EP3755709A1 - Assay for the diagnosis of viral infections - Google Patents
Assay for the diagnosis of viral infectionsInfo
- Publication number
- EP3755709A1 EP3755709A1 EP19705374.7A EP19705374A EP3755709A1 EP 3755709 A1 EP3755709 A1 EP 3755709A1 EP 19705374 A EP19705374 A EP 19705374A EP 3755709 A1 EP3755709 A1 EP 3755709A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- seq
- antibody
- powv
- infection
- flavivirus
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 238000003745 diagnosis Methods 0.000 title claims abstract description 29
- 230000009385 viral infection Effects 0.000 title claims abstract description 10
- 208000036142 Viral infection Diseases 0.000 title claims description 7
- 238000003556 assay Methods 0.000 title description 19
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 79
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 77
- 229920001184 polypeptide Polymers 0.000 claims abstract description 75
- 241000710831 Flavivirus Species 0.000 claims abstract description 62
- 208000015181 infectious disease Diseases 0.000 claims abstract description 50
- 238000000034 method Methods 0.000 claims abstract description 45
- 241000700605 Viruses Species 0.000 claims abstract description 16
- 238000003018 immunoassay Methods 0.000 claims abstract description 12
- 230000001965 increasing effect Effects 0.000 claims abstract description 9
- 238000011282 treatment Methods 0.000 claims abstract description 7
- 238000012544 monitoring process Methods 0.000 claims abstract description 6
- 238000012360 testing method Methods 0.000 claims description 21
- 239000011324 bead Substances 0.000 claims description 19
- 210000002966 serum Anatomy 0.000 claims description 9
- 238000004519 manufacturing process Methods 0.000 claims description 7
- 239000012528 membrane Substances 0.000 claims description 7
- 239000011521 glass Substances 0.000 claims description 6
- 238000002493 microarray Methods 0.000 claims description 6
- 230000005298 paramagnetic effect Effects 0.000 claims description 6
- 210000004369 blood Anatomy 0.000 claims description 5
- 239000008280 blood Substances 0.000 claims description 5
- 238000000018 DNA microarray Methods 0.000 claims description 4
- 230000003100 immobilizing effect Effects 0.000 claims description 4
- 238000001262 western blot Methods 0.000 claims description 4
- 241000710884 Powassan virus Species 0.000 description 80
- 101000807236 Human cytomegalovirus (strain AD169) Membrane glycoprotein US3 Proteins 0.000 description 69
- 239000000523 sample Substances 0.000 description 41
- 210000004027 cell Anatomy 0.000 description 32
- 239000000427 antigen Substances 0.000 description 29
- 102000036639 antigens Human genes 0.000 description 29
- 108091007433 antigens Proteins 0.000 description 29
- 238000001514 detection method Methods 0.000 description 29
- 238000002965 ELISA Methods 0.000 description 28
- 238000009739 binding Methods 0.000 description 18
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 18
- 230000027455 binding Effects 0.000 description 16
- 150000001413 amino acids Chemical class 0.000 description 15
- 108090000623 proteins and genes Proteins 0.000 description 14
- 102000004169 proteins and genes Human genes 0.000 description 14
- 239000000203 mixture Substances 0.000 description 12
- 230000035945 sensitivity Effects 0.000 description 12
- 241000907316 Zika virus Species 0.000 description 11
- 230000009260 cross reactivity Effects 0.000 description 11
- 150000007523 nucleic acids Chemical class 0.000 description 11
- 229960005486 vaccine Drugs 0.000 description 11
- 108020004707 nucleic acids Proteins 0.000 description 10
- 102000039446 nucleic acids Human genes 0.000 description 10
- 238000006243 chemical reaction Methods 0.000 description 9
- 239000003153 chemical reaction reagent Substances 0.000 description 9
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 9
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 8
- 241000710886 West Nile virus Species 0.000 description 8
- 239000000243 solution Substances 0.000 description 8
- 206010054261 Flavivirus infection Diseases 0.000 description 7
- 201000010099 disease Diseases 0.000 description 7
- 239000012634 fragment Substances 0.000 description 7
- 238000002360 preparation method Methods 0.000 description 7
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 6
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 6
- 230000004071 biological effect Effects 0.000 description 6
- 208000024891 symptom Diseases 0.000 description 6
- 108700004715 Flavivirus NS1 Proteins 0.000 description 5
- 241000710771 Tick-borne encephalitis virus Species 0.000 description 5
- 241000710772 Yellow fever virus Species 0.000 description 5
- 230000001154 acute effect Effects 0.000 description 5
- 239000002671 adjuvant Substances 0.000 description 5
- 238000002405 diagnostic procedure Methods 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 230000014509 gene expression Effects 0.000 description 5
- 239000003446 ligand Substances 0.000 description 5
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 5
- 241000710827 Dengue virus 1 Species 0.000 description 4
- 241000710815 Dengue virus 2 Species 0.000 description 4
- 241000710872 Dengue virus 3 Species 0.000 description 4
- 241000710844 Dengue virus 4 Species 0.000 description 4
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 4
- 208000020329 Zika virus infectious disease Diseases 0.000 description 4
- 239000000872 buffer Substances 0.000 description 4
- 238000004113 cell culture Methods 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 239000012228 culture supernatant Substances 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 239000003814 drug Substances 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 239000008194 pharmaceutical composition Substances 0.000 description 4
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 238000010186 staining Methods 0.000 description 4
- 238000005406 washing Methods 0.000 description 4
- 229940051021 yellow-fever virus Drugs 0.000 description 4
- 241000283707 Capra Species 0.000 description 3
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 241000710842 Japanese encephalitis virus Species 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 108010090804 Streptavidin Proteins 0.000 description 3
- 208000035056 Tick-Borne disease Diseases 0.000 description 3
- 229960002685 biotin Drugs 0.000 description 3
- 235000020958 biotin Nutrition 0.000 description 3
- 239000011616 biotin Substances 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 238000004040 coloring Methods 0.000 description 3
- 238000002591 computed tomography Methods 0.000 description 3
- 210000003527 eukaryotic cell Anatomy 0.000 description 3
- 238000011156 evaluation Methods 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 238000010166 immunofluorescence Methods 0.000 description 3
- 238000004949 mass spectrometry Methods 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 229910052759 nickel Inorganic materials 0.000 description 3
- 239000004033 plastic Substances 0.000 description 3
- 229920003023 plastic Polymers 0.000 description 3
- 239000013641 positive control Substances 0.000 description 3
- 230000000405 serological effect Effects 0.000 description 3
- 208000016523 tick-borne infectious disease Diseases 0.000 description 3
- 239000011534 wash buffer Substances 0.000 description 3
- YYGNTYWPHWGJRM-UHFFFAOYSA-N (6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene Chemical compound CC(C)=CCCC(C)=CCCC(C)=CCCC=C(C)CCC=C(C)CCC=C(C)C YYGNTYWPHWGJRM-UHFFFAOYSA-N 0.000 description 2
- VHJLVAABSRFDPM-UHFFFAOYSA-N 1,4-dithiothreitol Chemical compound SCC(O)C(O)CS VHJLVAABSRFDPM-UHFFFAOYSA-N 0.000 description 2
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 2
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 2
- 229920000936 Agarose Polymers 0.000 description 2
- 208000003322 Coinfection Diseases 0.000 description 2
- 206010012310 Dengue fever Diseases 0.000 description 2
- 241000725619 Dengue virus Species 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 101710128560 Initiator protein NS1 Proteins 0.000 description 2
- 208000016604 Lyme disease Diseases 0.000 description 2
- 239000007993 MOPS buffer Substances 0.000 description 2
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 2
- 101710144127 Non-structural protein 1 Proteins 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- BHEOSNUKNHRBNM-UHFFFAOYSA-N Tetramethylsqualene Natural products CC(=C)C(C)CCC(=C)C(C)CCC(C)=CCCC=C(C)CCC(C)C(=C)CCC(C)C(C)=C BHEOSNUKNHRBNM-UHFFFAOYSA-N 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 238000011088 calibration curve Methods 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 229910052799 carbon Inorganic materials 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 238000012864 cross contamination Methods 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 208000025729 dengue disease Diseases 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- PRAKJMSDJKAYCZ-UHFFFAOYSA-N dodecahydrosqualene Natural products CC(C)CCCC(C)CCCC(C)CCCCC(C)CCCC(C)CCCC(C)C PRAKJMSDJKAYCZ-UHFFFAOYSA-N 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 238000001502 gel electrophoresis Methods 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- 210000005260 human cell Anatomy 0.000 description 2
- 238000003384 imaging method Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 230000002458 infectious effect Effects 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 230000002427 irreversible effect Effects 0.000 description 2
- 239000004816 latex Substances 0.000 description 2
- 229920000126 latex Polymers 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 229910001629 magnesium chloride Inorganic materials 0.000 description 2
- 238000002595 magnetic resonance imaging Methods 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 2
- 238000004393 prognosis Methods 0.000 description 2
- 230000002250 progressing effect Effects 0.000 description 2
- 238000001742 protein purification Methods 0.000 description 2
- 230000005180 public health Effects 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 239000012723 sample buffer Substances 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 229940031439 squalene Drugs 0.000 description 2
- TUHBEKDERLKLEC-UHFFFAOYSA-N squalene Natural products CC(=CCCC(=CCCC(=CCCC=C(/C)CCC=C(/C)CC=C(C)C)C)C)C TUHBEKDERLKLEC-UHFFFAOYSA-N 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 238000000108 ultra-filtration Methods 0.000 description 2
- 238000002255 vaccination Methods 0.000 description 2
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 1
- HQFLTUZKIRYQSP-UHFFFAOYSA-N 3-ethyl-2h-1,3-benzothiazole-6-sulfonic acid Chemical compound OS(=O)(=O)C1=CC=C2N(CC)CSC2=C1 HQFLTUZKIRYQSP-UHFFFAOYSA-N 0.000 description 1
- XZKIHKMTEMTJQX-UHFFFAOYSA-N 4-Nitrophenyl Phosphate Chemical compound OP(O)(=O)OC1=CC=C([N+]([O-])=O)C=C1 XZKIHKMTEMTJQX-UHFFFAOYSA-N 0.000 description 1
- 241000238876 Acari Species 0.000 description 1
- 108091023037 Aptamer Proteins 0.000 description 1
- 206010003591 Ataxia Diseases 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 238000011537 Coomassie blue staining Methods 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 208000001490 Dengue Diseases 0.000 description 1
- 241000710829 Dengue virus group Species 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 206010013887 Dysarthria Diseases 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 208000001951 Fetal Death Diseases 0.000 description 1
- 206010057199 Flaviviral infections Diseases 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 102000005720 Glutathione transferase Human genes 0.000 description 1
- 108010070675 Glutathione transferase Proteins 0.000 description 1
- 206010019233 Headaches Diseases 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 241000710843 Japanese encephalitis virus group Species 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- 102000019298 Lipocalin Human genes 0.000 description 1
- 108050006654 Lipocalin Proteins 0.000 description 1
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- 208000025966 Neurological disease Diseases 0.000 description 1
- 206010060860 Neurological symptom Diseases 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- PXMQJPDWGONKAV-MYAGRZGASA-N OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO.O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO.O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O PXMQJPDWGONKAV-MYAGRZGASA-N 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 206010037660 Pyrexia Diseases 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 208000032140 Sleepiness Diseases 0.000 description 1
- 206010041349 Somnolence Diseases 0.000 description 1
- 208000002667 Subdural Hematoma Diseases 0.000 description 1
- 241001529801 Tick-borne flavivirus Species 0.000 description 1
- 241000907517 Usutu virus Species 0.000 description 1
- 101500019615 West Nile virus Non-structural protein 1 Proteins 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- 208000001455 Zika Virus Infection Diseases 0.000 description 1
- 208000035332 Zika virus disease Diseases 0.000 description 1
- 208000035472 Zoonoses Diseases 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 239000002250 absorbent Substances 0.000 description 1
- 230000002745 absorbent Effects 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 230000004520 agglutination Effects 0.000 description 1
- 230000000172 allergic effect Effects 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- 229940024545 aluminum hydroxide Drugs 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 238000011091 antibody purification Methods 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 201000007201 aphasia Diseases 0.000 description 1
- 239000007900 aqueous suspension Substances 0.000 description 1
- 238000000149 argon plasma sintering Methods 0.000 description 1
- 238000003149 assay kit Methods 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 238000010009 beating Methods 0.000 description 1
- RIIWUGSYXOBDMC-UHFFFAOYSA-N benzene-1,2-diamine;hydron;dichloride Chemical compound Cl.Cl.NC1=CC=CC=C1N RIIWUGSYXOBDMC-UHFFFAOYSA-N 0.000 description 1
- 102000023732 binding proteins Human genes 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 108091008394 cellulose binding proteins Proteins 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 230000006329 citrullination Effects 0.000 description 1
- 238000004737 colorimetric analysis Methods 0.000 description 1
- 238000007398 colorimetric assay Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 238000003271 compound fluorescence assay Methods 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 238000006114 decarboxylation reaction Methods 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000000586 desensitisation Methods 0.000 description 1
- 229910003460 diamond Inorganic materials 0.000 description 1
- 239000010432 diamond Substances 0.000 description 1
- 238000003748 differential diagnosis Methods 0.000 description 1
- 239000012470 diluted sample Substances 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 239000006196 drop Substances 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 239000003889 eye drop Substances 0.000 description 1
- 229940012356 eye drops Drugs 0.000 description 1
- 239000012894 fetal calf serum Substances 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 238000000799 fluorescence microscopy Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000012215 gene cloning Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 231100000869 headache Toxicity 0.000 description 1
- 230000033444 hydroxylation Effects 0.000 description 1
- 238000005805 hydroxylation reaction Methods 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000000951 immunodiffusion Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 238000007919 intrasynovial administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 230000000155 isotopic effect Effects 0.000 description 1
- -1 latex Chemical class 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 230000005291 magnetic effect Effects 0.000 description 1
- 230000005389 magnetism Effects 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 230000003340 mental effect Effects 0.000 description 1
- WSFSSNUMVMOOMR-NJFSPNSNSA-N methanone Chemical compound O=[14CH2] WSFSSNUMVMOOMR-NJFSPNSNSA-N 0.000 description 1
- 238000000386 microscopy Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 230000007971 neurological deficit Effects 0.000 description 1
- 230000002276 neurotropic effect Effects 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 150000002894 organic compounds Chemical class 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 150000002989 phenols Chemical class 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 239000007981 phosphate-citrate buffer Substances 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 238000013081 phylogenetic analysis Methods 0.000 description 1
- 230000003169 placental effect Effects 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- 239000012898 sample dilution Substances 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000011896 sensitive detection Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 238000011895 specific detection Methods 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 239000012089 stop solution Substances 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 229920001059 synthetic polymer Polymers 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229960004906 thiomersal Drugs 0.000 description 1
- 230000001296 transplacental effect Effects 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- YFTHZRPMJXBUME-UHFFFAOYSA-N tripropylamine Chemical compound CCCN(CCC)CCC YFTHZRPMJXBUME-UHFFFAOYSA-N 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 210000003501 vero cell Anatomy 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 206010048282 zoonosis Diseases 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/24011—Flaviviridae
- C12N2770/24111—Flavivirus, e.g. yellow fever virus, dengue, JEV
- C12N2770/24122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/18—Togaviridae; Flaviviridae
- G01N2333/183—Flaviviridae, e.g. pestivirus, mucosal disease virus, bovine viral diarrhoea virus, classical swine fever virus (hog cholera virus) or border disease virus
- G01N2333/185—Flaviviruses or Group B arboviruses, e.g. yellow fever virus, japanese encephalitis, tick-borne encephalitis, dengue
Definitions
- the present invention relates to a recombinant or chemically synthesized polypeptide comprising SEQ ID N01 or a variant thereof, a diagnostically useful carrier comprising in means for specifically capturing an antibody to SEQ ID N01 in a sample from a subject, a kit comprising the polypeptide or a diagnostically useful carrier, and a method for diagnosing, prognosing or monitoring the treatment of a virus, preferably Flavivirus, more preferably POWV infection comprising the step detecting in the sample from a subject the presence or absence of an antibody to SEQ ID N01 and/or an antibody to SEQ ID N02, and a use of a polypeptide comprising SEQ ID N01 and/or a SEQ ID N02 or a variant thereof for the diagnosis and a use of an IgM antibody to SEQ ID N01 or in means for specifically capturing an IgM class antibody to SEQ ID N01 for increasing the diagnostic reliability of an immuno- assay for the diagnosis of a virus infection.
- a diagnostically useful carrier compris
- Tick-borne diseases are a major public health concern for the great Great Lakes region of the mid-Eastern United States to the sub-Saharan deserts of Africa. Ticks carry agents cause a wide array of clinical pathologies which are protozoan bacterial or viral in origin. Among them is the Powassan virus (POWV), which was first reported in 1958 in Powassan, Ontario, US. POWV is endemic in the north-east and upper mid-west of the United States, and cases have also been reported in far-eastern Russia. Like other tick-borne diseases, POWV is a diagnostic challenge because of its versatility of clinical presentation and the unpredictability of the cause of the illness.
- POWV Powassan virus
- POWV infection The symptoms of POWV infection vary from person to person, as some are asymptomatic and others have a more progressive cause, meaning that a significant number, possibly the majority of patients remain undiagnosed. However, a POWV infection not recognized as such can develop to a rapidly progressing, neurological disease. Symptoms include head- ache, fever, focal neurological deficits, confusion, generalized weakness, ataxia, somno- lence, speech problems, aphasia and dysarthria. The fatality rate is 10%, and about 50% of those people who developed neurological symptoms end up with long-term deficits.
- POWV is one of the more distant relatives of the ZIKV (Wong, S.S., Poon, R.W., Wong, S.C. (2016) Zika virus infec- tion-the next wave after dengue?, Journal of the Formosan Medical Association, http://doi.Org/10.1016/j.jfma.2016.02.002).
- tick-borne diseases such as POWV infection represents a clinical chal- lenge.
- Imaging methods including computer tomography (CT) scans and magnetic reso- nance imaging (MRI) of the brain may be employed.
- CT computer tomography
- MRI magnetic reso- nance imaging
- acute presentations of POWV will show no abnormalities on a CT scan unless there is intraparenchymal beating and subdural haematoma.
- MRI cannot be employed in an emergency setting as it requires a patient to be still throughout the scan. No imaging method at present may be used to provide the specific diagnosis of an infectious disease.
- the state of the art discloses a range of diagnostic tests centering around the detection of antibodies to Flavivirus NS1 and GpE polypeptides from Flaviviruses other than POWV.
- the Anti-West Nile Virus ELISA (IgM) (product no. El 2662-9601 M) commercialized by EUROIMMUN Medizinische Labordiagnostika, Liibeck, Germany is based on the detection of WNV IgM antibodies to WNV GpE.
- the manufacturer’s instructions disclose that signifi- cant cross reactivity with IgM to GpE from various other pathogens is an issue. For example, approximately 25 % of sera from patients suffering from Dengue virus infection were tested positive.
- WO2017/144174 discloses the detection of antibodies to SEQ ID N02, but not to SEQ ID N01.
- WO2017/174193 discloses a diagnostic carrier for the detection of ZIKV comprising a ZIKV GpE and a ZKV NS1 antigen. POWV, let alone reagents for the detection of POWV, are not disclosed. It is disclosed that ZKV GpE antigen shows a high cross reactivity towards antibodies to other Flaviviruses.
- a problem underlying the present invention is to provide a serological assay for the diagnosis of a virus, preferably Flavivirus, more preferably POWV infection.
- Another problem underlying the present invention is to provide a serological assay for the diagnosis of a virus, preferably Flavivirus, more preferably POWV infection, with excellent diagnostic reliability or increased diagnostically reliability relative to state of the art assays, in particular in terms of specificity and/or sensitivity.
- the assay is based on the detection of a single antibody.
- Another problem underlying the present invention is to provide methods and reagents for such an assay.
- the problem underlying the present invention is solved by a recombinant or chemically synthesized polypeptide comprising SEQ ID N01 or a variant thereof, preferably in an isolated form.
- a diagnostical- ly useful carrier comprising a means for specifically capturing an antibody to SEQ ID N01 , and/or a means for specifically capturing an antibody to SEQ ID N02, in a sample from a subject.
- the diagnostically useful carrier is selected from the group corn- prising a bead, preferably a paramagnetic bead, a test strip, a microtiter plate, a membrane, preferably from the group comprising western blot, line blot and dot blot, a lateral flow device, a glass surface, a slide, a microarray, and a biochip.
- the problem is solved by a kit comprising the polypeptide or the diagnosti- cally useful carrier, preferably further comprising a means for specifically detecting a captured antibody to SEQ ID N01 and/or a means for specifically detecting a captured antibody to SEQ ID N02.
- the means for specifically detecting a captured antibody to SEQ ID N01 is a secondary antibody recognizing IgM class antibodies.
- the means for specifically detecting captured antibody to SEQ ID N02 is a secondary antibody recognizing IgG or IgM, preferably IgG class antibodies.
- the kit further comprises a recombinant or monoclonal antibody to SEQ ID N02 and/or a recombinant or monoclonal antibody to SEQ ID N01.
- the problem underlying the present invention is solved by a method for diagnosing, prognosing and monitoring the treatment of a virus, preferably Flavivirus, more preferably POWV infection comprising the step detecting in a sample from a subject the presence of an antibody to SEQ ID N01 and/or an antibody to SEQ ID N02, preferably SEQ ID N01.
- the problem underlying the present invention is solved by a method for distinguishing a POWV infection from another viral infection, preferably with a Flavivirus other than POWV, comprising the step detecting in a sample from a subject the presence of an antibody to SEQ ID N01 and/or an antibody to SEQ ID N02, preferably SEQ ID N01.
- the problem underlying the present invention is solved by a method comprising the step immobilizing on a diagnostically useful carrier a means for specifically capturing an antibody to SEQ ID N01 and/or a means for specifically capturing an antibody to SEQ ID N02, preferably a means for specifically capturing an antibody to SEQ ID N01 , wherein the diagnostically useful carrier is preferably selected from the group comprising a bead, preferably a paramagnetic bead, a test strip, a microtiter plate, a membrane, prefera- bly from the group comprising western blot, line blot and dot blot, a lateral flow device, a glass surface, a slide, a microarray and a biochip.
- the diagnostically useful carrier is preferably selected from the group comprising a bead, preferably a paramagnetic bead, a test strip, a microtiter plate, a membrane, prefera- bly from the group comprising western blot, line
- the problem underlying the present invention is solved by a use of a polypeptide comprising SEQ ID N01 and/or a SEQ ID N02 or a variant thereof for the diagnosis of a Flavivirus, preferably POWV infection or for the manufacture of a kit for the diagnosis of a Flavivirus, preferably POWV infection, wherein preferably a POWV infection is distinguished from an infection with a Flavivirus other than POWV.
- the antibody to SEQ ID N02 is an IgG or IgM, preferably IgG class antibody.
- the antibody to SEQ ID N01 is an IgM class antibody.
- the problem underlying the present invention is solved by a use of an IgM antibody to SEQ ID N01 or a means for specifically capturing an IgM class antibody to SEQ ID N01 for increasing the diagnostic reliability, preferably specificity of an immunoas- say for the diagnosis of a virus, preferably Flavivirus, more preferably POWV infection.
- the sample comprises antibodies from the patient, including the antibodies from the anti- body classes to be detected, for example IgM or IgG class antibodies. Preferably it compris- es a representative set of the entirety of the patient’s antibodies. In another preferred embodiment, the antibodies from the class of antibodies to be detected are enriched, more preferably isolated. In a preferred embodiment, the sample is a blood, preferably plasma or serum or CSF sample, preferably a serum sample.
- the present invention is based on the inventors’ surprising finding that antibodies to SEQ ID N01 and/or NS1 may be used for the sensitive and specific diagnosis of an infection, preferably with POWV. Moreover, the invention is based on the inventors’ surprising finding that the presence of class IgM antibodies to SEQ ID N01 is a significantly more sensitive and specific indicator of infection than antibodies to GpE homologues of other Flaviviruses.
- the polypeptide may be a recombinant protein, wherein the term “recombinant”, as used herein, refers to a polypeptide produced using genetic engineering approaches at any stage of the production process, for example by fusing a nucleic acid encoding the polypeptide to a strong promoter for overexpression in cells or tissues or by engineering the sequence of the polypeptide itself.
- the person skilled in the art is familiar with methods for engineering nucleic acids and polypeptides encoded (for exam- pie, described in Sambrook, J., Fritsch, E. F. and Maniatis, T. (1989), Molecular Cloning, CSH or in Brown T. A.
- the polypeptide is POWV GpE, which has or comprises SEQ ID N01 or A0A166AJ81 (Uniprot), preferably SEQ ID N01.
- any data base code used refers to the sequence available from said data base on the first priority date relating to said application.
- POWV NS1 polypeptide may be used, which has or comprises SEQ Dl N02 from the present application or SEQ ID N019 from WO2017/144174, preferably SEQ Dl N02 from the present application.
- the polypeptide according to the present invention and used for the various embodiments of the present invention is an isolated polypeptide, wherein the term “isolated”, as used herein, means that the polypeptide has been enriched compared to its state upon production using a biotechnological or synthetic approach and is preferably pure, i.e. at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 95 or 99 percent of the polypeptide in the respective sample consists of said polypeptide as judged by SDS polyacrylamide gel electrophoresis followed by Coomassie blue staining and quantitative determination using a computer-aided densitometer.
- the term“variant”, as used herein, may refer to at least one fragment of the full length sequence referred to, for example SEQ ID N01 or SEQ ID N02, more preferably SEQ ID N01 , more specifically one or more amino acid or nucleic acid sequence which is, relative to the full-length sequence, truncated at one or both termini by one or more amino acids.
- a fragment comprises or encodes for a peptide having at least 10, 13, 15, 25, 50, 75, 100, 150, 200, 250 or 300 successive amino acids of the original sequence or a variant thereof.
- the total length of the variant may be at least 13, 25, 30, 40, 50, 60, 70, 80, 90, 100 or more amino acids.
- the term "variant" relates not only to at least one fragment, but also a polypeptide or a fragment thereof comprising amino acid sequences, preferably a fragment comprising at least 25, more preferably 50, more preferably 200, more preferably 300, more preferably 350 successive amino acids, that are at least 40, 50, 60, 70, 75, 80, 85, 90, 92, 94, 95, 96, 97, 98 99, 99.4, 99.5, 99.6, 99.7, 99.8 or 99.9 % identical to the reference amino acid sequence referred to or the fragment thereof, wherein amino acids other than those essential for the biological activity, for example the ability to bind specifically to an antibody of interest, or the fold or structure of the polypeptide are deleted or substitut- ed and/or one or more such essential amino acids are replaced in a conservative manner and/or amino acids are added or deleted such that the biological activity of the polypeptide is at least partially preserved.
- Known methods comprise various methods that may be used to align two given nucleic acid or amino acid sequences and to calculate the degree of identity, see for example Arthur Lesk (2008), Introduction to bioinformatics, Oxford University Press, 2008, 3 rd edition.
- the ClustalW software (Larkin, M. A., Black- shields, G., Brown, N. P., Chenna, R., McGettigan, P. A., McWilliam, H., Valentin, F., Wallace, I. M., Wilm, A., Lopez, R., Thompson, J. D., Gibson, T. J., Higgins, D. G. (2007): Clustal W and Clustal X version 2.0.
- SEQ ID N01 include the peptides EDLALPWKHKDNQD, DLALPWKHKDNQ, LALPWKHKDNQD, ALPWKHKDNQDW, LPWKHKDNQDWN and PWKHKDNQDWNS, which bind to IgM and IgG antibodies to SEQ ID N01.
- variants may, in addition, comprise chemical modifications, for example isotopic labels or covalent modifications such as glycosylation, phosphorylation, acetylation, decarboxylation, citrullination, hydroxylation and the like.
- chemical modifications for example isotopic labels or covalent modifications such as glycosylation, phosphorylation, acetylation, decarboxylation, citrullination, hydroxylation and the like.
- variants may also be generated by way of fusion with other known polypeptides or other variants.
- the variant of the polypeptide has biological activity.
- biological activity is the ability to bind to, preferably capture specifically the respective antibody if the variant is a variant of a sequence from the group comprising SEQ ID N01 , or SEQ ID N02, preferably SEQ ID N01.
- a variant of SEQ ID N01 has the ability to capture specifically an antibody to SEQ ID N01 in a sample obtained from a subject suffering from or suspected of suffering from a viral infection, preferably POWV infection.
- Such variants have at least one epitope recognized by the antibody to be captured, for example one epitope in SEQ ID N01 if an antibody to SEQ ID N01 is captured.
- a variant of SEQ ID N02 has the ability to capture specifically an antibody to SEQ ID N02 in a sample from a subject suffering from or suspected of suffering from a viral infection, preferably POWV infection.
- the person skilled in the art is capable of designing variants by starting from the original SEQ ID N01 sequence, introducing modifications such as point mutations, truncations and the like and subsequently confirming that the variant still has biological activity by testing whether said variant binds to an antibody to SEQ ID N01 in a sample obtained from a subject suffering from the disease to be diagnosed, preferably an infection, more preferably a viral infection, more preferably an infection with a Flavivirus, most preferably an infection with POWV.
- the 3D protein structure of homologues of SEQ ID N01 or SEQ ID N02 have been published and may be used for guidance in the design of variants and choice of the sequences that may be varied without compromising the biological activity and to distinguish them from important epitopes (for example Xu et al., Contribution of intertwined loop to membrane association revealed by Zika virus full-length NS1 structure (EMBO J., published on August 30, 2016, open access; Akey et al., Flavivirus NS1 structures reveal surfaces for associations with membranes and the immune system, Science 21 ;343(6173):881-5. doi: 10.1 126/science; WO2015/095735).
- Variants may be identified by identifying naturally occurring fragments derived from the full-length protein or a precursor thereof, for example by purifying them using a polypeptide comprising SEQ ID N01 or SEQ ID N02, preferably SEQ ID N01 , as an affinity ligand followed by N-terminal Edman sequencing and/or tryptic digest in combination with mass spectrometry, and using them to practice the invention. Conservative amino acid substitutions may be used for all variants.
- a diagnostically useful carrier comprising a means for specifically capturing an antibody to an antigen such as SEQ ID N01 or SEQ ID N02, preferably SEQ ID N01.
- an antigen such as SEQ ID N01 or SEQ ID N02, preferably SEQ ID N01.
- the term“specifically capturing an antibody”, as used herein refers to the ability to bind specifically to the antibody of interest, preferably an IgA, IgM or IgG class antibody, to the effect that it is bound and may be removed from the sample, whereas other antibodies, preferably from the same class and/or to another antigen, are essentially not bound and remain in the sample.
- the antibody is preferably an antibody that binds to the antigen of interest only such as the one represented by SEQ ID N01 or SEQ ID N02, preferably SEQ ID N01.
- the diagnostically useful carrier according to the invention serves as a scaffold for the one or more means for specifically capturing an antibody, preferably a diagnostically relevant antibody to a Flavivirus antigen such as the one represented by SEQ ID N01.
- Said carrier is suitable for carrying out a diagnostic method.
- the diagnostically useful carrier is a diagnostic device, preferably selected from the group comprising a bead, preferably a paramagnetic bead, a test strip, a microtiter plate, a microarray, a blot and a membrane, and is preferably a line blot or microtiter plate, more preferably a microtiter plate.
- the carrier may comprise one or more controls, preferably all from the group comprising an IgM conjugate control, which confirms that a secondary antibody recognizing human IgM has been added, an IgG conjugate control, which confirms that a secondary antibody recognizing human IgG has been added, an IgA conjugate control, which confirms that a secondary antibody recognizing human IgA has been added, a serum control, which confirms that serum has been added, a negative control, which shows that there is no false positive signal, a positive control, which shows that there is no false negative signal, and one or more calibrator controls, which are preferably weak positive spots that allow for a semi-quantitative determi- nation.
- an IgM conjugate control which confirms that a secondary antibody recognizing human IgM has been added
- an IgG conjugate control which confirms that a secondary antibody recognizing human IgG has been added
- an IgA conjugate control which confirms that a secondary antibody recognizing human IgA has been added
- a serum control
- the carrier may comprise a separation band, which may indicate the spatial separation of bands, for example the control bands on one hand and the antigen bands on the other.
- the carrier may comprise a cut-off band or solution, which may indicate the minimum signal for a positive result.
- the carrier may comprise a coloring control, which may indicate that a coloring solution required for showing the presence of a detectable label, has been added.
- the diagnostically useful carrier may be a slide, preferably glass or plastic slide for micros- copy, comprising one or more eukaryotic cells, each spatially separated from each other and each expressing a polypeptide that is a means for specifically capturing an antibody.
- the one or more eukaryotic cells may be live cells, but are preferably fixed cells. State of the art protocols are available for fixing cells, for example using methanol or formaldehyde. Indirect immunofluorescence may be used to detect an antibody captured using such a carrier.
- One cell may comprise POWV GpE or a variant thereof.
- a cell may comprise POWV NS1 or a variant thereof.
- a cell may comprise a GpE protein from a Flavivirus other than POWV.
- a cell may comprise a GpE protein from a Flavivirus other than POWV.
- the cells may be arranged and the slide configured such that one drop of sample added is exposed to two or more cells at the same time, with barriers preventing cross-contamination in subsequent washing and developing reactions.
- the cells may be arranged and the carrier configured such that two or more cells may be examined simultaneously under a micro- scope.
- the diagnostically useful carrier may be a bead configured for an immunoassay comprising a polypeptide comprising SEQ ID N01 or a variant thereof.
- the bead is a solid bead comprising carbohydrate such as sepharose or synthetic polymer such as latex, preferably a paramagnetic bead, which may be removed from a solution and concentrated, preferably at the surface of a vessel, by applying a magnetic field.
- the bead comprises a means for capturing an antibody linked to the bead by a covalent or non- covalent bond.
- a mixture of beads for example one of which linked to SEQ ID N01 or a variant thereof, and/or one linked to SEQ ID N02 or a variant thereof, may be used.
- the diagnostically useful device is a microtiter plate comprising a range of wells configured for an immunoassay such as an ELISA assay.
- the microtiter plate comprises a well coated with a means for specifically capturing an antibody to SEQ ID N01 and or SEQ ID N02, preferably SEQ ID N01 , which means is preferably a polypeptide comprising SEQ ID N01 and or SEQ ID N02 or a variant thereof.
- the term“microtiter plate” is a diagnostic device, preferably made from glass or plastic, more preferably plastic, comprising one or more, preferably more than one, more preferably at least 8 wells, in which reactions in liquid buffer may be run separately without cross-contamination.
- At least one of the wells is coated with a polypeptide, preferably an antigenic polypeptide that may be used to specifically capture a diagnostically useful antibody. If more than one means for specifically detecting an antigen is used, then prefera- bly each means is in a well separate from other means.
- the microtiter plate may be used for running several samples in parallel, preferably in an automated fashion.
- the wells are preferably compatible with at least one routine detection techniques such colorimetry, immunofluorescence, detection of enzymatic activity, chemiluminscence, radioactivity or the like.
- a separate well may include one or more antigens for detecting another Flavivirus infection and may preferably comprise a means for capturing an antibody to a GpE from a Flavivirus other than POWV.
- a separate well may comprise a means for capturing an antibody to a NS1 from a Flavivirus other than POWV.
- a separate well comprise a Flavivirus other than POWV.
- the term“specifically detecting a captured antibody”, as used herein, means that the antibody binding specifically to the means for specifically capturing the antibody, preferably a polypeptide comprising SEQ ID N01 or SED ID N02, preferably SEQ ID N01 or a variant thereof, following capture, binds specifically to the means for detecting the antibody, for example a secondary antibody.
- the term“specifically capturing an antibody”, as used herein, means that the means for specifi- cally capturing an antibody binds specifically to the antibody and does not bind, at a signifi- cant or detectable level to any other antibody.
- the term“binding specifically”, as used herein, means that the binding is stronger than a binding reaction characterized by a dissociation constant of 1 x 10 5 M, more preferably 1 x 10 7 M, more preferably 1 x 10 M, more preferably 1 x 10 M, more preferably 1 x 10 M, more prefera- bly 1 x 10 11 M, more preferably 1 x 10 12 M, as determined by surface plasmon resonance using Biacore equipment at 25 °C in PBS buffer at pH 7.
- the term“specifically detecting of an antibody”, which antibody belongs to a certain class of antibodies, for example IgA, IgM or IgG class antibodies, means that said antibody is detected in an assay spatially separated from any binding reaction involving the detection of antibodies to the same antigen associated with another class and, more preferably, no antibody from another class against the same antigen is detected in the same reaction, for example an ELISA well.
- the assay is carried out such that the readout allows to distinguish between antibody classes, for example IgG or IgM antibodies from other antibody classes, and to conclude and detect specifically to which antibody class the detected antibody belongs or to detect only a specific class of antibody to an antigen of interest, preferably IgM antibodies to SEQ ID N01 or IgG antibod- ies to SEQ ID N02. This does not rule out that antibodies to the same antigen, but associat- ed with another class of antibodies, may be detected in a spatially separate reaction simultaneously.
- antibody classes for example IgG or IgM antibodies from other antibody classes
- binding reactions involving the same antigen such as SEQ ID N01 or SEQ ID N02 or a variant thereof may be run in separate wells of an ELISA micro- titerplate, but may be developed using secondary antibodies binding to different classes of antibodies, for example IgM and IgG, respectively.
- an antibody from one Ig class only is detected, preferably from the group comprising IgG, IgM and IgA, preferably IgM.
- an IgM antibody is detected, IgG or IgA antibodies binding to the same means for capturing an antibody will not be detected.
- two separate vessels such as wells in a microtiter plate may comprise the same means for specifically capturing the antibody, but the antibody captured may be detected using two different means for specifically detecting, for example secondary antibod- ies, for example a secondary antibody for specifically detecting an IgG class antibody and a secondary antibody for detecting an IgM class antibody.
- an IgM class antibody to PWV GpE is detected.
- an IgG class antibody to PWV GpE is detected.
- an IgA class antibody to PWV GpE is detected.
- an IgM class antibody to PWV NS1 is detected.
- an IgG class antibody to PWV NS1 is detected. In a preferred embodiment, an IgA class antibody to PWV NS1 is detected. In a more preferred embodiment, an IgM antibody to GpE from a flavivirus other than PWV is detected in addition. In a more preferred embodiment, an IgG antibody to GpE from a flavivirus other than PWV is detected in addition. In a more preferred embodiment, an IgA antibody to GpE from a flavivirus other than PWV is detected in addition. In a more preferred embodiment, an IgM antibody to NS1 from a flavivirus other than PWV is detected in addition.
- an IgG antibody to NS1 from a flavivirus other than PWV is detected in addition.
- an IgA antibody to NS1 from a flavivirus other than PWV is detected in addition.
- a means for specifically detecting a captured antibody refers to a reagent that binds specifically to the captured antibody, preferably to its constant region, such that the antibody captured or to be captured remains capable of binding to its antigen.
- the sequence of the constant region depends on the organism from which the sample is taken and analyzed, and the antibody class.
- the means binds to human IgA, IgM or IgG class antibodies. If an antibody to SEQ ID N01 is detected, it is preferred that the secondary antibody recognizes the constant region of IgM class antibodies. If an antibody to SEQ ID N02 is detected, it is preferred that the secondary antibody recognizes constant region of IgG class antibodies.
- the means for specifically detecting a captured antibody is selected from the group comprising a secondary antibody, an aptamer and an anticalin (Skerra, A. (2008). "Alternative binding proteins: anticalins - harnessing the structural plasticity of the lipocalin ligand pocket to engineer novel binding activities". FEBS J. 275 (11 ): 2677-83) and is most preferably a secondary antibody.
- a secondary antibody may be a mammalian antibody, more preferably selected from the group comprising a cow, goat, chicken, rat, murine, porcine, equine or rabbit antibody.
- the means may comprise a detect- able label, preferably from the group comprising an enzymatically active, colored label, preferably from the group comprising a gold and a latex label, chemiluminescent and fluorescent label.
- a polypeptide preferably comprising one or more sequences selected from the group comprising SEQ ID N01 or SEQ ID N02, preferably SEQ ID N01 , when used to carry out the teachings of the present invention, may be provided in any form and at any degree of purification, from tissues or cells comprising said polypeptide in an endogenous form, more preferably cells overexpressing the polypeptide, crude or enriched lysates of such cells, to purified and/or isolated polypeptide which may be essentially pure.
- the term “overexpressing”, as used herein, means that the cell, preferably a eukaryotic, more prefera- bly a mammalian or insect, more preferably a mammalian, more preferably a human cell, most preferably a HEK293 or HEK293T cell, has been genetically engineered such that it expresses more of the protein of interest than a non-engineered wild type cell would.
- the polypeptide is a native polypeptide, wherein the term“native polypeptide”, as used herein, refers to a folded polypeptide comprising at least 15, 30, 50, 100 150, 200, 300 or 350 amino acids, preferably more than 30 amino acids, more prefera- bly to a folded polypeptide purified from tissues or cells, more preferably from mammalian cells or tissues, optionally from non-recombinant tissues or cell.
- the polypeptide is a linear peptide having at least 7, more preferably at least 10 amino acid residues. If a native polypeptide is used, it is preferably enriched compared to its natural state.
- a recombinant polypeptide may comprise a C-terminal or N-terminal tag for affinity purification, immobilization or detection such as a His tag, as exemplified by SEQ ID NO 3 or SEQ ID N04, or a streptavidin tag, preferably a streptavidin, which tag may preferably be removed by cleavage using a protease recognizing a protease cleavage site in a polypeptide linker between the tag and the N terminus or C-terminus, respectively, as part of the purifica- tion or method.
- the cleaved polypeptide may subsequently be attached to a diagnostically useful carrier to yield the diagnostically useful carrier according to the present invention.
- the means for specifically capturing an antibody is a POWV- infected eukaryotic, preferably human cell.
- a POWV- infected eukaryotic preferably human cell.
- Such a cell may be evaluated by fluorescence microscopy.
- the cells may be transiently or stably transfected, preferably transiently trans- fected, preferably with a vector comprising a sequence encoding SEQ ID N01 or SEQ ID N02, preferably SEQ ID N02, under the control of an inducible or constantly induced promotor.
- Said means for specifically capturing an antibody, together with the insoluble carrier to which it is attached, may be separated from a sample from a subject in a straightforward manner, for example by filtration, centrifugation, magnetism or decanting.
- Said means may be immobilized in a reversible or irreversible manner. For example, the immobilization is reversible if the means interacts with the carrier via ionic interactions which may be masked by addition of a high concentration of salt or if the molecule is bound via a cleavable covalent bond or a non-covalent bond.
- the immobilization is irreversible if the means is tethered to the carrier via a covalent bond that cannot be cleaved in aqueous solution.
- the means may be indirectly immobilized, for example by immobilizing an antibody or other entity having affinity to the polypeptide, followed by addition of the means and formation of a means-antibody complex.
- a non-covalent bond may be made by chemically attaching a ligand to the carrier, preferably via a covalent bond, and fusing to the means a polypeptide having affinity to the ligand.
- the ligand is selected from the group comprising biotin, in which case the polypeptide having affinity may be streptavidin or a variant thereof binding to biotin, glutathione (polypeptide having affinity: glutathione-S- transferase), Nickel (polypeptide having affinity: His tag), Flag tag (polypeptide having affinity: anti-flag antibody), carbohydrate such as maltose or cellulose (polypeptide having affinity: maltose or cellulose binding protein), and is preferably biotin.
- a nucleic acid encoding the polypeptide according to the present invention such as a polypeptide comprising SEQ ID N01 or SEQ ID N02, preferably SEQ ID N01 or a variant thereof, optionally with an inducible promotor, which polypeptide is preferably for use for the diagnosis of a disease or the manufacture of a kit or reagent for such use, is provided.
- Said nucleic acid may be a part of a vector, preferably for expressing said nucleic acid.
- a eukaryotic or prokaryotic, preferably eukaryotic cell comprising this vector and preferably expressing the polypeptide encoding by the vector, is also provided.
- the nucleic acid, the vector and the cell may be used for the manufacture of a kit for use according to the present invention such as use of an antibody to SEQ ID N01 or SEQ ID N02, preferably SEQ ID N01.
- the nucleic acid may be expressed, the polypeptide encoded purified and used, preferably immobilized on a diagnostically useful carrier, in order to make the diagnostically useful carrier according to the present invention.
- the nucleic acid may be used to design and prepare a nucleic acid construct encoding a variant of the polypeptide for expression and use of the resulting variant for the preparation of a diagnostically useful carrier and for the detection of the respective antibody such as an antibody to SEQ ID N01 or SEQ ID N02, preferably SEQ ID N01.
- kits preferably for diagnosing an infection, more preferably for diagnosing a flavivirus infection, most preferably a POWV infection.
- a kit is a container that comprises specific reagents required to practice the inventive method, in particular the diagnostically useful carrier according to the present invention, optionally in addition to one or more reagents and solutions required to practice the inventive method, preferably selected from or all from the group comprising sample dilution buffer, washing buffer and a means for detecting any specifically captured antibody and optionally a means for detecting the specifically captured antibody, which may optionally be attached to the secondary antibody, for example a fluorescent, enzymatically active, radioactive, chemilumi- nescent, preferably electrochemiluminscent label or a spin label.
- the kit may comprise a chemical solution for carrying out a detection reaction such as 3,3',5,5'-tetramethylbenzidine, p-Nitrophenyl Phosphate, 2,2'-Azinobis [3-ethylbenzothiazoline-6-sulfonic acid or o- phenylenediamine dihydrochloride for a colorimetric reaction tripropylamin for an electro- chemiluminescence reaction.
- it may comprise instructions detailing how to use the kit and the inventive diagnostically useful carrier for contacting the inventive polypeptide with a bodily fluid sample from a subject, preferably a human subject.
- the kit may comprise a negative and/or a positive control serum, more preferably both.
- the kit may comprise a coloring or developing solution for showing the presence of a detectable label depending on this, for example an enzymatically active or chemiluminescent label, respectively.
- the kit may comprise a positive control, for example a recombinant antibody known to bind to SEQ ID N01 and/or a recombinant antibody known to bind to SEQ ID N02, and a negative control, for example a protein having no detectable affinity to SEQ ID N01 or to SEQ ID N02.
- the kit may comprise one or more calibrators, which is preferably a solution comprising a SEQ ID N01-binding and/or SEQ ID N02-binding, preferably SEQ ID N01 -binding antibody for preparing a calibration curve.
- the kit comprises more than one, preferably three or more calibrators comprising different concentrations of an antibody to SEQ ID N01 , which antibody is preferably recognized by a secondary antibody to human IgM class antibodies.
- the kit comprises at least one antibody to SEQ ID N02, which antibody is preferably recognized by a secondary antibody to human IgG class antibodies.
- Such calibrator may be or comprise a chimeric antibody comprising a human constant region and optionally a variable region from a mammal other than a human. If more than one calibrator is used, the two or more calibra- tors comprise different concentrations of the antibody, preferably at a range of concentra- tions that allow the user to set up a calibration curve.
- IgG class antibodies may be removed or their concentration may be decreased prior to determining the IgM class antibodies. This may be achieved by pre-absorbing IgG class antibodies, for example by contacting them with an anti-lgG antibody, for example a mammalian, preferably goat anti-human IgG antibody. This antibody may absorb IgG antibodies that may interfere with the IgM detection assay. Suitable reagents are commer- cially available, for example EUROSORB commercialized by EUROIMMUN, Liibeck. Alternatively, this may be achieved by isolating the entirety of IgM class antibody prior to detecting an IgM antibody to SEQ ID N01 or SEQ ID N02, preferably SEQ ID N01.
- a vaccine may be provided that comprises the polypeptide comprising SEQ ID N01 and/or the polypeptide comprising SEQ ID N02, preferably SEQ ID N01 or a variant thereof may be formulated with one or more diluents, one or more glidants, and/or one or more filling agents.
- suitable formulations is described in the state of the art, for example in US20130022631A1.
- the vaccine formulation may comprise, in addition to the purified polypeptide, a pharmaceutically accepted buffer such as phosphate or phosphate-citrate buffer in the pH range 6.4-7.5 with added stabilizing agents that may include one or more of the following, but is not limited to: human serum albumin, gelatin, reducing and non-reducing sugars, amino acids, polyols such as sorbitol and mannitol, glycerol organic and inorganic salts, polyvinyl pyrrolidone etc.
- the stable formulation may be in a liquid form is suitable for intramuscu- lar/intradermal/subcutaneous/intravenous administration in a human host.
- the stable formulation may be in a dry lyophilized form can be reconstituted with a suitable solvent before administration.
- the formulations may be suitable for oral and intranasal administra- tion in humans.
- composition or a vaccine which composition or immunogenic composition such as a vaccine comprises a polypeptide comprising SEQ ID N01 and/or SEQ ID N02, preferably SEQ ID N01 or a variant thereof
- An immunogenic composition or vaccine may comprise components to inactivate a virus or bacteria and stabilize the vaccine, helping to preserve the vaccine and prevent it from losing its potency over time.
- Adjuvants are added to vaccines to simulate the production of antibodies against the vaccine to make it more effective.
- An adjuvant could be organic or inorganic. The most common inorganic adjuvants for human vaccines include aluminum phosphate and alumi- num hydroxide. Organic adjuvants could be based on the organic compound squalene and an oil [squalene] in water adjuvant can be used.
- An immunogenic composition may comprise stabilizers that help the vaccine to maintain its effectiveness during storage, e.g., MgCI 2 , MgSQ 4 , lactose-sorbitol, or sorbitol-gelatin, and preservatives to prevent bacterial and fungal growth, e.g., thiomersal, formaldehyde, or phenol derivatives, antibiotics.
- the composition is preferably suitable for administration to a subject, preferably a mammalian subject, more preferably to a human.
- Such a pharmaceuti- cal composition may comprise a pharmaceutically acceptable carrier.
- the pharmaceutical composition may, for example, be administered orally, parenterally, by inhalation spray, topically, by eyedrops, rectally, nasally, buccally, vaginally or via an implanted reservoir, wherein the term “parentally”, as used herein, comprises subcutaneous, intracutaneous, intravenous, intramuscular, intra-articular, intrasynovial, instrasternal, intrathecal, intralesion- al and intracranial injection or infusion techniques.
- the pharmaceutical composition may be provided in suitable dosage forms, for example capsules, tablets and aqueous suspensions and solutions, preferably in sterile form. It may be used in a method of treatment of a disease, which method comprises administering an effective amount of the inventive polypeptide to a subject.
- the inventive method for diagnosing a Flavivirus infection may comprise the step detecting in a first sample from a subject an IgA class antibody to NS1 of a Flavivirus, preferably POWV, optionally further comprising detecting in said first sample an IgM and/or IgG class, prefera- bly IgM class antibody to NS1 of a Flavivirus, preferably POWV, such as SEQ ID N02 or a variant thereof.
- the method further comprises the step detecting in a second sample obtained from said subject an IgA class antibody to NS1 of said Fla- vivirus, optionally further comprising detecting in said second sample an IgM and/or IgG class, preferably IgM class antibody to NS1 of a Flavivirus such as SEQ ID N02, optionally further comprising detecting in said first sample an IgM and/or IgG class, preferably IgM class antibody to NS1 of a Flavivirus, more preferably SEQ ID N02.
- a dynamic titer of IgA or IgM preferably IgA class antibodies to NS1 of a Flavivirus, prefera- bly to SEQ ID N02, increasing and decreasing significantly relatively to the background before emergence of IgG class antibodies (i.e. seroconversion), may indicate an acute POWV infection, which is a primary Flavivirus infection.
- a parallel increase of IgA and IgG may indicate an acute POWV infection, which is a secondary Flavivirus infection.
- the first sample is obtained at least 3, 4, 5, 6 days, 1 , 2 3 or 4 weeks following the subject’s exposure or suspected exposure to a Flavivirus.
- the first sample is taken in the two weeks after onset of symptoms.
- the presence or absence of antibodies may be determined as well as their relative levels over time.
- the second sample may be obtained at least 3, 4, 5, 6 days, 1 , 2, 4, 6, 8, 12, 16, 20, 24, 28 or 32 weeks later than the first sample, preferably at least 3 days, more preferably at least 7 days.
- a total number of at least 2, 3, 4, 5 or six samples may be taken, preferably at least 2 samples, optionally each sample at least 1 day, 3 days, one week, preferably one week after the previous sample.
- the total concentrations of IgG, IgM and/or IgA, preferably IgM may be determined in addition, for example to rule out insufficiencies. This way, the titers of the respective antibodies may be monitored over time.
- the titer of IgM, IgG and/or IgA, preferably IgA and IgG, more preferably IgA to NS1 , preferably to SEQ ID N02 is monitored by detecting the presence or absence or, preferably relative level over time for a period of at least 3, 4, 5, 6, 10, 14, 21 , 28, 35 or 42 days, preferably at least 6 days, with the first sample being taken at least five days, preferably at least 7 days following onset of the symptoms.
- Seroconversion may be detected by monitoring the presence or absence or relative level over time of IgG class antibodies to NS1 , preferably SEQ ID N02. This may help identify the time window in which the increase and decrease of IgM and/or IgA class antibodies would be expected or conclud- ing that this time window has passed.
- the inventive method, kit and carriers may be used to distinguish between a primary and a secondary Flavivirus infection, preferably POWV infection.
- the term“primary infection”, as used herein refers to an infection of a person who has never had an infection with said Flavivirus or another Flavivirus, preferably said Flavivirus, more preferably the POWV, by contrast to a secondary infection in a patient who has been exposed to a virus or immunogenic compositions derived thereof before. In a preferred embodiment, this may involve distinguishing a primary POWV infection from a secondary infection with another Flavivirus.
- a Flavivirus other than POWV may be selected from the group comprising dengue virus 1 , dengue virus 2, dengue virus 3, dengue virus 4, Yellow fever virus, Tick-borne encephalitis virus, Usutu virus, West Nile virus, Zika virus and Japanese encephalitis virus, or may refer to two or more viruses from this group, preferably all of them.
- an antibody to an NS1 from a Flavivirus other than POWV may be detected or the diagnostically useful carrier may comprise a means for capturing an antibody to an NS1 from a Flavivirus other than POWV.
- An NS1 protein from a Flavivirus other than POWV may comprise all or may be selected from the group comprising Zika NS1 (SEQ ID N01 from WO2017/144174), dengue virus 1 NS1 (SEQ ID N02 from WO2017/144174), dengue virus 2 NS1 (SEQ ID N03 from WO2017/144174), dengue virus 3 NS1 (SEQ ID N04 from WO2017/144174), dengue virus 4 NS1 (SEQ ID N05 from WO2017/144174), West Nile virus NS1 (SEQ ID N06 from WO2017/144174), Tick-borne encephalitis virus NS1 (SEQ ID N07 from WO2017/144174), Japanese encephalitis virus NS1 (SEQ ID N08 from Zika NS
- a GpE protein from a Flavivirus other than POWV may comprise all or may be selected from the group comprising Zika GpE (SEQ ID N011 from WO2017/144174), dengue virus 1 GpE (SEQ ID N012 from WO2017/144174), dengue virus 2 GpE (SEQ ID N033 from WO2017/144174), dengue virus 3 GpE (SEQ ID N014 from WO2017/144174), dengue virus 4 GpE (SEQ ID N015 from WO2017/144174), West Nile virus GpE (SEQ ID N016 from WO2017/144174), Tick-borne encephalitis virus GpE (SEQ ID N017 from WO2017/144174), Japanese encephalitis virus GpE
- an antibody to a GpE from a Flavivirus other than POWV may be detected or the diagnostically useful carrier may comprise a means for capturing an antibody to a GpE from a Flavivirus other than POWV.
- An GpE protein from a Flavivirus other than POWV may be selected from the group comprising Zika GpE (SEQ ID N01 1 from WO2017/144174), dengue virus 1 GpE (SEQ ID N012 from WO2017/144174), dengue virus 2 GpE (SEQ ID N013 from WO2017/144174), dengue virus 3 GpE (SEQ ID N014 from WO2017/144174), dengue virus 4 GpE (SEQ ID N015 from WO2017/144174) West Nile virus GpE (SEQ ID N016 from WO2017/144174), Tick-borne encephalitis virus GpE (SEQ ID N017 from WO2017/144174), Japanese encephalitis virus GpE (SEQ ID N0
- detecting or detecting the presence of an antibody optionally meaning determining whether the concentration of the antibody is beyond a certain threshold prefera- bly as set by measurement using ELISA, preferably as described in Example 1 , in the implicit detection limit by this method, often suggested by the detection limit, in the sample, is sufficient for the diagnosis. If the antibody can be detected, this will be information instru- mental for the clinician’s diagnosis and indicates an increased likelihood that the patient suffers from a disease.
- the relative concentration of the antibody in the serum compared to the level that may be found in the average healthy subject, may be determined.
- the term “detecting the presence”, as used herein, means that it is sufficient to check whether a signal sufficiently beyond any back- ground level may be detected using a suitable complex detection method that indicates that the antibody of interest is present or more antibody of interest is present than would be in a healthy subject. In a more preferred embodiment this may involve determining whether the concentration is at least 0.1 , preferably 0.2, 0.5, 1 , 2, 5, 10, 20, 25, 50, 100, 200, 500, 1000, 10000 or 100000 times higher than the concentration of the antibody of interest found in the average healthy subject.
- the term ..diagnosis refers to any kind of procedure aiming to obtain information instrumental in the assessment whether a patient suffers or is likely or more likely than the average or a comparative subject, the latter preferably having similar symptoms, to suffer from a certain disease or disorder in the past, at the time of the diagnosis or in the future, to find out how the disease is progressing or is likely to progress in the future or to evaluate the responsiveness of a patient with regard to a certain treatment, for example the administration of suitable drugs such as drugs for the desensitization of allergic patients.
- the term“diagnosis” comprises not only diagnosing, but also prognosticating and/or monitoring the course of a disease or disorder.
- the term“diagnosis” does preferably not imply that the diagnostic methods or agents according to the present invention will be definitive and sufficient to finalize the diagnosis on the basis of a single test, let alone parameter, but may refer to a contribution to what is referred to as a “differential diagnosis”, i.e. a systematic diagnostic procedure considering the likelihood of a range of possible conditions on the basis of a range of diagnostic parameters.
- the term“diagnosis” may also refer to a method or agent used to choose the most promising treatment regime for a patient. In other words, the method or agent may relate to selecting a treatment regimen for a subject.
- the invention may be used to provide a prognosis whether a pregnant woman’s newborn child is likely to suffer from a deformity if the sample from the pregnant woman is tested.
- the pregnant woman may have symptoms suggesting that she may suffer from a flaviviral infection or may very actually suffer from an infection.
- the present invention relates to a method comprising the step detecting in a sample from a subject the presence or absence of an antibody to an antigenic polypeptide such as a polypeptide comprising a SEQ ID N01 or SEQ ID N02, preferably SEQ ID N01 or a variant thereof.
- This method preferably comprises immobilizing said antibody followed by specific detection of said antibody, for example by way of the steps a) (optionally) providing a sample from a subject, b) contacting the sample with the diagnostically useful carrier according to the present invention under conditions compatible with the formation of a complex compris- ing the diagnostically useful carrier and the antibody, more specifically the means for specifically capturing the antibody and the antibody, c) isolating any said complex, for example by removing the sample, d) optionally washing said complex, and e) optionally detecting said complex.
- the method is preferably an in vitro method.
- the detection of the complex for the prognosis, diagnosis, methods or test kit comprises the use of a method selected from the group comprising immunodiffusion techniques, immunoelectrophoretic techniques, light scattering immunoassays, agglutination techniques, labeled immunoassays such as those from the group comprising radiolabeled immunoassay, enzyme immunoassays such as colorimetric assays, chemiluminscence, preferably electrochemiluminescence, immunoassays and immunofluorescence techniques.
- a method selected from the group comprising immunodiffusion techniques, immunoelectrophoretic techniques, light scattering immunoassays, agglutination techniques, labeled immunoassays such as those from the group comprising radiolabeled immunoassay, enzyme immunoassays such as colorimetric assays, chemiluminscence, preferably electrochemiluminescence, immunoassays and immunofluorescence techniques.
- the method may further involve testing the avidity of antibodies to SEQ ID N01 or SEQ ID N02 in the sample, preferably of antibodies to SEQ ID NQ1.
- SEQ ID NO 1 (mature sequence of POWV Glycoprotein E) ASMRCTHLENRDFVTGTQGTTRVSLVLELGGCVTITAEGKPSIDVWLEDIFQESPAETREYC
- SEQ ID NO 2 (mature sequence of POWV NS1)
- Fig. 1 shows SDS-PAGE and Coomassie staining of 1 pg purified recombinant GpE.
- 1 pg protein was separated on an 8-16 % denaturing iD-PAGE gel, documenting high protein purity. Molecular weight markers are indicated on the left.
- Fig. 2 shows SDS-PAGE and Coomassie staining of 1 pg purified recombinant NS1.
- 1 pg protein was separated on an 8-16 % denaturing iD-PAGE gel, documenting high protein purity. Molecular weight markers are indicated on the left.
- Fig. 3 shows the results of an ELISA-based assay for the detection of POWV glycoprotein E and NS1 IgM.
- Anti-POWV positive samples ⁇
- samples from healthy blood donors x
- Anti- DENV positive samples A
- Anti-WNV positive samples ⁇
- Anti-ZIKV positive samples ⁇
- the broken line defines a borderline range (Ratio 0.8 - 1.1 ).
- Fig. 4 shows the results of an ELISA-based assay for the detection of POWV glycoprotein E and NS1 IgG.
- Anti-POWV positive samples ⁇
- samples from healthy blood donors x
- Anti- DENV positive samples A
- Anti-WNV positive samples ⁇
- Anti-ZIKV positive samples ⁇
- the broken line defines a borderline range (Ratio 0.8 - 1.1 ).
- Recombinant POWV GpE was expressed in Sf9 cells using standard cloning and expression methods based on the pHEP plasmid with an artificial signal sequence and a C-terminal His tag (SEQ ID N01 ).
- Transfected cells were cultures at 27,5°C in Insect-XPRESSTM Protein- free Insect Cell Medium with L-glutamine for four days. Cells were harvested, resuspended in 20 mM Tris-HCI pH 7.4, 10% (w/v) sucrose, 5 mM EDTA, 1 mM PMSF and stored at - 80°C until further use.
- GpE cell culture supernatant was adjusted to 11 mmol/l MOPS pH7,0, 200 mmol/l sodium chloride, 50 mmol/l magnesium chloride, 20 mmol/l imidazole, cleared by centrifugation for 30 minutes at 17,600xg, 4°C, applied to Nickel Rapid Run (Agarose Bead Technologies, Miami, FL, USA) equilibrated with 10 mmol/l MOPS pH 7.0, 300 mmol/l sodium chloride, 20 mmol/l imidazole and eluted by increasing the imidazole concentration to 150 mmol/l. All fractions containing GpE[POWV] were pooled and concentrated by ultrafiltra- tion (Vivaspin, Sartorius, Gottingen, Germany). The final preparation was stored at -80°C until further use.
- the final protein preparation of GpE were treated with or without 16 mmol/l dithiotreitol and incubated at 70°C or at room temperature for 10 minutes, followed by SDS gel electrophore- sis and Coomassie staining.
- GpE When separated by SDS-PAGE, GpE migrated essentially according to its predicted molecular mass (49 kDa; Fig. 1 ). Protein identity was verified by mass spectrometry.
- Recombinant POWV NS1 was expressed in HEK293T cells using standard cloning and expression methods based on the pTriEx-1 plasmid with an artificial signal sequence and a C-terminal His tag (SEQ ID NO 2).
- Transfected cells were cultures at 37°C and 8.5% C02 in Dulbecco’s modified eagle’s medium with 10% fetal calf serum, 100 U/ml penicillin and 0.1 mg/ml streptomycin for three to five days. Cells were harvested, resuspended in 20 mM Tris- HCI pH 7.4, 10% (w/v) sucrose, 5 mM EDTA, 1 mM PMSF and stored at -80°C until further use.
- NS1 cell culture supernatant was adjusted to 5 mmol/l tris chloride pH 8.0, 164 mmol/l sodium chloride, 50 mmol/l magnesium chloride, 20 mmol/l imidazole, 0,1 % Triton X- 100, cleared by centrifugation for 30 minutes at 17,600xg, 4°C, applied to Nickel Rapid Run (Agarose Bead Technologies, Miami, FL, USA) equilibrated with 5 mmol/l tris chloride pH 8.0, 300 mmol/l sodium chloride, 20 mmol/l imidazole and eluted by increasing the imidazole concentration to 150 mmol/l. All fractions containing NS1 [POWV] were pooled and concen- trated by ultrafiltration (VivaSpin, Sartorius, Gottingen, Germany). The final preparation was stored at -80°C until further use.
- NS1 The final protein preparation of NS1 was treated with or without 16 mmol/l dithiotreitol and incubated at 70°C or at room temperature for 10 minutes, followed by SDS gel electrophore- sis and Coomassie staining.
- NS1 When separated by SDS-PAGE, NS1 migrated essentially according to its predicted molecu- lar mass (43.2 kDa; Fig. 2). Protein identity was verified by mass spectrometry.
- Example 3 and 4 ELISA-based assay for the detection of POWV glycoprotein E IgM and ELISA-based assay for the detection of POWV NS1 IgG
- Panel 1 Eight clinical samples (7 serum samples; 1 CSF sample) of patients with acute POWV infection.
- Panel 2 (specificity panel): 171 samples which originate from healthy individuals. Previous exposure to POWV is highly unlikely because of the origin of the samples (Germany) and the rare occurrence of infections even in endemic regions.
- Panel 3 cross reactivity panel: This panel consists of 40 samples positive for antibodies against Dengue virus, 17 samples positive for antibodies against West Nil virus and 39 samples positive for antibodies against Zika virus. This panel will be used for determination of cross-reactivity of the antigens used.
- glycoprotein E prepared from cell culture supernatant of Sf9 cells
- NS1 non-structural protein 1
- microtiter ELISA For use in microtiter ELISA these antigens were diluted in PBS to final concentrations of 2.5 pg/ml, respectively. Microtiter plates were coated with 100 pi of antigen dilution per well.
- Panel 1 was used for evaluation of sensitivity of the respective antigens for detection of specific anti-POWV IgM antibodies.
- Panel 2 and Panel 3 were incubated to determine specificity and cross reactivity of the test system.
- GpE and NS1 antigens showed sensitivities of 75.0% and 37.5%, respective- ly.
- the sample set used for evaluation of sensitivity of this test are samples originating from patients with acute infections. If these samples were drawn at early time points of infection there is the possibility of lacking anti-Powassan IgG because of seroconversion has not taken place yet.
- GpE suggests to be more sensitive for the detection of IgG, but due to higher cross reactivity of GpE in comparison to NS1 (Fig. 4), IgG antibodies measured may result from earlier flavivirus contact or vaccination (e.g. YFV vaccination).
- the NS1 -based anti-POWV IgG ELISA showed a specificity of 95.3% in panel 2 (healthy blood donors), in contrast to 87,9% for the GpE based ELISA. Again the lower specificity of GpE may result from prevalence of antibodies directed against other flaviviruses.
- GpE was selected for the anti-POWV IgM ELISA. This antigen allowed development of a specific test which shows highly sensitive detection of positive samples while the level of cross reactivity remains low.
- NS1 was selected for the anti-POWV IgG ELISA. This test is supposed to be highly specific.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Virology (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Genetics & Genomics (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Cell Biology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Physics & Mathematics (AREA)
- Pathology (AREA)
- Analytical Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- General Engineering & Computer Science (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
Claims
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP18158177.8A EP3530668A1 (en) | 2018-02-22 | 2018-02-22 | A novel assay for the diagnosis of viral infections |
| EP18207934 | 2018-11-23 | ||
| PCT/EP2019/054469 WO2019162454A1 (en) | 2018-02-22 | 2019-02-22 | Assay for the diagnosis of viral infections |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP3755709A1 true EP3755709A1 (en) | 2020-12-30 |
Family
ID=65433685
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP19705374.7A Withdrawn EP3755709A1 (en) | 2018-02-22 | 2019-02-22 | Assay for the diagnosis of viral infections |
Country Status (3)
| Country | Link |
|---|---|
| US (1) | US11292816B2 (en) |
| EP (1) | EP3755709A1 (en) |
| WO (1) | WO2019162454A1 (en) |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12247978B2 (en) | 2020-08-05 | 2025-03-11 | Arizona Board Of Regents On Behalf Of Northern Arizona University | Compositions and methods for detection and treatment of coronavirus infection |
| US20240182990A1 (en) * | 2021-03-09 | 2024-06-06 | Etablissement Français Du Sang | Detection of infectious agent based on recombinase polymerase amplification combined with a magnetic field-enhanced agglutination |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2002081754A1 (en) * | 2001-04-04 | 2002-10-17 | The Governement Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services, Centers For Disease Control And Prevention | Nucleic acid vaccines for prevention of flavivirus infection |
| WO2011062625A2 (en) * | 2009-11-18 | 2011-05-26 | The Board Of Regents Of The University Of Texas System | Physicochemical (pcp) based consensus sequences and uses thereof |
| WO2016022958A2 (en) * | 2014-08-07 | 2016-02-11 | The Trustees Of Columbia University In The City Of New York | Tick-associated virus sequences and uses thereof |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101516395B (en) | 2006-09-01 | 2014-03-26 | 伯哈拉特生物技术国际有限公司 | Vaccines against Chiki virus infection |
| US10046045B2 (en) | 2013-12-20 | 2018-08-14 | The Regents Of The University Of Michigan | Vaccine compositions and uses thereof |
| CN108650889B (en) | 2016-02-22 | 2022-06-10 | 欧蒙医学实验诊断股份公司 | Immunoassay for diagnosing viral infections |
| EP3229024A1 (en) | 2016-04-08 | 2017-10-11 | Viramed Biotech AG | Zika virus diagnosis |
-
2019
- 2019-02-22 WO PCT/EP2019/054469 patent/WO2019162454A1/en not_active Ceased
- 2019-02-22 US US15/733,517 patent/US11292816B2/en active Active
- 2019-02-22 EP EP19705374.7A patent/EP3755709A1/en not_active Withdrawn
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2002081754A1 (en) * | 2001-04-04 | 2002-10-17 | The Governement Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services, Centers For Disease Control And Prevention | Nucleic acid vaccines for prevention of flavivirus infection |
| WO2011062625A2 (en) * | 2009-11-18 | 2011-05-26 | The Board Of Regents Of The University Of Texas System | Physicochemical (pcp) based consensus sequences and uses thereof |
| WO2016022958A2 (en) * | 2014-08-07 | 2016-02-11 | The Trustees Of Columbia University In The City Of New York | Tick-associated virus sequences and uses thereof |
Non-Patent Citations (3)
| Title |
|---|
| MEGHAN E. HERMANCE ET AL: "Powassan Virus: An Emerging Arbovirus of Public Health Concern in North America", VECTOR BORNE AND ZOONOTIC DISEASES, vol. 17, no. 7, 1 July 2017 (2017-07-01), US, pages 453 - 462, XP055484741, ISSN: 1530-3667, Retrieved from the Internet <URL:https://www.liebertpub.com/doi/full/10.1089/vbz.2017.2110> DOI: 10.1089/vbz.2017.2110 * |
| RAFAL TOKARZ ET AL: "A multiplex serologic platform for diagnosis of tick-borne diseases", SCIENTIFIC REPORTS, vol. 8, no. 1, 16 February 2018 (2018-02-16), XP055469566, DOI: 10.1038/s41598-018-21349-2 * |
| See also references of WO2019162454A1 * |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2019162454A1 (en) | 2019-08-29 |
| US11292816B2 (en) | 2022-04-05 |
| US20200385430A1 (en) | 2020-12-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11828758B2 (en) | Immunoassay for the diagnosis of viral infections | |
| EP3869199B1 (en) | A method and reagents for the diagnosis of sars-cov-2 | |
| EP3855186A2 (en) | A method for determining the efficacy of a sars-cov-2 vaccine | |
| US11105804B1 (en) | COVID-19 spike-ACE2 binding assay for drug and antibody screening | |
| US11292816B2 (en) | Assay for the diagnosis of viral infections | |
| EP3530668A1 (en) | A novel assay for the diagnosis of viral infections | |
| EP1745291B1 (en) | Detection of west nile virus | |
| EP1664786B1 (en) | Detection of west nile virus infection and vaccination | |
| AU2020200382B2 (en) | Serological detection of Plasmodium antibodies | |
| US11353454B2 (en) | Methods for detection of flavivirus antibodies | |
| CN112646006B (en) | Marker epitope polypeptide for diagnosing COVID-19 mild and severe symptoms and application thereof | |
| JP2021098746A (en) | Recombinant trypanosoma cruzi jl7 antigen variants and their use for detecting chagas disease | |
| US11519919B2 (en) | Assay for the diagnosis of nematode infections | |
| US10921323B2 (en) | Method for the immunological diagnosis of a sample with a potential infection with an arbovirus and test kits suitable for this purpose | |
| US20240192224A1 (en) | Neutralizing antibody assays and compositions | |
| BR112018014122B1 (en) | KITS AND THEIR USE, IN VITRO METHODS FOR DIAGNOSING A DISEASE AND USES OF AN IGA CLASS ANTIBODY | |
| CA3213595A1 (en) | Neutralizing antibody assays and compositions | |
| BR102020012760B1 (en) | DIAGNOSTICALLY USEFUL VEHICLE, KIT, METHOD FOR DIAGNOSING AN INFECTION, COMPOSITION AND USE OF A PROTEIN |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20200903 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| AX | Request for extension of the european patent |
Extension state: BA ME |
|
| RIN1 | Information on inventor provided before grant (corrected) |
Inventor name: POLLMANN, MARC Inventor name: STEINHAGEN, KATJA Inventor name: MESSING, CLAUDIA Inventor name: BOETHFUER, JANA Inventor name: KLEMENS, OLIVER |
|
| DAV | Request for validation of the european patent (deleted) | ||
| DAX | Request for extension of the european patent (deleted) | ||
| PUAG | Search results despatched under rule 164(2) epc together with communication from examining division |
Free format text: ORIGINAL CODE: 0009017 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: EXAMINATION IS IN PROGRESS |
|
| 17Q | First examination report despatched |
Effective date: 20220317 |
|
| B565 | Issuance of search results under rule 164(2) epc |
Effective date: 20220317 |
|
| RIC1 | Information provided on ipc code assigned before grant |
Ipc: C07K 16/10 20060101ALI20220314BHEP Ipc: G01N 33/569 20060101ALI20220314BHEP Ipc: C07K 14/005 20060101AFI20220314BHEP |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20230802 |