EP4412636A2 - Novel interferon variants and bifunctional fusion molecules thereof - Google Patents
Novel interferon variants and bifunctional fusion molecules thereofInfo
- Publication number
- EP4412636A2 EP4412636A2 EP22859187.1A EP22859187A EP4412636A2 EP 4412636 A2 EP4412636 A2 EP 4412636A2 EP 22859187 A EP22859187 A EP 22859187A EP 4412636 A2 EP4412636 A2 EP 4412636A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- seq
- ifn
- amino acid
- acid sequence
- cancer
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/555—Interferons [IFN]
- C07K14/56—IFN-alpha
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
Definitions
- Interferons are soluble proteins produced naturally by cells in response to viruses. Interferons include type 1 interferons (e.g., interferon-alpha (IFN-a) and interferon-beta (IFN-P)) and type 2 interferons (e.g., interferon-gamma (IFN-y)).
- type 1 interferons e.g., interferon-alpha (IFN-a) and interferon-beta (IFN-P)
- type 2 interferons e.g., interferon-gamma (IFN-y)
- IFN-a Although first described for their ability to inhibit viral replication, IFN-a’s have multiple properties exhibiting anti-proliferative effects, induction of apoptosis (Rodriguez-Villanueva J and TJ McDonnell, Int J Cancer, 61 :1 10, 1995) and induction of the tumor suppressor gene, P53, in tumor cells (Takaoka A et aL, Nature, 424:516, 2003).
- IFN-oc were the first recombinant proteins used for the treatment of various cancers and IFN-a has been approved by the FDA for the treatment of several cancers including melanoma, renal cell carcinoma, B cell lymphoma, multiple myeloma, chronic myelogenous leukemia (CML) and hairy cell leukemia.
- IFN-a, pegylated IFN-a, and consensus IFN (interferon alfacon-1 ) are also approved by the FDA for the treatment of chronic infection with hepatitis C (HCV) and/or hepatitis B (HBV) virus.
- IFN-aR a shared receptor
- IFN-aR1 and IFN-aR2 Type I interferon
- Type I interferon (IFN) signaling drives pathology in a number of autoimmune diseases, in particular in systemic lupus erythematosus (SLE), and can be tracked via type I IFN-inducible transcripts present in whole blood-said transcripts provide a type I IFN gene signature.
- SLE systemic lupus erythematosus
- Yao et al. (Hum Genomics Proteomics 2009, pii: 374312) describe the identification of an IFNa/p 21 -gene signature and its use as a biomarker of type I IFN-related diseases or disorders.
- IFN-a A "direct" effect of IFN-a on the tumor cells is mediated by the IFN-a binding directly to the type I IFN receptor on those cells and stimulating apoptosis, terminal differentiation or reduced proliferation.
- type I interferon receptor is also present on most non-cancerous and non-virally infected cells. Systemic activation of this receptor on such cells by IFN-a causes the expression of numerous pro-inflammatory cytokines and chemokines, leading to toxicity.
- Cancer immunotherapy is the name given to cancer treatments that use the immune system to attack cancers and is rapidly evolving from therapies that globally and non- specif ically simulate the immune system to more targeted activation of individual components of the immune system, resulting in increased efficacy and decreased toxicity.
- therapies that inhibit the interaction between Programmed Death Ligand 1 (PD-L1), present on the surface of tumor or antigen-presenting cells, and Programmed Death 1 (PD-1 ), present on the surface of activated lymphocytes.
- P-L1 Programmed Death Ligand 1
- PD-1 Programmed Death 1
- PD-1 is a member of the CD28 family of receptors, which also includes CD28, CTLA-4, ICOS, and BTLA.
- PD-1 down-regulates T-cell activation that would typically occur with recognition, by the T cell regulators, of tumor antigens expressed in the context of the MHC on tumor cells.
- the PD-L1/PD-1 pathways can protect tumors from cytotoxic T cells, ultimately inhibiting the antitumor immune response by deactivating cytotoxic T cells in the tumor microenvironment and preventing priming and activation of new T cells in the lymph nodes and subsequent recruitment to the tumor (Chen and Irving, Clin Cancer Res., 18:6580-6587, 2012).
- PD-1 expression has been found on tumor infiltrating T cells and PD-L1 expression has been found on tumor cells and myeloid cells within the tumor in many murine and human cancers, including human lung, ovarian and colon carcinoma and various myelomas, and anti- PD-1 and anti-PD-L1 antibodies developed by, e.g., Bristol-Myers Squibb (nivolumab), Merck (pembrolizumab), Regeneron (cemiplimab), Roche (atezolizumab), AstraZeneca ( durvalumab) have been approved by the FDA to treat various cancer indications.
- Bristol-Myers Squibb nivolumab
- Merck pembrolizumab
- Regeneron cemiplimab
- Roche atezolizumab
- AstraZeneca durvalumab
- the PD-1/PD-L1 immune checkpoint is also involved in chronic viral infections, including hepatitis B virus (HBV) and hepatitis C virus (HCV).
- HBV hepatitis B virus
- HCV hepatitis C virus
- the chronic inflammation in the liver due to viral infection results in the expression of PD-L1 on hepatocytes, which supports the persistence of infection due to down-regulation of the anti-viral immune response via negative signaling through PD-1 expressed by immune cells.
- PD-1 and PD-L1 blocking antibodies are being tested in the clinic for chronic HBV and HCV infection and have shown promising activity. The proposed mechanism of action for these antibodies is restoring the anti-viral activity of dysfunctional immune cells at the site of infection.
- the present invention relates to bifunctional fusion molecules comprising a mutated polypeptide ligand (e.g., mutated IFN-a) having reduced biological activity attached to a disease tissue targeting biologic or a tumor associated antigen (TAA)-targeting biologic (e.g., anti-PD-L1 antibody), wherein the targeting biologic or TAA-targeting biologic directs the mutated ligands to cells that express on their surfaces the antigens to which said targeting biologic binds, as well as receptors for said ligands.
- TAA tumor associated antigen
- the mutated polypeptide ligands have reduced biological activity
- the resultant fusion molecule have reduced off-target activity and off-target toxicity.
- the targeting of the mutated ligand by the targeting biologic restores the activity of the mutated ligand, with the degree of activity restoration apparently correlated with the level of targeting biologic on the cells.
- the fusion molecules of the present invention advance the state of art by providing bifunctional fusion molecules having a greater concentration therapeutic window than those previously described.
- the present invention relates to the production of mutated variants of consensus IFN-a (con-IFN-a). These variants have amino acid substitutions which reduce their affinity for the IFN-aR1 and IFN-aR2 receptor complex (IFN-aR) and reduced or abolished ability to activate IFN-aR expressing cells but retain the ability to bind IFN-aR and the ability to bind and activate the IFN-aR receptor complex.
- con-IFN-a consensus IFN-a
- the mutant con-IFN-a has a biological activity selected from less than 70% of the biological activity of the wild-type con-IFN-a; less than 60% of the biological activity of the wild-type con-IFN-a; less than 50% of the biological activity of the wild-type con-IFN-a; less than 40% of the biological activity of the wild-type con-IFN-a; less than 30% of the biological activity of the wild-type con-IFN-a; less than 20% of the biological activity of the wild-type con-IFN-a; or less than 10% of the biological activity of the wild-type of which it is deduced (i.e., the wild-type con-IFN-a of which the coding sequence has been mutated to obtain the mutant IFN).
- the present invention relates to the use of these mutated con- IFN-a variants to construct bifunctional fusion molecules comprising a mutated con-IFN-a variant attached to a disease tissue targeting moiety or a tumor associated antigen (TAA)- targeting moiety, wherein the targeting moiety directs the mutated con-IFN-a variant to cells that express on their surfaces the antigens to which said targeting moiety binds, as well as receptors for said ligands.
- the targeting moiety is targeting to a marker expressed on an IFN receptor-expressing cell.
- the targeting moiety is directed to a tissue-specific marker.
- the tissue is a cancer tissue.
- the bifunctional fusion molecules comprise a targeting moiety in the form of an antibody, a bispecific antibody, a heterodimeric antibody, an antibody fragment, a diabody, a protein or a peptide binding to a molecule enriched in the cancer tissue, such as a tumor associated antigen antibody (TAA Ab).
- TAA Ab tumor associated antigen antibody
- the present invention relates to the use of these mutated con- IFN-a variants to construct bifunctional fusion molecules comprising a mutated con-IFN-a variant attached to a disease tissue targeting moiety or a tumor associated antigen (TAA)- targeting moiety, wherein the targeting moiety directs the mutated con-IFN-a variant to cells that express on their surfaces the antigens to which said targeting moiety binds, as well as receptors for said ligands.
- the targeting moiety is targeting to a marker expressed on an IFN receptor-expressing cell.
- the targeting moiety is directed to a virally infected tissue-specific marker.
- the tissue is a hepatitis virus infected liver.
- the bifunctional fusion molecules comprise a targeting moiety in the form of an antibody, a bispecific antibody, a heterodimeric antibody, an antibody fragment, a diabody, a protein or a peptide binding to a molecule enriched in the virus infected liver tissue.
- the fusion molecule comprises a type 1 interferon molecule.
- the fusion molecule comprises an interferon-alpha (IFN-oc) molecule.
- the fusion molecule comprises an interferon-beta (IFN-0) molecule.
- the fusion molecule comprises a consensus interferon-alpha (con-IFN-oc) molecule.
- the fusion molecule comprises a type 1 interferon mutant molecule.
- the fusion molecule comprises a con-IFN- a molecule having the amino acid sequence of SEQ ID NO: 1 .
- the fusion molecule comprises a con-IFN-a mutant molecule having the amino acid sequence of SEQ ID NO: 2. In various embodiments, the fusion molecule comprises a con-IFN-a mutant molecule having the amino acid sequence of SEQ ID NO: 3. In various embodiments, the fusion molecule comprises a con-IFN-a mutant molecule having the amino acid sequence of SEQ ID NO: 4. In various embodiments, the fusion molecule comprises a con-IFN-a mutant molecule having the amino acid sequence of SEQ ID NO: 5. In various embodiments, the fusion molecule comprises a human IFN-a2b molecule having the amino acid sequence of SEQ ID NO: 6.
- the fusion molecule comprises a human IFN-a2b mutant molecule having the amino acid sequence of SEQ ID NO: 7. In various embodiments, the fusion molecule comprises a human IFN-a5 molecule having the amino acid sequence of SEQ ID NO: 8. In various embodiments, the fusion molecule comprises a human IFN-a5 mutant molecule having the amino acid sequence of SEQ ID NO: 9. In various embodiments, the fusion molecule comprises a human IFN-a5 mutant molecule having the amino acid sequence of SEQ ID NO: 10. In various embodiments, the fusion molecule comprises a human IFN-a6 molecule having the amino acid sequence of SEQ ID NO: 11 .
- the fusion molecule comprises a human IFN-a6 mutant molecule having the amino acid sequence of SEQ ID NO: 12. In various embodiments, the fusion molecule comprises a human IFN-a6 mutant molecule having the amino acid sequence of SEQ ID NO: 13. In various embodiments, the fusion molecule comprises a human IFN-a6 mutant molecule having the amino acid sequence of SEQ ID NO: 14.
- the fusion molecule comprises an TAA Ab selected from the group consisting of a fully human antibody, a humanized antibody, a chimeric antibody, a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a bispecific antibody, a heterodimeric antibody, an antigen-binding antibody fragment, a Fab, a Fab', a Fab 2 , a Fab' 2 , a IgG, a IgM, a IgA, a IgE, a scFv, a dsFv, a dAb, a nanobody, a unibody, and an diabody.
- TAA Ab selected from the group consisting of a fully human antibody, a humanized antibody, a chimeric antibody, a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a bispecific antibody, a heterodimeric antibody, an antigen-binding antibody fragment, a
- the antibody is a chimeric antibody. In various embodiments, the antibody is a humanized monoclonal antibody. In various embodiments, the antibody is a fully human monoclonal antibody. In various embodiments, the TAA Ab is a human anti-PD-L1 Ab. In various embodiments, the TAA Ab is a human anti-PD-1 Ab. In various embodiments, the TAA Ab is an anti-PD-L1 having the light chain sequence set forth in SEQ ID NO: 15 and the heavy chain sequence set forth in SEQ ID NO: 16. In various embodiments, the TAA Ab is an anti-PD- L1 having the light chain sequence set forth in SEQ ID NO: 15 and the heavy chain sequence set forth in SEQ ID NO: 17. In various embodiments, the TAA Ab is an anti-PD-L1 heterodimer having the light chain sequence set forth in SEQ ID NO: 15 and the heavy chain sequences set forth in SEQ ID NO: 18 and 19.
- the fusion molecule is a recombinantly expressed fusion molecule.
- the fusion molecules comprise an interferon molecule that is directly attached to the targeting moiety.
- the fusion molecules comprise an IFN molecule that is attached to the targeting moiety via a peptide linker.
- the linker may be an artificial sequence of between 5, 10, 15, 20, 30, 40 or more amino acids that are relatively free of secondary structure.
- the linker is a rigid linker peptide of between 10, 15, 20, 30, 40 or more amino acids that display a-helical conformation and may act as rigid spacers between protein domains.
- the peptide linker is a G/S rich linker.
- the peptide linker is an alphahelical linker. In various embodiments, the peptide linker is a glycine linker. In various embodiments, the peptide linker has the sequence set forth in SEQ ID NO: 20. In various embodiments, the peptide linker has the sequence set forth in SEQ ID NO: 21 . In various embodiments, the peptide linker has the sequence set forth in SEQ ID NO: 22. In various embodiments, the peptide linker has the sequence set forth in SEQ ID NO: 23.
- the fusion molecule is an anti-PD-L1 Ab-IFN-a2b fusion molecule (“FP-01”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a IFN-a2b molecule having the amino acid sequence of SEQ ID NO: 6 directly fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 16.
- FP-01 anti-PD-L1 Ab-IFN-a2b fusion molecule
- the fusion molecule is an anti-PD-L1 Ab-IFN-a2b (R149A) fusion molecule (“FP-02”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a IFN-a2b (R149A) molecule having the amino acid sequence of SEQ ID NO: 7 directly fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 16.
- R149A Ab-IFN-a2b
- the fusion molecule is an anti-PD-L1 Ab-IFN- ⁇ 5 fusion molecule (“FP-03”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a IFN-a5 molecule having the amino acid sequence of SEQ ID NO: 8 directly fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 16.
- FP-03 anti-PD-L1 Ab-IFN- ⁇ 5 fusion molecule
- the fusion molecule is an anti-PD-L1 Ab-IFN-a5 (R150A) fusion molecule (“FP-04”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a IFN-a5 (R150A) molecule having the amino acid sequence of SEQ ID NO: 9 directly fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 16.
- the fusion molecule is an anti- PD-L1 Ab-IFN-a5 (A146D) fusion molecule (“FP-05”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a IFN-a5 (A146D) molecule having the amino acid sequence of SEQ ID NO: 10 directly fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 16.
- the fusion molecule is an anti-PD-L1 Ab-con-IFN-a fusion molecule (“FP-06”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a con-IFN-a molecule having the amino acid sequence of SEQ ID NO: 1 directly fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 16.
- FP-06 Ab-con-IFN-a fusion molecule
- the fusion molecule is an anti-PD-L1 Ab-con-IFN-a (R150A) fusion molecule (“FP-07”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a con-IFN-a (R150A) molecule having the amino acid sequence of SEQ ID NO: 2 directly fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 16.
- R150A Ab-con-IFN-a
- the fusion molecule is an anti-PD-L1 Ab-con-IFN-a (A146D) fusion molecule (“FP-08”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a con-IFN-a (A146D) molecule having the amino acid sequence of SEQ ID NO: 3 directly fused to the C- terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 16.
- A146D Ab-con-IFN-a
- the fusion molecule is an anti-PD-L1 Ab-con-IFN-a (A146K) fusion molecule (“FP-09”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a con-IFN-a (A146K) molecule having the amino acid sequence of SEQ ID NO: 4 directly fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 16.
- A146K Ab-con-IFN-a
- the fusion molecule is an anti-PD-L1 Ab-IFN-a6 fusion molecule (“FP-10”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a IFN-a6 molecule having the amino acid sequence of SEQ ID NO: 11 directly fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 16.
- FP-10 anti-PD-L1 Ab-IFN-a6 fusion molecule
- the fusion molecule is an anti-PD-L1 Ab-IFN-a6 (R150A) fusion molecule (“FP-11”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a IFN-a6 (R150A) molecule having the amino acid sequence of SEQ ID NO: 12 directly fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 16.
- R150A Ab-IFN-a6
- the fusion molecule is an anti-PD-L1 Ab-IFN- ⁇ 6 (A146D) fusion molecule (“FP-12”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a IFN-a6 (A146D) molecule having the amino acid sequence of SEQ ID NO: 13 directly fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 16.
- A146D Ab-IFN- ⁇ 6
- the fusion molecule is an anti- PD-L1 Ab-IFN-a6 (A146K) fusion molecule (“FP-13”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a IFN-a6 (A146K) molecule having the amino acid sequence of SEQ ID NO: 14 directly fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 16.
- A146K Ab-IFN-a6
- the fusion molecule is an anti-PD-L1 Ab-con-IFN-a fusion molecule (“FP-14”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a con-IFN-a molecule having the amino acid sequence of SEQ ID NO: 2 fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 17 with a peptide linker having the sequence set forth in SEQ ID NO: 22.
- FP-14 Ab-con-IFN-a fusion molecule
- the fusion molecule is an anti-PD-L1 Ab-con-IFN-a fusion molecule (“FP-15”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a con-IFN-a molecule having the amino acid sequence of SEQ ID NO: 2 fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 17 with a peptide linker having the sequence set forth in SEQ ID NO: 23.
- FP-15 Ab-con-IFN-a fusion molecule
- the fusion molecule is an anti-PD-L1 Ab-con-IFN-a fusion molecule (“FP-16”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a con-IFN-a molecule having the amino acid sequence of SEQ ID NO: 3 fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 17 with a peptide linker having the sequence set forth in SEQ ID NO: 22.
- FP-16 Ab-con-IFN-a fusion molecule
- the fusion molecule is an anti- PD-L1 Ab-con-IFN-a fusion molecule (“FP-17”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a con-IFN-a molecule having the amino acid sequence of SEQ ID NO: 3 fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 17 with a peptide linker having the sequence set forth in SEQ ID NO: 23.
- FP-17 Ab-con-IFN-a fusion molecule
- the fusion molecule is an anti-PD-L1 Ab-con-IFN-a fusion molecule (“FP-18”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a con-IFN-a molecule having the amino acid sequence of SEQ ID NO: 5 fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 17 with a peptide linker having the sequence set forth in SEQ ID NO: 22.
- FP-18 Ab-con-IFN-a fusion molecule
- the fusion molecule is an anti-PD-L1 Ab-con-IFN-a fusion molecule (“FP-19”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a con-IFN-a molecule having the amino acid sequence of SEQ ID NO: 2 fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 19 with a peptide linker having the sequence set forth in SEQ ID NO: 22 and a second heavy chain having the amino acid sequence set forth in SEQ ID NO: 18 forming a heterodimeric antibody molecule.
- FP-19 Ab-PD-L1 Ab-con-IFN-a fusion molecule
- the fusion molecule is an anti-PD-L1 Ab-con-IFN-a fusion molecule (“FP-20”) comprising a light chain having the amino acid sequence set forth in SEQ ID NO: 15, and a con- IFN-a molecule having the amino acid sequence of SEQ ID NO: 5 fused to the C-terminus of a heavy chain having the amino acid sequence set forth in SEQ ID NO: 19 with a peptide linker having the sequence set forth in SEQ ID NO: 22 and a second heavy chain having the amino acid sequence set forth in SEQ ID NO: 18 forming a heterodimeric antibody molecule.
- FP-20 Ab-PD-L1 Ab-con-IFN-a fusion molecule
- the present invention provides a pharmaceutical composition which comprises a bifunctional fusion molecule of the present invention as an active ingredient, in a pharmaceutically acceptable excipient or carrier.
- the pharmaceutical composition is formulated for administration via a route selected from the group consisting of subcutaneous injection, intraperitoneal injection, intramuscular injection, intrasternal injection, intravenous injection, intraarterial injection, intrathecal injection, intraventricular injection, intraurethral injection, intracranial injection, intrasynovial injection or via infusions.
- the present disclosure relates to the identification and use of biomarkers for the detection and/or monitoring of a subject suffering from a type I interferon- mediated disease or disorder.
- the disease or disorder is selected from the group consisting of: cancer, infectious diseases, immune disorders, inflammatory diseases or conditions, and autoimmune diseases.
- the present disclosure provides a method for treating cancer or cancer metastasis in a subject, comprising administering a therapeutically effective amount of the pharmaceutical compositions of the invention to a subject in need thereof.
- the subject is a human subject.
- the present disclosure provides a method for treating cancer or cancer metastasis in a subject, comprising administering a therapeutically effective amount of the pharmaceutical compositions of the invention in combination with a second therapy selected from the group consisting of: cytotoxic chemotherapy, immunotherapy, small molecule kinase inhibitor targeted therapy, surgery, radiation therapy, and stem cell transplantation.
- a second therapy selected from the group consisting of: cytotoxic chemotherapy, immunotherapy, small molecule kinase inhibitor targeted therapy, surgery, radiation therapy, and stem cell transplantation.
- the combination therapy may comprise administering to the subject a therapeutically effective amount of immunotherapy, including, but are not limited to, treatment using depleting antibodies to specific tumor antigens; treatment using antibody-drug conjugates; treatment using agonistic, antagonistic, or blocking antibodies to co-stimulatory or co-inhibitory molecules (immune checkpoints) such as CTLA-4, PD-1 , PD-L1 , OX-40, CD137, GITR, LAG3, TIM-3, CD40, CD47, SIRPa, ICOS, Siglec 8, Siglec 9, Siglec 15, TIGIT and VISTA; treatment using bispecific T cell engaging antibodies (BiTE®) such as blinatumomab: treatment involving administration of biological response modifiers such as TNF family, IL-1 , IL-4, IL-7, IL-12, IL-15, IL-17, IL-21 , IL-22, GM-CSF, IFN-a, IFN-p and IFN-y; treatment using bispecific T cell
- the cancer is selected from the group consisting of: B cell lymphoma; a lung cancer (small cell lung cancer and non-small cell lung cancer); a bronchus cancer; a colorectal cancer; a prostate cancer; a breast cancer; a pancreas cancer; a stomach cancer; an ovarian cancer; a urinary bladder cancer; a brain or central nervous system cancer; a peripheral nervous system cancer; an esophageal cancer; a cervical cancer; a melanoma; a uterine or endometrial cancer; a cancer of the oral cavity or pharynx; a liver cancer; a kidney cancer; a biliary tract cancer; a small bowel or appendix cancer; a salivary gland cancer; a thyroid gland cancer; a adrenal gland cancer; an osteosarcoma; a chondrosarcoma;
- the individual previously responded to treatment with an anti-cancer therapy, but, upon cessation of therapy, suffered relapse (hereinafter “a recurrent cancer”).
- a recurrent cancer the individual has a resistant or refractory cancer.
- the present disclosure provides a method for treating an infectious disease in a subject, comprising administering a therapeutically effective amount of the pharmaceutical compositions of the invention to a subject in need thereof.
- the subject is a human subject.
- the present disclosure provides a method for treating HBV infection in a subject, comprising administering a therapeutically effective amount of the pharmaceutical compositions of the invention to a subject in need thereof.
- the subject is a human subject.
- the present disclosure provides a method for treating HBV infection in a subject, comprising administering a therapeutically effective amount of the pharmaceutical compositions of the invention in combination with a second therapy selected from the group consisting of: treatment using nucleo(t)side analogs such as Tenofovir disoproxil fumarate (TDF), Tenofovir alafenamide (TAF), Lamivudine, Adefovir dipivoxil, Entecavir (ETV), Telbivudine, AGX-1009, emtricitabine, clevudine, ritonavir, dipivoxil, lobucavir, famvir, FTC, N- Acetyl-Cysteine (NAC), PC1323, theradigm-HBV, thymosin-alpha, and ganciclovir, besifovir (ANA-380/LB-80380), and tenofovir-exaliades (TLX/CMX157); treatment
- TDF Tenofo
- the present disclosure provides a method for treating HCV infection in a subject, comprising administering a therapeutically effective amount of the pharmaceutical compositions of the invention to a subject in need thereof.
- the subject is a human subject.
- the present disclosure provides a method for treating HCV infection in a subject, comprising administering a therapeutically effective amount of the pharmaceutical compositions of the invention in combination with a second therapy selected from the group consisting of protease inhibitors, polymerase inhibitors, direct-acting antivirals, ribavirin and pegylated interferon.
- a second therapy selected from the group consisting of protease inhibitors, polymerase inhibitors, direct-acting antivirals, ribavirin and pegylated interferon.
- the second therapy is selected from the group consisting of: Mavyet (glecaprevir/pibrentasvir), Epclusa (sofosbuvir/velpatasvir), Vosevi (sofosbuvir/velpatasvir/voxilapresvir), Harvoni (ledipasvir/sofosbuvir), Sovaldi (sofosbuvir), and Zepatier (elbasvir/grazoprevir).
- the present disclosure provides polynucleotides that encode the fusion molecules of the present disclosure; vectors comprising polynucleotides encoding fusion molecules of the disclosure; optionally, operably-linked to control sequences recognized by a host cell transformed with the vector; host cells comprising vectors comprising polynucleotides encoding fusion molecules of the disclosure; a process for producing a fusion molecule of the disclosure comprising culturing host cells comprising vectors comprising polynucleotides encoding fusion molecules of the disclosure such that the polynucleotide is expressed; and, optionally, recovering the fusion molecule from the host cell culture medium.
- FIG.1 is a set of diagrams showing the molecular structure of the antibody-IFN fusion proteins tested in these studies.
- A. comprises an antibody directly fused to an IFN molecule at the C-terminus of the antibody heavy chain.
- B. comprises an antibody fused to an IFN molecule at the C-terminus of the antibody heavy chain with a peptide linker.
- C. comprises a heterodimeric antibody using knob-into-hole and engineered disulfide bond technology where only one heavy chain is fused to an IFN molecule at the C-terminus with a peptide linker.
- FIG. 2 is a line graph depicting the results of a cell growth inhibition assay.
- the cell growth inhibition was measured using CellTiter 96 AQueous Non-Radioactive Cell Proliferation Assay (Promega).
- FIG. 3 is a line graph depicting the results of an MHC-1 expression assay.
- OVCAR-3 cells were incubated for 2 days in growth medium (cell control) or growth medium with the addition of samples (REMD290, IFN-oc2b or fusion proteins).
- MHC-I expression was determined by FACS with PE anti-human HLA-A,B,C antibody (sample MFI) or without antibody (background MFI).
- FIG. 4 is a line graph depicting the results of an PD-L1 expression assay.
- OVCAR-3 cells were incubated for 2 days in growth medium (cell control) or growth medium with addition of samples (REMD290, IFN-oc2b or fusion proteins).
- PD-L1 expression was determined by FACS with REMD290 (sample MFI) or without antibody (background MFI), and then by FITC goat anti-human IgG secondary antibody.
- polypeptide polypeptide
- peptide polypeptide
- protein protein
- peptides polypeptides
- proteins are chains of amino acids whose alpha carbons are linked through peptide bonds.
- the terminal amino acid at one end of the chain (amino terminal) therefore has a free amino group, while the terminal amino acid at the other end of the chain (carboxy terminal) has a free carboxyl group.
- amino terminus refers to the free oc-amino group on an amino acid at the amino terminal of a peptide or to the oc-amino group (imino group when participating in a peptide bond) of an amino acid at any other location within the peptide.
- carboxy terminus refers to the free carboxyl group on the carboxy terminus of a peptide or the carboxyl group of an amino acid at any other location within the peptide.
- Peptides also include essentially any polyamino acid including, but not limited to, peptide mimetics such as amino acids joined by an ether as opposed to an amide bond.
- Polypeptides of the disclosure include polypeptides that have been modified in any way and for any reason, for example, to: (1 ) reduce susceptibility to proteolysis, (2) reduce susceptibility to oxidation, (3) alter binding affinity for forming protein complexes, (4) alter binding affinities, and (5) confer or modify other physicochemical or functional properties.
- amino acid substitution refers to the replacement in a polypeptide of one amino acid at a particular position in a parent polypeptide sequence with a different amino acid.
- Amino acid substitutions can be generated using genetic or chemical methods well known in the art. For example, single or multiple amino acid substitutions (e.g., conservative amino acid substitutions) may be made in the naturally occurring sequence (e.g., in the portion of the polypeptide outside the domain(s) forming intermolecular contacts).
- a “conservative amino acid substitution” refers to the substitution in a polypeptide of an amino acid with a functionally similar amino acid. The following six groups each contain amino acids that are conservative substitutions for one another:
- a “non-conservative amino acid substitution” refers to the substitution of a member of one of these classes for a member from another class.
- the hydropathic index of amino acids may be considered. Each amino acid has been assigned a hydropathic index on the basis of its hydrophobicity and charge characteristics.
- hydrophilicity values have been assigned to these amino acid residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0.+-.1); glutamate (+3.0.+-.1); serine (+0.3); asparagine (+0.2); glutamine (+0.2); glycine (0); threonine (-0.4); proline (-0.5.+-.1); alanine (-0.5); histidine (-0.5); cysteine (-1 .0); methionine (-1 .3); valine (-1 .5); leucine (-1 .8); isoleucine (-1 .8); tyrosine (-2.3); phenylalanine (-2.5) and tryptophan (-3.4).
- the substitution of amino acids whose hydrophilicity values are within +2 is included, in various embodiments, those that are within +1 are included, and in various embodiments, those within +0.5 are included.
- a skilled artisan will be able to determine suitable variants of polypeptides as set forth herein using well-known techniques.
- one skilled in the art may identify suitable areas of the molecule that may be changed without destroying activity by targeting regions not believed to be important for activity.
- the skilled artisan can identify residues and portions of the molecules that are conserved among similar polypeptides.
- even areas that may be important for biological activity or for structure may be subject to conservative amino acid substitutions without destroying the biological activity or without adversely affecting the polypeptide structure.
- One skilled in the art can also analyze the three-dimensional structure and amino acid sequence in relation to that structure in similar polypeptides. In view of such information, one skilled in the art may predict the alignment of amino acid residues of a polypeptide with respect to its three-dimensional structure. In various embodiments, one skilled in the art may choose to not make radical changes to amino acid residues predicted to be on the surface of the polypeptide, since such residues may be involved in important interactions with other molecules. Moreover, one skilled in the art may generate test variants containing a single amino acid substitution at each desired amino acid residue. The variants can then be screened using activity assays known to those skilled in the art. Such variants could be used to gather information about suitable variants.
- polypeptide fragment and “truncated polypeptide” as used herein refers to a polypeptide that has an amino-terminal and/or carboxy-terminal deletion as compared to a corresponding full-length protein.
- fragments can be, e.g., at least 5, at least 10, at least 25, at least 50, at least 100, at least 150, at least 200, at least 250, at least 300, at least 350, at least 400, at least 450, at least 500, at least 600, at least 700, at least 800, at least 900 or at least 1000 amino acids in length.
- fragments can also be, e.g., at most 1000, at most 900, at most 800, at most 700, at most 600, at most 500, at most 450, at most 400, at most 350, at most 300, at most 250, at most 200, at most 150, at most 100, at most 50, at most 25, at most 10, or at most 5 amino acids in length.
- a fragment can further comprise, at either or both of its ends, one or more additional amino acids, for example, a sequence of amino acids from a different naturally-occurring protein ⁇ e.g., an Fc or leucine zipper domain) or an artificial amino acid sequence e.g., an artificial linker sequence).
- polypeptide variant refers to a polypeptide that comprises an amino acid sequence wherein one or more amino acid residues are inserted into, deleted from and/or substituted into the amino acid sequence relative to another polypeptide sequence.
- the number of amino acid residues to be inserted, deleted, or substituted can be, e.g., at least 1 , at least 2, at least 3, at least 4, at least 5, at least 10, at least 25, at least 50, at least 75, at least 100, at least 125, at least 150, at least 175, at least 200, at least 225, at least 250, at least 275, at least 300, at least 350, at least 400, at least 450 or at least 500 amino acids in length.
- Hybrids of the present disclosure include fusion proteins.
- a single mutation will be identified by the particular amino acid substitution at a specific amino acid position within the sequence of a wild-type IFN.
- a mutation comprising a tyrosine substituted for the full-length wild-type histidine at amino acid 57 is identified as H57Y.
- a "derivative" of a polypeptide is a polypeptide that has been chemically modified, e.g., conjugation to another chemical moiety such as, for example, polyethylene glycol, albumin (e.g., human serum albumin), phosphorylation, and glycosylation.
- % sequence identity is used interchangeably herein with the term “% identity” and refers to the level of amino acid sequence identity between two or more peptide sequences or the level of nucleotide sequence identity between two or more nucleotide sequences, when aligned using a sequence alignment program. For example, as used herein, 80% identity means the same thing as 80% sequence identity determined by a defined algorithm and means that a given sequence is at least 80% identical to another length of another sequence.
- the % identity is selected from, e.g., at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% or more sequence identity to a given sequence. In various embodiments, the % identity is in the range of, e.g., about 60% to about 70%, about 70% to about 80%, about 80% to about 85%, about 85% to about 90%, about 90% to about 95%, or about 95% to about 99%.
- % sequence homology is used interchangeably herein with the term “% homology” and refers to the level of amino acid sequence homology between two or more peptide sequences or the level of nucleotide sequence homology between two or more nucleotide sequences, when aligned using a sequence alignment program.
- 80% homology means the same thing as 80% sequence homology determined by a defined algorithm, and accordingly a homologue of a given sequence has greater than 80% sequence homology over a length of the given sequence.
- the % homology is selected from, e.g., at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% or more sequence homology to a given sequence. In various embodiments, the % homology is in the range of, e.g., about 60% to about 70%, about 70% to about 80%, about 80% to about 85%, about 85% to about 90%, about 90% to about 95%, or about 95% to about 99%.
- BLAST programs e.g., BLASTN, BLASTX, and TBLASTX, BLASTP and TBLASTN
- Sequence searches are typically carried out using the BLASTP program when evaluating a given amino acid sequence relative to amino acid sequences in the GenBank Protein Sequences and other public databases.
- the BLASTX program is preferred for searching nucleic acid sequences that have been translated in all reading frames against amino acid sequences in the GenBank Protein Sequences and other public databases. Both BLASTP and BLASTX are run using default parameters of an open gap penalty of 11 .0, and an extended gap penalty of 1.0, and utilize the BLOSUM-62 matrix.
- the BLAST algorithm In addition to calculating percent sequence identity, the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat'L Acad. Sci. USA, 90:5873-5787, 1993).
- One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
- a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is, e.g., less than about 0.1 , less than about 0.01 , or less than about 0.001 .
- modification refers to any manipulation of the peptide backbone (e.g., amino acid sequence) or the post-translational modifications (e.g., glycosylation) of a polypeptide.
- therapeutic protein refers to proteins, polypeptides, antibodies, peptides or fragments or variants thereof, having one or more therapeutic and/or biological activities.
- Therapeutic proteins encompassed by the invention include but are not limited to, proteins, polypeptides, peptides, antibodies, and biologies (the terms peptides, proteins, and polypeptides are used interchangeably herein). It is specifically contemplated that the term “therapeutic protein” encompasses the fusion molecules of the present invention.
- fusion protein refers to a fusion polypeptide molecule comprising two or more genes that originally coded for separate proteins, wherein the components of the fusion protein are linked to each other by peptide-bonds, either directly or through peptide linkers.
- fused refers to components that are linked by peptide bonds, either directly or via one or more peptide linkers.
- Linker refers to a molecule that joins two other molecules, either covalently, or through ionic, van der Waals or hydrogen bonds, e.g., a nucleic acid molecule that hybridizes to one complementary sequence at the 5' end and to another complementary sequence at the 3' end, thus joining two non-complementary sequences.
- a “cleavable linker” refers to a linker that can be degraded or otherwise severed to separate the two components connected by the cleavable linker. Cleavable linkers are generally cleaved by enzymes, typically peptidases, proteases, nucleases, lipases, and the like.
- Cleavable linkers may also be cleaved by environmental cues, such as, for example, changes in temperature, pH, salt concentration, etc.
- peptide linker refers to a peptide comprising one or more amino acids, typically about 2-20 amino acids. Peptide linkers are known in the art or are described herein. Suitable, non-immunogenic linker peptides include, for example, (G 4 S) n , (SG 4 )n or G 4 (SG 4 )n peptide linkers, “n” is generally a number between 1 and 10, typically between 2 and 4.
- cancer refers to any uncontrolled growth of cells that may interfere with the normal functioning of the bodily organs and systems, and includes both primary and metastatic tumors.
- Primary tumors or cancers that migrate from their original location and seed vital organs can eventually lead to the death of the subject through the functional deterioration of the affected organs.
- a metastasis is a cancer cell or group of cancer cells, distinct from the primary tumor location, resulting from the dissemination of cancer cells from the primary tumor to other parts of the body. Metastases may eventually result in death of a subject.
- cancers can include benign and malignant cancers, polyps, hyperplasia, as well as dormant tumors or micrometastases.
- TAA tumor associated antigen
- TAA variant and TAA mutant as used herein refers to a TAA that comprises an amino acid sequence wherein one or more amino acid residues are inserted into, deleted from and/or substituted into the amino acid sequence relative to another TAA sequence.
- the number of amino acid residues to be inserted, deleted, or substituted can be, e.g., at least 1 , at least 2, at least 3, at least 4, at least 5, at least 10, at least 25, at least 50, at least 75, at least 100, at least 125, at least 150, at least 175, at least 200, at least 225, at least 250, at least 275, at least 300, at least 350, at least 400, at least 450 or at least 500 amino acids in length.
- tumor microenvironment refers to the cellular environment in which the tumor exists, including surrounding blood vessels, immune cells, fibroblasts, bone marrow-derived inflammatory cells, lymphocytes, signaling molecules and the extracellular matrix (ECM).
- Components in the tumor microenvironment can modulate the growth of tumor cells, e.g., their ability to progress and metastasize.
- the tumor microenvironment can also be influenced by the tumor releasing extracellular signals, promoting tumor angiogenesis and inducing peripheral immune tolerance.
- “Pharmaceutical composition” refers to a composition suitable for pharmaceutical use in an animal.
- a pharmaceutical composition comprises a pharmacologically effective amount of an active agent and a pharmaceutically acceptable carrier.
- “Pharmacologically effective amount” refers to that amount of an agent effective to produce the intended pharmacological result.
- “Pharmaceutically acceptable carrier” refers to any of the standard pharmaceutical carriers, vehicles, buffers, and excipients, such as a phosphate buffered saline solution, 5% aqueous solution of dextrose, and emulsions, such as an oil/water or water/oil emulsion, and various types of wetting agents and/or adjuvants. Suitable pharmaceutical carriers and formulations are described in Remington's Pharmaceutical Sciences, 21st Ed.
- a “pharmaceutically acceptable salt” is a salt that can be formulated into a compound for pharmaceutical use including, e.g., metal salts (sodium, potassium, magnesium, calcium, etc.) and salts of ammonia or organic amines.
- treatment refers to clinical intervention in an attempt to alter the natural course of a disease in the individual being treated and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
- references herein to "alleviate” a disease, disorder or condition means reducing the severity and/or occurrence frequency of the symptoms of the disease, disorder, or condition.
- references herein to “treatment” include references to curative, palliative and prophylactic treatment.
- an effective amount refers to an amount of a compound or composition sufficient to treat a specified disorder, condition or disease such as ameliorate, palliate, lessen, and/or delay one or more of its symptoms.
- an effective amount comprises an amount sufficient to: (i) reduce the number of cancer cells; (ii) reduce tumor size; (iii) inhibit, retard, slow to some extent and preferably stop cancer cell infiltration into peripheral organs; (iv) inhibit (i.e.
- tumor metastasis slow to some extent and preferably stop
- tumor metastasis inhibit tumor growth;
- An effective amount can be administered in one or more administrations.
- Adjuvant setting refers to a clinical setting in which an individual has had a history of a proliferative disease, particularly cancer, and generally (but not necessarily) been responsive to therapy, which includes, but is not limited to, surgery (such as surgical resection), radiotherapy, and chemotherapy. However, because of their history of the proliferative disease (such as cancer), these individuals are considered at risk of development of the disease.
- Treatment or administration in the "adjuvant setting” refers to a subsequent mode of treatment.
- the degree of risk i.e., when an individual in the adjuvant setting is considered as "high risk” or "low risk) depends upon several factors, most usually the extent of disease when first treated.
- administering refers to the actions taken by a medical professional (e.g., a physician), or a person controlling medical care of a patient, that control and/or permit the administration of the agent(s)/compound(s) at issue to the patient.
- Causing to be administered can involve diagnosis and/or determination of an appropriate therapeutic regimen, and/or prescribing particular agent(s)/compounds for a patient.
- Such prescribing can include, for example, drafting a prescription form, annotating a medical record, and the like. Where administration is described herein, "causing to be administered” is also contemplated.
- the terms "co-administration”, “co-administered” and “in combination with”, referring to the fusion molecules of the invention and one or more other therapeutic agents is intended to mean, and does refer to and include the following: simultaneous administration of such combination of fusion molecules of the invention and therapeutic agent(s) to an individual in need of treatment, when such components are formulated together into a single dosage form which releases said components at substantially the same time to said individual; substantially simultaneous administration of such combination of fusion molecules of the invention and therapeutic agent(s) to an individual in need of treatment, when such components are formulated apart from each other into separate dosage forms which are taken at substantially the same time by said individual, whereupon said components are released at substantially the same time to said individual; sequential administration of such combination of fusion molecules of the invention and therapeutic agent(s) to an individual in need of treatment, when such components are formulated apart from each other into separate dosage forms which are taken at consecutive times by said individual with a significant time interval between each administration, whereupon said components are released at substantially different times to
- patient may be used interchangeably and refer to a mammal, preferably a human or a non-human primate, but also domesticated mammals (e.g., canine or feline), laboratory mammals (e.g., mouse, rat, rabbit, hamster, guinea pig), and agricultural mammals (e.g., equine, bovine, porcine, ovine).
- domesticated mammals e.g., canine or feline
- laboratory mammals e.g., mouse, rat, rabbit, hamster, guinea pig
- agricultural mammals e.g., equine, bovine, porcine, ovine
- the patient can be a human (e.g., adult male, adult female, adolescent male, adolescent female, male child, female child) under the care of a physician or other health worker in a hospital, psychiatric care facility, as an outpatient, or other clinical context.
- the patient may be an immunocompromised patient or a patient with a weakened immune system including, but not limited to patients having primary immune deficiency, AIDS; cancer and transplant patients who are taking certain immunosuppressive drugs; and those with inherited diseases that affect the immune system (e.g., congenital agammaglobulinemia, congenital IgA deficiency).
- the patient has an immunogenic cancer, including, but not limited to bladder cancer, lung cancer, melanoma, and other cancers reported to have a high rate of mutations (Lawrence et aL, Nature, 499(7457): 214-218, 2013).
- an immunogenic cancer including, but not limited to bladder cancer, lung cancer, melanoma, and other cancers reported to have a high rate of mutations (Lawrence et aL, Nature, 499(7457): 214-218, 2013).
- immunotherapy refers to cancer treatments which include, but are not limited to, treatment using depleting antibodies to specific tumor antigens; treatment using antibody-drug conjugates; treatment using agonistic, antagonistic, or blocking antibodies to costimulatory or co-inhibitory molecules (immune checkpoints) such as CTLA-4, PD-1 , OX-40, CD137, GITR, LAG3, TIM-3, SIRP, CD40, CD47, Siglec 8, Siglec 9, Siglec 15, TIGIT and VISTA; treatment using bispecific T cell engaging antibodies (BiTE®) such as blinatumomab: treatment involving administration of biological response modifiers such as IL-2, IL-12, IL-15, IL- 21 , GM-CSF, IFN-a, IFN-p and IFN-y; treatment using therapeutic vaccines such as sipuleucel- T; treatment using Bacilli Calmette-Guerin (BCG); treatment using dendritic cell vaccines, or
- Resistant or refractory cancer refers to tumor cells or cancer that do not respond to previous anti-cancer therapy including, e.g., chemotherapy, surgery, radiation therapy, stem cell transplantation, and immunotherapy.
- Tumor cells can be resistant or refractory at the beginning of treatment, or they may become resistant or refractory during treatment.
- Refractory tumor cells include tumors that do not respond at the onset of treatment or respond initially for a short period but fail to respond to treatment.
- Refractory tumor cells also include tumors that respond to treatment with anticancer therapy but fail to respond to subsequent rounds of therapies.
- refractory tumor cells also encompass tumors that appear to be inhibited by treatment with anticancer therapy but recur up to five years, sometimes up to ten years or longer after treatment is discontinued.
- the anticancer therapy can employ chemotherapeutic agents alone, radiation alone, targeted therapy alone, immunotherapy alone, surgery alone, or combinations thereof.
- chemotherapeutic agents alone, radiation alone, targeted therapy alone, immunotherapy alone, surgery alone, or combinations thereof.
- the refractory tumor cells are interchangeable with resistant tumor.
- ELISA enzyme-linked immunosorbent assay
- SPR Surface Plasmon Resonance
- affinity refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g. an antibody) and its binding partner (e.g. an antigen).
- the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (KD), which is the ratio of dissociation and association rate constants (koff and kon, respectively).
- KD dissociation constant
- a particular method for measuring affinity is Surface Plasmon Resonance (SPR).
- reduced binding refers to a decrease in affinity for the respective interaction, as measured for example by SPR. Conversely, “increased binding” refers to an increase in binding affinity for the respective interaction.
- polymer as used herein generally includes, but is not limited to, homopolymers; copolymers, such as, for example, block, graft, random and alternating copolymers; and terpolymers; and blends and modifications thereof. Furthermore, unless otherwise specifically limited, the term “polymer” shall include all possible geometrical configurations of the material. These configurations include, but are not limited to isotactic, syndiotactic, and random symmetries. [072] "Polynucleotide” refers to a polymer composed of nucleotide units.
- Polynucleotides include naturally occurring nucleic acids, such as deoxyribonucleic acid (“DNA”) and ribonucleic acid (“RNA”) as well as nucleic acid analogs.
- Nucleic acid analogs include those which include non-naturally occurring bases, nucleotides that engage in linkages with other nucleotides other than the naturally occurring phosphodiester bond or which include bases attached through linkages other than phosphodiester bonds.
- nucleotide analogs include, for example and without limitation, phosphorothioates, phosphorodithioates, phosphorotriesters, phosphoramidates, boranophosphates, methylphosphonates, chiral-methyl phosphonates, 2-0- methyl ribonucleotides, peptide-nucleic acids (PNAs), and the like.
- PNAs peptide-nucleic acids
- Such polynucleotides can be synthesized, for example, using an automated DNA synthesizer.
- the term “nucleic acid” typically refers to large polynucleotides.
- oligonucleotide typically refers to short polynucleotides, generally no greater than about 50 nucleotides.
- nucleotide sequence is represented by a DNA sequence (i.e., A, T, G, C)
- this also includes an RNA sequence (i.e., A, U, G, C) in which "U" replaces "T.”
- the DNA strand having the same sequence as an mRNA is referred to as the "coding strand”; sequences on the DNA strand having the same sequence as an mRNA transcribed from that DNA and which are located 5' to the 5'-end of the RNA transcript are referred to as "upstream sequences"; sequences on the DNA strand having the same sequence as the RNA and which are 3' to the 3' end of the coding RNA transcript are referred to as "downstream sequences.”
- a "vector” is a polynucleotide that can be used to introduce another nucleic acid linked to it into a cell.
- a "plasmid” refers to a linear or circular double stranded DNA molecule into which additional nucleic acid segments can be ligated.
- a viral vector e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses
- certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors comprising a bacterial origin of replication and episomal mammalian vectors).
- vectors e.g., non-episomal mammalian vectors
- An "expression vector” is a type of vector that can direct the expression of a chosen polynucleotide.
- a "regulatory sequence” is a nucleic acid that affects the expression (e.g., the level, timing, or location of expression) of a nucleic acid to which it is operably linked.
- the regulatory sequence can, for example, exert its effects directly on the regulated nucleic acid, or through the action of one or more other molecules (e.g., polypeptides that bind to the regulatory sequence and/or the nucleic acid).
- Examples of regulatory sequences include promoters, enhancers and other expression control elements (e.g., polyadenylation signals).
- a nucleotide sequence is "operably linked" to a regulatory sequence if the regulatory sequence affects the expression (e.g., the level, timing, or location of expression) of the nucleotide sequence.
- a "host cell” is a cell that can be used to express a polynucleotide of the disclosure.
- a host cell can be a prokaryote, for example, E. coli, or it can be a eukaryote, for example, a single-celled eukaryote (e.g., a yeast or other fungus), a plant cell (e.g., a tobacco or tomato plant cell), an animal cell (e.g., a human cell, a monkey cell, a hamster cell, a rat cell, a mouse cell, or an insect cell) or a hybridoma.
- a prokaryote for example, E. coli
- a eukaryote for example, a single-celled eukaryote (e.g., a yeast or other fungus)
- a plant cell e.g., a tobacco or tomato plant cell
- an animal cell e.g.,
- a host cell is a cultured cell that can be transformed or transfected with a polypeptide-encoding nucleic acid, which can then be expressed in the host cell.
- the phrase "recombinant host cell” can be used to denote a host cell that has been transformed or transfected with a nucleic acid to be expressed.
- a host cell also can be a cell that comprises the nucleic acid but does not express it at a desired level unless a regulatory sequence is introduced into the host cell such that it becomes operably linked with the nucleic acid. It is understood that the term host cell refers not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to, e.g., mutation or environmental influence, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
- isolated molecule (where the molecule is, for example, a polypeptide or a polynucleotide) is a molecule that by virtue of its origin or source of derivation (1) is not associated with naturally associated components that accompany it in its native state, (2) is substantially free of other molecules from the same species (3) is expressed by a cell from a different species, or (4) does not occur in nature.
- a molecule that is chemically synthesized, or expressed in a cellular system different from the cell from which it naturally originates will be “isolated” from its naturally associated components.
- a molecule also may be rendered substantially free of naturally associated components by isolation, using purification techniques well known in the art.
- Molecule purity or homogeneity may be assayed by a number of means well known in the art.
- the purity of a polypeptide sample may be assayed using polyacrylamide gel electrophoresis and staining of the gel to visualize the polypeptide using techniques well known in the art.
- higher resolution may be provided by using HPLC or other means well known in the art for purification.
- a protein or polypeptide is "substantially pure,” “substantially homogeneous,” or “substantially purified” when at least about 60% to 75% of a sample exhibits a single species of polypeptide.
- the polypeptide or protein may be monomeric or multimeric.
- a substantially pure polypeptide or protein will typically comprise about 50%, 60%, 70%, 80% or 90% W/W of a protein sample, more usually about 95%, and preferably will be over 99% pure. Protein purity or homogeneity may be indicated by a number of means well known in the art, such as polyacrylamide gel electrophoresis of a protein sample, followed by visualizing a single polypeptide band upon staining the gel with a stain well known in the art. For certain purposes, higher resolution may be provided by using HPLC or other means well known in the art for purification.
- heterologous refers to a composition or state that is not native or naturally found, for example, that may be achieved by replacing an existing natural composition or state with one that is derived from another source.
- expression of a protein in an organism other than the organism in which that protein is naturally expressed constitutes a heterologous expression system and a heterologous protein.
- Interferons include type I interferons (e.g., IFN-a, IFN-P) as well as type II interferons (e.g., IFN-y).
- interferon refers to a full-length interferon or to an interferon fragment (truncated interferon) or to an interferon mutant (truncated interferon and interferon mutant collectively referred to herein as ‘modified interferon’), that substantially retains the biological activity of the full length wild-type interferon (e.g., retains at least 50%, for example at least about any of 60%, 70%, 80%, 90%, or more biological activity of the full length wild-type interferon), including any biosimilar, biogeneric, follow-on biologic, or follow-on protein version of an interferon taught in the art.
- the interferon can be from essentially any mammalian species.
- the interferon is from a species selected from the group consisting of human, equine, bovine, rodent, porcine, lagomorph, feline, canine, murine, caprine, ovine, a non-human primate, and the like.
- Various such interferons have been extensively described in the literature and are well known to one of ordinary skill in the art (see, e.g., Pestka, Immunological Reviews, 202(1 ):8-32, 2004).
- FDA-approved interferons include, e.g., ROFERONO-A (Roche), INTRON® A (Schering), AVONEX® (Biogen, Inc.), BETASERON® (Chiron Corporation) and REBIF® (EMD Serono and Pfizer).
- Consensus interferon (con-IFN-a) (also referred to as “IFN-alfacon-1”), a nonnatural recombinant interferon, is a second-generation cytokine that was engineered to contain the most frequently occurring amino acids among the non-allelic IFN-a subtypes in humans to form a consensus molecule (Blatt et al., J Interferon Cytokine Res., 16:489-99, 1996).
- Con-IFN- a shows a higher biological and antiviral capacity in vitro than the non-allelic IFN-a subtypes and the FDA-approved INFERGEN® (InterMune, Inc) has been used internationally to treat patients with chronic hepatitis C (HCV) infection.
- HCV chronic hepatitis C
- the TAA antibody-IFN fusion molecules comprise an interferon or a modified interferon that possesses, e.g., at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 100%, of the endogenous activity of the wild-type interferon having the same amino acid sequence but not attached to an antibody.
- the TAA antibody-IFN fusion molecules will comprise an interferon or a modified interferon that possesses, e.g., less than 10%, less than 20%, less than 30%, less than 40%, less than 50%, less than 55%, less than 60%, less than 65%, less than
- Interferon activity can be assessed, for example, using the various anti-viral and anti-proliferative assays described in art (see, e.g., U.S. Patent No. 8,563,692, U.S. Pat. Public. No. 20130230517, U.S. Pat. Public. No. 20110158905, PCT WO/2014/028502, and PCT WO/2013/059885) as well as the assays described in the Examples section below.
- the TAA antibody-IFN fusion molecules will show at least 10, at least 100, at least 1000, at least 10,000, or at least 100,000-fold selectivity toward cells that express the TAA to which the antibody binds over cells that do not express the TAA, when compared to interferon having the same amino acid sequence not attached to an antibody.
- Single point mutations contemplated for use herein include, but are not limited to, a series of mostly single point mutations in amino acid residues that are considered important to the binding affinity of IFN-oc to IFN-ocR1 based on published information on NMR structure with the assumption that a single point mutation may change the binding affinity but will not completely knock off the activity of con-IFN-oc, therefore still retaining the anti-proliferative properties albeit at much higher concentrations. This will potentially improve the therapeutic index of the fusion molecules comprising an antibody fused to the interferon-alpha mutants.
- a single mutation will be identified by the particular amino acid substitution at a specific amino acid position within the sequence of con-IFN-oc provided as SEQ ID NO: 1 .
- a mutation comprising an alanine substituted for the full-length wild-type arginine at amino acid 150 is identified as R150A.
- the TAA antibody-IFN fusion molecule comprises an interferon mutant comprising one or more amino acid substitutions, insertions, and/or deletions.
- Means of identifying such modified interferon molecules are routine to those of skill in the art.
- a library of truncated and/or mutated IFN- oc is produced and screened for IFN-oc activity. Methods of producing libraries of polypeptide variants are well known to those of skill in the art. The resultant library members can then be screened according to standard methods know to those of skill in the art.
- IFN-oc activity can be assayed by measuring antiviral activity against a particular test virus. Kits for assaying for IFN-oc activity are commercially available (see, e.g., ILITETM alphabeta kit by Neutekbio, Ireland).
- the interferon contains an amino acid sequence that shares an observed homology of, e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% with the wildtype con-IFN-oc sequence provided below as SEQ ID NO: 1 .
- the interferon has less than any of about 70%, 75%, 80%, 85%, 90%, or 95%, activity of con-IFN-oc provided below as SEQ ID NO: 1 :
- the interferon is a con-IFN-oc mutant molecule wherein the arginine at amino acid residue 150 of SEQ ID NO: 1 is replaced with an alanine (R150A).
- This con-IFN-oc mutant molecule is referred to hereinafter as “con-IFN-oc (R150A)”.
- the amino acid sequence of con-IFN-oc (R150A) is provided below as SEQ ID NO: 2:
- the interferon is a con-IFN-oc mutant molecule wherein the alanine at amino acid residue 146 of SEQ ID NO: 1 is replaced with an aspartic acid (A146D).
- This con-IFN-oc mutant molecule is referred to hereinafter as “con-IFN-oc (A146D)”.
- the amino acid sequence of con-IFN-oc (A146D) is provided below as SEQ ID NO: 3.
- the interferon is a con-IFN-oc mutant molecule wherein the alanine at amino acid residue 146 of SEQ ID NO: 1 is replaced with a lysine (A146K).
- This con-IFN-oc mutant molecule is referred to hereinafter as “con-IFN-oc (A146K)”.
- the amino acid sequence of con-IFN-oc (A146K) is provided below as SEQ ID NO: 4:
- the interferon is a con-IFN-oc mutant molecule wherein the alanine at amino acid residue 146 of SEQ ID NO: 1 is replaced with an aspartic acid (A146D) and the arginine at amino acid residue 150 of SEQ ID NO: 1 is replaced with an alanine (R150A) .
- This con-IFN-oc mutant molecule is referred to hereinafter as “con-IFN-oc (A146D and R150A)”.
- the amino acid sequence of con-IFN-oc (A146D and R150A) is provided below as SEQ ID NO: 5.
- the interferon contains an amino acid sequence that shares an observed homology of, e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% with the human IFN-oc2b sequence provided below as SEQ ID NO: 6 (hereinafter referred to as “IFN- oc2b”).
- the interferon has less than any of about 70%, 75%, 80%, 85%, 90%, or 95%, activity of IFN-oc2b provided below as SEQ ID NO: 6:
- the interferon is a IFN-oc2b mutant molecule wherein the arginine at amino acid residue 149 of SEQ ID NO: 6 is replaced with an alanine (R149A).
- This IFN-oc2b mutant molecule is referred to hereinafter as “IFN-oc2b (R149A)”.
- the amino acid sequence of IFN-oc2b (R149A) is provided below as SEQ ID NO: 7:
- the interferon contains an amino acid sequence that shares an observed homology of, e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% with the human IFN-oc5 sequence provided below as SEQ ID NO: 8 (hereinafter referred to as “IFN-oc5”).
- the interferon has less than any of about 70%, 75%, 80%, 85%, 90%, or 95%, activity of IFN-oc5 provided below as SEQ ID NO: 8:
- the interferon is a IFN-oc5 mutant molecule wherein the arginine at amino acid residue 150 of SEQ ID NO: 8 is replaced with an alanine (R150A).
- This IFN-oc5 mutant molecule is referred to hereinafter as “IFN-oc5 (R150A)”.
- the amino acid sequence of IFN-oc5 (R150A) is provided below as SEQ ID NO: 9.
- the interferon is a IFN-oc5 mutant molecule wherein the alanine at amino acid residue 146 of SEQ ID NO: 8 is replaced with an aspartic acid (A146D).
- This IFN-oc5 mutant molecule is referred to hereinafter as “IFN-oc5 (A146D)”.
- the amino acid sequence of IFN-oc5 (A146D) is provided below as SEQ ID NO: 10:
- the interferon contains an amino acid sequence that shares an observed homology of, e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% with the human IFN-oc6 sequence provided below as SEQ ID NO: 11 (hereinafter referred to as “IFN- oc6”).
- IFN- oc6 human IFN-oc6 sequence provided below as SEQ ID NO: 11
- the interferon has less than any of about 70%, 75%, 80%, 85%, 90%, or 95%, activity of IFN-oc6 provided below as SEQ ID NO: 11 : CDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQ
- the interferon is a IFN-oc6 mutant molecule wherein the arginine at amino acid residue 150 of SEQ ID NO: 11 is replaced with an alanine (R150A).
- This IFN-oc6 mutant molecule is referred to hereinafter as “IFN-oc6 (R150A)”.
- the amino acid sequence of IFN-oc6 (R150A) is provided below as SEQ ID NO: 12.
- the interferon is a IFN-oc6 mutant molecule wherein the alanine at amino acid residue 146 of SEQ ID NO: 11 is replaced with an aspartic acid (A146D).
- This IFN-oc6 mutant molecule is referred to hereinafter as “IFN-oc6 (A146D)”.
- the amino acid sequence of IFN-oc6 (A146D) is provided below as SEQ ID NO: 13:
- the interferon is a IFN-oc6 mutant molecule wherein the alanine at amino acid residue 146 of SEQ ID NO: 11 is replaced with a lysine (A146K).
- This IFN-oc6 mutant molecule is referred to hereinafter as “IFN-oc6 (A146K)”.
- the amino acid sequence of IFN-oc6 (A146K) is provided below as SEQ ID NO: 14:
- the interferon is an IFN-oc2b mutant molecule having the amino acid sequence set forth in SEQ ID NO: 6, and comprising one or more single point mutations selected from L15A, A19W, R22A, R23A, S25A, L26A, F27A, L30A, L30V, K31A, D32A, R33K, R33A, R33Q, H34A, D35E, Q40A, H57A, H57S, H57Y, E58A, E58N, E58S, Q61 A, Q61 S, D114R, L117A, R120A, R125A, R125E, K131A, E132A, K133A, K134A, R144A, R144D, R144E, R144G, R144H, R144I, R144K, R144L, R144N, R144Q, R144S, R144T, R144V, R144Y, A145D, A145E, A145G,
- the interferon is an con-IFN-oc mutant molecule having the amino acid sequence set forth in SEQ ID NO: 1 , and comprising one or more single point mutations selected from L15A, A19W, R22A, R23A, S25A, L26A, F27A, L30A, L30V, K31A, D32A, R33K, R33A, R33Q, H34A, D35E, Q40A, H58A, H58S, H58Y, E59A, E59N, E59S, Q62A, Q62S, D115R, L118A, R121A, R126A, R126E, K132A, E133A, K134A, K135A, R145A, R145D, R145E, R145G, R145H, R145I, R145K, R145L, R145N, R145Q, R145S, R145T, R145V, R145Y, A146D, A146E, A
- Additional interferon mutants contemplated for use include those described in, e.g., U.S. Pat. No. 9,61 1 ,322 (Wilson et aL), U.S. Pat. No. 8,258,263 (Morrison et al), U.S. Patent No. 9,492, 562 (Tavernier et aL), U.S. Pat. No. 10,259,854 (Grewal et al), each of which is hereby incorporated by reference in its entirety for the interferon mutants and sequences provided therein.
- the interferon contains an amino acid sequence that shares an observed homology of, e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% with the wildtype IFN-oc sequence selected from the group consisting of IFN-oc5 (NP 002160.1 ), IFN-oc6 (NP 066282.1 ), IFN-oc7 (NP_066401 .1 ), IFN-oc8 (NP_002161 .2), IFN-a10 (NP_002162.1 ), IFN- a16 (NP 002164.1 ), IFN-a17 (NP_067091 .1 ), IFN-a21 (NP_002166.2), and con-IFN-oc (DB00069).
- IFN-oc5 NP 002160.1
- IFN-oc6 NP 066282.1
- IFN-oc7
- the methods of the present invention utilize isolated non-occurring genetically engineered bifunctional fusion molecules comprising at least one interferon, or interferon mutant molecule attached to at least one targeting moieties having recognition domains which specifically bind to a target (e.g. antigen, receptor) of interest.
- a target e.g. antigen, receptor
- the target (e.g. antigen, receptor) of interest can be found on one or more immune cells, which can include, without limitation, T cells, cytotoxic T lymphocytes, T helper cells, natural killer (NK) cells, natural killer T (NKT) cells, anti-tumor macrophages (e.g.
- the recognition domains specifically bind to a target (e.g. antigen, receptor) of interest and effectively, directly or indirectly, recruit one of more immune cells.
- the target (e.g. antigen, receptor) of interest can be found on one or more tumor cells.
- the bifunctional fusion proteins comprise two or more targeting moieties.
- the bifunctional fusion proteins may directly or indirectly recruit an immune cell, e.g., in some embodiments, to a therapeutic site (e.g. a locus with one or more disease cell or cell to be modulated for a therapeutic effect).
- the present bifunctional fusion proteins may directly or indirectly recruit an immune cell, e.g. an immune cell that can kill and/or suppress a tumor cell, to a site of action (such as, by way of non-limiting example, the tumor microenvironment).
- an immune cell e.g. an immune cell that can kill and/or suppress a tumor cell
- a site of action such as, by way of non-limiting example, the tumor microenvironment.
- the present bifunctional fusion proteins are capable of, or find use in methods involving, shifting the balance of immune cells in favor of immune attack of a tumor.
- the present bifunctional fusion proteins can shift the ratio of immune cells at a site of clinical importance in favor of cells that can kill and/or suppress a tumor (e.g.
- T cells cytotoxic T lymphocytes, T helper cells, natural killer (NK) cells, natural killer T (NKT) cells, anti-tumor macrophages (e.g. M1 macrophages), B cells, dendritic cells, or subsets thereof) and in opposition to cells that protect tumors (e.g. myeloid-derived suppressor cells (MDSCs), regulatory T cells (Tregs); tumor associated neutrophils (TANs), M2 macrophages, tumor associated macrophages (TAMs), or subsets thereof).
- tumors e.g. myeloid-derived suppressor cells (MDSCs), regulatory T cells (Tregs); tumor associated neutrophils (TANs), M2 macrophages, tumor associated macrophages (TAMs), or subsets thereof.
- the present bifunctional fusion protein is capable of increasing a ratio of effector T cells to regulatory T cells.
- the TAA Ab- IFN fusion molecules used in the methods of the present invention may comprise an antibody, or antigen binding antibody fragment, specific to any of the tumor associated antigens described in the art, including any biosimilar, biogeneric, follow-on biologic, or follow-on protein version of any TAA described in the art.
- the TAA can be any peptide, polypeptide, protein, nucleic acid, lipid, carbohydrate, or small organic molecule, or any combination thereof, against which the skilled artisan wishes to induce an immune response.
- the TAA contemplated for use includes, but is not limited to those provided in Table 2. Each associated reference is incorporated herein by reference for the purpose of identifying the referenced tumor markers.
- MT-MMP's such as Sato and Seiki (1996) J Biochem (Tokyo), 1 19(2): 209-215 MMP2, MMP3, MMP7, MMP9
- Mucin such as MUC-1 , Lewis and Houghton (1995) Semin Cancer Biol., 6(6): 321 -327
- Thymosin p 15 Bao et al. (1996) Nature Medicine. 2(12), 1322-1328
- TAAs targets for fusion molecules of this invention Any of the foregoing markers can be used as TAAs targets for fusion molecules of this invention.
- the one or more TAA, TAA variant, or TAA mutant contemplated for use in the fusion molecule constructs and methods of the present disclosure is selected from, or derived from, the list provided in Table 3.
- a method for generating a monoclonal antibody that binds specifically to a targeted antigen polypeptide may comprise administering to a mouse an amount of an immunogenic composition comprising the targeted antigen polypeptide effective to stimulate a detectable immune response, obtaining antibody-producing cells (e.g., cells from the spleen) from the mouse and fusing the antibody-producing cells with myeloma cells to obtain antibody-producing hybridomas, and testing the antibody-producing hybridomas to identify a hybridoma that produces a monoclonal antibody that binds specifically to the targeted antigen polypeptide.
- antibody-producing cells e.g., cells from the spleen
- a hybridoma can be propagated in a cell culture, optionally in culture conditions where the hybridoma-derived cells produce the monoclonal antibody that binds specifically to targeted antigen polypeptide.
- the monoclonal antibody may be purified from the cell culture. A variety of different techniques are then available for testing an antigen/antibody interaction to identify particularly desirable antibodies.
- Antibodies can be engineered in numerous ways. They can be made as bispecific antibodies, heterodimeric antibodies, single-chain antibodies (including small modular immunopharmaceuticals or SMIPsTM), Fab and F(ab') 2 fragments, etc. Antibodies can be humanized, chimerized, deimmunized, or fully human. Numerous publications set forth the many types of antibodies and the methods of engineering such antibodies. For example, see U.S. Pat. Nos. 6,355,245; 6,180,370; 5,693,762; 6,407,213; 6,548,640; 5,565,332; 5,225,539; 6,103,889; and 5,260,203.
- Chimeric antibodies can be produced by recombinant DNA techniques known in the art. For example, a gene encoding the Fc constant region of a murine (or other species) monoclonal antibody molecule is digested with restriction enzymes to remove the region encoding the murine Fc, and the equivalent portion of a gene encoding a human Fc constant region is substituted (see Robinson et aL, International Patent Publication PCT/US86/02269; Akira, et aL, European Patent Application 184,187; Taniguchi, M., European Patent Application 171 ,496; Morrison et aL, European Patent Application 173,494; Neuberger et aL, International Application WO 86/01533; Cabilly et aL U.S.
- a humanized antibody has one or more amino acid residues introduced from a source that is nonhuman, in addition to the nonhuman CDRs.
- Humanization can be essentially performed following the method of Winter and co-workers (Jones et aL, Nature, 321 :522-525, 1986; Riechmann et aL, Nature, 332:323-327, 1988; Verhoeyen et aL, Science, 239:1534-1536, 1988), by substituting hypervariable region sequences for the corresponding sequences of a human antibody. Accordingly, such "humanized" antibodies are chimeric antibodies (U.S. Patent No.
- humanized antibodies are typically human antibodies in which some hypervariable region residues and possibly some framework region residues are substituted by residues from analogous sites in rodent antibodies.
- U.S. Patent No. 5,693,761 to Queen et al discloses a refinement on Winter et aL for humanizing antibodies, and is based on the premise that ascribes avidity loss to problems in the structural motifs in the humanized framework which, because of steric or other chemical incompatibility, interfere with the folding of the CDRs into the binding-capable conformation found in the mouse antibody.
- Queen teaches using human framework sequences closely homologous in linear peptide sequence to framework sequences of the mouse antibody to be humanized. Accordingly, the methods of Queen focus on comparing framework sequences between species. Typically, all available human variable region sequences are compared to a particular mouse sequence and the percentage identity between correspondent framework residues is calculated.
- the human variable region with the highest percentage is selected to provide the framework sequences for the humanizing project. Queen also teaches that it is important to retain in the humanized framework, certain amino acid residues from the mouse framework critical for supporting the CDRs in a binding-capable conformation. Potential criticality is assessed from molecular models. Candidate residues for retention are typically those adjacent in linear sequence to a CDR or physically within 6A of any CDR residue.
- framework shuffling Another method of humanizing antibodies, referred to as “framework shuffling", relies on generating a combinatorial library with nonhuman CDR variable regions fused in frame into a pool of individual human germline frameworks (Dall'Acqua et al., Methods, 36:43, 2005). The libraries are then screened to identify clones that encode humanized antibodies which retain good binding.
- variable regions both light and heavy
- sequence of the variable region of a rodent antibody is screened against the entire library of known human variable-domain sequences.
- the human sequence that is closest to that of the rodent is then accepted as the human framework region (framework region) for the humanized antibody (Sims et al., J. Immunol., 151 :2296, 1993; Chothia et al., J. Mol. Biol., 196:901 , 1987).
- Another method uses a particular framework region derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chain variable regions.
- the same framework may be used for several different humanized antibodies (Carter et aL, Proc. Natl. Acad. Sci. (U.S.A.), 89:4285, 1992; Presta et aL, J. Immunol., 151 :2623, 1993).
- the choice of nonhuman residues to substitute into the human variable region can be influenced by a variety of factors. These factors include, for example, the rarity of the amino acid in a particular position, the probability of interaction with either the CDRs or the antigen, and the probability of participating in the interface between the light and heavy chain variable domain interface. (See, for example, U.S. Patent Nos. 5,693,761 , 6,632,927, and 6,639,055).
- One method to analyze these factors is through the use of three-dimensional models of the non-human and humanized sequences. Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art. Computer programs are available that illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences.
- a method for producing a TAA antibody or antigen-binding fragment thereof comprises the steps of synthesizing a library of human antibodies on phage, screening the library with TAA or an antibody-binding portion thereof, isolating phage that bind TAA, and obtaining the antibody from the phage.
- one method for preparing the library of antibodies for use in phage display techniques comprises the steps of immunizing a non-human animal comprising human immunoglobulin loci with TAA or an antigenic portion thereof to create an immune response, extracting antibody-producing cells from the immunized animal; isolating RNA encoding heavy and light chains of antibodies of the disclosure from the extracted cells, reverse transcribing the RNA to produce cDNA, amplifying the cDNA using primers, and inserting the cDNA into a phage display vector such that antibodies are expressed on the phage.
- Recombinant anti-TAA antibodies of the disclosure may be obtained in this way.
- recombinant human anti-TAA antibodies of the disclosure can also be isolated by screening a recombinant combinatorial antibody library.
- the library is a scFv phage display library, generated using human V and V H cDNAs prepared from mRNA isolated from B cells. Methods for preparing and screening such libraries are known in the art. Kits for generating phage display libraries are commercially available (e.g., the Pharmacia Recombinant Phage Antibody System, catalog no. 27-9400-01 ; and the Stratagene SurfZAPTM phage display kit, catalog no. 240612).
- Hybridomas 3:81 -85, 1992; Huse et aL, Science, 246:1275-1281 , 1989; McCafferty et aL, Nature, 348:552-554, 1990; Griffiths et aL, EMBO J., 12:725-734, 1993; Hawkins et aL, J. MoL Biol., 226:889-896, 1992; Clackson et aL, Nature, 352:624-628, 1991 ; Gram et aL, Proc. NatL Acad. Sci.
- Human antibodies are also produced by immunizing a non-human, transgenic animal comprising within its genome some or all of human immunoglobulin heavy chain and light chain loci with a human IgE antigen, e.g., a XenoMouseTM animal (Abgenix, Inc./Amgen, Inc.- Fremont, Calif.).
- XenoMouseTM mice are engineered mouse strains that comprise large fragments of human immunoglobulin heavy chain and light chain loci and are deficient in mouse antibody production. See, e.g., Green et aL, Nature Genetics, 7:13-21 , 1994 and U.S. Pat. Nos.
- XenoMouseTM mice produce an adult-like human repertoire of fully human antibodies and generate antigen-specific human antibodies.
- the XenoMouseTM mice contain approximately 80% of the human antibody V gene repertoire through introduction of megabase sized, germline configuration fragments of the human heavy chain loci and kappa light chain loci in yeast artificial chromosome (YAC).
- YAC yeast artificial chromosome
- XenoMouseTM mice further contain approximately all of the human lambda light chain locus. See Mendez et aL, Nature Genetics, 15:146-156, 1997; Green and Jakobovits, J. Exp. Med., 188:483-495, 1998; and WO 98/24893.
- the fusion molecules of the present disclosure utilize an antibody or antigen-binding fragment thereof that is selected from the group consisting of a polyclonal antibody, a monoclonal antibody, a recombinant antibody, a bispecific antibody, a heterodimeric antibody, a diabody, a chimerized or chimeric antibody or antigen-binding fragment thereof, a humanized antibody or antigen-binding fragment thereof, a fully human antibody or antigen-binding fragment thereof, a CDR-grafted antibody or antigen-binding fragment thereof, a single chain antibody, an Fv, an Fd, an Fab, an Fab', or an F(ab') 2 , and synthetic or semi-synthetic antibodies.
- an antibody or antigen-binding fragment thereof that is selected from the group consisting of a polyclonal antibody, a monoclonal antibody, a recombinant antibody, a bispecific antibody, a heterodimeric antibody, a diabody, a chimer
- the fusion molecules of the present disclosure utilize an antibody or antigen-binding fragment that binds to a TAA with a dissociation constant (K D ) of, e.g., at least about 1 x10 3 M, at least about 1 x10 4 M, at least about 1 x10 5 M, at least about
- K D dissociation constant
- 1 x10 6 M at least about 1 x10 7 M, at least about 1 x10 8 M, at least about 1 x10 9 M, at least about 1x10 40 M, at least about 1 x10 11 M, or at least about 1 x10 12 M.
- the fusion molecules of the present disclosure utilize an antibody or antigen-binding fragment that binds to a TAA with a dissociation constant (K D ) in the range of, e.g., at least about 1 x10 3 M to at least about 1 x10 4 M, at least about 1 x10 4 M to at least about 1 x10 5 M, at least about 1 x10 5 M to at least about 1 x10 6 M, at least about 1 x10 6 M to at least about 1 x10 7 M, at least about 1 x10 7 M to at least about 1 x10 8 M, at least about 1 x10 8 M to at least about 1 x10 9 M, at least about 1 x10 9 M to at least about 1x10 40 M, at least about 1 x10 10 M to at least about 1x10 41 M, or at least about 1 x10 11 M to at least about 1 x10 12 M.
- K D dissociation constant
- the fusion molecules of the present disclosure utilize an antibody or antigen-binding fragment that cross-competes for binding to the same epitope on the TAA as a reference antibody which comprises the heavy chain variable region and light chain variable region set forth in the references and sequence listings provided herein.
- immune-checkpoint protein antigens have been reported to be expressed on various immune cells, including, e.g., SIRP (expressed on macrophage, monocytes, dendritic cells), CD47 (highly expressed on tumor cells and other cell types), VISTA (expressed on monocytes, dendritic cells, B cells, T cells), CD152 (expressed by activated CD8+ T cells, CD4+ T cells and regulatory T cells), CD279 (expressed on tumor infiltrating lymphocytes, expressed by activated T cells (both CD4 and CD8), regulatory T cells, activated B cells, activated NK cells, anergic T cells, monocytes, dendritic cells), CD274 (expressed on T cells, B cells, dendritic cells, macrophages, vascular endothelial cells, pancreatic islet cells), and CD223 (expressed by activated T cells, regulatory T cells, anergic T cells, NK cells, NKT cells, and plasmacytoid dendriti
- Antibodies that bind to an antigen which is determined to be an immune-checkpoint protein are known to those skilled in the art.
- various anti-CD276 antibodies have been described in the art (see, e.g., U.S. Pat. Public. No. 20120294796 (Johnson et al) and references cited therein);
- various anti-CD272 antibodies have been described in the art (see, e.g., U.S. Pat. Public. No. 20140017255 (Mataraza et al) and references cited therein);
- various anti-CD152/CTLA-4 antibodies have been described in the art (see, e.g., U.S. Pat. Public. No.
- IFN fusion partner can be an antibody, bispecific antibody, heterodimeric antibody, antibody fragment, a diabody, or protein or peptide that exhibit binding to an immune-checkpoint protein antigen that is present on the surface of an immune cell.
- the immune-checkpoint protein antigen is selected from the group consisting of, but not limited to, CD279 (PD-1), CD274 (PDL-1 ), CD276, CD272, CD152, CD223 (LAG-3), CD40, SIRPa, CD47, OX-40, GITR, ICOS, CD27, 4-1 BB, TIM-3, B7-H3, B7-H4, TIGIT, and VISTA.
- the fusion molecule is a recombinantly expressed fusion molecule.
- the fusion molecules comprise an interferon molecule that is directly attached to the targeting moiety.
- the fusion molecules comprise an IFN molecule that is attached to the targeting moiety via a peptide linker.
- the linker may be an artificial sequence of between 5, 10, 15, 20, 30, 40 or more amino acids that are relatively free of secondary structure.
- the linker is a rigid linker peptide of between 10, 15, 20, 30, 40 or more amino acids that display a-helical conformation and may act as rigid spacers between protein domains.
- the peptide linker is a G/S rich linker.
- the peptide linker is an alphahelical linker. In various embodiments, the peptide linker is a glycine linker. In various embodiments, the peptide linker has the sequence set forth in SEQ ID NO: 20. In various embodiments, the peptide linker has the sequence set forth in SEQ ID NO: 21 . In various embodiments, the peptide linker has the sequence set forth in SEQ ID NO: 22. In various embodiments, the peptide linker has the sequence set forth in SEQ ID NO: 23.
- the fusion molecules of the present disclosure will comprise the antibody and interferon molecule combinations recited in Table 4.
- the present disclosure provides isolated nucleic acid molecules comprising a polynucleotide encoding I FN, an IFN variant, an IFN fusion protein, or an IFN variant fusion protein of the present disclosure.
- the subject nucleic acids may be singlestranded or double stranded.
- Such nucleic acids may be DNA or RNA molecules.
- DNA includes, for example, cDNA, genomic DNA, synthetic DNA, DNA amplified by PCR, and combinations thereof. Genomic DNA encoding IFN polypeptides is obtained from genomic libraries which are available for a number of species.
- RNA may be obtained from prokaryotic expression vectors which direct high-level synthesis of mRNA, such as vectors using T7 promoters and RNA polymerase.
- cDNA is obtained from libraries prepared from mRNA isolated from various tissues that express IFN.
- the DNA molecules of the disclosure include full-length genes as well as polynucleotides and fragments thereof. The full-length gene may also include sequences encoding the N-terminal signal sequence. Such nucleic acids may be used, for example, in methods for making the novel IFN variants.
- the isolated nucleic acid molecules comprise the polynucleotides described herein, and further comprise a polynucleotide encoding at least one heterologous protein described herein. In various embodiments, the nucleic acid molecules further comprise polynucleotides encoding the linkers or hinge linkers described herein.
- the recombinant nucleic acids of the present disclosure may be operably linked to one or more regulatory nucleotide sequences in an expression construct.
- Regulatory sequences are art-recognized and are selected to direct expression of the IFN variant. Accordingly, the term regulatory sequence includes promoters, enhancers, and other expression control elements. Exemplary regulatory sequences are described in Goeddel; Gene Expression Technology: Methods in Enzymology, Academic Press, San Diego, Calif. (1990).
- said one or more regulatory nucleotide sequences may include, but are not limited to, promoter sequences, leader or signal sequences, ribosomal binding sites, transcriptional start and termination sequences, translational start and termination sequences, and enhancer or activator sequences. Constitutive or inducible promoters as known in the art are contemplated by the present disclosure.
- the promoters may be either naturally occurring promoters, or hybrid promoters that combine elements of more than one promoter.
- An expression construct may be present in a cell on an episome, such as a plasmid, or the expression construct may be inserted in a chromosome.
- the expression vector contains a selectable marker gene to allow the selection of transformed host cells.
- the subject nucleic acid is provided in an expression vector comprising a nucleotide sequence encoding an IFN variant and operably linked to at least one regulatory sequence.
- expression vector refers to a plasmid, phage, virus or vector for expressing a polypeptide from a polynucleotide sequence. Vectors suitable for expression in host cells are readily available and the nucleic acid molecules are inserted into the vectors using standard recombinant DNA techniques.
- Such vectors can include a wide variety of expression control sequences that control the expression of a DNA sequence when operatively linked to it may be used in these vectors to express DNA sequences encoding an IFN variant.
- useful expression control sequences include, for example, the early and late promoters of SV40, tet promoter, adenovirus or cytomegalovirus immediate early promoter, RSV promoters, the lac system, the trp system, the TAC or TRC system, T7 promoter whose expression is directed by T7 RNA polymerase, the major operator and promoter regions of phage lambda , the control regions for fd coat protein, the promoter for 3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase, e.g., PhoS, the promoters of the yeast a-mating factors, the polyhedron promoter of the baculovirus system and other sequences known to control the expression of genes of prokary
- the design of the expression vector may depend on such factors as the choice of the host cell to be transformed and/or the type of protein desired to be expressed. Moreover, the vector's copy number, the ability to control that copy number and the expression of any other protein encoded by the vector, such as antibiotic markers, should also be considered.
- a recombinant nucleic acid of the present disclosure can be produced by ligating the cloned gene, or a portion thereof, into a vector suitable for expression in either prokaryotic cells, eukaryotic cells (yeast, avian, insect or mammalian), or both.
- Expression vehicles for production of a recombinant IFN polypeptide include plasmids and other vectors.
- suitable vectors include plasmids of the types: pBR322-derived plasmids, pEMBL-derived plasmids, pEX-derived plasmids, pBTac-derived plasmids and pUC-derived plasmids for expression in prokaryotic cells, such as E. coli.
- Some mammalian expression vectors contain both prokaryotic sequences to facilitate the propagation of the vector in bacteria, and one or more eukaryotic transcription units that are expressed in eukaryotic cells.
- the pcDNAI/amp, pcDNAI/neo, pRc/CMV, pSV2gpt, pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg derived vectors are examples of mammalian expression vectors suitable for transfection of eukaryotic cells.
- vectors are modified with sequences from bacterial plasmids, such as pBR322, to facilitate replication and drug resistance selection in both prokaryotic and eukaryotic cells.
- bacterial plasmids such as pBR322
- derivatives of viruses such as the bovine papilloma virus (BPV-1 ), or Epstein-Barr virus (pHEBo, pREP-derived and p205) can be used for transient expression of proteins in eukaryotic cells.
- BBV-1 bovine papilloma virus
- pHEBo Epstein-Barr virus
- pREP-derived and p205 Epstein-Barr virus
- examples of other viral (including retroviral) expression systems can be found below in the description of gene therapy delivery systems.
- the various methods employed in the preparation of the plasmids and in transformation of host organisms are well known in the art.
- baculovirus expression systems include pVL-derived vectors (such as pVL1392, pVL1393 and pVL941 ), pAcUW-derived vectors (such as pAcUWI), and pBlueBac-derived vectors (such as the B-gal containing pBlueBac III).
- pVL-derived vectors such as pVL1392, pVL1393 and pVL941
- pAcUW-derived vectors such as pAcUWI
- pBlueBac-derived vectors such as the B-gal containing pBlueBac III.
- a vector will be designed for production of the subject IFN variants in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif.), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors (Promega, Madison, Wis.).
- the subject gene constructs can be used to cause expression of the subject IFN variants in cells propagated in culture, e.g., to produce proteins, including fusion proteins or variant proteins, for purification.
- This present disclosure also pertains to a host cell transfected with a recombinant gene including a nucleotide sequence coding an amino acid sequence for one or more of the subject IFN variant.
- the host cell may be any prokaryotic or eukaryotic cell.
- an IFN variant of the present disclosure may be expressed in bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells. Other suitable host cells are known to those skilled in the art.
- the present disclosure further pertains to methods of producing the subject IFN variants.
- a host cell transfected with an expression vector encoding an IFN variant can be cultured under appropriate conditions to allow expression of the IFN variant to occur.
- the IFN variant may be secreted and isolated from a mixture of cells and medium containing the IFN variant.
- the IFN variant may be retained cytoplasmically or in a membrane fraction and the cells harvested, lysed and the protein isolated.
- a cell culture includes host cells, media and other byproducts. Suitable media for cell culture is well known in the art.
- polypeptides and proteins of the present disclosure can be purified according to protein purification techniques are well known to those of skill in the art. These techniques involve, at one level, the crude fractionation of the proteinaceous and non- proteinaceous fractions. Having separated the peptide polypeptides from other proteins, the peptide or polypeptide of interest can be further purified using chromatographic and electrophoretic techniques to achieve partial or complete purification (or purification to homogeneity).
- isolated polypeptide or “purified polypeptide” as used herein, is intended to refer to a composition, isolatable from other components, wherein the polypeptide is purified to any degree relative to its naturally-obtainable state.
- a purified polypeptide therefore also refers to a polypeptide that is free from the environment in which it may naturally occur.
- purified will refer to a polypeptide composition that has been subjected to fractionation to remove various other components, and which composition substantially retains its expressed biological activity.
- substantially purified this designation will refer to a peptide or polypeptide composition in which the polypeptide or peptide forms the major component of the composition, such as constituting about 50%, about 60%, about 70%, about 80%, about 85%, or about 90% or more of the proteins in the composition.
- the present disclosure provides a pharmaceutical composition
- a pharmaceutical composition comprising the con-IFN-a mutants, or bifunctional con-IFN-a mutant fusion proteins, in admixture with a pharmaceutically acceptable carrier.
- pharmaceutically acceptable carriers are well known and understood by those of ordinary skill and have been extensively described (see, e.g., Remington's Pharmaceutical Sciences, 18th Edition, A. R. Gennaro, ed., Mack Publishing Company, 1990).
- the pharmaceutically acceptable carriers may be included for purposes of modifying, maintaining or preserving, for example, the pH, osmolarity, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration of the composition.
- Suitable pharmaceutically acceptable carriers include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine or lysine); antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen-sulfite); buffers (such as borate, bicarbonate, Tris-HCI, citrates, phosphates, other organic acids); bulking agents (such as mannitol or glycine), chelating agents (such as ethylenediamine tetraacetic acid (EDTA)); complexing agents (such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxypropyl-beta- cyclodextrin); fillers; monosaccharides; disaccharides and other carbohydrates (such as glucose, mannose, or dextrins); proteins
- the primary vehicle or carrier in a pharmaceutical composition may be either aqueous or non-aqueous in nature.
- a suitable vehicle or carrier may be water for injection, physiological saline solution or artificial cerebrospinal fluid, possibly supplemented with other materials common in compositions for parenteral administration.
- Neutral buffered saline or saline mixed with serum albumin are further exemplary vehicles.
- Other exemplary pharmaceutical compositions comprise Tris buffer of about pH 7.0-8.5, or acetate buffer of about pH 4.0-5.5, which may further include sorbitol or a suitable substitute thereof.
- compositions may be prepared for storage by mixing the selected composition having the desired degree of purity with optional formulation agents (Remington's Pharmaceutical Sciences, supra) in the form of a lyophilized cake or an aqueous solution. Further, the therapeutic composition may be formulated as a lyophilizate using appropriate excipients such as sucrose.
- the optimal pharmaceutical composition will be determined by one of ordinary skill in the art depending upon, for example, the intended route of administration, delivery format, and desired dosage.
- the therapeutic pharmaceutical compositions may be in the form of a pyrogen-free, parenterally acceptable aqueous solution comprising the desired con-IFN-a mutants, or bifunctional con-IFN-a mutant fusion proteins, in a pharmaceutically acceptable vehicle.
- a particularly suitable vehicle for parenteral injection is sterile distilled water in which a polypeptide is formulated as a sterile, isotonic solution, properly preserved.
- pharmaceutical formulations suitable for injectable administration may be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hanks' solution, Ringer's solution, or physiologically buffered saline.
- Aqueous injection suspensions may contain substances that increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran. Additionally, suspensions of the active compounds may be prepared as appropriate oily injection suspensions. Optionally, the suspension may also contain suitable stabilizers or agents to increase the solubility of the compounds and allow for the preparation of highly concentrated solutions.
- the therapeutic pharmaceutical compositions may be formulated for targeted delivery using a colloidal dispersion system.
- Colloidal dispersion systems include macromolecule complexes, nanocapsules, microspheres, beads, and lipid- based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
- lipids useful in liposome production include phosphatidyl compounds, such as phosphatidylglycerol, phosphatidylcholine, phosphatidylserine, phosphatidylethanolamine, sphingolipids, cerebrosides, and gangliosides.
- Illustrative phospholipids include egg phosphatidylcholine, dipalmitoylphosphatidylcholine, and distearoylphosphatidylcholine.
- the targeting of liposomes is also possible based on, for example, organ-specificity, cell-specificity, and organelle-specificity and is known in the art.
- oral administration of the pharmaceutical compositions is contemplated. Pharmaceutical compositions that are administered in this fashion can be formulated with or without those carriers customarily used in the compounding of solid dosage forms such as tablets and capsules.
- one or more therapeutic compounds of the present disclosure may be mixed with one or more pharmaceutically acceptable carriers, such as sodium citrate or dicalcium phosphate, and/or any of the following: (1 ) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and/or silicic acid; (2) binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose, and/or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators, such as quaternary ammonium compounds; (7) wetting agents,
- pharmaceutically acceptable carriers such as sodium citrate or dicalcium phosphate, and/or any of the following: (1 ) fillers or
- the pharmaceutical compositions may also comprise buffering agents.
- Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols and the like.
- Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and elixirs.
- the liquid dosage forms may contain inert diluents commonly used in the art, such as water or other solvents, solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1 ,3- butylene glycol, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof
- the oral compositions can also include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, coloring, perfuming, and preservative agents.
- topical administration of the pharmaceutical compositions is contemplated.
- the topical formulations may further include one or more of the wide variety of agents known to be effective as skin or stratum corneum penetration enhancers. Examples of these are 2-pyrrolidone, N- methyl-2-pyrrolidone, dimethylacetamide, dimethylformamide, propylene glycol, methyl or isopropyl alcohol, dimethyl sulfoxide, and azone. Additional agents may further be included to make the formulation cosmetically acceptable. Examples of these are fats, waxes, oils, dyes, fragrances, preservatives, stabilizers, and surface active agents.
- Keratolytic agents such as those known in the art may also be included. Examples are salicylic acid and sulfur.
- Dosage forms for the topical or transdermal administration include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches, and inhalants.
- the active compound may be mixed under sterile conditions with a pharmaceutically acceptable carrier, and with any preservatives, buffers, or propellants which may be required.
- the ointments, pastes, creams and gels may contain, in addition to a subject compound of the disclosure (e.g., a con-IFN-a mutant), excipients, such as animal and vegetable fats, oils, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc and zinc oxide, or mixtures thereof.
- excipients such as animal and vegetable fats, oils, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc and zinc oxide, or mixtures thereof.
- compositions contemplated for use herein include formulations involving polypeptides in sustained- or controlled-delivery formulations.
- Techniques for formulating a variety of other sustained- or controlled-delivery means, such as liposome carriers, bio-erodible microparticles or porous beads and depot injections, are also known to those skilled in the art.
- An effective amount of a pharmaceutical composition to be employed therapeutically will depend, for example, upon the therapeutic context and objectives.
- One skilled in the art will appreciate that the appropriate dosage levels for treatment will thus vary depending, in part, upon the molecule delivered, the indication for which the polypeptide is being used, the route of administration, and the size (body weight, body surface or organ size) and condition (the age and general health) of the patient. Accordingly, the clinician may titer the dosage and modify the route of administration to obtain the optimal therapeutic effect.
- a typical dosage may range from about 0.001 mg/kg to up to about 100 mg/kg or more, depending on the factors mentioned above.
- Polypeptide compositions may be preferably injected or administered intravenously.
- compositions may be administered every three to four days, every week, or biweekly depending on the half-life and clearance rate of the particular formulation. The frequency of dosing will depend upon the pharmacokinetic parameters of the polypeptide in the formulation used. Typically, a composition is administered until a dosage is reached that achieves the desired effect. The composition may therefore be administered as a single dose, or as multiple doses (at the same or different concentrations/dosages) over time, or as a continuous infusion. Further refinement of the appropriate dosage is routinely made. Appropriate dosages may be ascertained through use of appropriate dose-response data.
- the route of administration of the pharmaceutical composition is in accord with known methods, e.g. orally, through injection by intravenous, intraperitoneal, intracerebral (intra- parenchymal), intracerebroventricular, intramuscular, intra-ocular, intraarterial, intraportal, intralesional routes, intramedullary, intrathecal, intraventricular, transdermal, subcutaneous, or intraperitoneal or intratumorally; as well as intranasal, enteral, topical, sublingual, urethral, vaginal, or rectal means, by sustained release systems or by implantation devices.
- the compositions may be administered by bolus injection or continuously by infusion, or by implantation device.
- the composition may be administered locally via implantation of a membrane, sponge, or another appropriate material on to which the desired molecule has been absorbed or encapsulated.
- a membrane, sponge, or another appropriate material on to which the desired molecule has been absorbed or encapsulated.
- the device may be implanted into any suitable tissue or organ, and delivery of the desired molecule may be via diffusion, timed-release bolus, or continuous administration.
- the present disclosure provides for a method of treating a type I interferon mediated disorder selected from the group consisting of: cancer, infectious diseases, immune disorders, inflammatory diseases or conditions, and autoimmune diseases.
- cancer refers to any uncontrolled growth of cells that may interfere with the normal functioning of the bodily organs and systems and includes both primary and metastatic tumors.
- Primary tumors or cancers that migrate from their original location and seed vital organs can eventually lead to the death of the subject through the functional deterioration of the affected organs.
- a metastasis is a cancer cell or group of cancer cells, distinct from the primary tumor location, resulting from the dissemination of cancer cells from the primary tumor to other parts of the body. Metastases may eventually result in death of a subject.
- cancers can include benign and malignant cancers, polyps, hyperplasia, as well as dormant tumors or micrometastases.
- the present disclosure provides for a method of treating cancer cells in a subject, comprising administering to said subject a therapeutically effective amount (either as monotherapy or in a combination therapy regimen) of a con-IFN-a mutant, or bifunctional con-IFN-a mutant fusion protein of the present disclosure in pharmaceutically acceptable carrier, wherein such administration inhibits the growth and/or proliferation of a cancer cell.
- a con-IFN-a mutant, or bifunctional con-IFN-a mutant fusion protein of the present disclosure is useful in treating disorders characterized as cancer.
- Such disorders include, but are not limited to solid tumors, such as cancers of the breast, respiratory tract, brain, reproductive organs, digestive tract, urinary tract, eye, liver, skin, head and neck, thyroid, parathyroid and their distant metastases, lymphomas, sarcomas, multiple myeloma and leukemia.
- solid tumors such as cancers of the breast, respiratory tract, brain, reproductive organs, digestive tract, urinary tract, eye, liver, skin, head and neck, thyroid, parathyroid and their distant metastases, lymphomas, sarcomas, multiple myeloma and leukemia.
- breast cancer include, but are not limited to invasive ductal carcinoma, invasive lobular carcinoma, ductal carcinoma in situ, and lobular carcinoma in situ.
- cancers of the respiratory tract include, but are not limited to, small-cell and non-small-cell lung carcinoma, as well as bronchial adenoma and pleuropulmonary blastoma.
- brain cancers include, but are not limited to, brain stem and hypophthalmic glioma, cerebellar and cerebral astrocytoma, medulloblastoma, ependymoma, as well as neuroectodermal and pineal tumor.
- Tumors of the male reproductive organs include, but are not limited to, prostate and testicular cancer.
- Tumors of the female reproductive organs include, but are not limited to endometrial, cervical, ovarian, vaginal, and vulvar cancer, as well as sarcoma of the uterus.
- Tumors of the digestive tract include, but are not limited to anal, colon, colorectal, esophageal, gallbladder, gastric, pancreatic, rectal, small-intestine, and salivary gland cancers.
- Tumors of the urinary tract include, but are not limited to, bladder, penile, kidney, renal pelvis, ureter, and urethral cancers.
- Eye cancers include, but are not limited to, intraocular melanoma and retinoblastoma.
- liver cancers include, but are not limited to, hepatocellular carcinoma (liver cell carcinomas with or without fibrolamellar variant), cholangiocarcinoma (intrahepatic bile duct carcinoma), and mixed hepatocellular cholangiocarcinoma.
- Skin cancers include, but are not limited to squamous cell carcinoma, Kaposi's sarcoma, malignant melanoma, Merkel cell skin cancer, and non-melanoma skin cancer.
- Head-and-neck cancers include, but are not limited to nasopharyngeal cancer, and lip and oral cavity cancer.
- Lymphomas include, but are not limited to AIDS-related lymphoma, non-Hodgkin's lymphoma, cutaneous T-cell lymphoma, Hodgkin's disease, and lymphoma of the central nervous system.
- Sarcomas include, but are not limited to, sarcoma of the soft tissue, osteosarcoma, malignant fibrous histiocytoma, lymphosarcoma, and rhabdomyosarcoma.
- Leukemias include, but are not limited to acute myeloid leukemia, acute lymphoblastic leukemia, various lymphocytic leukemia, various myelogenous leukemia, and hairy cell leukemia.
- the cancer will be a cancer with high expression of TGF-p family member, such as activin A, myostatin, TGF-p and GDF15, e.g., pancreatic cancer, gastric cancer, ovarian cancer, colorectal cancer, melanoma leukemia, lung cancer, prostate cancer, brain cancer, bladder cancer, and head-neck cancer.
- TGF-p family member such as activin A, myostatin, TGF-p and GDF15
- pancreatic cancer gastric cancer, ovarian cancer, colorectal cancer, melanoma leukemia, lung cancer, prostate cancer, brain cancer, bladder cancer, and head-neck cancer.
- the present con-IFN-a mutants, or bifunctional con-IFN- a mutant fusion proteins can be utilized to promote growth inhibition and/or proliferation of a cancerous tumor cell. These methods may inhibit or prevent the growth of the cancer cells of said subject, such as for example, by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%.
- the modulation may reduce the size of the solid tumor by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%.
- the inhibition of the cancer cell proliferation can be measured by cell-based assays, such as bromodeoxyuridine (BRDU) incorporation (Hoshino et aL, Int. J. Cancer 38, 369, 1986; Campana et aL, J. Immunol. Meth. 107:79, 1988; [ 3 H]-thymidine incorporation (Chen, J., Oncogene 13:1395-403, 1996; Jeoung, J., J. Biol. Chem. 270:18367-73, 1995; the dye Alamar Blue (available from Biosource International) (Voytik-Harbin et aL, In Vitro Cell Dev Biol Anim 34:239-46, 1998).
- BRDU bromodeoxyuridine
- the anchorage independent growth of cancer cells is assessed by colony formation assay in soft agar, such as by counting the number of cancer cell colonies formed on top of the soft agar (see Examples and Sambrook et aL, Molecular Cloning, Cold Spring Harbor, 1989).
- the inhibition of cancer cell growth in a subject may be assessed by monitoring the cancer growth in a subject, for example in an animal model or in human subjects.
- One exemplary monitoring method is tumorigenicity assays.
- a xenograft comprises human cells from a pre-existing tumor or from a tumor cell line. Tumor xenograft assays are known in the art and described herein (see, e.g., Ogawa et aL, Oncogene 19:6043-6052, 2000).
- tumorigenicity is monitored using the hollow fiber assay, which is described in U.S. Patent No. 5,698,413, which is incorporated herein by reference in its entirety.
- the percentage of the inhibition is calculated by comparing the cancer cell proliferation, anchorage independent growth, or cancer cell growth under modulator treatment with that under negative control condition (typically without modulator treatment). For example, where the number of cancer cells or cancer cell colonies (colony formation assay), or PRDU or [ 3 H]-thymidine incorporation is A (under the treatment of modulators) and C (under negative control condition), the percentage of inhibition would be (C-A)/Cx100%.
- tumor cell lines derived from human tumors and available for use in the in vitro and in vivo studies include, but are not limited to, B lymphoblast cell lines (e.g., Daudi cell lines); leukemia cell lines (e.g., CCRF-CEM, HL-60(TB), K-562, MOLT-4, RPM1- 8226, SR, P388 and P388/ADR); non-small cell lung cancer cell lines (e.g., A549/ATCC, EKVX, HOP-62, HOP-92, NCI-H226, NCI-H23, NCI-H322M, NCI-H460, NCI-H522 and LXFL 529); small cell lung cancer cell lines (e.g., DMS 114 and SHP-77); colon cancer cell lines (e.g., COLO 205, HCC-2998, HCT-116, HCT-15, HT29, KM12, SW-620, DLD-1 and KM20
- HBV infection is a major cause of hepatocellular carcinoma (HCC) worldwide and its most important cause in Asia. Seventy-five percent of all chronic HBV infections occur in Asia and the prevalence in Taiwan is 15-20%, where more than 90% of the adult population has been infected with HBV in the past (Chen et aL, J. Formos. Med. Assoc. (2007) 106(2) :148-55).
- Current clinically approved treatment options are nucleos(t)ide analogs and interferon-a. Nucleos(t)ide analogs control but do not cure hepatitis B and require expensive long-term treatment potentially associated with the emergence of resistant viruses.
- Interferon-a therapy is limited by side-effects and is only curative in 15-20% of patients.
- the virus is divided into four major serotypes (adr, adw, ayr, ayw) that induce differential antibody responses based on antigenic epitopes present on its envelope proteins, and into (at least) eight genotypes (A-l) according to overall nucleotide sequence variation of the genome.
- the genotypes have a distinct geographical distribution and are used in tracing the evolution and transmission of the virus. Differences between genotypes affect the disease severity, course and likelihood of complications, and response to treatment and possibly vaccination.
- subgenotypes e.g. A1 -5, exist. In Central Europe and the United States, the predominant genotype is A2.
- HBV vaccines provide a better protection against HBV of the same (sub)genotype as the HBV antigens comprised in the vaccine than to other (sub)genotypes.
- the present disclosure provides for a method of treating HBV infection in a subject, comprising administering to said subject a therapeutically effective amount (either as monotherapy or in a combination therapy regimen) of a con-IFN-a mutant, or bifunctional con-IFN-a mutant fusion protein of the present disclosure in pharmaceutically acceptable carrier, wherein such administration protects the cell from virus infection.
- the present con-IFN-a mutants, or bifunctional con-IFN- a mutant fusion proteins can be utilized to protect cells from a viral challenge. These methods may inhibit or prevent the viral infection of said subject, such as for example, by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%.
- the protection from viral challenge can be measured by treating cells with drug and then challenging cells with HBV and monitoring infection rates.
- the rate of infection can be assessed by measuring expression of hepatitis B surface antigen (HBsAg) and HBV DNA.
- Examples of cells that can be used to monitor infection rates after drug treatment and viral challenge include, but are not limited to, human fetal hepatocytes, human adult hepatocytes, primary tree shrew hepatocytes, HepaRG cells, induced pluripotent stem cell- derived human hepatocytes, and NTCP-overexpressing hepatoma cell lines (see, e.g., Xu et aL, Virology Journal 18(1 ):105, 2021 ).
- the present con-IFN-a mutants, or bifunctional con-IFN- a mutant fusion proteins can be utilized to treat HBV-infected cells. These methods may treat the viral infection of said subject, such as for example, by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%.
- the efficacy of antiviral treatment of HBV infected cells can be measured by treating HBV infected cells with drug and then measuring markers of HBV infection. Infection can be assessed by measuring expression HBsAg and HBV DNA.
- Examples of cells that can be used to monitor antiviral treatment of HBV infected cells include, but are not limited to, HepG2.2.15 cells, HepAD38 cells, HepDE19 cells and HepDESI 9 cells (see, e.g., Xu et aL, Virology Journal 18(1 ):105, 2021 ).
- Hepatitis C is a blood-borne, infectious, viral disease that is caused by an RNA virus belonging to the Hepacivirus genus in the Flaviviridae family called HCV.
- the enveloped HCV virion contains a positive stranded RNA genome encoding all known virus-specific proteins in a single, uninterrupted, open reading frame.
- the open reading frame comprises approximately 9500 nucleotides and encodes a single large polyprotein of about 3000 amino acids.
- the polyprotein comprises a core protein, envelope proteins E1 and E2, a membrane bound protein p7, and the non-structural proteins NS2, NS3, NS4A, NS4B, NS5A and NS5B.
- HCV genotypes At least six different HCV genotypes (with several subtypes within each genotype) are known to date.
- HCV genotype 1 a predominates, followed by HCV genotypes 1b, 2a, 2b, and 3a.
- HCV genotypes 1 , 2, and 3 are the most common, with about 80% of the hepatitis C patients having HCV genotype 1 .
- HCV genotype 1 b is predominant, followed by HCV genotypes 2a, 2b, 2c, and 3a.
- HCV genotypes 4 and 5 are found almost exclusively in Africa. The patient's HCV genotype is clinically important in determining the patient's potential response to therapy and the required duration of such therapy.
- Chronic HCV infection is associated with progressive liver pathology, including cirrhosis and hepatocellular carcinoma.
- chronic hepatitis C was treated with peginterferon-alpha in combination with ribavirin, which had substantial limitations of efficacy and tolerability.
- Glecaprevir-pibrentasvir was approved for treatment of chronic HCV infection in treatment-naive individuals without cirrhosis for a duration lasting only eight weeks. Further, all other currently approved treatments, sofosbuvir, ledipasvir, velpatasvir, voxilaprevir, daclatasvir, elbasvir, grazoprevir, simeprevir are indicated for the treatment of chronic HCV.
- hepatitis C is treated with a combination of pegylated interferon alpha and ribavirin for a period of 24 or 48 weeks, depending on the HCV genotype.
- Acute HCV infection may also be defined as within six month of ALT>10X ULN. Methods of determining ALT and ULN are known in the art.
- the present disclosure provides for a method of treating HCV infection in a subject, comprising administering to said subject a therapeutically effective amount (either as monotherapy or in a combination therapy regimen) of a con-IFN-a mutant, or bifunctional con-IFN-a mutant fusion protein of the present disclosure in pharmaceutically acceptable carrier, wherein such administration protects the cell from virus infection.
- “Therapeutically effective amount” or “therapeutically effective dose” refers to that amount of the therapeutic agent being administered which will relieve to some extent one or more of the symptoms of the disorder being treated.
- a therapeutically effective dose can be estimated initially from cell culture assays by determining an EC 5 o- A dose can then be formulated in animal models to achieve a circulating plasma concentration range that includes the EC 5 O as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. Levels in plasma may be measured, for example, by HPLC. The exact composition, route of administration and dosage can be chosen by the individual physician in view of the subject's condition.
- Dosage regimens can be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response). For example, a single bolus can be administered, several divided doses (multiple or repeat or maintenance) can be administered over time and the dose can be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
- Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the mammalian subjects to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms of the present disclosure will be dictated primarily by the unique characteristics of the antibody and the particular therapeutic or prophylactic effect to be achieved.
- the dose and dosing regimen is adjusted in accordance with methods well-known in the therapeutic arts. That is, the maximum tolerable dose can be readily established, and the effective amount providing a detectable therapeutic benefit to a subject may also be determined, as can the temporal requirements for administering each agent to provide a detectable therapeutic benefit to the subject. Accordingly, while certain dose and administration regimens are exemplified herein, these examples in no way limit the dose and administration regimen that may be provided to a subject in practicing the present disclosure.
- dosage values may vary with the type and severity of the condition to be alleviated and may include single or multiple doses. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition. Further, the dosage regimen with the compositions of this disclosure may be based on a variety of factors, including the type of disease, the age, weight, sex, medical condition of the subject, the severity of the condition, the route of administration, and the particular antibody employed. Thus, the dosage regimen can vary widely, but can be determined routinely using standard methods.
- doses may be adjusted based on pharmacokinetic or pharmacodynamic parameters, which may include clinical effects such as toxic effects and/or laboratory values.
- the present disclosure encompasses intra-subject dose-escalation as determined by the skilled artisan. Determining appropriate dosages and regimens are well-known in the relevant art and would be understood to be encompassed by the skilled artisan once provided the teachings disclosed herein.
- An exemplary, non-limiting daily dosing range for a therapeutically or prophylactically effective amount of a con-IFN-a mutant, or bifunctional con-IFN-a mutant fusion protein of the disclosure can be 0.001 to 100 mg/kg, 0.001 to 90 mg/kg, 0.001 to 80 mg/kg, 0.001 to 70 mg/kg, 0.001 to 60 mg/kg, 0.001 to 50 mg/kg, 0.001 to 40 mg/kg, 0.001 to 30 mg/kg,
- 0.001 to 20 mg/kg 0.001 to 10 mg/kg, 0.001 to 5 mg/kg, 0.001 to 4 mg/kg, 0.001 to 3 mg/kg,
- dosage values may vary with the type and severity of the conditions to be alleviated. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition.
- Toxicity and therapeutic index of the pharmaceutical compositions of the disclosure can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD 5 o (the dose lethal to 50% of the population) and the ED 5 o (the dose therapeutically effective in 50% of the population).
- the dose ratio between toxic and therapeutic effective dose is the therapeutic index and it can be expressed as the ratio LD50/ED50.
- Compositions that exhibit large therapeutic indices are generally preferred.
- the dosing frequency of the administration of the con-IFN-a mutant, or bifunctional con-IFN-a mutant fusion protein pharmaceutical composition depends on the nature of the therapy and the particular disease being treated.
- the subject can be treated at regular intervals, such as twice weekly, weekly or monthly, until a desired therapeutic result is achieved.
- exemplary dosing frequencies include but are not limited to: once weekly without break; once every 2 weeks; once every 3 weeks; weekly without break for 2 weeks, then monthly; weekly without break for 3 weeks, then monthly; monthly; once every other month; once every three months; once every four months; once every five months; or once every six months, or yearly.
- the present disclosure provides a method for treating cancer or cancer metastasis in a subject, comprising administering a therapeutically effective amount of the pharmaceutical compositions of the invention in combination with a second therapy, including, but not limited to immunotherapy, cytotoxic chemotherapy, small molecule kinase inhibitor targeted therapy, surgery, radiation therapy, and stem cell transplantation.
- a second therapy including, but not limited to immunotherapy, cytotoxic chemotherapy, small molecule kinase inhibitor targeted therapy, surgery, radiation therapy, and stem cell transplantation.
- cytotoxic chemotherapy cytotoxic chemotherapy
- small molecule kinase inhibitor targeted therapy surgery
- radiation therapy radiation therapy
- stem cell transplantation stem cell transplantation
- a wide array of conventional compounds has been shown to have anti-neoplastic activities. These compounds have been used as pharmaceutical agents in chemotherapy to shrink solid tumors, prevent metastases and further growth, or decrease the number of malignant T-cells in leukemic or bone marrow malignancies.
- chemotherapy has been effective in treating various types of malignancies, many anti-neoplastic compounds induce undesirable side effects. It has been shown that when two or more different treatments are combined, the treatments may work synergistically and allow reduction of dosage of each of the treatments, thereby reducing the detrimental side effects exerted by each compound at higher dosages. In other instances, malignancies that are refractory to a treatment may respond to a combination therapy of two or more different treatments.
- a second anti-cancer agent such as a chemotherapeutic agent
- chemotherapeutic agent includes, but is not limited to, daunorubicin, dactinomycin, doxorubicin, bleomycin, mitomycin, nitrogen mustard, chlorambucil, melphalan, cyclophosphamide, 6- mercaptopurine, 6-thioguanine, bendamustine, cytarabine (CA), 5-fluorouracil (5-FU), floxuridine (5-FUdR), methotrexate (MTX), colchicine, vincristine, vinblastine, etoposide, teniposide, cisplatin, carboplatin, oxaliplatin, pentostatin, cladribine, cytarabine, gemcitabine, pralatrexate, mitoxantrone, diethylstilbestrol (DES),
- DES diethylstilbestrol
- the dosages of such chemotherapeutic agents include, but is not limited to, about any of 10 mg/m 2 , 20 mg/m 2 , 30 mg/m 2 , 40 mg/m 2 , 50 mg/m 2 , 60 mg/m 2 , 75 mg/m 2 , 80 mg/m 2 , 90 mg/m 2 , 100 mg/m 2 , 120 mg/m 2 , 150 mg/m 2 , 175 mg/m 2 , 200 mg/m 2 , 210 mg/m 2 , 220 mg/m 2 , 230 mg/m 2 , 240 mg/m 2 , 250 mg/m 2 , 260 mg/m 2 , and 300 mg/m 2 .
- the combination therapy methods of the present disclosure may further comprise administering to the subject a therapeutically effective amount of immunotherapy, including, but are not limited to, treatment using depleting antibodies to specific tumor antigens; treatment using antibody-drug conjugates; treatment using agonistic, antagonistic, or blocking antibodies to co-stimulatory or co-inhibitory molecules (immune checkpoints) such as CTLA-4, PD-1 , OX-40, CD137, GITR, LAG3, TIM-3, SIRP, CD47, CD40 Siglec 8, Siglec 9, Siglec 15, TIGIT and VISTA; treatment using bispecific T cell engaging antibodies (BiTE®) such as blinatumomab: treatment involving administration of biological response modifiers such as IL-2, IL-12, IL-15, IL-21 , GM-CSF, IFN-a, IFN-p and IFN-y; treatment using therapeutic vaccines such as sipuleucel-T; treatment using Bacilli Calmette- Guerin
- immune checkpoints Treatment using agonistic, antagonistic, or blocking antibodies to co-stimulatory or co-inhibitory molecules (immune checkpoints) has been an area of extensive research and clinical evaluation. Under normal physiological conditions, immune checkpoints are crucial for the maintenance of self-tolerance (that is, the prevention of autoimmunity) and protect tissues from damage when the immune system is responding to pathogenic infection. It is now also clear that tumors co-opt certain immune-checkpoint pathways as a major mechanism of immune resistance, particularly against T cells that are specific for tumor antigens (Pardoll DM., Nat Rev Cancer, 12:252-64, 2012).
- treatment utilizing antibodies to immune checkpoint molecules including, e.g., CTLA-4 (ipilimumab), PD-1 (nivolumab; pembrolizumab; cemiplimab) and PD-L1 (atezolizumab; durvalumab; avelumab)(see, e.g, Philips and Atkins, International Immunology, 27(1); 39-46, Oct 2014), and OX-40, CD137, GITR, LAG3, TIGIT, TIM-3, and VISTA (see, e.g., Sharon et aL, Chin J Cancer., 33(9): 434-444, Sep 2014; Hodi et aL, N Engl J Med, 2010; Topalian et aL, N Engl J Med, 366:2443-54) are being evaluated or have been approved by the FDA as new, alternative immunotherapies to treat patients with proliferative diseases such as cancer, and in particular, patients with refrac
- CAR chimeric antigen receptor
- T cell therapy is an immunotherapy in which the patient's own T cells are isolated in the laboratory, redirected with a synthetic receptor to recognize a particular antigen or protein, and reinfused into the patient.
- CARs are synthetic molecules that minimally contain: (1) an antigen-binding region, typically derived from an antibody, (2) a transmembrane domain to anchor the CAR into the T cells, and (3) 1 or more intracellular T cell signaling domains.
- a CAR redirects T cell specificity to an antigen in a human leukocyte antigen (HLA)-independent fashion, and overcomes issues related to T cell tolerance (Kalos M and June CH, Immunity, 39(1 ):49-60, 2013).
- Abecma targets the B-cell maturation antigen (BCMA)
- BCMA B-cell maturation antigen
- Next generation CAR-T cell therapies are being developed and tested in the clinic by many pharmaceutical and biotechnology companies and are designed to improve upon the toxicity, efficacy, and manufacturability of the first-generation cellular therapies (see, e.g., Sterner and Sterner, Blood Cancer Journal 11 :69, 2021 ; Larson and Maus, Nature Reviews Cancer 21 :145-161 , 2021)
- NK cells In contrast to donor T cells, natural killer (NK) cells are known to mediate anticancer effects without the risk of inducing graft-versus-host disease (GvHD). Accordingly, alloreactive NK cells are now also the focus of considerable interest as suitable and powerful effector cells for cellular therapy of cancer.
- NK-92, HANK-1 , KHYG-1 , NK-YS, NKG, YT, YTS, NKL and NK3.3 Kornbluth,J., et aL, J. Immunol. 134, 728-735, 1985; Cheng, M. et aL, Front. Med.
- CAR-NK CAR expressing NK cells
- Immunotherapy using CAR expressing NK cells is an active area of research and clinical evaluation (see, e.g., Glienke et aL, Front Pharmacol, 6(21 ):1 -7, Feb 2015).
- Bispecific T-cell engager molecules constitute a class of bispecific single-chain antibodies for the polyclonal activation and redirection of cytotoxic T cells against pathogenic target cells.
- BiTEOs are bispecific for a surface target antigen on cancer cells, and for CD3 on T cells.
- BiTEOs are capable of connecting any kind of cytotoxic T cell to a cancer cell, independently of T-cell receptor specificity, costimulation, or peptide antigen presentation, a unique set of properties that have not yet been reported for any other kind of bispecific antibody construct, namely extraordinary potency and efficacy against target cells at low T-cell numbers without the need for T-cell co-stimulation (Baeuerle et aL, Cancer Res, 69(12):4941-4, 2009).
- BiTE antibodies have so far been constructed to many different target antigens, including CD19, EpCAM, Her2/neu, EGFR, CD66e (or CEA, CEACAM5), CD33, EphA2, MCSP (or HMW- MAA)(ld.), BCMA, CLDN18.2, DLL3, FLT3, MUC17, and PSMA.
- Blincyto blindatumomab
- the present disclosure provides a method for treating an infectious disease in a subject, comprising administering a therapeutically effective amount of the pharmaceutical compositions of the invention in combination with a second agent/therapy selected from the group consisting of Abacavir, Acyclovir, Adefovir, Amprenavir, Atazanavir, Cidofovir, Darunavir, Delavirdine, Didanosine, Docosanol, Efavirenz, Elvitegravir, Emtricitabine, Enfuvirtide, Etravirine, Famciclovir, and Foscarnet.
- a second agent/therapy selected from the group consisting of Abacavir, Acyclovir, Adefovir, Amprenavir, Atazanavir, Cidofovir, Darunavir, Delavirdine, Didanosine, Docosanol, Efavirenz, Elvitegravir, Emtricitabine, Enfuvirtide, Etravirine, Famc
- the anti-infective is an anti-bacterial agent including, but not limited to, cephalosporin antibiotics (cephalexin, cefuroxime, cefadroxil, cefazolin, cephalothin, cefaclor, cefamandole, cefoxitin, cefprozil, and ceftobiprole); fluoroquinolone antibiotics (cipro, Levaquin, floxin, tequin, avelox, and norflox); tetracycline antibiotics (tetracycline, minocycline, oxytetracycline, and doxycycline); penicillin antibiotics (amoxicillin, ampicillin, penicillin V, dicloxacillin, carbenicillin, vancomycin, and methicillin); monobactam antibiotics (aztreonam); and carbapenem antibiotics (ertapenem, doripenem, imipenem/cilastatin, and meropenem).
- cephalosporin antibiotics ce
- the anti-infectives include anti-malarial agents (e.g., chloroquine, quinine, mefloquine, primaquine, doxycycline, artemether/lumefantrine, atovaquone/proguanil and sulfadoxine/pyrimethamine), metronidazole, tinidazole, ivermectin, pyrantel pamoate, and albendazole.
- anti-malarial agents e.g., chloroquine, quinine, mefloquine, primaquine, doxycycline, artemether/lumefantrine, atovaquone/proguanil and sulfadoxine/pyrimethamine
- metronidazole e.g., chloroquine, quinine, mefloquine, primaquine, doxycycline, artemether/lumefantrine, atovaquone/proguanil and sulfa
- the present disclosure provides a method for treating HCV in a subject, comprising administering a therapeutically effective amount of the pharmaceutical compositions of the invention in combination with a second therapy selected from the group consisting of protease inhibitors, polymerase inhibitors, direct-acting antivirals, ribavirin and pegylated interferon.
- a second therapy selected from the group consisting of protease inhibitors, polymerase inhibitors, direct-acting antivirals, ribavirin and pegylated interferon.
- the second therapy is selected from the group consisting of: Mavyet (glecaprevir/pibrentasvir), Epclusa (sofosbuvir/velpatasvir), Vosevi (sofosbuvir/velpatasvir/voxilapresvir), Harvoni (ledipasvir/sofosbuvir), Sovaldi (sofosbuvir), and Zepatier (elbasvir/grazoprevir).
- Exemplary formulations of ribavirin include COPEGUS®, REBETOL®, and RIBASPHERE®.
- An exemplary pro-drug of ribavirin is taribavirin having the chemical name of 1-p-D-ribofuranosyl-1 ,2,4-triazole-3-carboxamidine.
- Ribavirin and taribavirin may be administered in accordance with ribavirin and taribavirin administration well known in the art.
- ribavirin or taribavirin may be administered in a total daily dose of from about 5 mg to about 1500 mg.
- the present disclosure provides a method for treating HBV in a subject, comprising administering a therapeutically effective amount of the pharmaceutical compositions of the invention in combination with a second therapy selected from the group consisting of: treatment using nucleo(t)side analogs such as Tenofovir disoproxil fumarate (TDF), Tenofovir alafenamide (TAF), Lamivudine, Adefovir dipivoxil, Entecavir (ETV), Telbivudine, AGX-1009, emtricitabine, clevudine, ritonavir, dipivoxil, lobucavir, famvir, FTC, N- Acetyl-Cysteine (NAC), PC1323, theradigm-HBV, thymosin-alpha, and ganciclovir, besifovir (ANA-380/LB-80380), and tenofovir-exaliades (TLX/CMX157); treatment using nucleo(t)side
- the combination therapy comprises administering a con- IFN-a mutant, or bifunctional con-IFN-a mutant fusion protein composition and the second therapy or second agent composition simultaneously, either in the same pharmaceutical composition or in separate pharmaceutical composition.
- a con-IFN-a mutant, or bifunctional con-IFN-a mutant fusion protein composition and the second therapy or second agent composition are administered sequentially, i.e., a con-IFN-a mutant, or bifunctional con-IFN-a mutant fusion protein composition is administered either prior to or after the administration of the second therapy or second agent composition.
- the administrations of a con-IFN-a mutant, or bifunctional con-IFN-a mutant fusion protein and the second therapy or second agent composition are concurrent, i.e., the administration period of a con-IFN-a mutant, or bifunctional con-IFN-a mutant fusion protein composition and the second therapy or second agent composition overlap with each other.
- the administrations of a con-IFN-a mutant, or bifunctional con-IFN-a mutant fusion protein composition and the second therapy or second agent composition are non-concurrent.
- the administration of a con-IFN-a mutant, or bifunctional con- IFN-a mutant fusion protein composition is terminated before the second therapy or second agent composition is administered.
- the administration of the second therapy or second agent composition is terminated before a con-IFN-a mutant, or bifunctional con-IFN-a mutant fusion protein composition is administered.
- IFN-a2b (Accession # P01563), IFN-a5 (Accession # P01569, and IFN-a6 (Accession # P05013) were obtained from the Uniprot database.
- the sequence for Consensus Human Leukocyte IFN (Con-IFN) was obtained from US Patent No. US4695623 (incorporated by reference in its entirety).
- Mutations in the IFN-a2b sequence designed to attenuate the affinity for the Type I IFN receptor (IFNAR) were described in US Patent No. 9492562 (R149A) (incorporated by reference in its entirety) and US Patent No. 9611322 (A145D and A145K) (incorporated by reference in its entirety).
- the sequence for the anti-PD-L1 mAb was obtained from PCT Patent Application PCT/US2017/068369 (incorporated by reference in its entirety).
- the sequence for the antibody heavy chain mutations to promote heterodimer formation using “knob-into-hole” were described in, e.g., Merchant et aL, Nat. BiotechnoL, 16:677-681 ,1998.
- the sequence for the antibody heavy chain mutations to promote heterodimer formation via engineered disulfide bond were described in US Patent No. 8,765,412.
- Sequences for the antibody-IFN fusion proteins were constructed by adding the IFN sequence to the C-terminus of the antibody heavy chain sequence using techniques well known and understood by one of ordinary skill in the art.
- a consensus interferon mutant molecule (SEQ ID NO: 2) was expressed as C-terminal fusion to an anti-PD-L1 antibody heavy chain (SEQ ID NO: 16) and co-expressed with an anti-PD-L1 light chain (SEQ ID NO: 15) to form an anti-PD-L1 Ab-con-IFN-a mutant fusion protein.
- the gene sequence of the target proteins were optimized for mammalian expression and synthesized.
- the target sequences were then cloned to expression vector pTT5.
- 300 mL CHO-3E7 cells were then transiently transfected and cells were cultured in shaker flasks for 5-7 days. After culture cell culture medium was harvested and fusion proteins were purified with Protein A resin. Purified proteins quality was checked with SDS-PAGE and SEC-HPLC.
- the final material was formulated in 10 mM histidine, 8% sucrose, 0.01% polysorbate 80, pH 5.5 with concentration above 1 mg/ml and stored at -80°C.
- Example 2 Determination of the IFN activity of PD-L1 Ab-IFN-a mutant fusion proteins using an interferon-a reporter assay
- An IFN-a reporter assay system that measures expression of secreted embryonic alkaline phosphatase (SEAP) under the control of an IFN-a responsive promoter was used to determine the IFN activity of the PD-L1 Ab-IFN-a mutant fusion proteins.
- SEAP secreted embryonic alkaline phosphatase
- the HEK293-based reporter cell line was found to express low levels of PD-L1 , so to assess the true non-targeted activity, REMD290 PD-L1 Ab was pre-incubated to block any PD-L1 on the cells, so the only binding was between IFN and IFNAR. To determine the targeted activity the reporter cell line was not pre-incubated with PD-L1 Ab.
- the IFN-a reporter assay protocol was as follows: (1) the IFN-a reporter cells were added to 96-well plate and then incubated with or without PD-L1 Ab for 2 hrs; (2) prediluted fusion proteins and IFN-a2b were added to the wells and then incubated overnight; (3) QUANTI-Blue solution was added to each well and then incubated for 4 hrs; and (4) Absorbance readings were taken at 655 nm.
- EC50 ratiol indicates the fold of attenuation of IFN activity compared to wild-type IFN-a2b on PD-L1 -negative cells (non- targeted cells), while EC50 ratio2 represents the fold of enhancement of IFN activity compared to wild-type IFN-a2b on PD-L1 -positive cells (targeted cells).
- Targeting index is the product of ratio 1 and ratio2, suggesting the relative level of safety window of the fusion protein.
- Tumor cell growth inhibition by IFN-a2b or the fusion proteins was measured using CellTiter 96 AQueous Non-Radioactive Cell Proliferation Assay.
- the protocol was as follows: (1) Daudi NIH tumor cells were added to 96-well plate and were incubated for 5 days in growth medium (cell control) or growth medium with the addition of pre-diluted IFN-a2b or fusion proteins. Growth medium without cells was used as background control; (2) MTS was added to each well and then incubated for 4 hrs; (3) The absorbance readings were taken at 490 nm; and (4) Percent maximum growth was calculated as follows: (sample signal-background signal)/(cell control signal-background signal)*100.
- Daudi/PD-L1 #2 and Daudi/PD-L1 #4 are transfected Daudi cell lines expressing different levels of PD-L1. As depicted in Table 8, PD-L1 expression significantly enhances fusion protein inhibitory activity on Daudi cells, and the level of enhancement is correlated with PD-L1 expression level.
- OVCAR-3 ovarian cancer cells express low levels of PD-L1 .
- the cells were treated for 5 days at 37°C/5% CO 2 with titrated concentrations of IFN-a2b, FP-07, FP-08, or left untreated.
- the cell growth inhibition was measured using CellTiter 96 AQueous NonRadioactive Cell Proliferation Assay (Promega).
- FP-07 treatment showed much less potent growth inhibition activity.
- FP-07 and FP-08 inhibit OVCAR-3 cell growth with different attenuated IFN activity (see FIG. 2).
- MHC-1 expression assay OVCAR-3 cells were incubated for 2 days in growth medium (cell control) or growth medium with the addition of samples (REMD290, IFN-oc2b or fusion proteins). MHC-I expression was determined by FACS with PE anti-human HLA-A,B,C antibody (sample MFI) or without antibody (background MFI). Fold increase was calculated as follows: (sample MFI-background MFI)/(cell control MFI-background MFI). Treatment with IFN- oc2b and FP-08 resulted in similarly increased levels of MHC-I on the cell surface and FP-07 treatment resulted in only slightly increased MHC-I expression, compared to cell control. FP-07 and FP-08 increase MHC-I expression in OVCAR-3 cells. Increased MHC-I expression can make tumor cells more immunogenic, i.e. , better recognized by CD8 + T cells (see FIG. 3).
- PD-L1 expression assay OVCAR-3 cells were incubated for 2 days in growth medium (cell control) or growth medium with addition of samples (REMD290, IFN-oc2b or fusion proteins). PD-L1 expression was determined by FACS with REMD290 (sample MFI) or without antibody (background MFI), and then by FITC goat anti-human IgG secondary antibody. Fold increase was calculated as follows: (sample MFI-background MFI)/(cell control MFI- background MFI). Treatment with FP-08 and IFN-oc2b resulted in a minor increase in PD-L1 expression while FP-07 did not increase PD-L1 expression. Increased PD-L1 levels may help enhance the targeted effect of the PD-L1 directed fusion proteins on tumor cells (see FIG. 4).
- SEQ ID NO: 1 is a wildtype consensus IFN amino acid sequence.
- SEQ ID NO: 2 is a consensus IFN (R150A) mutant amino acid sequence.
- SEQ ID NO: 3 is a consensus IFN (A146D) mutant amino acid sequence.
- SEQ ID NO: 4 is a consensus IFN (A146K) mutant amino acid sequence.
- SEQ ID NO: 5 is a consensus IFN (A146D and R150A) mutant amino acid sequence.
- SEQ ID NO: 6 is a wildtype IFN-a2b amino acid sequence.
- SEQ ID NO: 7 is an IFN-a2b (R149A) mutant amino acid sequence.
- SEQ ID NO: 8 is a wildtype IFN-a5 amino acid sequence.
- SEQ ID NO: 9 is an IFN-a5 (R150A) mutant amino acid sequence.
- SEQ ID NO: 10 is an IFN-a5 (A146D) mutant amino acid sequence.
- SEQ ID NO: 11 is a wildtype IFN-a6 amino acid sequence.
- SEQ ID NO: 12 is an IFN-a6 (R150A) mutant amino acid sequence.
- SEQ ID NO: 13 is an IFN-a6 (A146D) mutant amino acid sequence.
- SEQ ID NO: 14 is an IFN-a6 (A146K) mutant amino acid sequence.
- SEQ ID NO: 15 is the amino acid sequence encoding the light chain of an anti-PD-L1 antibody.
- SEQ ID NO: 16 is the amino acid sequence encoding the heavy chain of an anti-PD-L1 antibody.
- SEQ ID NO: 17 is the amino acid sequence encoding the heavy chain of an anti-PD-L1 antibody.
- SEQ ID NO: 18 is the amino acid sequence encoding the heavy chain of an anti-PD-L1 antibody containing the “knob”.
- SEQ ID NO: 19 is the amino acid sequence encoding the heavy chain of an anti-PD-L1 antibody containing the “hole”.
- SEQ ID NOS: 20-23 are the amino acid sequences of peptide linkers.
- SEQ ID NO: 24 is the amino acid sequence of a peptide leader sequence.
- Amino acid sequence encoding the heavy chain of an anti-PD-L1 antibody QMQLVQSGAEVKKTGSSVKVSCKASGYTFTSYSINWVRQAPGKGLEWVAYFYVGNGYTDYN
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Genetics & Genomics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- General Chemical & Material Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Oncology (AREA)
- Virology (AREA)
- Communicable Diseases (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Description
Claims
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202263347871P | 2022-06-01 | 2022-06-01 | |
| PCT/US2022/040807 WO2023023283A2 (en) | 2021-08-18 | 2022-09-12 | Novel interferon variants and bifunctional fusion molecules thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| EP4412636A2 true EP4412636A2 (en) | 2024-08-14 |
| EP4412636A4 EP4412636A4 (en) | 2025-09-17 |
Family
ID=90344842
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP22859187.1A Pending EP4412636A4 (en) | 2022-06-01 | 2022-09-12 | NEW INTERFERON VARIANTS AND BIFUNCTIONAL FUSION MOLECULES THEREOF |
Country Status (3)
| Country | Link |
|---|---|
| EP (1) | EP4412636A4 (en) |
| CN (1) | CN118201953A (en) |
| CA (1) | CA3232777A1 (en) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN118165125B (en) * | 2024-05-14 | 2024-07-26 | 北京伟杰信生物科技有限公司 | Fusion protein of recombinant porcine interferon lambda 1, porcine interferon gamma and porcine SA and application thereof |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2766582C2 (en) * | 2016-12-23 | 2022-03-15 | Ремд Биотерапьютикс, Инк. | Immunotherapy using antibodies binding programmed cell death protein ligand 1 (pd-l1) |
| JP7423511B2 (en) * | 2017-08-09 | 2024-01-29 | オリオンズ バイオサイエンス インコーポレイテッド | PD-1 and PD-L1 binding substances |
| CN108727504B (en) * | 2018-04-16 | 2021-08-27 | 泉州向日葵生物科技有限公司 | Fusion protein of IFN and anti-PD-L1 antibody and application thereof |
| JP7689079B2 (en) * | 2019-03-28 | 2025-06-05 | オリオニス バイオサイエンシズ,インコーポレイテッド | Therapeutic interferon alpha 1 protein |
-
2022
- 2022-09-12 CA CA3232777A patent/CA3232777A1/en active Pending
- 2022-09-12 CN CN202280070328.3A patent/CN118201953A/en active Pending
- 2022-09-12 EP EP22859187.1A patent/EP4412636A4/en active Pending
Also Published As
| Publication number | Publication date |
|---|---|
| CA3232777A1 (en) | 2023-02-23 |
| EP4412636A4 (en) | 2025-09-17 |
| CN118201953A (en) | 2024-06-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN114651004B (en) | New interleukin-2 variant for cancer treatment | |
| EP3150218B1 (en) | Targeted interferon demonstrates potent apoptotic and anti-tumor activities | |
| EP3227342B2 (en) | Proteinaceous heterodimer and use thereof | |
| JP2023112192A (en) | Cytokine fusion protein | |
| RU2758139C2 (en) | Il2 and mutant tnf immunoconjugates | |
| US20200392239A1 (en) | Use of a multimeric anti-dr5 binding molecule in combination with a chemotherapeutic agent for treating cancer | |
| KR20190095919A (en) | Anti-Human 4-1BB Antibody and Uses thereof | |
| AU2016274897B2 (en) | Focused interferon immunotherapy for treatment of cancer | |
| WO2020249757A1 (en) | Immunoconjugates comprising a single chain diabody and interleukin-15 or interleukin-15 and a sushi domain of interleukin-15 receptor alpha | |
| JP2024539139A (en) | Heterodimeric FC cytokines and uses thereof | |
| JP2023502091A (en) | Compositions and methods for immunotherapy | |
| CN120960400A (en) | Methods to increase lymphocyte count in tumors using IL-7 fusion protein | |
| WO2017091611A1 (en) | Enhanced cancer immunotherapy using antibody-interferon fusion molecules | |
| KR20250084992A (en) | Novel PD1-targeting IL-15 immunocytokine and non-cytokine fusions | |
| CA3232777A1 (en) | Novel interferon variants and bifunctional fusion molecules thereof | |
| US20250145680A1 (en) | Novel interferon variants and bifunctional fusion molecules thereof | |
| JP2023512456A (en) | Methods of treating tumors with a combination of IL-7 protein and bispecific antibody | |
| WO2025184154A1 (en) | Pd1-targeted novel il-2 vitokine fusions | |
| WO2017180764A1 (en) | Focused interferon immunotherapy | |
| US20240343788A1 (en) | Novel bifunctional multispecific antagonists capable of inhibiting multiple ligands of tgf-beta family and uses thereof | |
| CA3163865A1 (en) | Method of treating a tumor with a combination of il-7 protein and a bispecific antibody | |
| RU2858732C2 (en) | Bifunctional antagonists of activin/tgf-beta and rankl, and their uses | |
| US20230391880A1 (en) | Bifunctional antagonists of activin/tgf-beta and rankl and uses thereof | |
| WO2022103660A1 (en) | Bifunctional antagonists of activin/tgf-beta and rankl and uses thereof | |
| CN116801895A (en) | Novel bifunctional multispecific antagonists capable of inhibiting more than one ligand of the TGF-β family and their uses |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20240314 |
|
| AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| REG | Reference to a national code |
Ref country code: DE Ref legal event code: R079 Free format text: PREVIOUS MAIN CLASS: A61K0038210000 Ipc: C07K0014560000 |
|
| DAV | Request for validation of the european patent (deleted) | ||
| DAX | Request for extension of the european patent (deleted) | ||
| A4 | Supplementary search report drawn up and despatched |
Effective date: 20250821 |
|
| RIC1 | Information provided on ipc code assigned before grant |
Ipc: C07K 14/56 20060101AFI20250814BHEP Ipc: C07K 16/28 20060101ALI20250814BHEP Ipc: A61K 47/68 20170101ALI20250814BHEP Ipc: A61P 31/12 20060101ALI20250814BHEP Ipc: A61P 35/00 20060101ALI20250814BHEP Ipc: A61K 38/00 20060101ALN20250814BHEP Ipc: A61K 39/00 20060101ALN20250814BHEP Ipc: C07K 19/00 20060101ALN20250814BHEP |