EP4149971A2 - Sars-cov2 neutralizing single domain antibody constructs - Google Patents
Sars-cov2 neutralizing single domain antibody constructsInfo
- Publication number
- EP4149971A2 EP4149971A2 EP21804288.5A EP21804288A EP4149971A2 EP 4149971 A2 EP4149971 A2 EP 4149971A2 EP 21804288 A EP21804288 A EP 21804288A EP 4149971 A2 EP4149971 A2 EP 4149971A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- seq
- vhcdr1
- vhcdr2
- vhcdr3
- composition according
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—RNA viruses
- C07K16/102—Coronaviridae (F)
- C07K16/104—Severe acute respiratory syndrome coronavirus 2 [SARS‐CoV‐2]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/22—Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
Definitions
- SARS-COV2 NEUTRALIZING SINGLE DOMAIN ANTIBODY CONSTRUCTS
- SARS ⁇ CoV ⁇ 2 Severe acute respiratory syndrome coronavirus 2 or “SARS ⁇ CoV ⁇ 2” is a virus strain that causes coronavirus disease 2019 (COVID ⁇ 19). See, e.g., Gorbalenya AE, et al. Nature Microbiology. 5 (4): 536–544 (March 2020). Therapeutic treatments to address the global pandemic are needed.
- Figures 1A and 1B depicts the general strategy for blocking the entry of the SARS ⁇ CoV2 virus (“SC2 virus”).
- the spike protein of the SC2 virus forms a trimeric structure that binds to the extracellular domain of the ACE2 receptor on human cells at a location deemed the spike receptor binding domain (RBD).
- Figure 1A depicts a space filling model and Figure 1B uses a ribbon diagram. Figure 1B shows that by blocking the ACE2 – spike protein interaction, the SC2 virus can no longer enter the host cells.
- FIGS 2A, 2B and 2C show the validation of the correct structure for the spike trimeric antigen comprising residues extracellular domain (ECD) residues 1 ⁇ 1208, stabilizing mutations P986 and P987, a substitution for the furin cleavage site and a C ⁇ terminal trimerization motif (hereafter termed “spike ECD”).
- Figure 2A shows a model of the structure of the SC2 spike ECD binding the human ACE2 receptor, showing the location of the RBD within the spike ECD.
- the spike ECD was used to generate antigen binding domains (ABDs) in the present invention.
- FIG. 2B shows that using Cryogenic Electron Microscopy (“cryo ⁇ EM”) the correct trimeric spike protein ECD structure of the antigen was used herein.
- Figure 2C depicts the antigen validation using a spike ECD ⁇ ACE2 binding assay, showing a KD of 44 nM, a ka of 32.6 X 10 5 M ⁇ 1 s ⁇ 1 and a kd of 0.012s ⁇ 1 .
- Figure 3 depicts the binding of a candidate MASC protein, “AeroNab6”, to SC2 spike ECD, that competes for binding to that is competitive with ACE2.
- MASC protein (monomer) was displayed on the surface of yeast by fusion to a HA ⁇ epitope tagged “stalk” protein that tethers the MASC protein to the yeast cell surface.
- Yeast displaying the MASC protein were incubated for 30 minutes at room temperature with 1 nM purified spike ECD labeled with Alexa 647 fluorophore (Spike ⁇ Alexa 647) and 10 ⁇ g/mL anti ⁇ HA Alexa488 antibody (12CA5) in assay buffer (20 mM HEPES pH 8.0, 150 mM sodium chloride, and 0.1% bovine serum albumin). Yeast were subsequently washed with assay buffer to remove unbound spike ECD and amount of spike ECD binding on the yeast surface was assessed by flow cytometry.
- FIG. 4A and 4B depicts a schematic of the “up” and “down” conformations of the RBD domains of spike protein trimers.
- Figure 4A shows a cryo ⁇ EM structure of the “down” or “off” position on the left and engaged with the ACE2 receptor in the “extended” or “on” position on the right.
- the RBD must be extended in order to engage the ACE2 receptor.
- Figure 4B shows a cryo ⁇ EM structure at ⁇ 3.0 ⁇ resolution with a MASC protein monomer, AeroNab6, showing that the AeroNab6 MASC monomer binds to the “down” conformation of the Spike trimer on the left, thus preventing the binding of ACE2.
- On the right of Figure 4B is a top view of the structure, showing three AeroNab6 monomers engaged on the Spike trimer.
- FIG. 5A shows that the AeroNab6 MASC protein engages with one RBD of the trimer using CDR1 and CDR2, and a second RBD of the trimer with CDR3. This is extremely effective in locking the RBD into the “off” position with extremely high affinity, as discussed further below.
- AeroNab6 MASC makes extensive contacts within the ACE2 binding region of the SC2 spike RBD, including residues 446, 447, 449, 453, 455, 456, 483 ⁇ 486, 489 ⁇ 490, 493 ⁇ 496, 498, 501, and 505).
- the CDR3 of AeroNab6 MASC contacts a neighboring RBD on the SC2 spike at a three ⁇ dimensional epitope defined by residues 342, 343, 367, 371 ⁇ 375, 404, 436 ⁇ 441. This additional contact enables AeroNab6 MASC to locking the neighboring RBD in the “off” position, while simultaneously disrupting ACE2 binding at an adjacent RBD.
- Figure 5B shows the overlap between the binding site of the AeroNab6 MASC molecule to the Spike protein with the binding site of ACE2 to the Spike protein. This overlap explains the fact that the AeroNab6 MASC monomer still blocks ACE2 from binding to monomeric RBDs.
- Figure 6A shows the monomeric AeroNab6 binding kinetics, with a KD of 210 nM.
- Figure 6B shows the increase in binding affinity of the dimeric MASC fusion protein, and
- Figure 6C shows the further increase of a trimeric MASC fusion protein.
- FIGS 7A and 7B show affinity maturation of one MASC monomer, AeroNab6.
- Figure 7A shows mutations were made in vhhCDR1 and vhhCDR2, which binds to a first RBD, and in vhhCDR3, which binds to a second RBD of the Spike trimer.
- Figure 7B shows the binding kinectics of the parent protein, AeroNab6, and one of the affinity matured candidates, AeroNab6m, as measured by surface plasmon resonance (SPR).
- SPR surface plasmon resonance
- FIGS 8A, 8B and 8C show the increase in binding affinity of an affinity matured MASC protein candidate, AeroNab6m X 3.
- Figure 8A is the parental AeroNab6, AeroNab6m is an affinity matured protein and AeroNab6mX3 is the trimeric form, designed to bind to the trimeric Spike protein, as measured by SPR.
- the trimeric AeroNab6mX3 disassociates from the Spike protein with a half ⁇ life of at least weeks.
- FIGS 9A, 9B and 9C depicts the successful humanization of the AeroNab6 MASC protein.
- Figure 9A shows the starting kinetic parameters of the AeroNab6, with the llama framework regions shown in Figure 9B.
- the CDRs are transplanted onto a human heavy chain framework (IGHV3 ⁇ 66) as shown in Figure 9C.
- the humanized version, AeroNabh has only two amino acid substitutions in the human IGHV3 ⁇ 66 sequence as shown in Figure 17.
- the humanization substitutions do not cause significant loss of affinity for the Spike protein.
- Figure 10 depicts a pseudovirus neutralization assay, using infection of human ACE2 ⁇ expressing HEK293 cells with a lentiviral construct containing the SARS ⁇ CoV2 Spike protein.
- the trimeric MASC fusion proteins show higher neutralization than the MASC monomers. Additionally, the affinity matured MASC proteins show increased potency as well.
- Figure 11 shows a real viral neutralization assay, measuring inhibition of SARS ⁇ CoV2 infection of VeroE6 cells by the MASC test articles shown, with viral quantification after 72 hours. As shown, the trimeric MASC fusion proteins show higher neutralization than the MASC monomers. Additionally, the affinity matured MASC proteins show increased potency as well.
- Figure 13 depicts the sequences of some sdABDs in the original screening, including the CDRs and each framework, noting that FR2 in some of the original clones was also changed.
- Figure 14 depicts the full length sequences of the sdABDs of the MASC proteins corresponding to the clones in Figure 13.
- Figure 15 depicts the framework backbone and the CDR sets for a number of different MASC protein of the invention.
- Figure 16 depicts the sdABD sequences of a number of MASC monomers based on the CDRs disclosed herein.
- Figures 17A and 17B depicts some sequences of use in the invention.
- Figure 17A depicts the sequence of the spike antigen used in the generation of the data herein and Figure 17B is the sequence of the human ACE2 extracellular domain (ECD).
- the SC2 Spike ECD used for MASC protein identification used a construct encoding residues 1 ⁇ 1208 of SARS ⁇ Cov2 with proline substitutions at 986/987 and a substitution for the furin cleavage site (GSAS for residues 682 ⁇ 685).
- a C ⁇ terminal T4 fibritin trimerization motif was included, followed by a rhinovirus 3C protease cleavage site, an 8x histidine tag, and a Twin Strep Tag (as described in Wrapp et al Science 2020).
- FIG. 18 depicts some sequences of particular use in the present invention. The CDRs are each underlined, and the junctions between the sdABDs and the linkers are shown as slashes (“/”). [0020] Figure 19 depicts the significant lyophilization stability of a trimeric MASC fusion protein, AeroNab6X3.
- FIGS 20A, 20B and 20C shows the significant stability to aerosolization by a trimeric MASC fusion protein, AeroNab6X3.
- Figure 18A shows an inexpensive nebulizer that creates 3.5 ⁇ m droplets.
- Figure 21 shows the significant increase in affinity achieved in Example 2.
- Yeast displaying nanobody variants of NbCOV6 were incubated with fluorescent SARS ⁇ Cov2 Spike receptor binding domain (RBD). The amount of RBD bound to the yeast cell surface was quantified by flow cytometry. The pool of affinity matured variants titrate with increased potency compared to the parent NbCOV6, indicative of higher affinity to the receptor binding domain.
- Figure 22 shows a comparison of the SPR affinities for the original parental anti ⁇ Spike MASC proteins measured using immobilized SC2 spike ECD.
- Figure 23 shows comparison of the SPR affinities for a number of MASC proteins and fusion proteins measured using immobilized SC2 spike ECD.
- Figure 24 shows the humanization strategy for AeroNab6, showing the close similarity of the parental clone for human IGHV3 ⁇ 66 sequence.
- Figure 25 shows useful CDR sets and the framework regions of the invention.
- Figure 26 shows the sequences of two dimeric MASC constructs using the AeroNab6mh sdABD and the NbCOV003 sdABD.
- Figure 27 shows data to support Example 4.
- Figure 28 shows data to support Example 4.
- Figure 29 shows data to support Example 4.
- Figure 30 shows data to support Example 4.
- Figure 31 shows data to support Example 4.
- Figure 32 shows the Cryo ⁇ EM workflow for Nb6.
- FIG. 34 shows resolution of cryo-EM maps and models.
- FIG. 35 shows modeling of distances for multimeric nanobody design.
- N- and C-termini of both nanobodies Minimal distance between N- and C-termini of both nanobodies is 72 ⁇ . Nb6 cannot bind RBD2 in open Spike S2P , as this would sterically clash with RBD3.
- FIG. 36 shows radiolytic hydroxyl radical footprinting of Spike S2P .
- A Change in oxidation rate between Spike S2P and Nb3-Spike S2P complexes at all residues. A cluster of highly protected residues in the Spike S2P -Nb3 complex is observed in the N-terminal domain.
- B Oxidation rate plots of the two (M177, H207) most heavily protected residues upon Nb3 binding to Spike S2P .
- FIG. 37 shows multivalent Nb3 construct inhibits Spike S2P :ACE2 interaction.
- FIG. 38 shows CryoEM workflow for mNb6. Classification workflow for the Spike S2P - mNb6 complex yielding a closed Spike S2P conformation. From top to bottom, particles were template picked from two separate collections with a set of 20 ⁇ low-pass filtered 2D backprojections of apo-Spike S2P in the closed conformation. Extracted particles were Fourier cropped to 96 pixels prior to 2D classification.
- Particles in Spike S2P 2D classes were selected for a round of heterogeneous refinement in cryoSPARC using a 20 ⁇ low-pass filtered volume of apo- Spike S2P in the closed conformation and additional na ⁇ ve classes for removal of non-Spike S2P particles.
- Unbinned particles in the Spike S2P -closed conformation were exported into cisTEM for automatic refinement, followed by local refinement using a mask around the RBD::Nanobody interface.
- FIG. 39 shows mNb6 and Nb3-tri are additive for viral neutralization. Inhibition of pseudotyped lentivirus infection of ACE2 expressing HEK293T cells by mNb6 with increasing concentrations of Nb3-tri. mNb6 neutralization is additive with Nb3-tri, as demonstrated by inhibitory activity at a sub-saturating dose of Nb3-tri. However, the potency of mNb6 is unchanged by Nb3-tri, suggesting no synergistic effect on viral neutralization.
- Figure 40 shows stability of Nb6 and its derivatives.
- A Thermal denaturation of nanobodies assessed by circular dichroism measurement of molar ellipticity at 204 nm. Apparent melting temperatures (Tm) for each nanobody are indicated.
- B Nanobody inhibition of 1 nM Spike S2P ⁇ Alexa 647 binding to ACE2 expressing HEK293T cells after incubation at either 25 °C or 50 °C for 1 hour or after aerosolization.
- C Inhibition of pseudotyped lentivirus infection of ACE2 expressing HEK293T cells by mNb6 ⁇ tri after aerosolization, lyophilization, or heat treatment at 50°C for 1 hour.
- Figure 41 shows nanobody affinities and efficacies in neutralization assays.
- n 3 biological replicates for all others.
- d Nb3, Nb17, and Nb18 expresses at 41.3, 4.0, and 2.2 milligrams per liter of E.
- Figure 42 shows Cryo ⁇ electron microscopy data collection and refinement statistics.
- Figure 43 shows X ⁇ ray crystallography data collection and refinement statistics.
- Figure 45 shows nanobody expression plasmids.
- Figure 46 shows Biophysical stability of AeroNab6mhx3. AeroNab6mhx3 is resistant to thermal denaturation. Circular dichroism of AeroNabs measured over increasing temperatures shows loss of beta ⁇ sheet character at 204 nm. Melting temperatures (Tm) were calculated as loss of 50% signal.
- Figure 47 shows the structure of Spike bound to mNb6. Cryo ⁇ EM structure of mNb6 bound to Spike shows stabilization of closed Spike conformation.
- Figure 48 shows mNb6 X ⁇ Ray Structure (apo ⁇ and Spike ⁇ bound). CDR1 and CDR3 bind by an adaptive fit mechanism.
- Figure 49 shows other nanobodies from primary screen.
- Figure 50 shows AeroNab3 targets an allosteric epitope. Inhibition of SARS ⁇ CoV2 infection of VeroE6 cells by indicated dose of AeroNab constructs. Viral plaques were quantified after 72 hours. AeroNab3 targets a unique epitope on Spike to neutralize viral infection.
- Figure 51 shows the Experimental Design of a Transmission Study for Example 5.
- Figure 52 shows the Experimental Design of an Efficacy Study for Example 5.
- Figure 53 shows lung virus titers of golden Syrian hamsters after treatment with Nanoparticle A prior to cohabitation with SARS ⁇ CoV ⁇ 2 ⁇ infected animals as described in Example 5.
- Figure 54 shows oropharyngeal swab virus titers of golden Syrian hamsters after treatment with Nanoparticle A prior to cohabitation with SARS ⁇ CoV ⁇ 2 ⁇ infected animals as described in Example 5.
- Figure 55 shows lung virus titers of golden Syrian hamsters treated with Nanoparticle A and infected with SARS ⁇ CoV ⁇ 2 as described in Example 5.
- Figure 56 shows oropharyngeal swab virus titers of golden Syrian hamsters treated with Nanoparticle A and infected with SARS ⁇ CoV ⁇ 2 as described in Example 5.
- Figure 58 shows for the Transmission Study outlined in Example 5, the lung virus titers of 5 ⁇ week ⁇ old golden Syrian hamsters after challenge with SARS ⁇ CoV ⁇ 2 and treatment with Nanoparticle A prior to cohabitation with infected animals. Animals with the same shape symbols were cohabitated. Groups represented with the closed circle and closed square were infected on study day 0. Animals represented by the open circle were na ⁇ ve and placebo ⁇ treated prior to cohabitation with animals from group 1 for 4 hrs per day for 3 days. Animals represented by the open square were na ⁇ ve and Nanoparticle A ⁇ treated prior to cohabitation with animals from group 3.
- FIG. 59 shows for the Transmission Study outlined in Example 5, the lung weights of 5 ⁇ week ⁇ old golden Syrian hamsters after challenge with SARS ⁇ CoV ⁇ 2 and treatment with Nanoparticle A prior to cohabitation with infected animals. Animals with the same shape symbols were cohabitated. Groups represented with the closed circle and closed square were infected on study day 0. Animals represented by the open circle were na ⁇ ve and placebo ⁇ treated prior to cohabitation with animals from group 1 for 4 hrs per day for 3 days.
- Figure 60 shows for the Transmission Study in Example 5, oropharyngeal swab virus titers of 5 ⁇ week ⁇ old golden Syrian hamsters after challenge with SARS ⁇ CoV ⁇ 2 and treatment with Nanoparticle A prior to cohabitation with infected animals. Animals with the same shape symbols were cohabitated. Groups represented with the closed circle and closed square were infected on study day 0. Animals represented by the open circle were na ⁇ ve and placebo ⁇ treated prior to cohabitation with animals from group 1 for 4 hrs per day for 3 days.
- Figure 62 shows the lung virus titers of 5 ⁇ week ⁇ old golden Syrian hamsters after treatment with Nanoparticle A and infection with SARS ⁇ CoV ⁇ 2. Treatment with Nanoparticle A started significantly reduced lung virus titers at doses of 2 and 0.63 mg/kg/d compared to placebo ⁇ treated animals. (**P ⁇ 0.01 compared to placebo ⁇ treated animals.)
- Figure 63 shows the lung weights of 5 ⁇ week ⁇ old golden Syrian hamsters after challenge with SARS ⁇ CoV ⁇ 2 and treatment with Nanoparticle A prior to cohabitation with infected animals. Lung weights were not statistically different between groups when compared by one ⁇ way ANOVA.
- Figure 64 shows for the Efficacy Study in Example 5, oropharyngeal swab virus titers of 5 ⁇ week ⁇ old golden Syrian hamsters after treatment with Nanoparticle A and infection with SARS ⁇ CoV ⁇ 2. Treatment with Nanoparticle A at a dose of 2 mg/kg/d significantly reduced oropharyngeal swab titers of hamsters infected with SARS ⁇ CoV ⁇ 2. (*P ⁇ 0.05 compared to placebo ⁇ treated animals.) III. DETAILED DESCRIPTION OF THE INVENTION A.
- ⁇ amino acid ⁇ and ⁇ amino acid identity ⁇ as used herein is meant one of the 20 naturally occurring amino acids or any non ⁇ natural analogues that may be present at a specific, defined position.
- amino acid means one of the 20 naturally occurring amino acids.
- ⁇ protein ⁇ herein is meant at least two covalently attached amino acids, which includes proteins, polypeptides, oligopeptides and peptides.
- ⁇ amino acid modification ⁇ herein is meant an amino acid substitution, insertion, and/or deletion in a polypeptide sequence or an alteration to a moiety chemically linked to a protein.
- a modification may be an altered carbohydrate or PEG structure attached to a protein.
- the amino acid modification is always to an amino acid coded for by DNA, e.g. the 20 amino acids that have codons in DNA and RNA.
- the preferred amino acid modification herein is a substitution.
- ⁇ amino acid substitution ⁇ or ⁇ substitution ⁇ herein is meant the replacement of an amino acid at a particular position in a parent polypeptide sequence with a different amino acid.
- the substitution is to an amino acid that is not naturally occurring at the particular position, either not naturally occurring within the organism or in any organism.
- a protein which has been engineered to change the nucleic acid coding sequence but not change the starting amino acid is not an ⁇ amino acid substitution ⁇ ; that is, despite the creation of a new gene encoding the same protein, if the protein has the same amino acid at the particular position that it started with, it is not an amino acid substitution.
- ⁇ amino acid insertion ⁇ or ⁇ insertion ⁇ as used herein is meant the addition of an amino acid sequence at a particular position in a parent polypeptide sequence.
- ⁇ amino acid deletion ⁇ or ⁇ deletion ⁇ as used herein is meant the removal of an amino acid sequence at a particular position in a parent polypeptide sequence.
- the polypeptides of the invention specifically bind to the Spike trimeric protein as outlined herein. “Specific binding” or “specifically binds to” or is “specific for” a particular antigen or an epitope means binding that is measurably different from a non ⁇ specific interaction. Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule, which generally is a molecule of similar structure that does not have binding activity. For example, specific binding can be determined by competition with a control molecule that is similar to the target.
- an antigen binding domain having a KD for an antigen or epitope of at least about 10 ⁇ 4 M, at least about 10 ⁇ 5 M, at least about 10 ⁇ 6 M, at least about 10 ⁇ 7 M, at least about 10 ⁇ 8 M, at least about 10 ⁇ 9 M, alternatively at least about 10 ⁇ 10 M, at least about 10 ⁇ 11 M, at least about 10 ⁇ 12 M, at least about 10 ⁇ 13 M, at least about 10 ⁇ 14 M, at least about 10 ⁇ 15 M or greater, where KD refers to a dissociation rate of a particular ABD ⁇ antigen interaction.
- SBD antigen binding domain
- an ABD that specifically binds an antigen will have a KD that is 20 ⁇ , 50 ⁇ , 100 ⁇ , 500 ⁇ , 1000 ⁇ , 5,000 ⁇ , 10,000 ⁇ or more times greater for a control molecule relative to the antigen or epitope.
- specific binding for a particular antigen or an epitope can be exhibited, for example, by an antibody having a KA or Ka for an antigen or epitope of at least 20 ⁇ , 50 ⁇ , 100 ⁇ , 500 ⁇ , 1000 ⁇ , 5,000 ⁇ , 10,000 ⁇ or more times greater for the epitope relative to a control, where KA or Ka refers to an association rate of a particular antibody ⁇ antigen interaction.
- Binding affinity is generally measured using a Biacore assay or Octet as is known in the art.
- ⁇ parent polypeptide ⁇ or ⁇ precursor polypeptide ⁇ as used herein is meant a polypeptide that is subsequently modified to generate a variant.
- any one of the starting clones of Figure 13 can be considered a “parent polypeptide” as is the case of AeroNab6.
- Parent polypeptide may refer to the polypeptide itself, compositions that comprise the parent polypeptide, or the amino acid sequence that encodes it.
- polypeptides of the invention have at least about 90%, 91, 92, 92, 94, 95, 96, 97, 98, 99, 99.2. 99.4. 99.6. 99.8 or 100% sequence identity with a sequence set forth herein.
- ⁇ position ⁇ as used herein is meant a location in the sequence of a protein. Positions may be numbered sequentially, or according to an established format.
- variable heavy domain or “VH domain” or “VHH domain” herein is meant the region of the antigen binding domain that contains the CDRs. The molecules discussed herein do not contain VL domains.
- each VH is composed of three hypervariable regions (“complementary determining regions,” “CDRs”) and four “framework regions”, or “FRs”, arranged from amino ⁇ terminus to carboxy ⁇ terminus in the following order: FR1 ⁇ vhhCDR1 ⁇ FR2 ⁇ vhhCDR2 ⁇ FR3 ⁇ vhhCDR3 ⁇ FR4.
- the vhFR regions self ⁇ assemble to form the sdABD that are Fv domains.
- single domain Fv single domain Fv
- sdFv single domain Fv
- sdABD single domain Fv
- sdABDs are distinguished from single domain antibodies by the lack of the constant domains (in the case of camelid antibodies, the CH2 ⁇ CH3 domains).
- the hypervariable regions confer antigen binding specificity and generally encompasses amino acid residues from about amino acid residues 24 ⁇ 34 (LCDR1; “L” denotes light chain), 50 ⁇ 56 (LCDR2) and 89 ⁇ 97 (LCDR3) in the light chain variable region and around about 31 ⁇ 35B (HCDR1; “H” denotes heavy chain), 50 ⁇ 65 (HCDR2), and 95 ⁇ 102 (HCDR3) in the heavy chain variable region; Kabat et al., SEQUENCES OF PROTEINS OF IMMUNOLOGICAL INTEREST, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991) and/or those residues forming a hypervariable loop (e.g.
- the spike antigen is defined by the sequence found in Figure 17A and/or the following sequence: MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFH AIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCE FQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFK NIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGA AAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVR FPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTK
- the variants differ from the above sequence in the ACE2 binding domain of the spike protein. In some embodiments, the variants differ from the above sequence at a site other than the ACE2 binding domain. In some embodiments, the variants differ from the above sequence in at least the ACE2 binding domain and one other site. In various embodiments, the variant is different than the above sequence by at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acids. [0080] As will be appreciated by those in the art, the exact numbering and placement of the CDRs can be different among different numbering systems.
- variable heavy and/or variable light sequence includes the disclosure of the associated (inherent) CDRs. Accordingly, the disclosure of each variable heavy region is a disclosure of the vhCDRs (e.g. vhCDR1, vhCDR2 and vhCDR3).
- vhCDRs e.g. vhCDR1, vhCDR2 and vhCDR3
- IMGT numbering system is generally used when referring to a residue in the variable domain.
- the present invention provides a large number of different CDR sets which can be assembled into sdABDs.
- a CDR set is only three CDRs; these are sometimes referred to in the art as “VHH” domains as well.
- the CDRs contribute to the formation of the antigen ⁇ binding, or more specifically, epitope binding sites.
- Epitope refers to a determinant that interacts with a specific antigen binding site in the variable regions known as a paratope. Epitopes are groupings of molecules such as amino acids or sugar side chains and usually have specific structural characteristics, as well as specific charge characteristics. A single antigen may have more than one epitope.
- the epitope may comprise amino acid residues directly involved in the binding (also called immunodominant component of the epitope) and other amino acid residues, which are not directly involved in the binding, such as amino acid residues which are effectively blocked by the specific antigen binding peptide; in other words, the amino acid residue is within the footprint of the specific antigen binding peptide.
- Epitopes may be either conformational or linear. A conformational epitope is produced by spatially juxtaposed amino acids from different segments of the linear polypeptide chain. A linear epitope is one produced by adjacent amino acid residues in a polypeptide chain.
- Conformational and nonconformational epitopes may be distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
- An epitope typically includes at least 3, and more usually, at least 5 or 8 ⁇ 10 amino acids in a unique spatial conformation. Antibodies that recognize the same epitope can be verified in a simple immunoassay showing the ability of one antibody to block the binding of another antibody to a target antigen, for example “binning.” As outlined below, the invention not only includes the enumerated antigen binding domains and antibodies herein, but those that compete for binding with the epitopes bound by the enumerated antigen binding domains. B.
- coronaviruses are enveloped positive ⁇ stranded RNA viruses that relies on membrane fusion as an early step for entering host cells. Additionally, the surfaces of many coronaviruses, and SARS ⁇ CoV2 in particular, are decorated with a Spike glycoprotein.
- the Spike protein forms a homotrimeric complex of three identical Spike protein monomers that can be functionally categorized as having two distinct subunits, S1 and S2.
- the S1 subunit contains the receptor binding domain (RBD) which binds to the ACE2 receptor on human cells, while the S2 subunit is involved in the fusion of the viral and cellular membranes.
- RBD receptor binding domain
- the RBDs of the trimeric complex can be in two different conformations: an extended, or “up” conformation (sometimes also referred to herein as the “on” conformation), as depicted in Figure 4, that is accessible for binding to the ACE2 complex, and a “down” or “off” conformation, again depicted in Figure 4, which represents a receptor ⁇ inaccessible state. That is, the Spike protein cannot bind to the ACE2 receptor and infect cells when in the “down” conformation.
- the present invention is directed to antigen binding domains that not only bind to the Spike protein, but bind in such a way as to “lock” the Spike protein in the “off” or “down” position with extremely high affinity.
- the present invention provides Multivalent Anti ⁇ SARS ⁇ CoV2 (“MASC”) fusion proteins to antigen binding domains (ABDs) that bind in a multivalent way to the trimeric Spike protein of the SARS ⁇ CoV2 virus with very high affinity.
- MSC Multivalent Anti ⁇ SARS ⁇ CoV2
- the antigen binding domains are based on single domain antibodies (sdAbs) that contain a single variable heavy domain (frequently referred to in the field as “VHH” domains) instead of the typical variable heavy and variable light domains of traditional antibodies.
- the single domain antigen binding domains (sdABDs) confer a number of advantages in their use to bind to viral proteins, as they are significantly smaller than traditional ABDs, have generally high thermal stability, and increased solubility, as further discussed below. [0091] Additionally, as has been shown for other sdABDs, the sdABDs of the present invention can be assembled into multimeric structures such as dimers and trimers, similar to other “NanobodiesTM”; see generally US Patent No. 9,834,595.
- the present invention provides multivalent anti ⁇ SARS ⁇ CoV2 (“MASC”) fusion proteins that contain sdABDs linked together through domain linkers as is more fully described below that bind the Spike protein and prevent viral entry into human cells via the ACE2 receptor, as is further discussed below.
- the fusion proteins of the invention have a several different components, generally referred to herein as domains, which are linked together in a variety of ways depending on the format. Some of the domains are binding domains, that each bind to the target Spike protein, and some are domain linkers.
- the present invention provides for MASC proteins that comprise a single sdABD that binds the RBD, as well as MASC fusion proteins that contain two sdABDs linked using a domain linker (sdABD ⁇ domain linker ⁇ sdABD) and MASC fusion proteins that contain three sdABDs linked with domain linkers (sdABD ⁇ domain linker ⁇ sdABD ⁇ domain linker ⁇ sdABD). As discussed below, these domain linkers can be the same or different.
- Another distinct advantage of the MASC fusion proteins of the invention is that due to their significant thermal and structure stability, the MASC fusion proteins can be lyophilized and/or aerosolized while retaining binding and neutralization functions.
- the present invention provides MASC proteins and MASC fusion proteins as is further described herein.
- C. Multivalent Anti ⁇ SARS ⁇ CoV2 (“MASC”) Proteins [0095] Accordingly, the present invention provides MASC proteins that can take several different formats. As discussed herein, the MASC proteins can be a single sdABD as outlined herein, sometimes referred to herein as “monomeric MASC proteins”. MASC proteins can also be linked together to form dimers and trimers as discussed herein.
- the dimers and trimers are referred to generally as “MASC fusion proteins”, and there are domain linkers between the monomers.
- multimers can also be made using sdABDs with different binding affinities or properties. That is, a dimeric MASC fusion protein can be “homodimeric”, with the sdABDs having the identical CDRs and/or sequence, or “heterodimeric”, where one sdABD has one set of CDRs and the other has a different set of CDRs.
- trimeric MASC fusion proteins can be homotrimers, or they can be heterotrimers, either utilizing two different sdABDs with different CDRs (two of one and one of the other in the trimer), or heterotrimers with three different CDR sets.
- the MASC fusion proteins can also include an additional domain that serves to extend the half ⁇ life of the MASC protein in plasma.
- monomeric, dimeric or trimeric MASC proteins can be fused to a half ⁇ life extension domain.
- 21 different clones were originally made, representing a wide variety of antigen binding domains as depicted in Figure 13. All of these clones bound the spike trimer.
- any of the parental MASC proteins shown in Figure 13 can undergo affinity maturation.
- An exemplary example is the affinity maturation of AeroNab6, discussed herein.
- An affinity maturation campaign resulted in a number of changes in the vhhCDRs, all of which can be combined.
- the parental MASC proteins of Figure 13, or affinity matured MASC proteins can also be humanized. Humanization techniques are well known in the art.
- AeroNab6 MASC makes extensive contacts within the ACE2 binding region of the SC2 spike RBD, including residues 446, 447, 449, 453, 455, 456, 483 ⁇ 486, 489 ⁇ 490, 493 ⁇ 496, 498, 501, and 505).
- the CDR3 of AeroNab6 MASC contacts a neighboring RBD on the SC2 spike at a three dimensional epitope defined by residues 342, 343, 367, 371 ⁇ 375, 404, 436 ⁇ 441. This additional contact enables AeroNab6 MASC to locking the neighboring RBD in the “off” position, while simultaneously disrupting ACE2 binding at an adjacent RBD.
- the MASC protein is a single sdABD, as generally depicted in Figure 6, and thus is a composition comprising a sdABD comprising, from N ⁇ to C ⁇ terminal, FR1 ⁇ vhCDR1 ⁇ FR2 ⁇ vhCDR2 ⁇ FR3 ⁇ vhCDR3 ⁇ FR, wherein the vhhCDR1, vhhCDR2 and vhhCDR3 domains are selected from the sets depicted in Figure 13, Figure 15, Figure 18 and Figure 25.
- the said vhCDR1 has a sequence GI(I/Y/W/F/V/L)FGRNA
- said vhCDR2 has a sequence TRR(G/H/Y/G/Q)SITY
- said vhCDR3 has a sequence AADPA(S/V/L/I/T)PA(P/F/W/Y/L/V)GDY as discussed above.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4).
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:5, vhCDR2 has SEQ ID NO:6, and vhCDR3 has SEQ ID NO:7.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:8, vhCDR2 has SEQ ID NO:9, and vhCDR3 has SEQ ID NO:10.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:11, vhCDR2 has SEQ ID NO:12, and vhCDR3 has SEQ ID NO:13.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:14, vhCDR2 has SEQ ID NO:15, and vhCDR3 has SEQ ID NO:16.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:17, vhCDR2 has SEQ ID NO:18, and vhCDR3 has SEQ ID NO:19.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:20, vhCDR2 has SEQ ID NO:21, and vhCDR3 has SEQ ID NO:22.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:23, vhCDR2 has SEQ ID NO:24, and vhCDR3 has SEQ ID NO:25.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:26, vhCDR2 has SEQ ID NO:27, and vhCDR3 has SEQ ID NO:28.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:29, vhCDR2 has SEQ ID NO:30, and vhCDR3 has SEQ ID NO:31.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:32, vhCDR2 has SEQ ID NO:33, and vhCDR3 has SEQ ID NO:34.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:35, vhCDR2 has SEQ ID NO:36, and vhCDR3 has SEQ ID NO:37.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:38, vhCDR2 has SEQ ID NO:39, and vhCDR3 has SEQ ID NO:40.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:41, vhCDR2 has SEQ ID NO:42, and vhCDR3 has SEQ ID NO:43.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO44:, vhCDR2 has SEQ ID NO45:, and vhCDR3 has SEQ ID NO:46.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:47, vhCDR2 has SEQ ID NO:48, and vhCDR3 has SEQ ID NO:49.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:50, vhCDR2 has SEQ ID NO:51, and vhCDR3 has SEQ ID NO:52.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:53, vhCDR2 has SEQ ID NO:54, and vhCDR3 has SEQ ID NO:55.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:56, vhCDR2 has SEQ ID NO:57, and vhCDR3 has SEQ ID NO:58.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:59, vhCDR2 has SEQ ID NO:60, and vhCDR3 has SEQ ID NO:61.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO62 vhCDR2 has SEQ ID NO:63, and vhCDR3 has SEQ ID NO:64.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:65, vhCDR2 has SEQ ID NO:66, and vhCDR3 has SEQ ID NO:67.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:68, vhCDR2 has SEQ ID NO:69, and vhCDR3 has SEQ ID NO:70.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:71, vhCDR2 has SEQ ID NO:72, and vhCDR3 has SEQ ID NO:73.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the sdABD has a set of a three CDRs where vhCDR1 has SEQ ID NO:74, vhCDR2 has SEQ ID NO:75, and vhCDR3 has SEQ ID NO:76.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), or can be different.
- the MASC protein is “AeroNab6mh” and has the sequence EVQLVESGGGLVQPGGSLRLSCAASGYIFGRNAMGWYRQAPGKGLELVAGITRRGSITYYADSV KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAADPASPAYGDYWGQGTQVTVSS. 2.
- the MASC protein is a MASC fusion protein and contains two sdABDs, as generally depicted in Figure 6, and thus is a composition comprising a sdABD comprising, from N ⁇ to C ⁇ terminal, FR1 ⁇ vhhCDR1 ⁇ FR2 ⁇ vhhCDR2 ⁇ FR3 ⁇ vhhCDR3 ⁇ FR4 ⁇ domain linker ⁇ FR1 ⁇ vhhCDR1 ⁇ FR2 ⁇ vhhCDR2 ⁇ FR3 ⁇ vhhCDR3 ⁇ FR4, wherein the vhhCDR1, vhhCDR2 and vhhCDR3 domains are selected from the sets depicted in Figure 13, Figure 15, Figure 18 and Figure 25.
- the two sdABDs that make up the dimer are the same, and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the said vhCDR1 has a sequence GI(I/Y/W/F/V/L)FGRNA
- said vhCDR2 has a sequence TRR(G/H/Y/G/Q)SITY
- said vhCDR3 has a sequence AADPA(S/V/L/I/T)PA(P/F/W/Y/L/V)GDY as discussed above.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4) and the domain linker is (GGGGS)3.
- the said vhCDR1 has a sequence GI(I/Y/W/F/V/L)FGRNA
- said vhCDR2 has a sequence TRR(G/H/Y/G/Q)SITY
- said vhCDR3 has a sequence AADPA(S/V/L/I/T)PA(P/F/W/Y/L/V)GDY as discussed above.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4) and the domain linker is (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:5, vhCDR2 has SEQ ID NO:6, and vhCDR3 has SEQ ID NO:7.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:8, vhCDR2 has SEQ ID NO:9, and vhCDR3 has SEQ ID NO:10.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:11, vhCDR2 has SEQ ID NO:12, and vhCDR3 has SEQ ID NO:13.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:14, vhCDR2 has SEQ ID NO:15, and vhCDR3 has SEQ ID NO:16.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:17, vhCDR2 has SEQ ID NO:18, and vhCDR3 has SEQ ID NO:19.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:20, vhCDR2 has SEQ ID NO:21, and vhCDR3 has SEQ ID NO:22.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:23, vhCDR2 has SEQ ID NO:24, and vhCDR3 has SEQ ID NO:25.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:26, vhCDR2 has SEQ ID NO:27, and vhCDR3 has SEQ ID NO:28.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:29, vhCDR2 has SEQ ID NO:30, and vhCDR3 has SEQ ID NO:31.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:32, vhCDR2 has SEQ ID NO:33, and vhCDR3 has SEQ ID NO:34.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:35, vhCDR2 has SEQ ID NO:36, and vhCDR3 has SEQ ID NO:37.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:38, vhCDR2 has SEQ ID NO:39, and vhCDR3 has SEQ ID NO:40.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:41, vhCDR2 has SEQ ID NO:42, and vhCDR3 has SEQ ID NO:43.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO44:, vhCDR2 has SEQ ID NO45:, and vhCDR3 has SEQ ID NO:46.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:47, vhCDR2 has SEQ ID NO:48, and vhCDR3 has SEQ ID NO:49.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:50, vhCDR2 has SEQ ID NO:51, and vhCDR3 has SEQ ID NO:52.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:53, vhCDR2 has SEQ ID NO:54, and vhCDR3 has SEQ ID NO:55.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:56, vhCDR2 has SEQ ID NO:57, and vhCDR3 has SEQ ID NO:58.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:59, vhCDR2 has SEQ ID NO:60, and vhCDR3 has SEQ ID NO:61.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO62 vhCDR2 has SEQ ID NO:63, and vhCDR3 has SEQ ID NO:64.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:65, vhCDR2 has SEQ ID NO:66, and vhCDR3 has SEQ ID NO:67.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:68, vhCDR2 has SEQ ID NO:69, and vhCDR3 has SEQ ID NO:70.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:71, vhCDR2 has SEQ ID NO:72, and vhCDR3 has SEQ ID NO:73.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:74, vhCDR2 has SEQ ID NO:75, and vhCDR3 has SEQ ID NO:76.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the MASC protein is “AeroNab6mhX2” and has the sequence: EVQLVESGGGLVQPGGSLRLSCAASGYIFGRNAMGWYRQAPGKGLELVAGITRRGSITYYADSV KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAADPASPAYGDYWGQGTQVTVSS/GGGGSGG GGSGGGGS/EVQLVESGGGLVQPGGSLRLSCAASGYIFGRNAMGWYRQAPGKGLELVAGITRRG SITYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAADPASPAYGDYWGQGTQVTVSS [00158] In a particularly useful embodiment, the MASC protein is “AeroNab6mhX2” and has the sequence: EVQLVESGGGLVQPGGSLRLSCAASGYIFGRNAMGWYRQAPGKGLELVAGITRRGSITYYADSV KGRFTISRDNSKNTLYL
- one of the sdABDs is “AeroNab6mh” and the other has the CDRs of NbCoV003, SEQ ID NO:21, SEQ ID NO:22 and SEQ ID NO:23; see Figure 26. 3.
- the MASC protein is a MASC fusion protein and contains three sdABDs, as generally depicted in Figure 6,, and thus is a composition comprising a sdABD comprising, from N ⁇ to C ⁇ terminal, FR1 ⁇ vhhCDR1 ⁇ FR2 ⁇ vhhCDR2 ⁇ FR3 ⁇ vhhCDR3 ⁇ FR4 ⁇ domain linker ⁇ FR1 ⁇ vhhCDR1 ⁇ FR2 ⁇ vhhCDR2 ⁇ FR3 ⁇ vhhCDR3 ⁇ FR4, wherein the vhhCDR1, vhhCDR2 and vhhCDR3 domains are selected from the sets depicted in Figure 13, Figure 15, Figure 18 and Figure 25.
- the three sdABDs that make up the trimer are the same, and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the said vhCDR1 has a sequence GI(I/Y/W/F/V/L)FGRNA
- said vhCDR2 has a sequence TRR(G/H/Y/G/Q)SITY
- said vhCDR3 has a sequence AADPA(S/V/L/I/T)PA(P/F/W/Y/L/V)GDY as discussed above.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4) and the domain linker is (GGGGS)3.
- the said vhCDR1 has a sequence GI(I/Y/W/F/V/L)FGRNA
- said vhCDR2 has a sequence TRR(G/H/Y/G/Q)SITY
- said vhCDR3 has a sequence AADPA(S/V/L/I/T)PA(P/F/W/Y/L/V)GDY as discussed above.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4) and the domain linker is (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:5, vhCDR2 has SEQ ID NO:6, and vhCDR3 has SEQ ID NO:7.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:8, vhCDR2 has SEQ ID NO:9, and vhCDR3 has SEQ ID NO:10.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:11, vhCDR2 has SEQ ID NO:12, and vhCDR3 has SEQ ID NO:13.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:14, vhCDR2 has SEQ ID NO:15, and vhCDR3 has SEQ ID NO:16.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:17, vhCDR2 has SEQ ID NO:18, and vhCDR3 has SEQ ID NO:19.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:20, vhCDR2 has SEQ ID NO:21, and vhCDR3 has SEQ ID NO:22.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:23, vhCDR2 has SEQ ID NO:24, and vhCDR3 has SEQ ID NO:25.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:26, vhCDR2 has SEQ ID NO:27, and vhCDR3 has SEQ ID NO:28.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:29, vhCDR2 has SEQ ID NO:30, and vhCDR3 has SEQ ID NO:31.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:32, vhCDR2 has SEQ ID NO:33, and vhCDR3 has SEQ ID NO:34.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:35, vhCDR2 has SEQ ID NO:36, and vhCDR3 has SEQ ID NO:37.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:38, vhCDR2 has SEQ ID NO:39, and vhCDR3 has SEQ ID NO:40.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:41, vhCDR2 has SEQ ID NO:42, and vhCDR3 has SEQ ID NO:43.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO44:, vhCDR2 has SEQ ID NO45:, and vhCDR3 has SEQ ID NO:46.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:47, vhCDR2 has SEQ ID NO:48, and vhCDR3 has SEQ ID NO:49.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:50, vhCDR2 has SEQ ID NO:51, and vhCDR3 has SEQ ID NO:52.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:53, vhCDR2 has SEQ ID NO:54, and vhCDR3 has SEQ ID NO:55.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:56, vhCDR2 has SEQ ID NO:57, and vhCDR3 has SEQ ID NO:58.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:59, vhCDR2 has SEQ ID NO:60, and vhCDR3 has SEQ ID NO:61.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO62 vhCDR2 has SEQ ID NO:63, and vhCDR3 has SEQ ID NO:64.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:65, vhCDR2 has SEQ ID NO:66, and vhCDR3 has SEQ ID NO:67.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:68, vhCDR2 has SEQ ID NO:69, and vhCDR3 has SEQ ID NO:70.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:71, vhCDR2 has SEQ ID NO:72, and vhCDR3 has SEQ ID NO:73.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the two sdABDs each have a set of three CDRs where vhCDR1 has SEQ ID NO:74, vhCDR2 has SEQ ID NO:75, and vhCDR3 has SEQ ID NO:76.
- the framework regions can have SEQ ID NO:1 (FR1), SEQ ID NO:2 (FR2), SEQ ID NO:3 (FR3) and SEQ ID NO:4 (FR4), and the domain linker is selected from (GGGGS)3 and (GGGGS)4.
- the MASC protein is “AeroNab6mhX3” and has the sequence: [00189] [00190] In a particularly useful embodiment, the MASC protein is “AeroNab6mhX3” and has the sequence: [00191] [00192] In some embodiments, the two sdABDs that make up the dimer are different.
- one of the sdABDs is “AeroNab6mh” and the other has the CDRs of NbCoV003, SEQ ID NO:21, SEQ ID NO:22 and SEQ ID NO:23.
- Domain Linkers [00193] In embodiments utilizing multimeric MASC proteins, the monomers are linked recombinantly using “domain linkers”.
- a linker can be used, many embodiments utilize a glycine-serine polymer, including for example (GS)n, (GSGGS)n, (GGGGS)n, and (GGGS)n, where n is an integer of at least one (and generally from 3 to 4 to 5) as well as any peptide sequence that allows for recombinant attachment of the two domains with sufficient length and flexibility to allow each domain to retain its biological function.
- the distance between the N- and C- termini of individual AeroNab6 monomers bound to spike ECD in the “down” state is 51 ⁇ . This requires >15 amino acids to bridge individual subunits to simultaneously engage multiple RBD monomers.
- the MASC proteins optionally include half ⁇ life extension domains, that allow for increased half ⁇ life in physiological environments such as plasma and lung tissue.
- Such domains are contemplated to include, but are not limited to, HSA binding domains, either scFvs or sdABDs, as well as all or part of human serum albumin, as discussed below.
- HSA Human serum albumin
- Molecular mass ⁇ 67 kDa is the most abundant protein in plasma, present at about 50 mg/ml (600 uM), and has a half ⁇ life of around 20 days in humans.
- HSA serves to maintain plasma pH, contributes to colloidal blood pressure, functions as carrier of many metabolites and fatty acids, and serves as a major drug transport protein in plasma.
- Noncovalent association with albumin extends the elimination half ⁇ time of short lived proteins.
- a recombinant fusion of an albumin binding domain to a Fab fragment resulted in a reduced in vivo clearance of 25 ⁇ and 58 ⁇ fold and a half ⁇ life extension of 26 ⁇ and 37 ⁇ fold when administered intravenously to mice and rabbits respectively as compared to the administration of the Fab fragment alone.
- insulin is acylated with fatty acids to promote association with albumin
- a protracted effect was observed when injected subcutaneously in rabbits or pigs.
- the antigen ⁇ binding proteins described herein comprise a half ⁇ life extension domain, for example a domain which specifically binds to HSA, that is attached either N ⁇ or C ⁇ terminal to the MASC protein.
- the half ⁇ life extension domain is a single domain antigen binding domain from a single domain antibody that binds to HSA. This domain is generally referred to herein as “sdABD” to human HSA (sdABD ⁇ HSA), or alternatively “sdABD(1 ⁇ 2)”, to distinguish these binding domains from the sdABDs to the spike protein.
- Suitable sdABD ⁇ HSA domains are well known in the art, see for example USP 8,703,131, the sequences of all sdABD ⁇ HSA domains therein (“ALB”, including specifically ALB1, ALB3, ALB4, ALB5, ALB6, ALB7, ALB8, ALB9 and ALB10) are expressly incorporated by reference.
- ALB sdABD ⁇ HSA domains therein
- USP 10,100,106 contains additional single domain albumin binding domains, the sequences of which are also specifically incorporated by reference herein, including SEQ ID NOs:4, 7, 9, 26 and 27.
- Another suitable half ⁇ life domain that can be fused to the MASC proteins is all or part of human HSA itself, again, either N ⁇ or C ⁇ terminal.
- HSA is a relatively small protein, roughly 65 amino acids long, and can be fused to one or more of the monomeric MASC proteins as will be appreciated by those in the art.
- the half ⁇ life extension domain of an antigen binding protein provides for altered pharmacodynamics and pharmacokinetics of the MASC proteins. As above, the half ⁇ life extension domain extends the elimination half ⁇ time. The half ⁇ life extension domain also alters pharmacodynamic properties including alteration of tissue distribution, penetration, and diffusion of the antigen ⁇ binding protein.
- D. Method of Making MASC Proteins [00200] The MASC proteins and fusion proteins of the invention are made as will generally be appreciated by those in the art and outlined below.
- the invention provides nucleic acid compositions that encode the MASC compositions of the invention.
- the nucleic acids encoding the compositions of the invention can be incorporated into expression vectors as is known in the art, and depending on the host cells used to produce the MASC proteins of the invention.
- the nucleic acids are operably linked to any number of regulatory elements (promoters, origin of replication, selectable markers, ribosomal binding sites, inducers, etc.).
- the expression vectors can be extra ⁇ chromosomal or integrating vectors.
- the nucleic acids and/or expression vectors of the invention are then transformed into any number of different types of host cells as is well known in the art, including mammalian, bacterial, yeast, insect and/or fungal cells, with mammalian cells (e.g. CHO cells, 293 cells), finding use in many embodiments.
- mammalian cells e.g. CHO cells, 293 cells
- the MASC proteins, including MASC fusion proteins, of the invention are made by culturing host cells comprising the expression vector(s) as is well known in the art under conditions that result in the expression of the proteins, followed by purification. E.
- Formulations of the MASC proteins used in accordance with the present invention are prepared for storage by mixing the proteins having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (as generally outlined in Remington’s Pharmaceutical Sciences 16th edition, Osol, A. Ed. [1980]), in the form of lyophilized formulations or aqueous solutions.
- F. Administration of the MASC Proteins [00205] The compositions of the invention comprising MASC proteins and MASC fusion proteins that are administered to a patient to prevent, treat or neutralize the SC2 virus or SC2 viral infection in a patient.
- the MASC proteins are administered to a patient’s pulmonary system, including the lungs.
- the invention provides for the delivery of the MASC proteins (including MASC fusion proteins) of the invention to the respiratory tract.
- MASC proteins of the invention are extremely stable and thus can be lyophilized, as is known in the art.
- the lyophilized proteins can then be reconstituted at a later date into a liquid formulation and then aerosolized through nebulization for direct delivery to the patient’s pulmonary system. See for example U.S. Patent Nos. 9,393,304 which describes a number of lyophilization techniques, conditions and formulations for NanobodiesTM that are for inhalation therapy.
- the formulations can be administered using nebulizers.
- nebulizers include, in non ⁇ limiting examples, jet nebulizers, ultrasonic nebulizers, and vibrating mesh nebulizers. These classes use different methods to create an aerosol from a liquid. In general, any aerosol ⁇ generating device that can maintain the integrity of the protein in these formulations is suitable for delivery of formulations as described herein.
- a vibrating ⁇ mesh nebulizers is used. Vibrating ⁇ mesh nebulizers are divided into passively and actively vibrating ⁇ mesh devices (Newman 2005, J. Appl. Ther. Res. 5: 29 ⁇ 33).
- Passively vibrating ⁇ mesh devices e.g. Omron MICROAIR.RTM. NE ⁇ U22 nebulizer
- Passively vibrating ⁇ mesh devices employ a perforated plate having up to 6000 micron sized holes.
- a vibrating piezo ⁇ electric crystal attached to a transducer horn induces ⁇ passive ⁇ vibrations in the perforated plate positioned in front of it, resulting in extrusion of fluid through the holes and generation of the aerosol.
- Actively vibrating ⁇ mesh devices e.g. AERONEB.RTM. Pro nebulizer
- vibrating ⁇ mesh nebulizers include the Akita2 Apixneb (Activaero, now Vectura, Germany), EFLOW.RTM. (PARI GmbH, Grafelingen, Germany; see also U.S. Pat. No. 5,586,550), AERONEB.RTM. (Aerogen, Inc., Sunnyvale, Calif.; see also U.S. Pat. Nos.
- a continuous flow nebuliser is used, particularly in cases where COVID19 patients may require oxygen as well, so continuous flow can be used to maintain a continuous oxygen or air supply to the patient.
- the nebulizer can be used with or without additional air or O2 flow.
- the nebulizer is used with additional air or O2 flow, such as a flow of 2 L/min additional air or O2.
- An exemplary inhalation device for delivering the polypeptide of the invention to a patient may comprises (a) an aerosol generator with a vibratable mesh; (b) a reservoir for a liquid to be nebulised, said reservoir being in fluid connection with the vibratable mesh; (c) a gas inlet opening; (d) a face mask, having a casing, an aerosol inlet opening, a patient contacting surface, and a one ⁇ way exhalation valve or a two ⁇ way inhalation/exhalation valve in the casing having an exhalation resistance selected in the range from 0.5 to 5 mbar; and (e) a flow channel extending from the gas inlet opening to the aerosol inlet opening of the face mask, the flow channel having a lateral opening through which the aerosol generator is at least partially inserted into the flow channel, and a constant flow resistance between the gas inlet opening and the aerosol inlet opening of the face mask at a flow rate of 1 to 20 L/min.
- the present invention also relates to a pharmaceutical device suitable for the delivery by inhalation of the MASC proteins of the invention and suitable in the use of a composition comprising the same.
- the present invention accordingly, relates to such a device comprising the MASC proteins of the invention at the selected dose.
- Various inhalation systems are e.g. described on pages 129 to 148 in the review ( ⁇ Pulmonary Drug Delivery ⁇ , Bechtold ⁇ Peters and Luessen, eds., supra).
- the device is an inhaler for liquids (e.g.
- the aerosol delivery system used in the method of the invention may comprise a container comprising the composition of the invention and an aerosol generator connected to it.
- the aerosol generator is constructed and arranged to generate an aerosol of the composition of the invention.
- the MASC proteins are administered via nasal administration as a nasal spray.
- nasal administration There are a wide variety of delivery systems for intranasal administration of the MASC proteins, ranging from simple drops or sprays to unit dosing systems for liquids; see for example Marx et al., Intranasal Drug Administration – An Attractive Delivery Route for Some Drugs; DOI: 10.5772/59468.
- the MASC proteins can be lyophilized and then reconstituted for nasal administration or administered directly as a liquid with lyophilization. 3.
- Intravenous Administration [00219] Additionally, as will be appreciated by those in the art, the MASC proteins of the invention can also be administered intraveneously. G.
- one or more MASC proteins as described herein can be used to detect SARS ⁇ CoV2 in a biological or non ⁇ biological sample.
- MASC proteins reagents can be used in assays to detect the presence or absence of, or protein expression levels, for SARS ⁇ CoV2 using any of a number of immunoassays known to those skilled in the art. Immunoassay techniques and protocols are generally described in Price and Newman, ⁇ Principles and Practice of Immunoassay, ⁇ 2nd Edition, Grove ⁇ s Dictionaries, 1997; and Gosling, “Immunoassays: A Practical Approach,” Oxford University Press, 2000.
- immunoassay encompasses techniques including, without limitation, enzyme immunoassays (EIA) such as enzyme multiplied immunoassay technique (EMIT), enzyme ⁇ linked immunosorbent assay (ELISA), IgM antibody capture ELISA (MAC ELISA), and microparticle enzyme immunoassay (MEIA); capillary electrophoresis immunoassays (CEIA); radioimmunoassays (RIA); immunoradiometric assays (IRMA); fluorescence polarization immunoassays (FPIA); and chemiluminescence assays (CL).
- EIA enzyme multiplied immunoassay technique
- ELISA enzyme ⁇ linked immunosorbent assay
- MAC ELISA IgM antibody capture ELISA
- MEIA microparticle enzyme immunoassay
- CEIA capillary electrophoresis immunoassays
- RIA radioimmunoassays
- IRMA immunoradiometric assays
- FPIA fluor
- Immunoassays can be automated. Immunoassays can also be used in conjunction with laser induced fluorescence. See, e.g., Schmalzing et al., Electrophoresis, 18:2184 ⁇ 93 (1997); Bao, J. Chromatogr. B. Biomed. Sci., 699:463 ⁇ 80 (1997).
- Liposome immunoassays such as flow ⁇ injection liposome immunoassays and liposome immunosensors, are also suitable for use in the present invention. See, e.g., Rongen et al., J. Immunol. Methods, 204:105 ⁇ 133 (1997).
- nephelometry assays in which the formation of protein/antibody complexes results in increased light scatter that is converted to a peak rate signal as a function of the protein concentration, are suitable for use in the methods of the present invention.
- Nephelometry assays are commercially available from Beckman Coulter (Brea, CA; Kit #449430) and can be performed using a Behring Nephelometer Analyzer (Fink et al., J. Clin. Chem. Clin. Biochem., 27:261 ⁇ 276 (1989)).
- Behring Nephelometer Analyzer Feink et al., J. Clin. Chem. Clin. Biochem., 27:261 ⁇ 276 (1989)
- Direct labels include fluorescent or luminescent tags, metals, dyes, radionuclides, and the like, attached to the antibody.
- a MASC protein labeled with iodine ⁇ 125 (125I) can be used.
- a chemiluminescence assay using a chemiluminescent antibody specific for the nucleic acid is suitable for sensitive, non ⁇ radioactive detection of protein levels.
- a MASC proteins labeled with fluorochrome is also suitable. Examples of fluorochromes include, without limitation, DAPI, fluorescein, Hoechst 33258, R ⁇ phycocyanin, B ⁇ phycoerythrin, R ⁇ phycoerythrin, rhodamine, Texas red, and lissamine.
- Indirect labels include various enzymes well known in the art, such as horseradish peroxidase (HRP), alkaline phosphatase (AP), ⁇ galactosidase, urease, and the like.
- HRP horseradish peroxidase
- AP alkaline phosphatase
- ⁇ galactosidase urease, and the like.
- a horseradish ⁇ peroxidase detection system can be used, for example, with the chromogenic substrate tetramethylbenzidine (TMB), which yields a soluble product in the presence of hydrogen peroxide that is detectable at 450 nm.
- TMB tetramethylbenzidine
- An alkaline phosphatase detection system can be used with the chromogenic substrate p ⁇ nitrophenyl phosphate, for example, which yields a soluble product readily detectable at 405 nm.
- a ⁇ galactosidase detection system can be used with the chromogenic substrate o ⁇ nitrophenyl ⁇ D ⁇ galactopyranoside (ONPG), which yields a soluble product detectable at 410 nm.
- An urease detection system can be used with a substrate such as urea ⁇ bromocresol purple (Sigma Immunochemicals; St. Louis, MO).
- a signal from the direct or indirect label can be analyzed, for example, using a spectrophotometer to detect color from a chromogenic substrate; a radiation counter to detect radiation such as a gamma counter for detection of 125I; or a fluorometer to detect fluorescence in the presence of light of a certain wavelength.
- the MASC proteins can be immobilized onto a variety of solid supports, such as magnetic or chromatographic matrix particles, the surface of an assay plate (e.g., microtiter wells), pieces of a solid substrate material or membrane (e.g., plastic, nylon, paper), in the physical form of sticks, sponges, papers, wells, and the like.
- solid supports such as magnetic or chromatographic matrix particles, the surface of an assay plate (e.g., microtiter wells), pieces of a solid substrate material or membrane (e.g., plastic, nylon, paper), in the physical form of sticks, sponges, papers, wells, and the like.
- An assay strip can be prepared by coating the antibody or a plurality of antibodies in an array on a solid support. This strip can then be dipped into the test sample and processed quickly through washes and detection steps to generate a measurable signal, such as a colored spot.
- a measurable signal such as a colored spot.
- Compet means that a first ABD, or an antigen ⁇ binding portion thereof, competes for binding with a second ABD, or an antigen ⁇ binding portion thereof, where binding of the first ABD with its cognate epitope is detectably decreased in the presence of the second ABD compared to the binding of the first ABD in the absence of the ABD antibody.
- the alternative, where the binding of the second ABD to its epitope is also detectably decreased in the presence of the first ABD can, but need not be the case. That is, a first ABD can inhibit the binding of a second ABD to its epitope without that second ABD inhibiting the binding of the first ABD to its respective epitope.
- each ABD detectably inhibits the binding of the other ABD with its cognate epitope or ligand, whether to the same, greater, or lesser extent, the ABDs are said to “cross ⁇ compete” with each other for binding of their respective epitope(s).
- Both competing and cross ⁇ competing ABD are encompassed by the present invention. Regardless of the mechanism by which such competition or cross ⁇ competition occurs (e.g., steric hindrance, conformational change, or binding to a common epitope, or portion thereof, and the like), the skilled artisan would appreciate, based upon the teachings provided herein, that such competing and/or cross ⁇ competing ABDs are encompassed and can be useful for the methods disclosed herein.
- RIA solid phase direct or indirect radioimmunoassay
- EIA solid phase direct or indirect enzyme immunoassay
- sandwich competition assay see Stahli et al., Methods in Enzymology 9:242 ⁇ 253 (1983)
- solid phase direct biotin ⁇ avidin EIA see Kirkland et al., J. Immunol. 137:3614 ⁇ 3619 (1986)
- solid phase direct labeled assay solid phase direct labeled sandwich assay (see Harlow and Lane, Antibodies, A Laboratory Manual, Cold Spring Harbor Press (1988)); solid phase direct label RIA using I ⁇ 125 label (see Morel et al., Molec.
- Antibodies identified by competition assay include antibodies binding to the same epitope as the reference antibody and antibodies binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antibody for steric hindrance to occur. Usually, when a competing antibody is present in excess, it will inhibit specific binding of a reference antibody to a common antigen by at least 50 or 75%.
- Competitive binding assays can be used to identify antibodies that compete with an antibody described herein for specific binding to the SARS ⁇ CoV2 virus. Any of a number of competitive binding assays known in the art can be used to measure competition between two antibodies to the same antigen. Briefly, the ability of different antibodies to inhibit the binding of another antibody is tested.
- antibodies can be differentiated by the epitope to which they bind using a sandwich ELISA assay. This is carried out by using a capture antibody to coat the surface of a well. A subsaturating concentration of tagged ⁇ antigen is then added to the capture surface. This protein will be bound to the antibody through a specific antibody:epitope interaction. After washing a second antibody, which has been covalently linked to a detectable moiety (e.g., HRP, with the labeled antibody being defined as the detection antibody) is added to the ELISA. If this antibody recognizes the same epitope as the capture antibody it will be unable to bind to the target protein as that particular epitope will no longer be available for binding.
- a sandwich ELISA assay This is carried out by using a capture antibody to coat the surface of a well. A subsaturating concentration of tagged ⁇ antigen is then added to the capture surface. This protein will be bound to the antibody through a specific antibody:epitope interaction. After washing a second antibody, which has been
- this second antibody recognizes a different epitope on the target protein it will be able to bind and this binding can be detected by quantifying the level of activity (and hence antibody bound) using a relevant substrate.
- the background is defined by using a single antibody as both capture and detection antibody, whereas the maximal signal can be established by capturing with an antigen specific antibody and detecting with an antibody to the tag on the antigen.
- antibodies can be assessed in a pair ⁇ wise manner to determine epitope specificity.
- a first antibody is considered to competitively inhibit binding of a second antibody, if binding of the second antibody to the antigen is reduced by at least 30%, usually at least about 40%, 50%, 60% or 75%, and often by at least about 90%, in the presence of the first antibody using any of the assays described above.
- the original clone was pNbCOV006A, with the sequence as follows (CDRs underlined): (a) Affinity maturation process: [00232] A saturation mutagenesis library of the original clone was generated by degenerate oligonucleotides encoding all 20 amino acids at each position within CDR1, CDR2, and CDR3. This library of variants was displayed on the surface of yeast. High affinity clones were progressively selected with stringent criteria, i.e. decreasing concentrations of the SARS ⁇ Cov2 Spike protein receptor binding domain (RBD). After two rounds of selection, a pool of yeast displaying nanobody variants showed higher affinity binding to the Spike RBD compared to the parent nanobody as outlined in the FIG. 2.
- mNbCOV6 is significantly more potent than the parent clone NbCOV6.
- HEK293 cells expressing the angiotensin converting enzyme 2 (ACE2) receptor were incubated with 1 nM purified, stabilized SARS ⁇ CoV2 Spike ectodomain fluorescently conjugated with an Alexa 647 dye in the presence of increasing concentrations of either the parent nanobody (NbCOV6) or the affinity matured nanobody (mNbCOV6).
- NbCOV6 inhibited Spike ectodomain binding with an EC50 of 359 nM while the affinity matured nanobody (mNbCOV6) has an EC50 of 0.056 nM.
- the same assay was repeated with fluorescently labeled SARS ⁇ CoV2 Spike receptor binding domain (RBD).
- the parent NbCOV6 inhibited RBD binding with an EC50 of 190 nM while the affinity mNbCOV6 inhibited with an EC50 of 1.5 nM.
- Example 4 An ultra-potent synthetic nanobody neutralizes SARS-CoV-2 by stabilizing inactive Spike [00249]
- the SARS ⁇ CoV ⁇ 2 virus enters host cells via an interaction between its Spike protein and the host cell receptor angiotensin converting enzyme 2 (ACE2).
- ACE2 angiotensin converting enzyme 2
- Cryogenic electron microscopy revealed that one nanobody, Nb6, binds Spike in a fully inactive conformation with its receptor binding domains (RBDs) locked into their inaccessible down ⁇ state, incapable of binding ACE2.
- RBDs receptor binding domains
- Affinity maturation and structure ⁇ guided design of multivalency yielded a trivalent nanobody, mNb6 ⁇ tri, with femtomolar affinity for Spike and picomolar neutralization of SARS ⁇ CoV ⁇ 2 infection.
- mNb6 ⁇ tri retains function after aerosolization, lyophilization, and heat treatment, which enables aerosol ⁇ mediated delivery of this potent neutralizer directly to the airway epithelia.
- Single domain antibodies were isolated that neutralize SARS ⁇ CoV ⁇ 2 by screening a yeast surface ⁇ displayed library of >2x10 9 synthetic nanobody sequences for binders to the Spike ectodomain (17).
- a mutant form of SARS ⁇ CoV ⁇ 2 Spike (Spike S2P ) was used as the antigen (15).
- Spike S2P lacks one of the two proteolytic cleavage sites between the S1 and S2 domains and introduces two mutations and a trimerization domain to stabilize the pre ⁇ fusion conformation.
- Spike S2P was labeled with biotin or with fluorescent dyes and selected nanobody ⁇ displaying yeast over multiple rounds, first by magnetic bead binding and then by fluorescence ⁇ activated cell sorting (Fig.27A).
- Fig.27A Fluorescence ⁇ activated cell sorting
- Three rounds of selection yielded 21 unique nanobodies that bound Spike S2P and showed decreased binding in the presence of a dimeric construct of the ACE2 extracellular domain (ACE2 ⁇ Fc). These nanobodies fall into two classes. Class I binds the RBD and competes directly with ACE2 ⁇ Fc (Fig.27B).
- a prototypical example of this class is nanobody Nb6, which binds to Spike S2P and to RBD alone with a KD of 210nM and 41nM, respectively (Fig.27C; Figure 42).
- Fig.27B In the presence of excess ACE2 ⁇ Fc, binding of Nb6 and other Class I nanobodies is blocked entirely, whereas binding of Nb3 and other Class II nanobodies is moderately decreased (Fig.27B).
- Class II nanobodies showed little to no activity in this assay.
- Two Class I nanobodies were prioritized, Nb6 and Nb11, that combine potent Spike S2P binding with relatively small differences in Ka between binding to Spike S2P or RBD.
- Nb3 For Class II nanobodies, we prioritized Nb3 because of its relative yield during purification ( Figure 42).
- the cryogenic electron microscopy (cryo ⁇ EM) structures bound to Spike S2P were determined (Fig.28A ⁇ B; Fig.27 ⁇ 29; Figure 44). Both nanobodies recognize RBD epitopes that overlap the ACE2 binding site (Fig.28E).
- Nb6 and Nb11 we resolved nanobody binding to both the open and closed conformations of Spike S2P .
- a 3.0 ⁇ map of Nb6 bound to closed Spike S2P which enabled modeling of the Nb6 ⁇ Spike S2P complex (Fig.28A), including the complementarity determining regions (CDRs).
- CDRs complementarity determining regions
- Nb6 bound to open Spike S2P 3.8 ⁇
- Nb11 bound to open and closed Spike S2P 4.2 ⁇ , and 3.7 ⁇ , respectively.
- Nb6 bound to closed Spike S2P straddles the interface between two adjacent RBDs.
- Nb6 bound to closed Spike S2P enabled us to engineer bivalent and trivalent nanobodies predicted to lock all RBDs in the down ⁇ state.
- the relatively similar Kd for the fast phase suggests that a fraction of the observed binding for the multivalent constructs is nanobody binding to a single Spike S2P RBD.
- the slow dissociation phase of Nb6 ⁇ bi and Nb6 ⁇ tri indicates engagement of two or three RBDs.
- This measurement remains an upper boundary estimate because the measurement is limited by the intrinsic dissociation rate of Spike S2P from the SPR chip imposed by the chemistry used to immobilize Spike S2P . The true dissociation rate, therefore, may be significantly lower.
- Biphasic dissociation could be explained by a slow interconversion between up ⁇ and down ⁇ state RBDs, with conversion to the more stable down ⁇ state required for multivalent binding: a single domain of Nb6 ⁇ tri engaged with an up ⁇ state RBD would dissociate rapidly. The system would then re ⁇ equilibrate as the RBD flips into the down ⁇ state, eventually allowing Nb6 ⁇ tri to trap all RBDs in closed Spike S2P . To test this directly, the association time was varied for Nb6 ⁇ tri binding to Spike S2P .
- apo ⁇ or Nb3 ⁇ bound Spike S2P were exposed to synchrotron X ⁇ ray radiation to label solvent ⁇ exposed amino acids with hydroxyl radicals, which was subsequently quantified by mass spectrometry of protease digested Spike S2P (18).
- Two neighboring surface residues on the S1 N ⁇ terminal domain of Spike (M177 and H207) were protected in the presence of Nb3 at a level consistent with prior observations of antibody ⁇ antigen interactions by hydroxyl radical footprinting (fig.37)(19).
- coronavirus neutralizing antibodies bind an epitope within the N ⁇ terminal domain of Spike with Fab fragments that are non ⁇ competitive with the host cell receptor (20, 21).
- Nb3 can bind Spike S2P simultaneously with monovalent ACE2 (Fig.38). It was hypothesized that multivalent display of Nb3 on the surface of yeast may account for the partial decrease in Spike S2P binding observed in the presence of ACE2 ⁇ Fc. Indeed, a trivalent construct of Nb3 with 15 amino acid linkers (Nb3 ⁇ tri) inhibited Spike S2P binding to ACE2 cells with an IC50 of 41nM (Fig. 38). How Nb3 ⁇ tri disrupts Spike ⁇ ACE2 interactions remains unclear.
- Nb6 and Nb11 monovalent and trivalent versions of our top Class I (Nb6 and Nb11) and Class II (Nb3) nanobodies was tested against SARS ⁇ CoV ⁇ 2 pseudotyped lentivirus using a previously described assay (22).
- Nb6 and Nb11 inhibited pseudovirus infection with IC50 values of 2.0 ⁇ M and 2.4 ⁇ M, respectively.
- Nb3 inhibited pseudovirus infection with an IC50 of 3.9 ⁇ M (Fig.29C, Figure 42).
- Nb6 ⁇ tri shows a 2000 ⁇ fold enhancement of inhibitory activity, with an IC50 of 1.2nM, whereas trimerization of Nb11 and Nb3 resulted in more modest gains of 40 ⁇ and 10 ⁇ fold (51nM and 400nM), respectively (Fig.29C).
- the neutralization activities were confirmed with a viral plaque assay using live SARS ⁇ CoV ⁇ 2 virus infection of VeroE6 cells.
- Nb6 ⁇ tri proved exceptionally potent, neutralizing SARS ⁇ CoV ⁇ 2 with an average IC50 of 160pM (Fig.29D).
- Nb3 ⁇ tri neutralized SARS ⁇ CoV ⁇ 2 with an average IC50 of 140nM (Fig.29D).
- Nb6 The potency of Nb6 was optimized by selecting a saturation mutagenesis library targeting all three CDRs. Two rounds of selection identified high ⁇ affinity clones with two penetrant mutations: I27Y in CDR1 and P105Y in CDR3. We incorporated these mutations into Nb6 to generate matured Nb6 (mNb6), which binds with 500 ⁇ fold increased affinity to Spike S2P (Fig.30A). mNb6 inhibits both pseudovirus and live SARS ⁇ CoV ⁇ 2 infection with low nanomolar potency, a ⁇ 200 ⁇ fold improvement compared to Nb6 (Fig. 30B; Figure 42).
- a 2.9 ⁇ cryo ⁇ EM structure shows that mNb6 binds to closed Spike S2P (Figure 30C; Figure 32).
- mNb6 induces a slight rearrangement of the down ⁇ state RBDs as compared to Spike S2P bound to Nb6, inducing a 9° rotation of the RBD away from the central three ⁇ fold symmetry axis. This deviation likely arises from a different interaction between CDR3 and Spike S2P , which nudges the RBDs into a new resting position (Figure 30D).
- mNb6 ⁇ tri displays further gains in potency in both pseudovirus and live SARS ⁇ CoV ⁇ 2 infection assays with IC50 values of 120 pM (5.0ng/mL) and 54pM (2.3ng/mL), respectively (Figure 30B, Figure 41). Given the sub ⁇ picomolar affinity observed by SPR, it is likely that these viral neutralization potencies reflect the lower limit of the assays. mNb6 ⁇ tri is therefore an exceptionally potent SARS ⁇ CoV ⁇ 2 neutralizing molecule. [00263] Next, viral neutralization by the Class I nanobody mNb6 was tested to see if it was potentially synergistic with the Class II nanobody Nb3 ⁇ tri.
- mNb6 and mNb6 ⁇ tri were stable to lyophilization and to aerosolization, showing no aggregation by size exclusion chromatography and preserved high affinity binding to Spike S2P (Fig.31A ⁇ B and Figure 40). Finally, mNb6 ⁇ tri retains potent inhibition of pseudovirus and live SARS ⁇ CoV ⁇ 2 infection after aerosolization, lyophilization, or heat treatment for 1 hour at 50°C ( Figure 31C and Figure 40). [00265] Strategies to prevent SARS ⁇ CoV ⁇ 2 entry into the host cell aim to block the ACE2 ⁇ RBD interaction (20, 23 ⁇ 30).
- nanobodies can be inexpensively produced in bacteria or yeast.
- the inherent stability of nanobodies enables aerosolized delivery directly to the nasal and lung epithelia (33). Indeed, aerosol delivery of a trimeric nanobody targeting respiratory syncytial virus (ALX ⁇ 0171) was recently demonstrated to be effective in substantially decreasing measurable viral load in hospitalized infants (34).
- Nanobody multimerization has been shown to improve target affinity by avidity (33, 36).
- structure ⁇ guided design of a multimeric construct that simultaneously engages all three RBDs yielded profound gains in potency.
- conformational control of RBD accessibility serves as an added neutralization mechanism (30).
- mNb6 ⁇ tri engages with Spike it prevents ACE2 binding by both directly occluding the binding site and by locking the RBDs into an inactive conformation.
- ExpiCHO or Expi293T cells were transfected with the Spike S2P construct per the manufacturer’s instructions for the MaxTiter protocol and harvested between 3 ⁇ 9 days after transfection. Clarified cell culture supernatant was loaded onto Ni ⁇ Excel beads (Cytiva) followed by extensive washes in 20 mM HEPES pH 8.0, 200 mM sodium chloride, and 10 mM imidazole and elution in the same buffer supplemented with 500 mM imidazole.
- Spike S2P was concentrated using a 100 kDa MWCO spin concentrator (Millipore) and further purified by size exclusion chromatography over a Superose 6 Increase 10/300 column (GE Healthcare) in 20 mM HEPES pH 8.0 and 200 mM sodium chloride. All purification steps were performed at room temperature. The resulting fractions for trimeric Spike S2P were pooled and either used directly for cryo ⁇ EM studies or concentrated and flash frozen in liquid nitrogen with 15% glycerol for other biochemical studies. [00270] We used a previously described construct to express and purify the SARS ⁇ CoV ⁇ 2 Receptor binding domain (RBD)(37).
- RBD SARS ⁇ CoV ⁇ 2 Receptor binding domain
- Expi293T cells (ThermoFisher) were transfected with the RBD construct per the manufacturer’s instructions and harvested between 3 ⁇ 6 days after transfection. Clarified cell culture supernatant was loaded onto Ni ⁇ Excel beads (Cytiva) or a His ⁇ Trap Excel column (GE Healthcare) followed by washes in 20 mM HEPES pH 8.0, 200 mM sodium chloride, and 10 mM imidazole and elution using the same buffer supplemented with 500 mM imidazole.
- RBD was concentrated using a 30 kDa MWCO spin concentrator (Millipore) and further purified by size exclusion chromatography over a Superdex 200 Increase 10/300 GL column (GE Healthcare) in 20 mM HEPES pH 8.0 and 200 mM sodium chloride. The resulting fractions were pooled, concentrated, and flash frozen in liquid nitrogen with 10% glycerol.
- ACE2 ⁇ ECD (18 ⁇ 614) Fc fusion expression plasmid to express and purify Fc tagged ACE2 ⁇ ECD(38).
- Expi293T cells (ThermoFisher) were transfected with the ACE2 ⁇ Fc construct per the manufacturer’s instructions and harvested between 5 ⁇ 7 days after transfection. Clarified cell culture supernatant was loaded onto a MabSelect Pure 1 mL Column (GE Healthcare).
- Buffer A (20 mM HEPES pH 7.5, 150 mM NaCl) and protein was eluted with Buffer B (100 mM Sodium Citrate pH 3.0, 150 mM NaCl) into a deep well block containing 1 M HEPES pH 7.5 to neutralize the acidic elution.
- Buffer B 100 mM Sodium Citrate pH 3.0, 150 mM NaCl
- ACE2 ⁇ Fc was concentrated using a 30 kDa MWCO spin concentrator (Millipore) and further purified by size exclusion chromatography over a Superdex 200 Increase 10/300 GL column (GE Healthcare) in SEC Buffer (20 mM HEPES pH 7.5, 150 mM NaCl, 5% v/v Glycerol).
- Nanobody sequences were cloned into the pET26 ⁇ b(+) expression vector using In ⁇ Fusion HD cloning (Takara Bio), transformed into BL21(DE3) E. coli (New England BioLabs), grown in Terrific Broth at 37 °C until OD 0.7 ⁇ 0.8, followed by gene induction using 1 mM IPTG for 18 ⁇ 22 hours at 25°C.
- In ⁇ Fusion HD cloning (Takara Bio)
- E. coli New England BioLabs
- Coli were harvested and resuspended in SET Buffer (200 mM Tris, pH 8.0, 500 mM sucrose, 0.5 mM EDTA, 1X cOmplete protease inhibitor (Roche)) for 30 minutes at 25 °C before a 45 minute osmotic shock with a two ⁇ fold volume addition of water.
- NaCl, MgCl2, and imidazole were added to the lysate to 150 mM, 2 mM, and 40 mM respectively before centrifugation at 17 ⁇ 20,000xg for 15 minutes to separate cell debris from the periplasmic fraction.
- the periplasmic fraction was then incubated with 4 mL of 50% HisPur Ni ⁇ NTA resin (Thermo Scientific) which had been equilibrated in Nickel Wash Buffer (20 mM HEPES, pH 7.5, 150 mM NaCl, 40 mM imidazole). This mixture was incubated for 1 hr with rotation at RT before centrifugation at 50xg to collect the resin. The resin was then washed with 5 volumes of Nickel Wash buffer 3 times, each time using centrifugation to remove excess wash buffer. Bound proteins were then eluted using three washes with Elution Buffer (20 mM HEPES, pH 7.5, 150 mM NaCl, 500 mM imidazole).
- the eluted protein was concentrated using a 3.5 kDa MWCO centrifugal filter unit (Amicon) before injection onto a Superdex 200 Increase 10/300 GL column equilibrated with 20 mM HEPES, pH 7.5, 150 mM NaCl. Nanobody constructs were concentrated again using a 3.5k MWCO centrifugal filter unit, and flash frozen in liquid nitrogen. [00278] 4.
- Nanobody (Nb) affinity determination experiments were performed on Biacore T200 and 8K instruments (Cytiva Life Sciences) by capturing the StreptagII ⁇ tagged Spike S2P at 10 ⁇ g/mL on a StreptactinXT ⁇ immobilized (Iba Life Sciences) CM5 Series S sensor chip (Cytiva Life Sciences) to achieve maximum response (Rmax) of approximately 30 response units (RUs) upon nanobody binding.
- the dissociation phase was fit to a biexponential decay constrained to two dissociation rate constants shared between each concentration.
- the association phase was fit separately using an association kinetics model simultaneously fitting the association rate constant for each concentration.
- Spike S2P was loaded onto a StreptactinXT ⁇ immobilized CM5 sensor chip as previously described.
- the primary nanobody was flowed over the captured Spike S2P surface for 60 seconds at 30 ⁇ L/minute to achieve saturation. Immediately following this, a second injection of a mixture of primary and variable nanobody at the same concentration as in the primary injection was performed. [00283] 5.
- ACE2 cellular surface binding competition assays [00284] A dilution series of nanobody was generated in PBE (PBS + 0.5% (w/v) BSA + 2 mM EDTA and mixed with Spike S2P ⁇ Alexa647 or RBD ⁇ Alexa647. ACE2 expressing HEK293T cells were dissociated with TrypLE Express (ThermoFisher) and resuspended in PBE(22). The cells were mixed with the Spike S2P ⁇ nanobody solution and incubated for 45 minutes, washed in PBE, and then resuspended in PBE.
- PBE PBS + 0.5% (w/v) BSA + 2 mM EDTA
- Spike S2P ⁇ Alexa647 or RBD ⁇ Alexa647 ACE2 expressing HEK293T cells were dissociated with TrypLE Express (ThermoFisher) and resuspended in PBE(22). The cells were mixed
- Nb6 Cell surface Alexa647 fluorescence intensity was assessed on an Attune Flow Cytometer (ThermoFisher).
- Affinity maturation of Nb6 [00286] A site saturation mutagenesis library of Nb6 was generated by assembly PCR of overlapping oligonucleotides encoding the Nb6 sequence. Individual oligos for each position in CDR1, CDR2, and CDR3 were designed with the degenerate “NNK” codon. The assembled gene product was amplified with oligonucleotides with overlapping ends to enable homologous recombination with the yeast surface display vector as previously described and purified with standard silica ⁇ based chromatography(17).
- the resulting insert DNA was transformed into Saccharomyces cerevisiae strain BJ5465 (ATCC 208289) along with the yeast display vector pYDS2.0 to generate a library of 2x10 8 transformants.
- 2x10 9 yeast were washed in selection buffer (20 mM HEPES, pH 8.0, 150 mM sodium chloride, 0.1% (w/v) low biotin BSA) and incubated with 1 nM biotin ⁇ Spike S2P for 1 hour at 25 °C.
- Yeast were subsequently washed in selection buffer, resuspended in 1 mL selection buffer, and incubated with 10 ⁇ L streptavidin microbeads (Miltenyi) for 15 min. at 4 °C.
- Yeast were washed again with cold selection buffer and Spike S2P ⁇ binding yeast were isolated by magnetic separation using an LS column (Miltenyi). Recovered yeast were grown in YPD+NTC at 37 °C and induced in YPG+NTC at 20 °C.
- a second round of selection was performed as above, substituting 100 pM RBD ⁇ Alexa647 as the antigen.
- Yeast displaying high affinity clones were selected by magnetic separation using Anti ⁇ Cy5 microbeads (Miltenyi) and an LS column. Analysis of the library after the second round of selection revealed a population of clones with clear binding of 10 pM RBD ⁇ Alexa647. Therefore, 96 individual clones were screened for binding to 10 pM RBD ⁇ Alexa647 by flow cytometry. Sequence analysis of eight clones that showed robust binding to 10 pM RBD ⁇ Alexa647 revealed two consensus mutations, I27Y and P105Y, which were used to generate the affinity matured clone mNb6. [00287] 7.
- mNb6 crystallography and structure determination [00288] Purified mNb6 was concentrated to 18.7 mg/mL and filtered using 0.1 ⁇ m hydrophilic PVDF filters (Millipore). mNb6 crystal screens were set up in 96 well plates in hanging drop format at 2:1 protein:reservoir in Index and AmSO4 screens (Hampton Research, Aliso Viejo, CA). Crystals in over 60 different screening conditions with various morphologies appeared overnight at ambient temperature and were obtained directly from the screens without further optimization.
- the crystals were cryoprotected by quick dipping in a solution containing 80% reservoir and 20% PEG400 or 20% Glycerol, then mounted in CrystalCap HT Cryoloops (Hampton Research, Aliso Viejo, CA) and flash cooled in a cryogenic nitrogen stream (100 K). All data were collected at the Advanced Light Source (Berkeley, CA) beam line 8.3.1. A single crystal of mNb6 that grew in 0.1 M Tris.HCl pH 8.5, 1.0 M Ammonium sulfate diffracted to 2.05 ⁇ . Integration, and scaling were performed with Xia2, using XDS for indexing and integration and XSCALE for scaling and merging(39).
- cryoSPARC patch CTF(46) Particles were picked with a 20 ⁇ low ⁇ pass filtered apo Spike 2D templates generated from a prior data collection.
- Nb6 ⁇ Spike S2P and mNb6 ⁇ Spike S2P particles were extracted with a 384 pixel box, binned to 96 pixels and subject to single rounds of 2D and 3D classification prior to unbinning for homogenous refinement in cryoSPARC. Using pyEM modules, refined particles were then imported into Relion3.1 for 3D classification without alignment using the input refinement map low pass filtered to 40 ⁇ (47, 48).
- Radiolytic hydroxyl radical footprinting and mass ⁇ spectrometry of apo and Nb3 ⁇ bound Spike S2P [00301] Spike S2P and Nb3 samples were buffer exchanged into 10 mM phosphate buffer (pH 7.4) by extensive dialysis at 25 °C. A 1.5 ⁇ fold molar excess of Nb3 was added to 5 ⁇ M Spike S2P and the complex was incubated for >24 hr at 25 °C. For radiolytic footprinting, protein concentrations and beam parameters were optimized using an Alexa ⁇ 488 fluorophore assay(18).
- Apo Spike S2P and Spike S2P ⁇ Nb3 complex at concentrations of 1 ⁇ 3 ⁇ M were exposed to a synchrotron X ⁇ ray white beam at 6 timepoints between 0 ⁇ 50 ms at beamline 3.2.1 at the Advanced Light Source in Berkeley, CA and were quenched with 10 mM methionine amide immediately post ⁇ exposure. Glycans were removed by treatment with 5% SDS, 5 mM DTT at 95 °C for five minutes and subsequent PNGase (Promega) digestion at 37°C for 2 hours. Samples were buffer exchanged into ammonium bicarbonate (ABC) buffer (pH 8.0) using ZebaSpin columns (Thermo Fisher).
- ABSC ammonium bicarbonate
- MS1 peptide abundances was performed using the FragPipe platform with either trypsin or GluC enzyme specificity, and all peptide and protein identifications were filtered to a 1% false ⁇ discovery rate(62). Searches were performed against a concatenated protein database of the Spike protein, common contaminant proteins, and the Saccharomyces cerevisiae proteome (downloaded July 23, 2020). Note, the Saccharomyces cerevisiae proteome was included to generate a sufficient population of true negative identifications for robust false discovery rate estimation of peptide and protein identifications. Lastly, the area under the curve MS1 intensities reported from FragPipe were summarized for each peptide species using MSstats(63).
- SARS ⁇ CoV ⁇ 2 neutralization assay E) Authentic SARS ⁇ CoV ⁇ 2 neutralization assay [00307] SARS ⁇ CoV ⁇ 2, isolate France/IDF0372/2020, was supplied by the National Reference Centre for Respiratory Viruses hosted by Institut Pasteur (Paris, France) and headed by Pr. Sylvie van der Werf. Viral stocks were prepared by propagation in Vero E6 cells in Dulbecco’s modified Eagle’s medium (DMEM) supplemented with 2% (v/v) fetal bovine serum (FBS, Invitrogen). Viral titers were determined by plaque assay.
- DMEM Dulbecco’s modified Eagle’s medium
- FBS fetal bovine serum
- the mixture was then used to inoculate Vero E6 cells seeded in 12 ⁇ well plates, for one hour at 37 °C, 5% CO2. Following this virus adsorption time, a solid agarose overlay (DMEM, 10% (v/v) FBS and 0.8% agarose) was added. The cells were incubated for a further 3 days prior to fixation using 4% formalin and plaques visualized by the addition of crystal violet. The number of plaques in quadruplicate wells for each dilution was used to determine the half maximal inhibitory concentrations (IC50) using 3 ⁇ parameter logistic regression (GraphPad Prism version 8).
- Nanobody stability studies [00310] Nanobody thermostability by circular dichroism was assessed using a Jasco J710 CD spectrometer equipped with a Peltier temperature control. Individual nanobody constructs were diluted to 5 ⁇ M in phosphate buffered saline. Mollar ellipticity was measured at 204 nm (2 nm bandwidth) between 25 °C and 80 °C with a 1 °C/min heating rate. The resulting molar ellipticity values were normalized and plotted in GraphPad Prism 8.0 after applying a nearest neighbor smoothing function.
- nanobodies were incubated at either 25°C or 50°C for one hour.
- each nanobody was aerosolized with a portable mesh nebulizer producing 2 ⁇ 5 ⁇ m particles at a final concentration of 0.5 mg/mL.
- the resulting aerosol was collected by condensation into a 50 mL tube cooled on ice. Samples were then treated as indicated above to determine IC50 values for binding to Spike S2P ⁇ Alexa647 or used for pseudovirus neutralization studies as described above.
- Virus Severe Acute Respiratory Syndrome Coronavirus ⁇ 2 (SARS ⁇ CoV ⁇ 2) USA_WA1/2020 strain was obtained from the World Reference Center for Emerging Viruses and Arboviruses (WRCEVA). The virus was passaged two times in Vero 76 cells to generate a working stock for infection of hamsters.
- Experiment Design – Transmission and Efficacy Study A total of 24 5 ⁇ week ⁇ old female golden Syrian hamsters were randomized into 2 groups of 4 hamsters to serve as untreated infected animals and 2 groups of 8 na ⁇ ve hamsters for cohabitation with and without Nanoparticle A treatment (Figure 51).
- hamsters in groups 1, 3, and 5 were anesthetized by IP injection of ketamine/xylazine (50 mg/kg / 5 mg/kg) prior to challenge by the intranasal route with a dose of 1 x 104.3 50% cell culture infectious doses (CCID50) in a 100 ⁇ l inoculum volume. All intranasal treatments were administered in a 100 ⁇ l volume after anesthetizing animals as was done for infections. Animals in groups 1 and 3 were not treated.
- Animals in group 2 and 4 were not infected but were cohabitated with animals from groups 1 or 3 for 4 hours each day on study days 1, 2, and 3. Animals in group 2 were treated with saline as a placebo. Animals in group 4 were treated once daily with Nanoparticle A 2 hours prior to cohabitation with infected animals. Hamsters were weighed prior to infection and then everyday thereafter to evaluate infection ⁇ associated weight loss. All animals were euthanized on study day 4 to evaluate lung virus titers and the transmission of virus from infected animals to na ⁇ ve animals. Oropharyngeal swabs were collected on all animals. [00318] Titration of Lung Tissue Samples: Lung tissues homogenates were titrated by endpoint dilution.
- Results Percent initial body weight of 5 ⁇ week ⁇ old golden Syrian hamsters following challenge with SARS ⁇ CoV ⁇ 2 and treatment with Nanoparticle A prior to cohabitation with infected animals is shown in Figure 57. Animals with the same shape symbols were cohabitated. Groups represented with the closed circle and closed square were infected on study day 0. Animals represented by the open circle were na ⁇ ve and placebo ⁇ treated prior to cohabitation with animals from group 1 for 4 hrs per day for 3 days. Animals represented by the open square were na ⁇ ve and Nanoparticle A ⁇ treated prior to cohabitation with animals from group 3. The differences in percent initial body weight were not statistically significant when compared by one ⁇ way ANOVA.
- Figure 58 shows lung virus titers of 5 ⁇ week ⁇ old golden Syrian hamsters after challenge with SARS ⁇ CoV ⁇ 2 and treatment with Nanoparticle A prior to cohabitation with infected animals. Animals with the same shape symbols were cohabitated. Groups represented with the closed circle and closed square were infected on study day 0. Animals represented by the open circle were na ⁇ ve and placebo ⁇ treated prior to cohabitation with animals from group 1 for 4 hrs per day for 3 days. Animals represented by the open square were na ⁇ ve and Nanoparticle A ⁇ treated prior to cohabitation with animals from group 3. Treatment with Nanoparticle A significantly reduced lung virus titers in na ⁇ ve animals cohabitated with SARS ⁇ CoV ⁇ 2 ⁇ infected animals.
- Figure 53 shows lung weights of 5 ⁇ week ⁇ old golden Syrian hamsters after challenge with SARS ⁇ CoV ⁇ 2 and treatment with Nanoparticle A prior to cohabitation with infected animals. Animals with the same shape symbols were cohabitated. Groups represented with the closed circle and closed square were infected on study day 0. Animals represented by the open circle were na ⁇ ve and placebo ⁇ treated prior to cohabitation with animals from group 1 for 4 hrs per day for 3 days. Animals represented by the open square were na ⁇ ve and Nanoparticle A ⁇ treated prior to cohabitation with animals from group 3. Lung weights were not statistically different between groups when compared by one ⁇ way ANOVA.
- Oropharyngeal swab virus titers of 5 ⁇ week ⁇ old golden Syrian hamsters after challenge with SARS ⁇ CoV ⁇ 2 and treatment with Nanoparticle A prior to cohabitation with infected animals are shown in Figure 60. Animals with the same shape symbols were cohabitated. Groups represented with the closed circle and closed square were infected on study day 0. Animals represented by the open circle were na ⁇ ve and placebo ⁇ treated prior to cohabitation with animals from group 1 for 4 hrs per day for 3 days. Animals represented by the open square were na ⁇ ve and Nanoparticle A ⁇ treated prior to cohabitation with animals from group 3. No significant difference in oropharyngeal swab virus titers were determined by one ⁇ way ANOVA.
- Figure 54 shows percent initial body weight of 5 ⁇ week ⁇ old golden Syrian hamsters following treatment with Nanoparticle A and infection with SARS ⁇ CoV ⁇ 2. The differences in percent initial body weight were not statistically significant when compared by one ⁇ way ANOVA.
- Figure 62 shows lung virus titers of 5 ⁇ week ⁇ old golden Syrian hamsters after treatment with Nanoparticle A and infection with SARS ⁇ CoV ⁇ 2. Treatment with Nanoparticle A started significantly reduced lung virus titers at doses of 2 and 0.63 mg/kg/d compared to placebo ⁇ treated animals. This data is summarized in Figure 55.
- Figure 63 shows lung weights of 5 ⁇ week ⁇ old golden Syrian hamsters after challenge with SARS ⁇ CoV ⁇ 2 and treatment with Nanoparticle A prior to cohabitation with infected animals. Lung weights were not statistically different between groups when compared by one ⁇ way ANOVA.
- Oropharyngeal swab virus titers of 5 ⁇ week ⁇ old golden Syrian hamsters after treatment with Nanoparticle A and infection with SARS ⁇ CoV ⁇ 2 are shown in Figure 64. Treatment with Nanoparticle A at a dose of 2 mg/kg/d significantly reduced oropharyngeal swab titers of hamsters infected with SARS ⁇ CoV ⁇ 2. This data is summarized in Figure 56.
- Oropharyngeal swab titers were significantly reduced by treatment with Nanoparticle A although the virus was not consistently detected even in placebo ⁇ treated animals.
- lung virus titers were significantly reduced lung virus titers in animals treated with 2 or 0.63 mg/kg/d compared to placebo ⁇ treated animals.
- Oropharyngeal titers were also significantly reduced by a 2 mg/kg/d dose of Nanoparticle A compared to placebo ⁇ treated animals.
- Oropharyngeal swab titers were only detected in one of eight, two of eight, and three of eight animals at doses of 2, 0.63, and 0.2 mg/kg/d respectively.
- Oropharyngeal swab titers were detected in six of eight placebo ⁇ treated animals. [00329] No adverse reactions to treatment were observed in any of the animals. A lack of weight loss following treatment also indicates that the treatment was well ⁇ tolerated in hamsters. [00330] REFERENCES AND NOTES: [00331] 1. T. G. Ksiazek et al., A novel coronavirus associated with severe acute respiratory syndrome. N Engl J Med 348, 1953 ⁇ 1966 (2003). [00332] 2. A. M. Zaki, S. van Boheemen, T. M. Bestebroer, A. D. Osterhaus, R. A.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Public Health (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Communicable Diseases (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Oncology (AREA)
- Veterinary Medicine (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Description
Claims
Applications Claiming Priority (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202063023645P | 2020-05-12 | 2020-05-12 | |
| US202063042135P | 2020-06-22 | 2020-06-22 | |
| US202063047655P | 2020-07-02 | 2020-07-02 | |
| US202063061928P | 2020-08-06 | 2020-08-06 | |
| PCT/US2021/032092 WO2021231651A2 (en) | 2020-05-12 | 2021-05-12 | Sars-cov2 neutralizing single domain antibody constructs |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| EP4149971A2 true EP4149971A2 (en) | 2023-03-22 |
| EP4149971A4 EP4149971A4 (en) | 2024-10-02 |
Family
ID=78525232
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP21804288.5A Withdrawn EP4149971A4 (en) | 2020-05-12 | 2021-05-12 | SINGLE-DOMAIN ANTIBODY CONSTRUCTS NEUTRALIZING SARS-COV2 |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US20230227538A1 (en) |
| EP (1) | EP4149971A4 (en) |
| JP (1) | JP2023526274A (en) |
| KR (1) | KR20230022412A (en) |
| AU (1) | AU2021271016A1 (en) |
| BR (1) | BR112022023117A2 (en) |
| CA (1) | CA3178801A1 (en) |
| CL (1) | CL2022003161A1 (en) |
| IL (1) | IL298161A (en) |
| MX (1) | MX2022014224A (en) |
| WO (1) | WO2021231651A2 (en) |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20220163529A1 (en) * | 2020-11-20 | 2022-05-26 | Arizona Board Of Regents On Behalf Of Arizona State University | MONOCLONAL ANTIBODY FOR SARS-CoV-2 SPIKE PROTEIN |
| WO2023104933A1 (en) * | 2021-12-07 | 2023-06-15 | new/era/mabs GmbH | Camelid antibodies for use in therapy and diagnosis |
| EP4194054A1 (en) * | 2021-12-07 | 2023-06-14 | new/era/mabs GmbH | Camelid antibodies for use in therapy and diagnosis |
| WO2024040187A2 (en) * | 2022-08-19 | 2024-02-22 | The Regents Of The University Of California | Sars-cov2 neutralizing single domain antibody constructs |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| LT2285408T (en) * | 2008-06-05 | 2019-01-25 | Ablynx N.V. | Amino acid sequences directed against envelope proteins of a virus and polypeptides comprising the same for the treatment of viral diseases |
| US20130302366A1 (en) * | 2012-05-09 | 2013-11-14 | Christopher Marshall | Conformationally Specific Viral Immunogens |
| WO2017196847A1 (en) * | 2016-05-10 | 2017-11-16 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Variable new antigen receptor (vnar) antibodies and antibody conjugates targeting tumor and viral antigens |
| EP3807311A4 (en) * | 2018-04-24 | 2022-01-26 | National Research Council of Canada | SERUM ALBUMIN BINDING ANTIBODIES FOR ADJUSTABLE HALF-LIFE EXTENSION OF BIOLOGICALS |
| WO2021156490A2 (en) * | 2020-02-06 | 2021-08-12 | Vib Vzw | Corona virus binders |
-
2021
- 2021-05-12 AU AU2021271016A patent/AU2021271016A1/en not_active Abandoned
- 2021-05-12 MX MX2022014224A patent/MX2022014224A/en unknown
- 2021-05-12 CA CA3178801A patent/CA3178801A1/en active Pending
- 2021-05-12 IL IL298161A patent/IL298161A/en unknown
- 2021-05-12 KR KR1020227043484A patent/KR20230022412A/en not_active Withdrawn
- 2021-05-12 EP EP21804288.5A patent/EP4149971A4/en not_active Withdrawn
- 2021-05-12 JP JP2022568967A patent/JP2023526274A/en active Pending
- 2021-05-12 BR BR112022023117A patent/BR112022023117A2/en not_active Application Discontinuation
- 2021-05-12 US US17/998,605 patent/US20230227538A1/en active Pending
- 2021-05-12 WO PCT/US2021/032092 patent/WO2021231651A2/en not_active Ceased
-
2022
- 2022-11-14 CL CL2022003161A patent/CL2022003161A1/en unknown
Also Published As
| Publication number | Publication date |
|---|---|
| KR20230022412A (en) | 2023-02-15 |
| WO2021231651A3 (en) | 2022-01-06 |
| CA3178801A1 (en) | 2021-11-18 |
| AU2021271016A1 (en) | 2023-01-19 |
| WO2021231651A8 (en) | 2022-11-17 |
| MX2022014224A (en) | 2023-02-23 |
| US20230227538A1 (en) | 2023-07-20 |
| EP4149971A4 (en) | 2024-10-02 |
| BR112022023117A2 (en) | 2023-01-17 |
| JP2023526274A (en) | 2023-06-21 |
| IL298161A (en) | 2023-01-01 |
| CL2022003161A1 (en) | 2023-10-20 |
| WO2021231651A2 (en) | 2021-11-18 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| TWI847020B (en) | Anti-coronavirus antibodies and methods of use | |
| WO2021231651A2 (en) | Sars-cov2 neutralizing single domain antibody constructs | |
| US20100266614A1 (en) | Ultra high affinity neutralizing antibodies | |
| WO2023019723A1 (en) | Monoclonal antibody 32c7, and preparation method therefor and use thereof | |
| EP3970798A1 (en) | Sars-cov-2-nanobodies | |
| JP2023516280A (en) | coronavirus binder | |
| WO2023019724A1 (en) | Monoclonal antibody 35b5, preparation method therefor, and use thereof | |
| US20250002563A1 (en) | Broadly neutralizing nanobodies for coronavirus and uses thereof | |
| US20240043505A1 (en) | Coronavirus nanobodies and methods for their use and identification | |
| CN114174331B (en) | Antibodies that bind to human metapneumovirus fusion proteins and uses thereof | |
| Chang et al. | IgG-like bispecific antibodies with potent and synergistic neutralization against circulating SARS-CoV-2 variants of concern | |
| US20240270826A1 (en) | Antibodies that bind sars-cov-2 spike protein | |
| US20240101647A1 (en) | Sarbecovirus binders | |
| WO2021244601A1 (en) | Neutralizing antibody of sars-cov-2 virus and application thereof | |
| US20230250157A1 (en) | Antibodies for coronavirus and uses thereof | |
| US20240270828A1 (en) | Human neutralizing antibodies against sars-cov-2 spike s2 domain and uses thereof | |
| Abu-Shmais et al. | A potently neutralizing and protective human antibody targeting antigenic site V on RSV and hMPV fusion glycoprotein | |
| US20190240316A1 (en) | Human respiratory syncytial virus antibodies and methods of use therefor | |
| JP2011072248A (en) | Human antibody against rabies virus and composition thereof | |
| KR20250122528A (en) | Antibodies to metapneumovirus fusion (F) protein and uses thereof | |
| WO2024053719A1 (en) | Human antibody against coronavirus variants or antigen-binding fragment thereof | |
| CN116472284A (en) | SARS-COV2 neutralizing single domain antibody construct | |
| CN116964103A (en) | Broad-spectrum antibody of SARS-CoV-2 virus and its application | |
| US20260109764A1 (en) | Monovalent cd47 binding proteins | |
| US20250296987A1 (en) | Rsv/hmpv cross-reactive antibodies |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20221209 |
|
| AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| P01 | Opt-out of the competence of the unified patent court (upc) registered |
Effective date: 20230524 |
|
| RIC1 | Information provided on ipc code assigned before grant |
Ipc: A61P 31/14 20060101ALI20240503BHEP Ipc: A61K 39/395 20060101ALI20240503BHEP Ipc: C07K 16/10 20060101AFI20240503BHEP |
|
| A4 | Supplementary search report drawn up and despatched |
Effective date: 20240829 |
|
| RIC1 | Information provided on ipc code assigned before grant |
Ipc: A61P 31/14 20060101ALI20240823BHEP Ipc: A61K 39/395 20060101ALI20240823BHEP Ipc: C07K 16/10 20060101AFI20240823BHEP |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20241203 |