EP3703817A2 - Oral delivery of glp-1 peptide analogs - Google Patents
Oral delivery of glp-1 peptide analogsInfo
- Publication number
- EP3703817A2 EP3703817A2 EP18874364.5A EP18874364A EP3703817A2 EP 3703817 A2 EP3703817 A2 EP 3703817A2 EP 18874364 A EP18874364 A EP 18874364A EP 3703817 A2 EP3703817 A2 EP 3703817A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- seq
- pharmaceutical composition
- peptide
- sodium
- glp
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 292
- 101100337060 Caenorhabditis elegans glp-1 gene Proteins 0.000 title claims abstract description 32
- 239000000203 mixture Substances 0.000 claims abstract description 269
- ZTHYODDOHIVTJV-UHFFFAOYSA-N Propyl gallate Chemical compound CCCOC(=O)C1=CC(O)=C(O)C(O)=C1 ZTHYODDOHIVTJV-UHFFFAOYSA-N 0.000 claims description 515
- 239000008194 pharmaceutical composition Substances 0.000 claims description 322
- 229940075579 propyl gallate Drugs 0.000 claims description 257
- 239000000473 propyl gallate Substances 0.000 claims description 257
- 235000010388 propyl gallate Nutrition 0.000 claims description 257
- WDFRNBJHDMUMBL-OICFXQLMSA-M sodium;(4r)-4-[(3r,5s,7r,8r,9s,10s,13r,14s,17r)-3,7-dihydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthren-17-yl]pentanoate Chemical compound [Na+].C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC([O-])=O)C)[C@@]2(C)CC1 WDFRNBJHDMUMBL-OICFXQLMSA-M 0.000 claims description 194
- FIWQZURFGYXCEO-UHFFFAOYSA-M sodium;decanoate Chemical compound [Na+].CCCCCCCCCC([O-])=O FIWQZURFGYXCEO-UHFFFAOYSA-M 0.000 claims description 61
- DTHNMHAUYICORS-KTKZVXAJSA-N Glucagon-like peptide 1 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 DTHNMHAUYICORS-KTKZVXAJSA-N 0.000 claims description 8
- 102100025101 GATA-type zinc finger protein 1 Human genes 0.000 claims 1
- 101710198884 GATA-type zinc finger protein 1 Proteins 0.000 claims 1
- 238000009472 formulation Methods 0.000 abstract description 209
- 238000000034 method Methods 0.000 abstract description 80
- 101800000224 Glucagon-like peptide 1 Proteins 0.000 description 173
- 229920002125 Sokalan® Polymers 0.000 description 154
- 239000003826 tablet Substances 0.000 description 140
- USFZMSVCRYTOJT-UHFFFAOYSA-N Ammonium acetate Chemical compound N.CC(O)=O USFZMSVCRYTOJT-UHFFFAOYSA-N 0.000 description 118
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 107
- 239000007983 Tris buffer Substances 0.000 description 106
- 239000011734 sodium Substances 0.000 description 92
- 229910052708 sodium Inorganic materials 0.000 description 75
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 73
- RUDATBOHQWOJDD-BSWAIDMHSA-N chenodeoxycholic acid Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)CC1 RUDATBOHQWOJDD-BSWAIDMHSA-N 0.000 description 71
- 229940009025 chenodeoxycholate Drugs 0.000 description 67
- LQIAZOCLNBBZQK-UHFFFAOYSA-N 1-(1,2-Diphosphanylethyl)pyrrolidin-2-one Chemical compound PCC(P)N1CCCC1=O LQIAZOCLNBBZQK-UHFFFAOYSA-N 0.000 description 65
- 229930195725 Mannitol Natural products 0.000 description 65
- 239000000594 mannitol Substances 0.000 description 65
- 235000010355 mannitol Nutrition 0.000 description 65
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 64
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 61
- 102000004196 processed proteins & peptides Human genes 0.000 description 59
- 150000001413 amino acids Chemical group 0.000 description 57
- 241000282472 Canis lupus familiaris Species 0.000 description 53
- 229960000913 crospovidone Drugs 0.000 description 49
- 235000013809 polyvinylpolypyrrolidone Nutrition 0.000 description 49
- 229920000523 polyvinylpolypyrrolidone Polymers 0.000 description 49
- 239000002702 enteric coating Substances 0.000 description 47
- 238000009505 enteric coating Methods 0.000 description 47
- MVPICKVDHDWCJQ-UHFFFAOYSA-N ethyl 3-pyrrolidin-1-ylpropanoate Chemical compound CCOC(=O)CCN1CCCC1 MVPICKVDHDWCJQ-UHFFFAOYSA-N 0.000 description 46
- 229940045902 sodium stearyl fumarate Drugs 0.000 description 46
- 235000001014 amino acid Nutrition 0.000 description 45
- 229940024606 amino acid Drugs 0.000 description 45
- 229920003134 Eudragit® polymer Polymers 0.000 description 42
- VVQNEPGJFQJSBK-UHFFFAOYSA-N Methyl methacrylate Chemical compound COC(=O)C(C)=C VVQNEPGJFQJSBK-UHFFFAOYSA-N 0.000 description 42
- 229910021485 fumed silica Inorganic materials 0.000 description 42
- 241001465754 Metazoa Species 0.000 description 41
- -1 glidant Substances 0.000 description 37
- 229920000642 polymer Polymers 0.000 description 36
- 239000003961 penetration enhancing agent Substances 0.000 description 34
- 239000003623 enhancer Substances 0.000 description 33
- 229920003145 methacrylic acid copolymer Polymers 0.000 description 33
- 239000000126 substance Substances 0.000 description 33
- 238000013461 design Methods 0.000 description 31
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 30
- 241000282465 Canis Species 0.000 description 30
- 238000010521 absorption reaction Methods 0.000 description 29
- 239000002775 capsule Substances 0.000 description 29
- 150000003839 salts Chemical class 0.000 description 28
- 239000000243 solution Substances 0.000 description 28
- 239000000227 bioadhesive Substances 0.000 description 27
- 238000013270 controlled release Methods 0.000 description 26
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 26
- LNTHITQWFMADLM-UHFFFAOYSA-N gallic acid Chemical class OC(=O)C1=CC(O)=C(O)C(O)=C1 LNTHITQWFMADLM-UHFFFAOYSA-N 0.000 description 26
- 239000007916 tablet composition Substances 0.000 description 24
- 239000011248 coating agent Substances 0.000 description 23
- 238000000576 coating method Methods 0.000 description 23
- 239000007935 oral tablet Substances 0.000 description 23
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 22
- 229940096978 oral tablet Drugs 0.000 description 22
- 239000008363 phosphate buffer Substances 0.000 description 22
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 22
- 239000003085 diluting agent Substances 0.000 description 21
- 239000000546 pharmaceutical excipient Substances 0.000 description 21
- 239000000945 filler Substances 0.000 description 20
- 241000700159 Rattus Species 0.000 description 19
- 201000010099 disease Diseases 0.000 description 19
- 230000035699 permeability Effects 0.000 description 18
- 239000007884 disintegrant Substances 0.000 description 17
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 17
- 229910002018 Aerosil® 300 Inorganic materials 0.000 description 16
- 229920003085 Kollidon® CL Polymers 0.000 description 16
- 210000001072 colon Anatomy 0.000 description 15
- 210000001035 gastrointestinal tract Anatomy 0.000 description 15
- 239000000314 lubricant Substances 0.000 description 15
- 239000003002 pH adjusting agent Substances 0.000 description 15
- 210000004027 cell Anatomy 0.000 description 14
- GHVNFZFCNZKVNT-UHFFFAOYSA-M decanoate Chemical compound CCCCCCCCCC([O-])=O GHVNFZFCNZKVNT-UHFFFAOYSA-M 0.000 description 14
- 238000004090 dissolution Methods 0.000 description 14
- 238000001990 intravenous administration Methods 0.000 description 14
- 125000000539 amino acid group Chemical group 0.000 description 13
- 229940088598 enzyme Drugs 0.000 description 13
- JVTIXNMXDLQEJE-UHFFFAOYSA-N 2-decanoyloxypropyl decanoate 2-octanoyloxypropyl octanoate Chemical compound C(CCCCCCC)(=O)OCC(C)OC(CCCCCCC)=O.C(=O)(CCCCCCCCC)OCC(C)OC(=O)CCCCCCCCC JVTIXNMXDLQEJE-UHFFFAOYSA-N 0.000 description 12
- 239000012729 immediate-release (IR) formulation Substances 0.000 description 12
- 150000002500 ions Chemical class 0.000 description 12
- 150000002632 lipids Chemical class 0.000 description 12
- 238000012360 testing method Methods 0.000 description 12
- 102000004190 Enzymes Human genes 0.000 description 11
- 108090000790 Enzymes Proteins 0.000 description 11
- 241000282414 Homo sapiens Species 0.000 description 11
- 238000003556 assay Methods 0.000 description 11
- 230000037396 body weight Effects 0.000 description 11
- 206010012601 diabetes mellitus Diseases 0.000 description 11
- 230000001965 increasing effect Effects 0.000 description 11
- 229940117841 methacrylic acid copolymer Drugs 0.000 description 11
- 239000002253 acid Substances 0.000 description 10
- 229940079593 drug Drugs 0.000 description 10
- 239000003814 drug Substances 0.000 description 10
- 238000002474 experimental method Methods 0.000 description 10
- 239000012634 fragment Substances 0.000 description 10
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 9
- 238000003776 cleavage reaction Methods 0.000 description 8
- 239000010410 layer Substances 0.000 description 8
- 239000000463 material Substances 0.000 description 8
- 230000007017 scission Effects 0.000 description 8
- 208000008589 Obesity Diseases 0.000 description 7
- DLSWIYLPEUIQAV-UHFFFAOYSA-N Semaglutide Chemical compound CCC(C)C(NC(=O)C(Cc1ccccc1)NC(=O)C(CCC(O)=O)NC(=O)C(CCCCNC(=O)COCCOCCNC(=O)COCCOCCNC(=O)CCC(NC(=O)CCCCCCCCCCCCCCCCC(O)=O)C(O)=O)NC(=O)C(C)NC(=O)C(C)NC(=O)C(CCC(N)=O)NC(=O)CNC(=O)C(CCC(O)=O)NC(=O)C(CC(C)C)NC(=O)C(Cc1ccc(O)cc1)NC(=O)C(CO)NC(=O)C(CO)NC(=O)C(NC(=O)C(CC(O)=O)NC(=O)C(CO)NC(=O)C(NC(=O)C(Cc1ccccc1)NC(=O)C(NC(=O)CNC(=O)C(CCC(O)=O)NC(=O)C(C)(C)NC(=O)C(N)Cc1cnc[nH]1)C(C)O)C(C)O)C(C)C)C(=O)NC(C)C(=O)NC(Cc1c[nH]c2ccccc12)C(=O)NC(CC(C)C)C(=O)NC(C(C)C)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CCCNC(N)=N)C(=O)NCC(O)=O DLSWIYLPEUIQAV-UHFFFAOYSA-N 0.000 description 7
- 239000008186 active pharmaceutical agent Substances 0.000 description 7
- 210000000577 adipose tissue Anatomy 0.000 description 7
- 238000000338 in vitro Methods 0.000 description 7
- 239000004615 ingredient Substances 0.000 description 7
- 125000000400 lauroyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 7
- 238000004519 manufacturing process Methods 0.000 description 7
- 230000004048 modification Effects 0.000 description 7
- 238000012986 modification Methods 0.000 description 7
- 230000003232 mucoadhesive effect Effects 0.000 description 7
- 229940100691 oral capsule Drugs 0.000 description 7
- 238000011002 quantification Methods 0.000 description 7
- 102000005962 receptors Human genes 0.000 description 7
- 108020003175 receptors Proteins 0.000 description 7
- 108010060325 semaglutide Proteins 0.000 description 7
- 229950011186 semaglutide Drugs 0.000 description 7
- 238000006467 substitution reaction Methods 0.000 description 7
- 230000009885 systemic effect Effects 0.000 description 7
- 210000001578 tight junction Anatomy 0.000 description 7
- WFDIJRYMOXRFFG-UHFFFAOYSA-N Acetic anhydride Chemical compound CC(=O)OC(C)=O WFDIJRYMOXRFFG-UHFFFAOYSA-N 0.000 description 6
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 6
- 102000007446 Glucagon-Like Peptide-1 Receptor Human genes 0.000 description 6
- 108010086246 Glucagon-Like Peptide-1 Receptor Proteins 0.000 description 6
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 6
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 6
- 102100040918 Pro-glucagon Human genes 0.000 description 6
- HYOWVAAEQCNGLE-JTQLQIEISA-N alpha-methyl-L-phenylalanine Chemical compound OC(=O)[C@](N)(C)CC1=CC=CC=C1 HYOWVAAEQCNGLE-JTQLQIEISA-N 0.000 description 6
- 239000012491 analyte Substances 0.000 description 6
- 230000015556 catabolic process Effects 0.000 description 6
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 6
- 239000003937 drug carrier Substances 0.000 description 6
- VFPFQHQNJCMNBZ-UHFFFAOYSA-N ethyl gallate Chemical compound CCOC(=O)C1=CC(O)=C(O)C(O)=C1 VFPFQHQNJCMNBZ-UHFFFAOYSA-N 0.000 description 6
- 239000012530 fluid Substances 0.000 description 6
- 239000000499 gel Substances 0.000 description 6
- 238000004128 high performance liquid chromatography Methods 0.000 description 6
- 238000001727 in vivo Methods 0.000 description 6
- 230000000968 intestinal effect Effects 0.000 description 6
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 6
- 235000020824 obesity Nutrition 0.000 description 6
- 229920001184 polypeptide Polymers 0.000 description 6
- 239000000843 powder Substances 0.000 description 6
- 238000002360 preparation method Methods 0.000 description 6
- 230000017854 proteolysis Effects 0.000 description 6
- 241000282412 Homo Species 0.000 description 5
- 108010019160 Pancreatin Proteins 0.000 description 5
- 102000035195 Peptidases Human genes 0.000 description 5
- 108091005804 Peptidases Proteins 0.000 description 5
- 150000001875 compounds Chemical class 0.000 description 5
- 230000003247 decreasing effect Effects 0.000 description 5
- 238000006731 degradation reaction Methods 0.000 description 5
- 230000003111 delayed effect Effects 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 230000003914 insulin secretion Effects 0.000 description 5
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 5
- 210000004185 liver Anatomy 0.000 description 5
- 229940055695 pancreatin Drugs 0.000 description 5
- 239000008188 pellet Substances 0.000 description 5
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 5
- 235000018102 proteins Nutrition 0.000 description 5
- 102000004169 proteins and genes Human genes 0.000 description 5
- 108090000623 proteins and genes Proteins 0.000 description 5
- 239000011347 resin Substances 0.000 description 5
- 229920005989 resin Polymers 0.000 description 5
- 210000002784 stomach Anatomy 0.000 description 5
- 230000001225 therapeutic effect Effects 0.000 description 5
- 229910002012 Aerosil® Inorganic materials 0.000 description 4
- 229920001661 Chitosan Polymers 0.000 description 4
- 108010067722 Dipeptidyl Peptidase 4 Proteins 0.000 description 4
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 4
- 239000004365 Protease Substances 0.000 description 4
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical compound C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 239000000872 buffer Substances 0.000 description 4
- 238000004364 calculation method Methods 0.000 description 4
- 208000035475 disorder Diseases 0.000 description 4
- 230000000694 effects Effects 0.000 description 4
- 230000002255 enzymatic effect Effects 0.000 description 4
- 230000002496 gastric effect Effects 0.000 description 4
- 239000003877 glucagon like peptide 1 receptor agonist Substances 0.000 description 4
- 230000002641 glycemic effect Effects 0.000 description 4
- 201000001421 hyperglycemia Diseases 0.000 description 4
- 230000001771 impaired effect Effects 0.000 description 4
- 238000004811 liquid chromatography Methods 0.000 description 4
- 235000018977 lysine Nutrition 0.000 description 4
- 102000039446 nucleic acids Human genes 0.000 description 4
- 108020004707 nucleic acids Proteins 0.000 description 4
- 150000007523 nucleic acids Chemical class 0.000 description 4
- WWZKQHOCKIZLMA-UHFFFAOYSA-M octanoate Chemical compound CCCCCCCC([O-])=O WWZKQHOCKIZLMA-UHFFFAOYSA-M 0.000 description 4
- 238000003908 quality control method Methods 0.000 description 4
- 230000009467 reduction Effects 0.000 description 4
- 238000002553 single reaction monitoring Methods 0.000 description 4
- BYKRNSHANADUFY-UHFFFAOYSA-M sodium octanoate Chemical compound [Na+].CCCCCCCC([O-])=O BYKRNSHANADUFY-UHFFFAOYSA-M 0.000 description 4
- 239000007909 solid dosage form Substances 0.000 description 4
- 230000000087 stabilizing effect Effects 0.000 description 4
- 239000006228 supernatant Substances 0.000 description 4
- 208000024891 symptom Diseases 0.000 description 4
- 230000004584 weight gain Effects 0.000 description 4
- 235000019786 weight gain Nutrition 0.000 description 4
- RUDATBOHQWOJDD-UHFFFAOYSA-N (3beta,5beta,7alpha)-3,7-Dihydroxycholan-24-oic acid Natural products OC1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)CC2 RUDATBOHQWOJDD-UHFFFAOYSA-N 0.000 description 3
- XOMRRQXKHMYMOC-NRFANRHFSA-N (3s)-3-hexadecanoyloxy-4-(trimethylazaniumyl)butanoate Chemical compound CCCCCCCCCCCCCCCC(=O)O[C@@H](CC([O-])=O)C[N+](C)(C)C XOMRRQXKHMYMOC-NRFANRHFSA-N 0.000 description 3
- CPUSCHYXEUZMSV-UHFFFAOYSA-N 2,6-diamino-2-methylhexanoic acid Chemical compound OC(=O)C(N)(C)CCCCN CPUSCHYXEUZMSV-UHFFFAOYSA-N 0.000 description 3
- BHIZVZJETFVJMJ-UHFFFAOYSA-N 2-hydroxypropyl dodecanoate Chemical compound CCCCCCCCCCCC(=O)OCC(C)O BHIZVZJETFVJMJ-UHFFFAOYSA-N 0.000 description 3
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 3
- CFYIUBWVKZQDOG-UHFFFAOYSA-N 4-[[2-[[2-[[1-(4-nitroanilino)-1-oxo-3-phenylpropan-2-yl]amino]-2-oxoethyl]amino]-2-oxoethyl]amino]-4-oxobutanoic acid Chemical compound C=1C=C([N+]([O-])=O)C=CC=1NC(=O)C(NC(=O)CNC(=O)CNC(=O)CCC(=O)O)CC1=CC=CC=C1 CFYIUBWVKZQDOG-UHFFFAOYSA-N 0.000 description 3
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 3
- 241000283690 Bos taurus Species 0.000 description 3
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 3
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 description 3
- 239000004262 Ethyl gallate Substances 0.000 description 3
- 108010088842 Fibrinolysin Proteins 0.000 description 3
- 108060005987 Kallikrein Proteins 0.000 description 3
- 102000001399 Kallikrein Human genes 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- 102000003729 Neprilysin Human genes 0.000 description 3
- 108090000028 Neprilysin Proteins 0.000 description 3
- 108010067372 Pancreatic elastase Proteins 0.000 description 3
- 102000016387 Pancreatic elastase Human genes 0.000 description 3
- 102000057297 Pepsin A Human genes 0.000 description 3
- 108090000284 Pepsin A Proteins 0.000 description 3
- 108090000190 Thrombin Proteins 0.000 description 3
- 108090000631 Trypsin Proteins 0.000 description 3
- 102000004142 Trypsin Human genes 0.000 description 3
- 230000036528 appetite Effects 0.000 description 3
- 235000019789 appetite Nutrition 0.000 description 3
- 239000003833 bile salt Substances 0.000 description 3
- 238000013262 cAMP assay Methods 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 229960001091 chenodeoxycholic acid Drugs 0.000 description 3
- 229960003964 deoxycholic acid Drugs 0.000 description 3
- XXJWXESWEXIICW-UHFFFAOYSA-N diethylene glycol monoethyl ether Chemical compound CCOCCOCCO XXJWXESWEXIICW-UHFFFAOYSA-N 0.000 description 3
- NLEBIOOXCVAHBD-QKMCSOCLSA-N dodecyl beta-D-maltoside Chemical compound O[C@@H]1[C@@H](O)[C@H](OCCCCCCCCCCCC)O[C@H](CO)[C@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 NLEBIOOXCVAHBD-QKMCSOCLSA-N 0.000 description 3
- 239000002552 dosage form Substances 0.000 description 3
- 235000019277 ethyl gallate Nutrition 0.000 description 3
- 235000019253 formic acid Nutrition 0.000 description 3
- 239000013022 formulation composition Substances 0.000 description 3
- 238000013467 fragmentation Methods 0.000 description 3
- 238000006062 fragmentation reaction Methods 0.000 description 3
- 238000012544 monitoring process Methods 0.000 description 3
- 230000001575 pathological effect Effects 0.000 description 3
- 229940111202 pepsin Drugs 0.000 description 3
- 239000012071 phase Substances 0.000 description 3
- 229940012957 plasmin Drugs 0.000 description 3
- 229920001983 poloxamer Polymers 0.000 description 3
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 3
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 3
- 229920000053 polysorbate 80 Polymers 0.000 description 3
- 229940068968 polysorbate 80 Drugs 0.000 description 3
- 239000002243 precursor Substances 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- FHHPUSMSKHSNKW-SMOYURAASA-M sodium deoxycholate Chemical compound [Na+].C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC([O-])=O)C)[C@@]2(C)[C@@H](O)C1 FHHPUSMSKHSNKW-SMOYURAASA-M 0.000 description 3
- JAJWGJBVLPIOOH-IZYKLYLVSA-M sodium taurocholate Chemical compound [Na+].C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCS([O-])(=O)=O)C)[C@@]2(C)[C@@H](O)C1 JAJWGJBVLPIOOH-IZYKLYLVSA-M 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 238000013268 sustained release Methods 0.000 description 3
- 239000012730 sustained-release form Substances 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 229960004072 thrombin Drugs 0.000 description 3
- 239000012588 trypsin Substances 0.000 description 3
- 239000003643 water by type Substances 0.000 description 3
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 2
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 2
- ATRRKUHOCOJYRX-UHFFFAOYSA-N Ammonium bicarbonate Chemical compound [NH4+].OC([O-])=O ATRRKUHOCOJYRX-UHFFFAOYSA-N 0.000 description 2
- 229910000013 Ammonium bicarbonate Inorganic materials 0.000 description 2
- FERIUCNNQQJTOY-UHFFFAOYSA-M Butyrate Chemical compound CCCC([O-])=O FERIUCNNQQJTOY-UHFFFAOYSA-M 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- 241000283086 Equidae Species 0.000 description 2
- 241000282326 Felis catus Species 0.000 description 2
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 2
- 230000005526 G1 to G0 transition Effects 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical group CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical group CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 2
- CERQOIWHTDAKMF-UHFFFAOYSA-N Methacrylic acid Chemical compound CC(=C)C(O)=O CERQOIWHTDAKMF-UHFFFAOYSA-N 0.000 description 2
- 229940122985 Peptide agonist Drugs 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 102000000591 Tight Junction Proteins Human genes 0.000 description 2
- 108010002321 Tight Junction Proteins Proteins 0.000 description 2
- 230000006978 adaptation Effects 0.000 description 2
- 235000012538 ammonium bicarbonate Nutrition 0.000 description 2
- 239000001099 ammonium carbonate Substances 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 230000004888 barrier function Effects 0.000 description 2
- 229940093761 bile salts Drugs 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 229960004424 carbon dioxide Drugs 0.000 description 2
- 235000011089 carbon dioxide Nutrition 0.000 description 2
- 150000003857 carboxamides Chemical class 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 238000007385 chemical modification Methods 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 229920001688 coating polymer Polymers 0.000 description 2
- 229920001577 copolymer Polymers 0.000 description 2
- 230000001186 cumulative effect Effects 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 239000007857 degradation product Substances 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 238000007922 dissolution test Methods 0.000 description 2
- 238000007908 dry granulation Methods 0.000 description 2
- 238000001035 drying Methods 0.000 description 2
- 230000009977 dual effect Effects 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 210000001842 enterocyte Anatomy 0.000 description 2
- 230000007515 enzymatic degradation Effects 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 230000002349 favourable effect Effects 0.000 description 2
- 239000000706 filtrate Substances 0.000 description 2
- 239000007902 hard capsule Substances 0.000 description 2
- 230000029226 lipidation Effects 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 239000011159 matrix material Substances 0.000 description 2
- 229930182817 methionine Chemical group 0.000 description 2
- 239000008185 minitablet Substances 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- HEGSGKPQLMEBJL-UHFFFAOYSA-N n-octyl beta-D-glucopyranoside Natural products CCCCCCCCOC1OC(CO)C(O)C(O)C1O HEGSGKPQLMEBJL-UHFFFAOYSA-N 0.000 description 2
- HEGSGKPQLMEBJL-RKQHYHRCSA-N octyl beta-D-glucopyranoside Chemical compound CCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O HEGSGKPQLMEBJL-RKQHYHRCSA-N 0.000 description 2
- 239000008203 oral pharmaceutical composition Substances 0.000 description 2
- 230000003647 oxidation Effects 0.000 description 2
- 238000007254 oxidation reaction Methods 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 229940124531 pharmaceutical excipient Drugs 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- GCYXWQUSHADNBF-AAEALURTSA-N preproglucagon 78-108 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 GCYXWQUSHADNBF-AAEALURTSA-N 0.000 description 2
- 230000001737 promoting effect Effects 0.000 description 2
- 230000002797 proteolythic effect Effects 0.000 description 2
- 230000006337 proteolytic cleavage Effects 0.000 description 2
- UMJSCPRVCHMLSP-UHFFFAOYSA-N pyridine Natural products COC1=CC=CN=C1 UMJSCPRVCHMLSP-UHFFFAOYSA-N 0.000 description 2
- 238000000611 regression analysis Methods 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 238000004366 reverse phase liquid chromatography Methods 0.000 description 2
- 238000004007 reversed phase HPLC Methods 0.000 description 2
- 210000000813 small intestine Anatomy 0.000 description 2
- RWYKOCBLMVTRSK-UHFFFAOYSA-M sodium 2-(3,4,5-trihydroxybenzoyl)oxyacetate Chemical compound [Na+].Oc1cc(cc(O)c1O)C(=O)OCC([O-])=O RWYKOCBLMVTRSK-UHFFFAOYSA-M 0.000 description 2
- NRHMKIHPTBHXPF-TUJRSCDTSA-M sodium cholate Chemical compound [Na+].C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC([O-])=O)C)[C@@]2(C)[C@@H](O)C1 NRHMKIHPTBHXPF-TUJRSCDTSA-M 0.000 description 2
- STFSJTPVIIDAQX-LTRPLHCISA-M sodium;(e)-4-octadecoxy-4-oxobut-2-enoate Chemical compound [Na+].CCCCCCCCCCCCCCCCCCOC(=O)\C=C\C([O-])=O STFSJTPVIIDAQX-LTRPLHCISA-M 0.000 description 2
- 239000007901 soft capsule Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 238000001228 spectrum Methods 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 230000002459 sustained effect Effects 0.000 description 2
- 230000002195 synergetic effect Effects 0.000 description 2
- 238000004885 tandem mass spectrometry Methods 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 2
- 238000001195 ultra high performance liquid chromatography Methods 0.000 description 2
- 230000004580 weight loss Effects 0.000 description 2
- FDKWRPBBCBCIGA-REOHCLBHSA-N (2r)-2-azaniumyl-3-$l^{1}-selanylpropanoate Chemical compound [Se]C[C@H](N)C(O)=O FDKWRPBBCBCIGA-REOHCLBHSA-N 0.000 description 1
- CTYHQVFFQRDJSN-LHEWISCISA-N (2s)-2-(9h-fluoren-9-ylmethoxycarbonylamino)-6-[[(4-methoxyphenyl)-diphenylmethyl]amino]hexanoic acid Chemical compound C1=CC(OC)=CC=C1C(C=1C=CC=CC=1)(C=1C=CC=CC=1)NCCCC[C@@H](C(O)=O)NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C21 CTYHQVFFQRDJSN-LHEWISCISA-N 0.000 description 1
- OYXZPXVCRAAKCM-SANMLTNESA-N (2s)-2-[(2-methylpropan-2-yl)oxycarbonylamino]-3-(1-tritylimidazol-4-yl)propanoic acid Chemical compound C1=NC(C[C@H](NC(=O)OC(C)(C)C)C(O)=O)=CN1C(C=1C=CC=CC=1)(C=1C=CC=CC=1)C1=CC=CC=C1 OYXZPXVCRAAKCM-SANMLTNESA-N 0.000 description 1
- ZEQLLMOXFVKKCN-AWEZNQCLSA-N (2s)-2-[(2-methylpropan-2-yl)oxycarbonylamino]-3-[4-[(2-methylpropan-2-yl)oxy]phenyl]propanoic acid Chemical compound CC(C)(C)OC(=O)N[C@H](C(O)=O)CC1=CC=C(OC(C)(C)C)C=C1 ZEQLLMOXFVKKCN-AWEZNQCLSA-N 0.000 description 1
- NGJOFQZEYQGZMB-KTKZVXAJSA-N (4S)-5-[[2-[[(2S,3R)-1-[[(2S)-1-[[(2S,3R)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[2-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[2-[[(1S)-4-carbamimidamido-1-carboxybutyl]amino]-2-oxoethyl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-2-oxoethyl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-2-oxoethyl]amino]-4-[[(2S)-2-[[(2S)-2-amino-3-(1H-imidazol-4-yl)propanoyl]amino]propanoyl]amino]-5-oxopentanoic acid Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 NGJOFQZEYQGZMB-KTKZVXAJSA-N 0.000 description 1
- UKAUYVFTDYCKQA-UHFFFAOYSA-N -2-Amino-4-hydroxybutanoic acid Natural products OC(=O)C(N)CCO UKAUYVFTDYCKQA-UHFFFAOYSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- DHMQDGOQFOQNFH-UHFFFAOYSA-M Aminoacetate Chemical compound NCC([O-])=O DHMQDGOQFOQNFH-UHFFFAOYSA-M 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 206010052360 Colorectal adenocarcinoma Diseases 0.000 description 1
- FDKWRPBBCBCIGA-UWTATZPHSA-N D-Selenocysteine Natural products [Se]C[C@@H](N)C(O)=O FDKWRPBBCBCIGA-UWTATZPHSA-N 0.000 description 1
- 241000237858 Gastropoda Species 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 101800004295 Glucagon-like peptide 1(7-36) Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 241001272567 Hominoidea Species 0.000 description 1
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 1
- 206010022489 Insulin Resistance Diseases 0.000 description 1
- PWKSKIMOESPYIA-BYPYZUCNSA-N L-N-acetyl-Cysteine Chemical compound CC(=O)N[C@@H](CS)C(O)=O PWKSKIMOESPYIA-BYPYZUCNSA-N 0.000 description 1
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- UKAUYVFTDYCKQA-VKHMYHEASA-N L-homoserine Chemical group OC(=O)[C@@H](N)CCO UKAUYVFTDYCKQA-VKHMYHEASA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- QEFRNWWLZKMPFJ-ZXPFJRLXSA-N L-methionine (R)-S-oxide Chemical group C[S@@](=O)CC[C@H]([NH3+])C([O-])=O QEFRNWWLZKMPFJ-ZXPFJRLXSA-N 0.000 description 1
- QEFRNWWLZKMPFJ-UHFFFAOYSA-N L-methionine sulphoxide Chemical group CS(=O)CCC(N)C(O)=O QEFRNWWLZKMPFJ-UHFFFAOYSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 102000004895 Lipoproteins Human genes 0.000 description 1
- 108090001030 Lipoproteins Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 1
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 206010033307 Overweight Diseases 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 241000282579 Pan Species 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 206010034912 Phobia Diseases 0.000 description 1
- 241000282405 Pongo abelii Species 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 241000282458 Ursus sp. Species 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- AYOPSBMGRBUJSJ-VQXBOQCVSA-N [(2s,3s,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)-2-[(2r,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxolan-2-yl]methyl dodecanoate Chemical compound O([C@@H]1[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O1)O)[C@]1(COC(=O)CCCCCCCCCCC)O[C@H](CO)[C@@H](O)[C@@H]1O AYOPSBMGRBUJSJ-VQXBOQCVSA-N 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 229960004308 acetylcysteine Drugs 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 125000002252 acyl group Chemical group 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 229920003144 amino alkyl methacrylate copolymer Polymers 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 239000012062 aqueous buffer Substances 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 210000000227 basophil cell of anterior lobe of hypophysis Anatomy 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000000337 buffer salt Substances 0.000 description 1
- 235000019577 caloric intake Nutrition 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- UHBYWPGGCSDKFX-UHFFFAOYSA-N carboxyglutamic acid Chemical compound OC(=O)C(N)CC(C(O)=O)C(O)=O UHBYWPGGCSDKFX-UHFFFAOYSA-N 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- WDRMVIMVHHWVBI-STCSGHEYSA-N chembl1222074 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)N[C@@H](CC=1NC=NC=1)C(O)=O)[C@@H](C)O)[C@H](C)O)C(C)C)C1=CC=CC=C1 WDRMVIMVHHWVBI-STCSGHEYSA-N 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 238000011097 chromatography purification Methods 0.000 description 1
- 238000007906 compression Methods 0.000 description 1
- 230000006835 compression Effects 0.000 description 1
- 208000012696 congenital leptin deficiency Diseases 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 229950006137 dexfosfoserine Drugs 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 229910001873 dinitrogen Inorganic materials 0.000 description 1
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 210000001198 duodenum Anatomy 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 230000007071 enzymatic hydrolysis Effects 0.000 description 1
- 238000006047 enzymatic hydrolysis reaction Methods 0.000 description 1
- 229940125532 enzyme inhibitor Drugs 0.000 description 1
- 239000002532 enzyme inhibitor Substances 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000035611 feeding Effects 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 235000012631 food intake Nutrition 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 230000027119 gastric acid secretion Effects 0.000 description 1
- 230000030136 gastric emptying Effects 0.000 description 1
- 230000030135 gastric motility Effects 0.000 description 1
- 238000003304 gavage Methods 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 229960002591 hydroxyproline Drugs 0.000 description 1
- 239000012728 immediate-release (IR) tablet Substances 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000010874 in vitro model Methods 0.000 description 1
- 238000011503 in vivo imaging Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 210000004347 intestinal mucosa Anatomy 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- 238000010930 lactamization Methods 0.000 description 1
- 125000005647 linker group Chemical group 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 238000001294 liquid chromatography-tandem mass spectrometry Methods 0.000 description 1
- 239000008297 liquid dosage form Substances 0.000 description 1
- 230000003908 liver function Effects 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 150000002669 lysines Chemical class 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 229920003146 methacrylic ester copolymer Polymers 0.000 description 1
- LSDPWZHWYPCBBB-UHFFFAOYSA-O methylsulfide anion Chemical compound [SH2+]C LSDPWZHWYPCBBB-UHFFFAOYSA-O 0.000 description 1
- 238000007431 microscopic evaluation Methods 0.000 description 1
- 210000000110 microvilli Anatomy 0.000 description 1
- 108091005601 modified peptides Proteins 0.000 description 1
- 238000012806 monitoring device Methods 0.000 description 1
- 208000001022 morbid obesity Diseases 0.000 description 1
- 210000003097 mucus Anatomy 0.000 description 1
- 125000001421 myristyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 125000002347 octyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 238000003305 oral gavage Methods 0.000 description 1
- 229940126701 oral medication Drugs 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 229960003104 ornithine Drugs 0.000 description 1
- 125000001312 palmitoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000006320 pegylation Effects 0.000 description 1
- 230000007030 peptide scission Effects 0.000 description 1
- 230000003285 pharmacodynamic effect Effects 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 208000019899 phobic disease Diseases 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 239000004014 plasticizer Substances 0.000 description 1
- 230000001323 posttranslational effect Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 238000002810 primary assay Methods 0.000 description 1
- 238000002540 product ion scan Methods 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 235000019419 proteases Nutrition 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 230000006920 protein precipitation Effects 0.000 description 1
- 229940024999 proteolytic enzymes for treatment of wounds and ulcers Drugs 0.000 description 1
- 210000001187 pylorus Anatomy 0.000 description 1
- 238000009490 roller compaction Methods 0.000 description 1
- 238000002390 rotary evaporation Methods 0.000 description 1
- ZKZBPNGNEQAJSX-UHFFFAOYSA-N selenocysteine Natural products [SeH]CC(N)C(O)=O ZKZBPNGNEQAJSX-UHFFFAOYSA-N 0.000 description 1
- 235000016491 selenocysteine Nutrition 0.000 description 1
- 229940055619 selenocysteine Drugs 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 239000002356 single layer Substances 0.000 description 1
- 238000009491 slugging Methods 0.000 description 1
- UOENJXXSKABLJL-UHFFFAOYSA-M sodium;8-[(2-hydroxybenzoyl)amino]octanoate Chemical compound [Na+].OC1=CC=CC=C1C(=O)NCCCCCCCC([O-])=O UOENJXXSKABLJL-UHFFFAOYSA-M 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 230000007928 solubilization Effects 0.000 description 1
- 238000005063 solubilization Methods 0.000 description 1
- 239000012453 solvate Substances 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000010414 supernatant solution Substances 0.000 description 1
- 239000007939 sustained release tablet Substances 0.000 description 1
- 230000001839 systemic circulation Effects 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- FGMPLJWBKKVCDB-UHFFFAOYSA-N trans-L-hydroxy-proline Natural products ON1CCCC1C(O)=O FGMPLJWBKKVCDB-UHFFFAOYSA-N 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 238000003260 vortexing Methods 0.000 description 1
- 238000004260 weight control Methods 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/20—Pills, tablets, discs, rods
- A61K9/28—Dragees; Coated pills or tablets, e.g. with film or compression coating
- A61K9/2806—Coating materials
- A61K9/2833—Organic macromolecular compounds
- A61K9/284—Organic macromolecular compounds obtained by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyvinyl pyrrolidone
- A61K9/2846—Poly(meth)acrylates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/26—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/08—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
- A61K47/14—Esters of carboxylic acids, e.g. fatty acid monoglycerides, medium-chain triglycerides, parabens or PEG fatty acid esters
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/28—Steroids, e.g. cholesterol, bile acids or glycyrrhetinic acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/20—Pills, tablets, discs, rods
- A61K9/2004—Excipients; Inactive ingredients
- A61K9/2013—Organic compounds, e.g. phospholipids, fats
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/20—Pills, tablets, discs, rods
- A61K9/2004—Excipients; Inactive ingredients
- A61K9/2022—Organic macromolecular compounds
- A61K9/2027—Organic macromolecular compounds obtained by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyvinyl pyrrolidone, poly(meth)acrylates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/4808—Preparations in capsules, e.g. of gelatin, of chocolate characterised by the form of the capsule or the structure of the filling; Capsules containing small tablets; Capsules with outer layer for immediate drug release
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/4841—Filling excipients; Inactive ingredients
- A61K9/4858—Organic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/4891—Coated capsules; Multilayered drug free capsule shells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/50—Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
- A61K9/5005—Wall or coating material
- A61K9/5021—Organic macromolecular compounds
- A61K9/5026—Organic macromolecular compounds obtained by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyvinyl pyrrolidone, poly(meth)acrylates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/50—Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
- A61K9/5073—Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals having two or more different coatings optionally including drug-containing subcoatings
- A61K9/5078—Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals having two or more different coatings optionally including drug-containing subcoatings with drug-free core
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
Definitions
- ORPEP-200-PSP_ST25_update.txt; Size: 12,389 bytes; and Date of Creation: October 21, 2018) filed with the application is incorporated herein by reference in its entirety.
- the present disclosure relates to formulations for oral delivery of GLP- 1 peptide analogs and methods of administering the same.
- Therapeutic peptides are commonly administered by parenteral routes such as
- Oral administration in contrast, is a simple and convenient mode of administration.
- oral administration of peptides is challenging because the peptides are susceptible to degradation from the acids of the stomach and from proteases. Proteolytic enzymes degrade peptides in the gastrointestinal tract, and this degradation can render the peptides inactive.
- Oral administration of peptides is also challenging because peptides are poorly absorbed in the gastrointestinal tract. The large size of peptides makes it difficult for them to cross through the intestinal mucus layer and to cross the tight junction epithelial cell layer.
- GLP-1 Glucagon-like peptide 1
- Peptides such as GLP-1 peptide analogs are generally large amphiphilic molecules that do not go into systemic circulation upon oral administration.
- the present invention targets the peptides at their most optimum site of absorption and enhances absorption using formulation components that improve the solubility of the peptide and excipients containing a combination of permeation enhancers sodium chenodeoxycholate and propyl gallate.
- the present invention also provides a methodology to deliver GLP- 1 peptide analogs orally through an approach that involves understanding the site of absorption and improving the solubility of the peptide using excipients, permeation enhancers, and pH modifiers for improved absorption.
- a pharmaceutical composition for oral administration is provided.
- a pharmaceutical composition for oral administration is provided.
- composition provided herein further comprises
- the ratio of sodium chenodeoxycholate to propyl gallate is 150: 1 to 1:4. In certain embodiments, the ratio of sodium chenodeoxycholate to propyl gallate is 145: 1. In certain embodiments, the ratio of sodium chenodeoxycholate to propyl gallate is 29: 1. In certain embodiments, the ratio of sodium chenodeoxycholate to propyl gallate is 14: 1. In certain embodiments, the ratio of sodium chenodeoxycholate to propyl gallate is 6.5: 1. In certain embodiments, the ratio of sodium chenodeoxycholate to propyl gallate is 4: 1.
- the ratio of sodium chenodeoxycholate to propyl gallate is 2: 1. In certain embodiments, the ratio of sodium chenodeoxycholate to propyl gallate is 1: 1. In certain embodiments, the ratio of sodium chenodeoxycholate to propyl gallate is 2: 1 to 1:4. In certain embodiments, the ratio of sodium chenodeoxycholate to propyl gallate is 1:2.
- the amount of sodium chenodeoxycholate is about 1 mg to about 1500 mg. In certain embodiments, the amount of sodium chenodeoxycholate is about 100 mg to about 800 mg. In certain embodiments, the amount of sodium chenodeoxycholate is about 100 mg, about 200 mg, about 300 mg, about 400 mg, about 500 mg, about 600 mg, about 700 mg, or about 800 mg. In certain embodiments, the amount of sodium chenodeoxycholate is about 50 mg, about 65 mg, about 120 mg, about 130 mg, about 140 mg, about 150 mg, about 260 mg, about 280 mg, about 290 mg, or about 299 mg. In certain embodiments, the amount of sodium chenodeoxycholate is about 100 mg.
- sodium chenodeoxycholate is about 15% to about 25% of the pharmaceutical composition by weight. In certain embodiments, sodium chenodeoxycholate is about 20% to about 21% of the pharmaceutical composition by weight. In certain embodiments, sodium chenodeoxycholate is about 15% to about 65% of the pharmaceutical composition by weight. In certain embodiments, sodium chenodeoxycholate is about 30% to about 65% of the pharmaceutical composition by weight.
- the amount of propyl gallate is about 1 mg to about 3000 mg.
- the amount of propyl gallate is about 200 mg to about 1600 mg. In certain embodiments, the amount of propyl gallate is about 2 mg, about 10 mg, about 20 mg, about 30 mg, about 40 mg, about 50 mg, about 100 mg, about 150 mg, or about 200 mg. In certain embodiments, the amount of propyl gallate is about 200 mg, about 300 mg, about 400 mg, about 500 mg, about 600 mg, about 700 mg, about 800 mg, about 900 mg, about 1000 mg, about 1100 mg, about 1200 mg, about 1300 mg, about 1400 mg, about 1500 mg, or about 1600 mg. In certain embodiments, the amount of propyl gallate is about 200 mg. In certain embodiments, propyl gallate is about 45% to about 55% of the pharmaceutical composition by weight. In certain embodiments, propyl gallate is about 40% to about 41% of the pharmaceutical composition by weight.
- the pharmaceutical composition does not comprise propyl gallate.
- a pharmaceutical composition provided herein further comprises a pH modifier.
- composition provided herein further comprises
- the amount of Tris base is up to 300 mg. In certain embodiments, the amount of Tris base is about 30 mg to about 40 mg. In certain embodiments, the amount of Tris base is about 36 mg to about 37 mg. In certain embodiments,
- Tris base is about 5% to about 10% of the pharmaceutical composition by weight. In certain embodiments, Tris base is about 7% to about 8% of the pharmaceutical composition by weight. [0013] In certain embodiments, a pharmaceutical composition provided herein does not comprise a pH modifier.
- a pharmaceutical composition provided herein does not comprise Tris base.
- a pharmaceutical composition provided herein comprises an enteric coating, e.g., an enteric coating that dissolves at a pH of about 5 to about 7.5, an enteric coating that dissolves at a pH of about 5.5 or above, or an enteric coating that dissolves at a pH of about 7.0 or above.
- an enteric coating e.g., an enteric coating that dissolves at a pH of about 5 to about 7.5, an enteric coating that dissolves at a pH of about 5.5 or above, or an enteric coating that dissolves at a pH of about 7.0 or above.
- composition provided herein further comprises
- composition provided herein further comprises
- cross-linked polyacryhc polymers comprises cross-linked polyacryhc polymers.
- the cross-linked polyacryhc polymers are in a powder form or a granular from.
- composition provided herein further comprises
- the amount of bioadhesive or cross-linked polyacryhc is the amount of bioadhesive or cross-linked polyacryhc
- the amount of bioadhesive or cross-linked polyacryhc polymers or Carbopol ® is about 1 mg to about 50 mg. In certain embodiments, the amount of bioadhesive or cross-linked polyacryhc polymers or Carbopol ® is about 1 mg to about 2 mg. In certain embodiments, the amount of bioadhesive or cross-linked polyacryhc polymers or Carbopol ® is about 4 mg to about 5 mg. In certain embodiments, the amount of bioadhesive or cross-linked polyacryhc polymers or Carbopol ® is about 14 mg to about 15 mg. In certain embodiments, the amount of bioadhesive or cross-linked polyacryhc polymers or Carbopol ® is about 48 mg to about 49 mg.
- the bioadhesive or cross-linked polyacryhc polymers or Carbopol ® is about 0.3% to about 10% of the pharmaceutical composition by weight. In certain embodiments, the bioadhesive or cross-linked polyacryhc polymers or Carbopol ® is about 0.3% to about 3% of the pharmaceutical composition by weight. In certain embodiments, the bioadhesive or cross-linked polyacryhc polymers or Carbopol ® is about 1% to about 10% of the pharmaceutical composition by weight. In certain embodiments, the bioadhesive or cross-linked polyacryhc polymers or Carbopol ® is about 0.3%, about 1%, about 3%, or about 10% of the pharmaceutical composition by weight. In certain embodiments, the bioadhesive or cross-linked polyacryhc polymers or Carbopol ® is about 0.3%, about 0.9%, or about 1.2% of the pharmaceutical composition by weight.
- the Carbopol ® is Carbopol ® 71G. In certain embodiments, the amount of Carbopol ® 71G is about 4 mg to about 5 mg. In certain embodiments, the amount of Carbopol ® 71G is about 48 mg to about 49 mg. In certain embodiments, Carbopol ® 71G is about 1% to about 10% of the pharmaceutical composition by weight.
- the Carbopol ® is Carbopol ® 97 IP. In certain embodiments, the amount of Carbopol ® 97 IP is about 1 mg to about 2 mg. In certain embodiments, the amount of Carbopol ® 971P is about 14 mg to about 15 mg. In certain embodiments, Carbopol ® 97 IP is about 0.3% to about 3% of the pharmaceutical composition by weight.
- a pharmaceutical composition provided herein does not comprise a bioadhesive.
- a pharmaceutical composition provided herein does not comprise cross-linked polyacrylic polymers.
- composition provided herein further comprises
- a pharmaceutical composition provided herein further comprises methacrylic acid copolymers.
- a pharmaceutical composition provided herein further comprises Eudragit ® .
- the amount of enteric coat or methacrylic acid copolymers or Eudragit ® is about 10 mg to about 65 mg.
- the amount of enteric coat or methacrylic acid copolymers or Eudragit ® is about 61 mg to about 62 mg.
- the amount of enteric coat or methacrylic acid copolymers or Eudragit ® is about 10 mg to about 53 mg.
- the enteric coat or methacrylic acid copolymers or Eudragit ® is about 5% to about 15% of the pharmaceutical composition by weight.
- the enteric coat or methacrylic acid copolymers or Eudragit ® dissolves at pH 5.5 or above.
- composition provided herein further comprises
- a pharmaceutical composition provided herein further comprises a diluent.
- a pharmaceutical composition provided herein further comprises mannitol.
- the amount of the filler, diluent, or mannitol is about 1 mg to about 150 mg. In certain embodiments, the amount of the filler, diluent, or mannitol is about 50 mg to about 100 mg. In certain embodiments, the amount of the filler, diluent, or mannitol is about 75 mg to about 150 mg. In certain embodiments, the filler, diluent, or mannitol is about 5% to about 30% of the pharmaceutical composition by weight.
- the filler, diluent, or mannitol is about 5% to about 20% of the pharmaceutical composition by weight. In certain embodiments, the filler, diluent, or mannitol is about 10% to about 20% of the pharmaceutical composition by weight. In certain embodiments, the filler, diluent, or mannitol is about 15% to about 30% of the
- composition provided herein further comprises
- a pharmaceutical composition provided herein further comprises crospovidone.
- the amount of disintegrant or crospovidone is about 25 mg to about 35 mg. In certain embodiments, the amount of disintegrant or crospovidone is about 28 mg to about 29 mg. In certain embodiments, the disintegrant or crospovidone is about 1% to about 10% of the pharmaceutical composition by weight. In certain embodiments, the disintegrant or crospovidone is about 5% to about 6% of the pharmaceutical composition by weight.
- composition provided herein further comprises
- a pharmaceutical composition provided herein further comprises fumed silica.
- the amount of glidant or fumed silica is about 1 mg to about 10 mg. In certain embodiments, the amount of glidant or fumed silica is about 4 mg to about 5 mg. In certain embodiments, the glidant or fumed silica is about 1 % of the pharmaceutical composition by weight.
- composition provided herein further comprises
- a pharmaceutical composition provided herein further comprises sodium stearyl fumarate. In certain embodiments, the amount of lubricant or sodium stearyl fumarate is about 20 mg to about 30 mg. In certain embodiments, the amount of lubricant or sodium stearyl fumarate is about 24 mg to about 25 mg. In certain embodiments, the lubricant or sodium stearyl fumarate is about 5% of the pharmaceutical composition by weight. [0030] In certain embodiments, a pharmaceutical composition provided herein further comprises sodium caprate. In certain embodiments, the composition comprises about 300 mg to about 2400 mg sodium caprate. In certain embodiments, the composition comprises about 300 mg sodium caprate. In certain embodiments, the composition comprises about 600 mg sodium caprate. In certain embodiments, the composition comprises about 900 mg sodium caprate. In certain embodiments, the composition comprises about 1200 mg sodium caprate. In certain embodiments, the composition comprises about 2400 mg sodium caprate.
- a pharmaceutical composition for oral administration is provided.
- a pharmaceutical composition for oral administration is provided.
- the amount of the GLP-1 peptide analog is about 0.1 mg to about 100 mg. In certain embodiments of a pharmaceutical composition provided herein the amount of the GLP- 1 peptide analog is about 0.0625 mg to about 36 mg. In certain embodiments of a pharmaceutical composition provided herein, the amount of the GLP-1 peptide analog is about 0.25 mg to about 36 mg. In certain embodiments of a pharmaceutical composition provided herein the amount of the GLP-1 peptide analog is about 0.125 mg, about 4.5 mg, or about 36 mg. In certain embodiments of a pharmaceutical composition provided herein the GLP- 1 peptide analog is about 0.2% to about 10% of the pharmaceutical composition by weight.
- a pharmaceutical composition for oral administration is provided.
- the pharmaceutical composition further comprises (i) about 0.1 mg to about 100 mg of a bislipidated GLP-1 peptide analog (ii) about 1 mg to about 1500 mg sodium chenodeoxycholate, (iii) about 1 mg to about 3000 mg propyl gallate, and (iv) 0 to about 300 mg Tris base.
- the pharmaceutical composition further comprises a filler, disintegrant, glidant, lubricant, bioadhesive and/or enteric coat.
- the pharmaceutical composition further comprises mannitol, crospovidone, fumed silica, sodium stearyl fumarate, cross-linked polyacrylic acid polymers, and/or methacrylic acid copolymers.
- a pharmaceutical composition for oral administration comprises i) about 0.1 % to about 10% of a bislipidated GLP-1 peptide analog (ii) about 10% to about 30% sodium chenodeoxycholate, and (iii) about 20% to about 60% propyl gallate.
- a pharmaceutical composition for oral administration is provided.
- the pharmaceutical composition further comprises (iv) about
- the pharmaceutical composition comprises about 3% to about 10 % crospovidone. In certain embodiments, the
- composition comprises about 1% to about 5% fumed silica.
- a pharmaceutical composition for oral administration is provided.
- a pharmaceutical composition for oral administration is provided.
- a bislipidated GLP-1 peptide analog comprises (i) about 0.256% to about 7.364% of a bislipidated GLP-1 peptide analog (ii) about 20.5% sodium chenodeoxycholate, (iii) about 40.9% propyl gallate, (iv) about 6.833% to about 18.903% mannitol, (v) 0 to about 7.815% Tris base; (vi) about 5.81% crospovidone, (vii) about 0.3% to about 10% cross-linked polyacrylic acid polymers, (viii) about 1% fumed silica, and (ix) about 2% to about 10% sodium stearyl fumarate.
- a bislipidated GLP-1 peptide analog comprises (i) about 0.256% to about 7.364% of a bislipidated GLP-1 peptide analog (ii) about 20.5% sodium chenodeoxycholate, (iii) about 40.9% propyl gallate, (iv) about 6.833% to about 18.903% mann
- a pharmaceutical composition for oral administration is provided.
- the pharmaceutical composition further comprises (iv) about
- a pharmaceutical composition for oral administration is provided.
- a bislipidated GLP-1 peptide analog comprises (i) about 1.25 mg, about 4.5 mg, or about 36 mg of a bislipidated GLP-1 peptide analog; (ii) about 100 mg of sodium chenodeoxycholate, (iii) about 200 mg propyl gallate, (iv) about 94.7 mg, about 89.6 mg, or about 51.8 mg mannitol, (v) 0 to about 36.2 mg Tris base, (vi) about 28.4 mg crospovidone, (vii) about 4.9 mg fumed silica, and (viii) about 24.4 mg sodium stearyl fumarate.
- a pharmaceutical composition for oral administration is provided.
- the pharmaceutical composition further comprises (i) about 1 mg to about 10 mg of a bislipidated GLP-1 peptide analog; (ii) about 50 mg to about 150 mg of sodium chenodeoxycholate, and (iii) about 100 mg to about 300 mg propyl gallate.
- the pharmaceutical composition further comprises (iv) about 50 mg to about 150 mg mannitol, (v) 0 to about 50 mg Tris base (vi) about 10 mg to about 45 mg crospovidone, (vii) about 1 mg to about 10 mg fumed silica, and (viii) about 5 mg to about 25 mg sodium stearyl fumarate.
- a pharmaceutical composition for oral administration is provided.
- a pharmaceutical composition for oral administration is provided.
- the pharmaceutical composition comprises (i) about 1 to about 15 mg of a bislipidated GLP-1 peptide analog; (ii) about 100 mg to about 800 mg of sodium chenodeoxycholate, and (iii) about 200 mg to about 1600 mg propyl gallate.
- the pharmaceutical composition comprises about 300 mg to about 400 mg of sodium chenodeoxycholate and about 600 mg to about 800 mg propyl gallate.
- the pharmaceutical composition further comprises mannitol, Tris, fumed silica, and/or sodium stearyl fumarate.
- the pharmaceutical composition further comprises about 50 mg to about 150 mg mannitol, 0 to about 50 mg Tris base about 10 mg to about 45 mg crospovidone, about 1 mg to about 10 mg fumed silica, and/or about 5 mg to about 25 mg sodium stearyl fumarate.
- the pharmaceutical composition further comprises cross-linked polyacrylic acid polymers.
- a pharmaceutical composition provided herein comprises an enteric coat.
- the enteric coat comprises methacrylic acid
- a pharmaceutical composition provided herein comprises a ratio of sodium chenodeoxycholate to propyl gallate of about 1 :2.
- a pharmaceutical composition provided herein comprises
- Tris base In certain embodiments, a pharmaceutical composition provided herein does not comprise Tris base.
- a pharmaceutical composition provided herein comprises a
- GLP-1 peptide analog that comprises any one of SEQ ID NOs: 2-10 or 12-15 or a salt thereof (e.g., an ammonium acetate salt).
- the GLP-1 peptide analog comprises SEQ ID NO:2 or a salt thereof (e.g., an ammonium acetate salt).
- the GLP-1 peptide comprises SEQ ID NO:2 and an ammonium acetate salt thereof.
- the GLP-1 peptide comprises an ammonium acetate salt of SEQ ID NO:2.
- a pharmaceutical composition provided herein is a solid dosage form.
- a pharmaceutical composition provided herein is in the form of a tablet, a hard capsule, or a soft capsule.
- a pharmaceutical composition provided herein is an
- immediate release, enterically coated, sustained release, or delayed release composition is immediate release, enterically coated, sustained release, or delayed release composition.
- the GLP- 1 peptide analog is absorbed in the proximal colon. In certain embodiments of a pharmaceutical composition provided herein the GLP- 1 peptide analog is absorbed in the proximal colon. In certain embodiments of a pharmaceutical composition provided herein the GLP- 1 peptide analog is absorbed in the proximal colon. In certain embodiments of a pharmaceutical composition provided herein the GLP- 1 peptide analog is absorbed in the proximal colon.
- the GLP- 1 peptide analog is absorbed in the proximal small bowel region. In certain embodiments of a pharmaceutical composition provided herein the GLP- 1 peptide analog is absorbed in the proximal colon and the proximal small bowel region. [0054] In certain embodiments of a pharmaceutical composition provided herein, administration of the pharmaceutical composition to a human results in a bioavailability of about 0.5% to about 35%.
- administration of the pharmaceutical composition results in a pK variability that does not exceed 100% or above, 50% or above, 25% or above and that is decreasing upon repeated daily dosing.
- a pharmaceutical composition provided herein has a
- disintegration time of about 5 minutes to about 100 minutes in disintegration test assay.
- a pharmaceutical composition provided herein has a
- dissolution time of about 10 minutes to about 500 minutes in dissolution test assay.
- a pharmaceutical composition provided herein is less than 2 grams, less than 1.5 grams, less than 1.0 grams, or less than 0.5 grams. In certain embodiments,
- a pharmaceutical composition is about 400 mg to about 500 mg.
- a method of improving glycemic control comprises
- a method of treating or preventing a disease or condition caused or characterized by hyperglycemia or impaired insulin release comprises
- a method of treating or preventing diabetes comprises
- the diabetes is type-2 diabetes.
- a method of reducing body weight comprises administering a pharmaceutical composition provided herein to a subject in need thereof.
- a method of reducing body fat comprises administering a pharmaceutical composition provided herein to a subject in need thereof.
- a method of treating obesity comprises administering a
- a method of treating or preventing a disease or condition caused or characterized by excess body weight comprises administering a pharmaceutical composition provided herein to a subject in need thereof.
- a method of managing weight comprises administering a pharmaceutical composition provided herein to a subject in need thereof.
- a method of increasing lipid oxidation comprises
- the subject has diabetes.
- the diabetes is type 2 diabetes mellitus.
- the subject's appetite is reduced.
- composition is administered once per day.
- the subject is human.
- a method of making a pharmaceutical composition provided herein comprises combining the GLP- 1 peptide analog, the sodium chenodeoxycholate, and the propyl gallate into an oral pharmaceutical composition.
- FIG. 1A shows the chemical structure, chemical formula, and molecular weight for SEQ ID NO:3.
- FIG. IB shows the chemical structure, chemical formula, and molecular weight for SEQ ID NO:4.
- FIG. 1C shows the chemical structure, chemical formula, and molecular weight for SEQ ID NO:5.
- FIG. ID shows the chemical structure, chemical formula, and molecular weight for SEQ ID NO:6.
- FIG. IE shows the chemical structure, chemical formula, and molecular weight for SEQ ID NO:7.
- FIG. IF shows the chemical structure, chemical formula, and molecular weight for SEQ ID NO:8.
- FIG. 1G shows the chemical structure, chemical formula, and molecular weight for SEQ ID NO:9.
- FIG. 1H shows the chemical structure, chemical formula, and molecular weight for SEQ ID NO:9.
- FIG. II shows the chemical structure, chemical formula, and molecular weight for
- FIG. 1 J shows the chemical structure, chemical formula, and molecular weight for semaglutide (SEQ ID NO: 11).
- FIG. IK shows the chemical structure, chemical formula, and molecular weight for
- FIG. 1L shows the chemical structure, chemical formula, and molecular weight for
- FIG. 1M shows the chemical structure, chemical formula, and molecular weight for
- FIG. IN shows the chemical structure, chemical formula, and molecular weight for
- FIG. 2 shows (A) the in vitro stability of GLP- 1 peptide analogs and semaglutide in the presence of simulated intestinal fluid with Pancreatin and (B) the in vivo concentration vs. time profile for SEQ ID NO:2 (MEDI7219), SEQ ID NO:6, and semaglutide (SEQ ID NO:2).
- FIG. 3 shows the solubility of propyl gallate, sodium chenodeoxycholate, and SEQ
- FIG. 4 shows an exemplary flow chart of tablet preparation methods tested for the development of the oral GLP-1 peptide analog formulation. (See Example 26.)
- FIG. 5 shows (A) hardness values attained and its relation to the thickness of the tablets, (B) disintegration time attained and its relation to the thickness of the tablets, and (C) a typical dissolution profile for uncoated tablets. (See Example 26.)
- FIG. 6 shows concentration vs. time profile for two 10 mg active pharmaceutical ingredient (API) content tablet formulations: tablets in oral IntelliCap ® capsules and oral tablets in acid-resistant capsules (see Example 12).
- API active pharmaceutical ingredient
- FIG. 7 shows concentration vs. time profile for tablet formulations for 5 mg and 10 mg active pharmaceutical ingredient (API) content tablet formulations.
- FIG. 8 shows concentration vs. time profile for tablet formulations of group 3 (small bowel) and 4 (colon) from second canine study. (See Example 12.)
- FIG. 9 shows repeated dose design for tablets from group 2 in Table 7. (See Example
- FIG. 10 shows SEQ ID NO: 2 (MEDI7219) concentration for repeated tablet dose up to day 5. (See Example 14.)
- FIG. 11 shows dissolution profiles of exemplary tablet compositions.
- FIG. 12 shows the clinical formulation design space and ranges for enterically coated tablets containing sodium chenodeoxycholate and propyl gallate. (See Example 24.)
- FIG. 13 shows the clinical formulation design space and ranges for additional
- enterically coated tablets containing sodium chenodeoxycholate and propyl gallate See Example 24.
- FIG. 14 shows the clinical formulation design space and ranges for enterically coated tablets containing sodium caprate. (See Example 28.)
- a peptide “comprising,” otherwise analogous aspects described in terms of “consisting of and/or “consisting essentially of are also provided.
- a peptide “comprising” a particular amino acid sequence refers to a peptide containing the amino acid sequence, wherein the peptide may or may not contain additional amino acids or other modifications to the amino acid sequence.
- a peptide “consisting of a particular amino acid sequence refers to a peptide containing only the amino acid sequence and no additional amino acids or other modifications to the amino acid sequence.
- a peptide "comprising" an amino acid sequence “consisting of a particular amino acid sequence refers to a peptide containing the amino acid sequence and no additional amino acids; however, the peptide may comprise other modifications to the amino acid sequence (e.g., an acyl moiety or a palmitoyl moiety).
- amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers.
- peptide further includes peptides that have undergone post-translational or post-synthesis modifications, for example, glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturally occurring amino acids.
- a “peptide” can be part of a fusion peptide comprising additional components such as, an Fc domain or an albumin domain, to increase half-life.
- a peptide as described herein can also be derivatized in a number of different ways.
- amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids.
- Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma- carboxyglutamate, and (9-phosphoserine.
- Amino acid analogs refer to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., an alpha carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs can have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- Amino acid mimetics refer to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that function similarly to a naturally occurring amino acid.
- amino acid and “amino acid residue” are used interchangeably throughout.
- isolated refers to the state in which peptides or nucleic acids, will
- Isolated peptides and isolated nucleic acids will be free or substantially free of material with which they are naturally associated such as other peptides or nucleic acids with which they are found in their natural
- Peptides and nucleic acid can be formulated with diluents or adjuvants and still for practical purposes be isolated - for example the peptides will normally be mixed with gelatin or other carriers if used to coat microtitre plates for use in immunoassays, or will be mixed with
- a "recombinant" peptide refers to a peptide produced via recombinant DNA
- Recombinantly produced peptides expressed in host cells are considered isolated for the purpose of the present disclosure, as are native or recombinant polypeptides which have been separated, fractionated, or partially or substantially purified by any suitable technique.
- fragment when referring to a
- peptide as provided herein include any peptide that has at least some activity of a
- GLP-1 peptide analog refers to a peptide that has at least some activity of GLP-1, e.g., binding to GLP-1 receptor.
- An "analog,” “derivative,” or “variant” peptide can contain a chemical modifications, e.g., chemical modifications intended to improve metabolic stability including those involve additional chemical manipulation following synthesis of the main peptide chain. Examples of manipulation include lactamization, disulfide bridge closure, lipidation and/or PEGylation.
- lipid modified amino acid and “lipidated amino acid” are used interchangeably herein, and refer to an amino acid, typically a lysine or cysteine, which has a lipid moiety attached.
- lipidated polypeptide “lipoprotein,” and the like refer to a peptide or polypeptide that includes one or more lipid modified amino acids. Representative examples of lipids, lipid moieties, and linkers are provided in WO 2016/198555 (see e.g., Figure 1 therein.)
- proteolytic degradation means the breakdown of peptides into smaller peptides or even amino acids, generally caused by the hydrolysis of a peptide bond by enzymes.
- composition or “pharmaceutical composition” refer to
- compositions containing a peptide or polypeptide provided herein, along with e.g. , pharmaceutically acceptable carriers, excipients, or diluents for administration to a subject in need of treatment e.g., pharmaceutically acceptable carriers, excipients, or diluents for administration to a subject in need of treatment.
- Lipidated peptides that are "substantially resistant" to proteolytic degradation can, for example, remain at least about 50% intact following exposure to an enzyme in conditions that the enzyme is generally active (e.g., suitable pH, temperature, other environmental conditions) for a defined period of time.
- Lipidated peptides provided herein can be substantially resistant to proteolytic degradation for a period of at least 4 hours, at least 8 hours, at least 12 hours, at least 24 hours, at least 36 hours, at least 48 hours, at least 72 hours, at least 96 hours, at least 120 hours, at least 144 hours, at least 168 hours, at least 192 hours, at least 216 hours, at least 240 hours, or about 36 hours to about 240 hours, about 48 hours to 240 hours, about 72 hours to about 240 hours, about 96 hours to about 240 hours, about 120 hours to about 240 hours, about 144 hours to about 240 hours, about 168 hours to about 240 hours, about 192 hours to about 240 hours, or about 216 hours to about 240 hours.
- At least about 60% of the lipidated peptide remains intact following exposure to an enzyme in conditions that the enzyme is generally active for a defined period of time, for example, at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 99.1 %, at least about 99.2%, at least about 99.3%, at least about 99.4%, at least about 99.5%, at least about 99.6%, at least about 99.7%, at least about 99.8%, at least about 99.9%, or at least about 100% of the lipidated peptide remains intact following exposure to an enzyme in conditions that the enzyme is generally active for a defined period of time.
- composition refers to a composition containing a GLP-1 agonist peptide provided herein, along with e.g. , pharmaceutically acceptable carriers, excipients, or diluents for administration to a subject in need of treatment, e.g. , a human subject.
- compositions that are, within the scope of sound medical judgment, suitable for contact with the tissues of human beings and animals without excessive toxicity or other complications commensurate with a reasonable benefit/risk ratio.
- pharmaceutically acceptable carrier refers to one or more non-toxic
- an "effective amount” is that amount of a peptide or formulation provided herein, the administration of which to a subject, either in a single dose or as part of a series, is effective for treatment, i.e., to reduce the severity of a disease or disorder (or one or more symptoms thereof), ameliorate one or more symptoms of such a disease or disorder, prevent the advancement of such a disease or disorder, cause regression of such a disease or disorder, or enhance or improve the therapeutic effect(s) of another therapy.
- subject is meant any subject, particularly a mammalian subject, in need of treatment with a peptide provided herein.
- Mammalian subjects include, but are not limited to, humans, dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, bears, cows, apes, monkeys, orangutans, and chimpanzees, and so on.
- the subject is a human subject.
- a "subject in need thereof refers to an individual for whom it is desirable to treat, e.g. , a subject with a condition caused or characterized by hyperglycemia or impaired insulin release, a subject with diabetes (e.g., type-2 diabetes), an obese subject or a subject prone to obesity for whom it is desirable to facilitate weight or body fat loss, weight or body fat maintenance, or to prevent or minimize weight gain over a specified period of time.
- a subject in need thereof refers to an individual for whom it is desirable to treat, e.g. , a subject with a condition caused or characterized by hyperglycemia or impaired insulin release, a subject with diabetes (e.g., type-2 diabetes), an obese subject or a subject prone to obesity for whom it is desirable to facilitate weight or body fat loss, weight or body fat maintenance, or to prevent or minimize weight gain over a specified period of time.
- Terms such as “treating” or “treatment” or “to treat” refer to therapeutic measures that cure and/or halt progression of a diagnosed
- preventing refer to prophylactic or preventative measures that prevent and/or slow the development of a targeted pathologic condition or disorder.
- those in need of treatment include those already with the disease or condition.
- those in need of prevention include those prone to have the disease or condition and those in whom the disease or condition is to be prevented.
- the phrase "treating a patient” having a disease or condition caused or characterized by excess body weight refers to reducing the severity of the disease or condition to an extent that the subject no longer suffers discomfort and/or altered function due to it.
- the phrase “preventing" a disease or condition caused or characterized by excess body weight refers to reducing the potential for the disease or condition and/or reducing the occurrence of the disease or condition (for example a relative reduction in occurrence as compared to untreated patients).
- GLP- 1 peptide analogs that can be orally administered are provided herein.
- a GLP- 1 peptide analog is a peptide that has at least some activity of GLP-1, e.g., binding to GLP-1 receptor.
- the native amino acid sequence of GLP-1 (7-36) is
- HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR (SEQ ID NO: l).
- the GLP-1 peptide analog is a bislipidated GLP-1 peptide analog.
- Exemplary bislipidated GLP- 1 peptide analogs are provided in Table 1. Table 1 : Exemplary bislipidated GLP- 1 peptide analogs
- the GLP-1 peptide analog comprises the lipidated peptide of
- the GLP-1 peptide analog consists of the lipidated peptide of SEQ ID NO:3 or a salt thereof (e.g., an ammonium acetate salt). [0128] In some embodiments, the GLP-1 peptide analog comprises the lipidated peptide of
- the GLP-1 peptide analog consists of the lipidated peptide of SEQ ID NO:4 or a salt thereof (e.g., an ammonium acetate salt).
- the GLP-1 peptide analog comprises the lipidated peptide of
- the GLP-1 peptide analog consists of the lipidated peptide of SEQ ID NO:5 or a salt thereof (e.g., an ammonium acetate salt).
- the GLP-1 peptide analog comprises the lipidated peptide of
- the GLP-1 peptide analog consists of the lipidated peptide of SEQ ID NO:6 or a salt thereof (e.g., an ammonium acetate salt).
- the GLP-1 peptide analog comprises the lipidated peptide of
- the GLP-1 peptide analog consists of the lipidated peptide of SEQ ID NO:7 a salt thereof (e.g., an ammonium acetate salt).
- the GLP-1 peptide analog comprises the lipidated peptide of
- the GLP-1 peptide analog consists of the lipidated peptide of SEQ ID NO:8 or a salt thereof (e.g., an ammonium acetate salt).
- the GLP-1 peptide analog comprises the lipidated peptide of
- the GLP-1 peptide analog consists of the lipidated peptide of SEQ ID NO:9 or a salt thereof (e.g., an ammonium acetate salt).
- the GLP-1 peptide analog comprises the lipidated peptide of
- the GLP-1 peptide analog comprises the lipidated peptide of SEQ ID NO: 2 or an ammonium acetate salt thereof (MED 17219). In some embodiments, the GLP-1 peptide analog consists of the lipidated peptide of SEQ ID NO:2 or a salt thereof (e.g., an ammonium acetate salt). In some embodiments, the GLP-1 peptide analog consists of the lipidated peptide of SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219). [0135] In some embodiments, the GLP-1 peptide analog comprises the lipidated peptide of
- the GLP-1 peptide analog consists of the lipidated peptide of SEQ ID NO: 10 or a salt thereof (e.g., an ammonium acetate salt).
- the GLP-1 peptide analog comprises the lipidated peptide of
- the GLP-1 peptide analog consists of the lipidated peptide of SEQ ID NO: 12 or a salt thereof (e.g., an ammonium acetate salt).
- the GLP-1 peptide analog comprises the lipidated peptide of
- the GLP-1 peptide analog consists of the lipidated peptide of SEQ ID NO: 13 or a salt thereof (e.g., an ammonium acetate salt).
- the GLP-1 peptide analog comprises the lipidated peptide of
- the GLP-1 peptide analog consists of the lipidated peptide of SEQ ID NO: 15 or a salt thereof (e.g., an ammonium acetate salt).
- the GLP-1 peptide analog is a synthetic peptide.
- the GLP-1 peptide analog e.g., SEQ ID NO:2 or an
- ammonium acetate salt thereof (MED 17219)) is lipidated.
- the GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)) is bislipidated.
- the GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)) contains two lipidated lysines. Methods of producing lipidated peptides are further described herein.
- the GLP-1 peptide analog e.g., SEQ ID NO:2 or an
- ammonium acetate salt thereof (MED 17219)) is substantially resistant to proteolytic degradation.
- the GLP-lpeptide analog e.g., SEQ ID NO: 2 or an ammonium acetate salt thereof (MEDI7219)
- the GLP-lpeptide analog is substantially resistant to DPP-IV, neprilysin, a-chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase, and/or pepsin degradation.
- the GLP-1 peptide analog e.g., SEQ ID NO:2 or an
- the GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) at least maintains substantially the same receptor selectivity as a compared to corresponding non-lipidated peptide.
- the GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) at least maintains substantially the same receptor potency and selectivity as a compared to corresponding non-lipidated peptide.
- the biological activity of a GLP-1 peptide analog can be evaluated, for example, by assessing the ability of the peptide to activate a receptor (e.g., a GLP-1 receptor). Peptide activation of such receptors results in downstream accumulation of cAMP second messenger which can be measured in a functional activity assay.
- a receptor e.g., a GLP-1 receptor
- the GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof
- MED 17219 exhibits an in vitro potency at the GLP-1 receptor as shown by an EC50 in a cAMP assay of less than 200 pM, less than 100 pM, less than 50 pM, less than 25 pM, less than 20 pM, less than 15 pM, less than 10 pM, less than 5 pM, or less than 4 pM.
- the GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)
- GLP-1 peptide analog exhibits an in vitro potency at the GLP-1 receptor as shown by an EC50 in a cAMP assay of about 3.9 pM, for example using a primary assay as described in WO 2016/198544, which is herein incorporated by reference in its entirety.
- the GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)
- GLP-1 peptide analog exhibits an in vitro potency at the GLP-1 receptor as shown by an EC50 in a cAMP assay of about 116 pM, for example using an INSle assay as described in WO 2016/198544, which is herein incorporated by reference in its entirety.
- lipidated peptides can be prepared as C-terminal
- amino acids can be coupled at ambient temperature, such as by using
- the N-Fmoc group can be deblocked using piperidine in DMF (20% v/v) at ambient temperature and the C-terminal residue incorporated as the N- Boc-protected form, e.g. Boc-His(Trt)-OH or Boc-Tyr(tBu)-OH or equivalent.
- the Mmt protecting group(s) can be removed manually and selectively by treatment of the synthesis resin with 1 % TFA
- the acidified resin can be quenched, such as with 5% DIPEA/NMP, and the exposed lysine amino-function(s) acylated, PEGylated or lipidated as required prior to peptide cleavage.
- Crude peptides can be cleaved from the resin support by treatment with a suitable cleavage cocktail.
- the cocktail consists of TFA (95% v/v), TIPS (2.5% v/v), and water (2.5% v/v) with agitation (3 x 1 hour at ambient temperature).
- Cleavage aliquots can be combined, concentrated by rotary evaporation and precipitated by addition of cold diethyl ether, isolating the solids by centrifugation.
- the crude peptides can be dried under a flow of dry nitrogen, reconstituted in a suitable aqueous buffer and filtered prior to chromatographic purification.
- the crude filtrates can be chromatographed, such as over an Agilent Polaris C8-A stationary phase (21.2 x 250 mm, 5 micron) eluting with a linear solvent gradient of 10-70%, 15-80% or 20-90% MeCN (0.1 % TFA v/v) in water (0.1% TFA v/v) over 30 minutes using a Varian SD-1 PrepStar binary pump system, monitoring by UV absorption at 210 nm.
- the peptide-containing fractions can then be pooled, frozen (dry-ice/acetone) and lyophilized.
- Crude bis-lipidated peptides can be dissolved, such as in 0.1M ammonium
- the peptide-containing fractions can then pooled, frozen (dry- ice/acetone) and lyophilized.
- the peptide sequence can be a GLP-1 analog sequence such as that provided in SEQ
- the lipid or lipid moiety can be any such as disclosed herein, including but not limited to: K(£-(PEG) 2 -(PEG) 2 -yE-Stearate); KCE-yE-Palmitoyl); K(£-(PEG) 2 -(PEG) 2 -yE- Stearate); KCyE-Palmitoyl); K(£-(PEG) 2 -(PEG) 2 -(PEG) 2 -Stearoyl); K(£-yE-Lauroyl); K(£- ⁇ - ⁇ -Lauroyl); K E-YE-yE-yE-Lauroyl); K(£-Ahx-Lauroyl); K(£-Ahx-Ahx-Lauroyl); K(£- Ahx-Ahx-Ahx-Lauroyl); K(£-(PEG) 2 -Lauroyl); K(£-(PEG) 2 -(PEG) 2
- the methods suitably comprise identifying at least one native amino acid residue in the peptide for substitution. In other embodiments, the methods suitably comprise identifying at least two native amino acid residues in the peptide for substitution. Alpha-methyl functionahzed amino acids can then substituted for the identified native amino acid residues.
- the synthetic peptides prepared by the methods provided herein suitably maintain substantially the same or exhibit increased receptor potency and in some cases selectivity as a corresponding synthetic peptide that does not comprise the substitutions.
- the synthetic peptides prepared according to the methods described herein can also be substantially resistant to proteolytic degradation.
- the substituted alpha-methyl functionalized amino acids correspond to the substituted native amino acid residues, and in additional embodiments, the substituted alpha-methyl functionalized amino acids correspond to the same class as the substituted native amino acid residues.
- the substituted alpha-methyl functionalized amino acids can be alpha-methyl phenylalanine.
- alpha-methyl phenylalanine is substituted for corresponding native amino acids, though in further embodiments of the methods, the alpha-methyl phenylalanine does not have to correspond to the same native amino acids for which the substitution is occurring.
- the synthetic peptides prepared according to the methods described herein can be substantially resistant to one or more of DPP-IV, neprilysin, a- chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase and pepsin degradation.
- synthetic peptides can be prepared as C-terminal carboxamides on
- identifying at least one native amino acid residue in the peptide for substitution suitably comprises identifying amino acids at sites susceptible to enzymatic cleavage.
- exemplary methods of identifying amino acids at sites susceptible to enzymatic cleavage are well known in the art.
- methods of identifying amino acids at sites susceptible to enzymatic cleavage suitably comprise exposing a natural peptide (e.g. , a wild-type peptide) to a single enzyme under conditions in which the enzyme is active (e.g., suitable pH, buffer conditions, temperature, etc.) for a pre-determined amount of time and measuring the enzymatic degradation products of the peptide.
- exemplary methods for measuring the enzymatic degradation products include, for example, reverse-phase liquid chromatography-mass spectrometry.
- Peptide solutions can be added to solutions of a protease.
- the peptide and enzyme can be co-incubated, suitably at about 37°C. Aliquots of the incubated peptide-enzyme mixture can be withdrawn periodically, quenched to arrest proteolytic activity, and analyzed by liquid chromatography-mass spectrometry (LC/MS). Analytes can be detected by both UV absorption (e.g., at 210 nm) and by ionization using a mass detector (ESI+ mode).
- LC/MS liquid chromatography-mass spectrometry
- Peptidic species (fragments) deriving from enzymatic cleavage of peptides can be analyzed post-process, and their molecular masses can be used to identify the precise cleavage position (highlighting the scissile bond in each case).
- the methods can be used to prepare synthetic GLP-1 peptide
- methods of preparing a proteolytically stable peptide comprise exposing a peptide to one or more proteases, identifying at least two native amino acid residues which are sites susceptible to proteolytic cleavage, and substituting alpha-methyl functionalized amino acids for the identified amino acid residues.
- Such methods provide a synthetic peptide that maintains substantially the same or exhibits increased receptor potency and in some cases selectivity as a corresponding synthetic peptide that does not comprise the substitution(s).
- the methods also provide a synthetic peptide that is substantially resistant to proteolytic degradation.
- the substituted alpha-methyl functionalized amino acids correspond to the substituted native amino acid residues, and in additional embodiments, the substituted alpha-methyl functionalized amino acids correspond to the same class as the substituted native amino acid residues.
- the substituted alpha-methyl functionalized amino acids can be selected from alpha-methyl functionalized Histidine, alpha-methyl functionalized Alanine, alpha-methyl functionalized Isoleucine, alpha-methyl functionalized Arginine, alpha-methyl functionalized Leucine, alpha-methyl functionalized Asparagine, alpha-methyl functionalized Lysine, alpha-methyl functionalized Aspartic acid, alpha-methyl
- Phenylalanine alpha-methyl functionalized Glutamic acid, alpha-methyl functionalized Threonine, alpha-methyl functionalized Glutamine, alpha-methyl
- the substituted alpha-methyl functionalized amino acids can be alpha-methyl phenylalanine and/or alpha-methyl lysine.
- alpha-methyl phenylalanine and/or alpha-methyl lysine can be substituted for corresponding native amino acids, though in further embodiments of the methods, the alpha-methyl phenylalanine and/or alpha-methyl lysine do not have to correspond to the same native amino acids for which the substitution is occurring.
- the synthetic peptides prepared according to the methods described herein can be substantially resistant to one or more of DPP-IV, neprilysin, a- chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase and pepsin degradation.
- formulations comprise a lipidated peptide as described herein (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) and a carrier, e.g., a lipidated peptide as described herein (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) and a carrier, e.g., a lipidated peptide as described herein (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) and a carrier, e.g., a lipidated peptide as described herein (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) and a carrier, e.g., a lipidated peptide as described herein (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) and
- Oral formulations as described herein can be formulated for a particular dosage form.
- Dosage regimens can be adjusted to provide the optimum response. It can be useful to formulate compositions in dosage unit forms for ease of administration and uniformity of dosage.
- Dosage unit forms as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of a lipidated peptide calculated to produce a therapeutic effect in association with the required pharmaceutical carrier.
- the oral formulation can comprise a dose of about 0.1 to about 100 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)).
- the oral formulation can comprise about 0.0625 to about 36 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)).
- the oral formulation can comprise about 0.25 to about 36 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)).
- the oral formulation can comprise about 0.5 to about 36 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)).
- the oral formulation can comprise about 1 to about 36 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)).
- the oral formulation can comprise about 3 to about 36 mg of a GLP- 1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)).
- the oral formulation can comprise about 6 to about 36 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)).
- the oral formulation can comprise about 9 to about 36 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)).
- the oral formulation can comprise about 18 to about 36 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)).
- the GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)
- the GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) can be about 0.0256% to about 7.36% of the oral formulation
- the oral formulation can comprise about 0.25 to about 18 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)).
- the oral formulation can comprise about 0.5 to about 18 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)).
- the oral formulation can comprise about 1 to about 18 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)).
- the oral formulation can comprise about 3 to about 18 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof
- the oral formulation can comprise about 6 to about 18 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)).
- the oral formulation can comprise about 9 to about 18 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)).
- the oral formulation can comprise about 0.25 to about 9 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)).
- the oral formulation can comprise about 0.5 to about 9 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)).
- the oral formulation can comprise about 1 to about 9 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)).
- the oral formulation can comprise about 3 to about 9 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)).
- the oral formulation can comprise about 6 to about 9 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)).
- the oral formulation can comprise about 0.25 to about 6 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)).
- the oral formulation can comprise about 0.5 to about 6 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)).
- the oral formulation can comprise about 1 to about 6 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)).
- the oral formulation can comprise about 3 to about 6 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof
- the oral formulation can comprise about 0.0625 mg of a GLP-1 peptide analog (e.g.,
- the oral formulation can comprise about 0.125 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)).
- the oral formulation can comprise about 0.5 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof
- the oral formulation can comprise about 1 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)).
- the oral formulation can comprise about 3 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)).
- the oral formulation can comprise about 4.5 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)).
- the oral formulation can comprise about 6 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)).
- the oral formulation can comprise about 9 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)).
- the oral formulation can comprise about 18 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)).
- the oral formulation can comprise about 36 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)).
- the amount of active pharmaceutical ingredient can be calculated by adjusting for pure peptide content, which can be calculated as an assay, encompassing content of ammonium, acetate and moisture, and multiplied by HPLC purity.
- the present invention provides oral
- the permeation enhancer can be, for example, a bile salt, sodium chenodeoxycholate, chenodeoxycholic acid, a gallate derivative, propyl gallate, ethyl gallate, or a combination thereof.
- the permeation enhancer can also be, for example, sodium caprate.
- the oral formulation comprises sodium chenodeoxycholate.
- the amount of sodium chenodeoxycholate can be about 1 mg to about 1500 mg.
- the amount of sodium chenodeoxycholate can be about 50 mg.
- the amount of sodium chenodeoxycholate can be about 65 mg.
- the amount of sodium chenodeoxycholate can be about 100 mg to about 800 mg.
- the amount of sodium chenodeoxycholate can be about 100 mg.
- the amount of sodium chenodeoxycholate can be about 120 mg.
- the amount of sodium chenodeoxycholate can be about 130 mg.
- the amount of sodium chenodeoxycholate can be about 140 mg.
- the amount of sodium chenodeoxycholate can be about 150 mg.
- the amount of sodium chenodeoxycholate can be about 200 mg.
- the amount of sodium sodium chenodeoxycholate can be about 1 mg to about 1500 mg.
- the amount of sodium chenodeoxycholate can be about 50 mg.
- the amount of sodium chenodeoxycholate can be
- chenodeoxycholate can be about 260 mg.
- the amount of sodium chenodeoxycholate can be about 280 mg.
- the amount of sodium chenodeoxycholate can be about 290 mg.
- the amount of sodium chenodeoxycholate can be about 299 mg.
- chenodeoxycholate can be about 300 mg.
- the amount of sodium chenodeoxycholate can be about 400 mg.
- the amount of sodium chenodeoxycholate can be about 500 mg.
- the amount of sodium chenodeoxycholate can be about 600 mg.
- chenodeoxycholate can be about 700 mg.
- the amount of sodium chenodeoxycholate can be about 800 mg.
- Sodium chenodeoxycholate can be about 15% to about 25% of the oral formulation by weight.
- Sodium chenodeoxycholate can be about 20 to about 21%, e.g., about 20.5% of the oral formulation by weight.
- the oral formulation comprises propyl gallate.
- the amount of propyl gallate can be about 1 mg to about 3000 mg.
- the amount of propyl gallate can be about 2 mg.
- the amount of propyl gallate can be about 10 mg.
- the amount of propyl gallate can be about 20 mg.
- the amount of propyl gallate can be about 30 mg.
- the amount of propyl gallate can be about 40 mg.
- the amount of propyl gallate can be about 50 mg.
- the amount of propyl gallate can be about 100 mg.
- the amount of propyl gallate can be about 150 mg.
- the amount of propyl gallate can be about 200 mg to about 1600 mg.
- the amount of propyl gallate can be about 200 mg.
- the amount of propyl gallate can be about 300 mg.
- the amount of propyl gallate can be about 400 mg.
- the amount of propyl gallate can be about 500 mg.
- the amount of propyl gallate can be about 600 mg.
- the amount of propyl gallate can be about 700 mg.
- the amount of propyl gallate can be about 800 mg.
- the amount of propyl gallate can be about 900 mg.
- the amount of propyl gallate can be about 1000 mg.
- the amount of propyl gallate can be about 1100 mg.
- the amount of propyl gallate can be about 1200 mg.
- the amount of propyl gallate can be about 1300 mg.
- the amount of propyl gallate can be about 1400 mg.
- the amount of propyl gallate can be about 1500 mg.
- the amount of propyl gallate can be about 1600 mg.
- Propyl gallate can be about 45% to about 55% of the oral formulation by weight.
- Propyl gallate can be about 40 to about 42%, e.g., about 40.9% of the oral formulation by weight.
- the oral formulation comprises sodium chenodeoxycholate and
- the ratio of sodium chenodeoxycholate to propyl gallate can be about 150: 1 to about 1:4. In one instance, the ratio of sodium chenodeoxycholate to propyl gallate is about 149.5: 1. In one instance, the ratio of sodium chenodeoxycholate to propyl gallate is about 145: 1. In one instance, the ratio of sodium chenodeoxycholate to propyl gallate is about 29: 1. In one instance, the ratio of sodium chenodeoxycholate to propyl gallate is about 14: 1. In one instance, the ratio of sodium chenodeoxycholate to propyl gallate is about 6.5: 1.
- the ratio of sodium chenodeoxycholate to propyl gallate is about 4: 1. In one instance, the ratio of sodium chenodeoxycholate to propyl gallate is about 2: 1. In one instance, the ratio of sodium chenodeoxycholate to propyl gallate is about 1: 1. The ratio of sodium chenodeoxycholate to propyl gallate can be about 2: 1 to about 1:4. The ratio of sodium chenodeoxycholate to propyl gallate can be about 1: 1 to about 1:4. The ratio of sodium chenodeoxycholate to propyl gallate can be about 1: 1 to about 1:3. In one instance, the ratio of sodium chenodeoxycholate to propyl gallate is about 1:2.
- the oral formulation comprises a combined amount of sodium
- the combined amount of sodium chenodeoxycholate and propyl gallate can be, for example, about 300 mg, about 600 mg, about 1200 mg, about 1800 mg, or about 2400 mg.
- the combined amount of sodium chenodeoxycholate and propyl gallate is about 300 mg.
- the oral formulation comprises a combined amount of sodium chenodeoxycholate and propyl gallate from about 50 mg to about 300 mg.
- the combined amount of sodium chenodeoxycholate and propyl gallate is about 75 mg.
- the combined amount of sodium chenodeoxycholate and propyl gallate is about 150 mg.
- the oral formulations provided herein can also comprise a pH modifier or pH
- the pH modifier or pH stabilizing excipient can, for example, maintain maximum solubility of the GLP-1 peptide analog (e.g., SEQ ID NO: 2 or an ammonium acetate salt thereof (MED 17219)) and/or the permeation enhancers (e.g., sodium
- the pH modifier or pH stabilizing agent can, for example, allow for slightly alkaline pH in an otherwise variable intestinal pH environment upon tablet disintegration and dissolution. Slightly alkaline pH can be beneficial for peptide and sodium chenodeoxycholate solubility, which in turn increases systemic bioavailability of GLP-1 peptide analogs.
- the pH modifier or pH stabilizing excipient can be, for example, phosphate, glycinate, citrate, or Tris base.
- the pH modifier or pH stabilizing excipient can be, for example Tris base.
- amount of pH modifier can be 0 to 300 mg.
- the amount of pH modifier e.g., Tris base
- Tris base can be about 5% to about 10% or about 7% to about 8%, e.g., about 7.41% or about 7.815% of the oral formulation by weight.
- pH modifiers can increase the oral bioavailability of peptides from oral tablet formulations.
- This increase in bioavailability can be achieved via a synergistic effect of (i) a pH modifier that increases the pH of the GI tract environment to pH values that are favorable for dissolution of peptide and (ii) permeation enhancer excipients present in said formulations.
- the site of absorption of peptide in gastrointestinal tract can significantly increase absolute oral bioavailability of the peptide. It is shown herein that delivery of oral peptide formulations to the proximal colon and to the proximal small bowel results in significantly higher absolute oral bioavailability as compared to delivery to the stomach. Matching the site of absorption with optimal tuning of the formulation for desired solubility at that site is one embodiment of this invention.
- the site of delivery of such formulations within the gastrointestinal tract can be controlled via an enteric coating that dissolves at a specified pH.
- the oral formulation can dissolve at a pH of about 5 to about 7.5.
- the pH of the oral formulation can be about 5, about 5.5, about 6.0, about 7.0, or about 7.5.
- the pH of the oral formulation is about 5.5.
- the pH of the oral formulation is about 7.0.
- Dissolution of tablets at specific pH values can be controlled with enteric coatings of polymers that are insoluble at the low pH of the stomach and are soluble at pHs of 5.5 or above.
- enteric coating polymers can be amino alkyl methacrylate copolymers, methacrylic ester copolymers, or methacrylic acid copolymers.
- enteric coating polymers can be methacrylic acid copolymers (e.g., Eudragit ® ).
- compositions for oral administration can comprise a mucoadhesive, e.g., cross-linked polyacrylic acid polymers (e.g., carbomers, e.g.,
- the mucoadhesive component can enable the permeation enhancer to stay close to the GLP-1 peptide agonist and/or to the walls of the GI tract, thereby increasing bioavailability.
- the oral formulation can be a sustained or delayed release
- Excipients such as cross-linked polyacrylic acid polymers (e.g., carbomers, e.g., Carbopol ® ) or methacrylic acid copolymers (e.g., Eudragit ® ) can be used in sustained or delayed release formulation.
- An enteric coat can, for example, allow the tablet to be intact in the harsh low pH environment of the stomach and to dissolve when the tablet reaches the proximal bowel where pH is 5.5 or above. This allows for GLP-1 agonist peptides to continue to be intact and readily available for systemic absorption upon dissolution.
- the cross-linked polyacrylic acid polymers can be, for example, about 0.3% to about 10% of the oral formulation by weight.
- the cross-linked polyacrylic acid polymers, e.g., Carbopol ® can be, for example, about 0.3% to about 3% of the oral formulation by weight.
- the cross-linked polyacrylic acid polymers, e.g., Carbopol ® can be, for example, about 1% to about 10% of the oral formulation by weight.
- the cross-linked polyacrylic acid polymers, e.g., Carbopol ® can be, for example, about 0.3%, about 1%, about 3%, or about 10% of the oral formulation by weight.
- the cross-linked polyacrylic acid polymers, e.g., Carbopol ® can be, for example, about 0.3%, about 0.9%, or about 1% of the oral formulation by weight.
- the oral formulation can comprise, for example, about 1 mg to about 50 mg of cross- linked polyacrylic acid polymers, e.g., Carbopol ® .
- the oral formulation can comprise, for example, about 1 mg to about 2 mg, e.g., about 1.5 mg, of cross-linked polyacrylic acid polymers, e.g., Carbopol ® .
- the oral formulation can comprise, for example, about 4 mg to about 5 mg, e.g., about 4.9 mg, of cross-linked polyacrylic acid polymers, e.g., Carbopol ® .
- the oral formulation can comprise, for example, about 14 mg to about 15 mg, e.g., about 14.6 mg, of cross-linked polyacrylic acid polymers, e.g., Carbopol ® .
- the oral formulation can comprise, for example, about 48 mg to about 49 mg, e.g., about 48.8 mg, of cross-linked polyacrylic acid polymers, e.g., Carbopol ® .
- cross-linked polyacrylic acid polymers e.g., Carbopol ®
- Carbopol ® can be, for example,
- the amount of cross-linked polyacrylic acid polymers, e.g., Carbopol ® (e.g., Carbopol 71G) can be, for example, about 1% to about 10% or about 1% to about 5% of the oral formulation by weight. In one instance, the amount of cross-linked polyacrylic acid polymers, e.g., Carbopol ® (e.g., Carbopol 71G) is about 1% of the oral formulation by weight. In one instance, the amount of cross-linked polyacrylic acid polymers, e.g.,
- Carbopol ® (e.g., Carbopol 71G) is about 2.5% of the oral formulation by weight. In one instance, the amount of cross-linked polyacrylic acid polymers, e.g., Carbopol ® (e.g., Carbopol 71G) is about 10% of the oral formulation by weight.
- Carbopol ® 71G in the oral formulation can be about 4.9 mg to about 48.8 mg.
- the amount of cross-linked polyacrylic acid polymers, e.g., Carbopol ® , e.g., Carbopol ® 71G in the oral formulation can be about 4.9 mg.
- the amount of cross-linked polyacrylic acid polymers, e.g., Carbopol ® , e.g., Carbopol ® 71G in the oral formulation can be about 48.8 mg.
- the amount of cross-linked polyacrylic acid polymers, e.g., Carbopol ® (e.g., Carbopol 971P) can be, for example, about 0.3% to about 3% of the oral formulation by weight. In one instance, the amount of cross-linked polyacrylic acid polymers, e.g., Carbopol ® (e.g., Carbopol 971P) is about 0.63% of the oral formulation by weight. In one instance, the amount of cross-linked polyacrylic acid polymers, e.g., Carbopol ® (e.g., Carbopol 971P) is about 3% of the oral formulation by weight.
- Carbopol ® 97 IP in the oral formulation can be up to 120 mg.
- the amount of cross-linked polyacrylic acid polymers, e.g., Carbopol ® , e.g., Carbopol ® 971P, in the oral formulation can be about 1.5 mg to about 14.6 mg.
- the amount of cross-linked polyacrylic acid polymers, e.g., Carbopol ® , e.g., Carbopol ® 971P, in the oral formulation can be about 1 mg to about 2 mg, e.g., about 1.5 mg.
- Carbopol ® e.g., Carbopol ® 97 IP
- in the oral formulation can be about 14 mg to about 15 mg, e.g., about 14.6 mg.
- the pharmaceutical composition can comprise an enteric coat.
- the enteric coat can comprise, for example, methacrylic acid copolymers.
- the methacrylic acid copolymers e.g., Eudragit ®
- the amount of methacrylic acid can be, for example, Eudragit RSPO.
- Eudragit ® can be, for example, about 5% to about 10% to about 20% or about 15% to about 20% of the pharmaceutical composition by weight. In one instance, the amount of Eudragit ® (e.g., Eudragit RSPO) is about 18%.
- the amount of methacrylic acid copolymers (e.g., Eudragit ® ) in the oral formulation can be about 60 to about 65 mg, e.g., about 61.1 mg or about 61.2 mg.
- the amount of methacrylic acid copolymers e.g.,
- Eudragit ® in the oral formulation can be about 52 to about 53 mg. In some embodiments, Eudragit is added in amount that results in about 12%, e.g., 12.5% weight gain of the pharmaceutical composition.
- the pharmaceutical composition can also comprise a filler and/or diluent, e.g., for providing suitable properties to a pharmaceutical powder blend upon manufacturing.
- the pharmaceutical composition can comprise mannitol.
- a pharmaceutical composition can comprise, for example, about 1% to about 30% or about 5% to about 30% mannitol of the pharmaceutical composition by weight.
- a pharmaceutical composition can comprise about 10% to about 20% mannitol of the pharmaceutical composition by weight.
- a pharmaceutical composition can comprise about 15% to about 30% mannitol of the pharmaceutical composition by weight.
- a pharmaceutical composition can comprise about 5% to about 20% mannitol of the pharmaceutical composition by weight.
- a pharmaceutical composition can comprise, for example, about 1 mg to about 150 mg or about 50 mg to about 100 mg mannitol.
- a pharmaceutical composition e.g., a
- composition containing Tris base comprises about 1% to about 20% mannitol, e.g., about 1% to about 9.35%, about 5% to about 20%, about 9.76% to about 18.39%, about 10% to about 20%, about 10.57% to about 19.30%, about 10.57% to about 19.4%, about 1%, about 9.35%, about 9.76%, about 18.3%, or about 18.39% of the pharmaceutical composition by weight.
- the amount of mannitol in a pharmaceutical formulation can be about 4.9 mg, about 45.7 mg, about 46.82 mg, about 51.8 mg, about 65.1 mg, about 75 mg, about 84.7 mg, about 88.1 mg, about 89.6 mg, about 94.7 mg, about 94.8 mg, about 101.8 mg.
- a pharmaceutical composition e.g., a pharmaceutical
- composition not containing Tris base comprises about 17 to about 30% mannitol, e.g., about 17.98% to about 26.78% of the pharmaceutical composition by weight.
- the amount of mannitol in a pharmaceutical formulation, e.g., a pharmaceutical formulation not containing Tris base, can be about 87.9 mg, about 125.3 mg, or about 130.9 mg.
- the pharmaceutical composition can also contain a disintegrant, e.g., that allows for the tablet to fall apart and adequately contact gastrointestinal fluid in order to be solubilized and systemically absorbed.
- the pharmaceutical composition can comprise crospovidone (e.g., Kollidon CL).
- a pharmaceutical composition e.g., a pharmaceutical composition containing or lacking Tris base, comprises about 1% to about 10%, about 5% to about 6 %, or about 5.81% crospovidone (e.g., Kollidon CL) of the pharmaceutical composition by weight.
- a pharmaceutical composition e.g., a pharmaceutical composition containing or lacking Tris base, comprises about 25 mg to about 35 mg, about 28 mg to about 29 mg, or about 28.4 mg crospovidone (e.g., Kollidon CL).
- crospovidone e.g., Kollidon CL
- the pharmaceutical composition can comprise a glidant, e.g., that ensures powder flow during tablet manufacturing.
- the pharmaceutical composition can comprise fumed silica (e.g., Aerosil 300).
- fumed silica e.g., Aerosil 300.
- a pharmaceutical composition e.g., a pharmaceutical composition containing or lacking Tris base
- a pharmaceutical composition e.g., a pharmaceutical composition containing or lacking Tris base
- the pharmaceutical composition can comprise a lubricant, e.g., that prevents blend sticking during tablet manufacturing.
- the pharmaceutical composition can comprise sodium stearyl fumarate.
- a pharmaceutical composition e.g., a pharmaceutical composition containing or lacking Tris base, comprises about 1% to about 10% or about 5% sodium stearyl fumarate of the pharmaceutical composition by weight.
- a pharmaceutical composition e.g., a pharmaceutical composition containing or lacking Tris base, comprises about 20 mg to about 30 mg or about 24 mg to about 25 mg, e.g., about 24.4 mg sodium stearyl fumarate.
- a pharmaceutical composition, e.g., a pharmaceutical composition containing Tris base comprises about 12 mg to about 13 mg, e.g., about 12.2 mg sodium stearyl fumarate.
- An oral formulation can comprise about 0.0625 mg to about 36 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)); about 100 mg to about 800 mg sodium chenodeoxycholate; about 200 mg to about 1600 mg propyl gallate; about 0 mg to about 120 mg Tris base; and/or about 0 mg to about 120 of cross-linked polyacrylic acid polymers (e.g., Carbopol 97 IP), optionally further comprising a filler (e.g., mannitol), a disintegrant (e.g., crospovidone such as Kollidon CL), a glidant (e.g., fumed silica such as Aerosil 300), and/or a lubricant (e.g., sodium stearyl fumarate).
- a GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED
- An oral formulation e.g., an immediate release oral formulation provided herein, can comprise about 0.1% to about 10% of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)); about 10% to about 30%, sodium chenodeoxycholate; about 15% to about 60% propyl gallate; about 5% to about 20% mannitol, 0% to about 10% Tris base, about 2% to about 10% of a disintegrant (e.g., crospovidone such as Kollidon CL), about 1% to about 5% of a glidant (e.g., fumed silica such as Aerosil 300), and/or about 1% to about 15% of a lubricant (e.g., sodium stearyl fumarate) of the oral formulation by weight.
- a GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)
- An oral formulation e.g., a controlled release oral formulation provided herein, can comprise about 0.1% to about 10% of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)); about 10% to about 30%, sodium
- chenodeoxycholate about 15% to about 60% propyl gallate; about 5% to about 20% mannitol, 0% to about 10% Tris base, about 2% to about 10% of a disintegrant (e.g., crospovidone such as Kollidon CL), about 0.1% to about 15% of cross-linked polyacrylic acid polymers (e.g., Carbopol 971P), about 1% to about 5% of a glidant (e.g., fumed silica such as Aerosil 300), and/or about 1% to about 15% of a lubricant (e.g., sodium stearyl fumarate) of the oral formulation by weight.
- a disintegrant e.g., crospovidone such as Kollidon CL
- cross-linked polyacrylic acid polymers e.g., Carbopol 971P
- a glidant e.g., fumed silica such as Aerosil 300
- a lubricant e.g
- An oral formulation e.g., an immediate release tablet, provided herein, can comprise about 4.5 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)); about 100 mg sodium chenodeoxycholate; about 200 mg propyl gallate; about 101 mg to about 102 mg, e.g., about 101.8 mg, mannitol; about 36 mg to about 37 mg, e.g., about 36.2 mg Tris base; about 28 mg to about 29 mg, e.g., about 28.4 mg, crospovidone (e.g., Kollidon CL); about 4 mg to about 5 mg, e.g., about 4.9 mg, fumed silica (e.g., Aerosil 300); and/or about 12 mg to about 13 mg, e.g.
- a GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED
- Such an oral formulation can optionally comprise about 60 mg to about 61 mg, e.g., about 61.2 mg of an enteric coating, e.g., a methacrylic acid copolymer coating (e.g., an Eudragit coating).
- an enteric coating e.g., a methacrylic acid copolymer coating (e.g., an Eudragit coating).
- An oral formulation e.g., a controlled release tablet, provided herein, can comprise about 4.5 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)); about 100 mg sodium chenodeoxycholate; about 200 mg propyl gallate; about 88 mg to about 89 mg, e.g., about 88.1 mg, mannitol; about 36 mg to about 37 mg, e.g., about 36.2 mg, Tris base; about 1 mg to about 2 mg, e.g., about 1.5 mg (or about 0.3%) of cross-linked polyacrylic acid polymers (e.g., Carbopol 971P);about 28 mg to about 29 mg, e.g., about 28.4 mg, crospovidone (e.g., Kollidon CL); about 4 mg to about 5 mg, e.g., about 4.9 mg, fumed silica (e.g., Aeros), a G
- Such an oral formulation can optionally comprise about 60 mg to about 61 mg, e.g., about 61.2 mg of an enteric coating, e.g., a methacrylic acid copolymer coating (e.g., an Eudragit coating).
- an enteric coating e.g., a methacrylic acid copolymer coating (e.g., an Eudragit coating).
- An oral formulation e.g., a controlled release tablet, provided herein, can comprise about 4.5 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)); about 100 mg sodium chenodeoxycholate; about 200 mg propyl gallate; about 75 mg, mannitol; about 36 mg to about 37 mg, e.g., about 36.2 mg, Tris base; about 14 mg to about 15 mg, e.g., about 14.6 mg, (or about 3%) of cross-linked polyacrylic acid polymers (e.g., Carbopol 971P); about 28 mg to about 29 mg, e.g., about 28.4 mg, crospovidone (e.g., Kollidon CL); about 4 mg to about 5 mg, e.g., about 4.9 mg, fumed silica (e.g., Aerosil 300); and/or about 12 mg to about 13 mg, e
- Such an oral formulation can optionally comprise about 60 mg to about 61 mg, e.g., about 61.2 mg of an enteric coating, e.g., a methacrylic acid copolymer coating (e.g., an Eudragit coating).
- an enteric coating e.g., a methacrylic acid copolymer coating (e.g., an Eudragit coating).
- An oral formulation e.g., an immediate release tablet, provided herein, can comprise about 1 mg to about 10 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)); about 50 mg to about 150 mg sodium chenodeoxycholate; about 100 mg to about 300 mg propyl gallate; about 50 mg to about 150 mg mannitol; about 15 mg to about 50 mg Tris base; about 10 mg to about 45 mg, crospovidone (e.g., Kollidon CL); about 1 mg to about 10 mg fumed silica (e.g., Aerosil 300); and/or about 5 mg to about 25 mg sodium stearyl fumarate.
- Such an oral formulation can optionally comprise about 60 mg to about 61 mg, e.g., about 61.2 mg of an enteric coating, e.g., a methacrylic acid copolymer coating (e.g., an Eudragit coating).
- An oral formulation e.g., a controlled release tablet, provided herein, can comprise about 1 mg to about 10 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)); about 50 mg to about 150 mg sodium chenodeoxycholate; about 100 mg to about 300 mg propyl gallate; about 35 mg to about 135 mg mannitol; about 15 mg to about 50 mg Tris base e; about 1 mg to about 2 mg, e.g., about 1.5 mg (or about 0.3%) of cross-linked polyacrylic acid polymers (e.g., Carbopol 97 IP); about 28 mg to about 29 mg, e.g., about 28.4 mg, crospovidone (e.g., Kollidon CL); about 1 mg to about 10 mg fumed silica (e.g., Aerosil 300); and/or about 10 mg to about 50 mg sodium stearyl fumarate.
- An oral formulation e.g., a controlled release tablet, provided herein, can comprise about 1 mg to about 10 mg of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)); about 50 mg to about 150 mg sodium chenodeoxycholate; about 100 mg to about 300 mg propyl gallate; about 25 mg to about 125 mg mannitol; about 15 mg to about 50 mg Tris base; about 14 mg to about 15 mg, e.g., about 14.6 mg, (or about 3%) of cross-linked polyacrylic acid polymers (e.g., Carbopol 971P); about 28 mg to about 29 mg, e.g., about 28.4 mg, crospovidone (e.g., Kollidon CL); about 1 mg to about 10 mg fumed silica (e.g., Aerosil 300); and/or about 5 mg to about 25 mg sodium stearyl fumarate.
- an enteric coating e.g., a methacrylic acid copolymer coating (e.g., an Eudragit coating) can comprise, for example, about 85% to about 86%, e.g., about 85.5%, of a methacrylic acid copolymer (e.g., Eudragit) and about 14% to about 15%, e.g., about 14.5% of an enteric coating plasticizer (e.g., PlasACRYL) of the oral formulation by weight.
- an enteric coating plasticizer e.g., PlasACRYL
- An oral formulation as provided herein can comprise salcaprozate sodium (i.e., sodium
- An oral formulation as provided herein can comprise sodium caprate.
- formulation can comprise, for example, about 300 mg sodium caprate to about 2400 mg sodium caprate.
- the formulation can comprise, for example, about 300 mg sodium caprate.
- the formulation can comprise, for example, about 600 mg sodium caprate.
- the formulation can comprise, for example, about 900 mg sodium caprate.
- the formulation can comprise, for example, about 1200 mg sodium caprate.
- the formulation can comprise, for example, about 2400 mg sodium caprate.
- caprate to GLP-l peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) can be, for example, 10: 1 to 150: 1.
- the ratio of sodium caprate to GLP-l peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)) can be, for example 15: 1.
- the ratio of sodium caprate to GLP-l peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)
- the ratio of sodium caprate to GLP-l peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) can be, for example, 150: 1.
- a formulation provided herein comprising sodium caprate can comprise an enteric coating, e.g., an enteric coating with a pH of 5.5 or with a pH of 7.0.
- a formulation comprising sodium caprate can comprise cross-linked polyacrylic acid polymers (e.g., Carbopol), e.g., about 0.9% of cross-linked polyacrylic acid polymers (e.g., Carbopol).
- the oral formulation can be a solid, a liquid, or a gel (e.g., a lipid gel).
- Solid dosage forms include, for example, tablets and capsules. Tablets include, for example, tablets in acid-resistant capsules, enterically-coated tablets, and mini-tablets. Mini- tablets may be enterically coated or uncoated and loaded in enterically coated capsules of acid-resistant capsules.
- the solid dosage form e.g., tablet
- Liquid dosage forms include, for example, solutions (e.g., a solution in an aqueous media) and suspensions (e.g., a suspension in an oil-based self-emulsified system).
- oral formulations provided herein can be controlled release formulations.
- the oral formulations provided herein can comprise an enteric coat.
- the oral compositions provided herein can comprise an enteric coat.
- formulations provided herein can comprise polymer layers, e.g., for controlled release or mucoadhesive properties.
- the GLP-l peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)) administered in the oral formulation provided herein can be absorbed in the proximal colon.
- the GLP-l peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)) administered in the oral formulation provided herein can be absorbed in the proximal small bowel region.
- the GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) administered in the oral formulation provided herein can be absorbed in the proximal colon and the proximal small bowel region.
- GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)
- administered in the oral formulation provided herein can be absorbed in the proximal colon and the proximal small bowel region.
- Such oral formulations provide high bioavailability of the GLP-1 peptide analog (e.g.,
- the pharmaceutical excipients identified herein act as a dual agent in maintaining the solubility of the GLP- 1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)) as well as disrupting tight junctions and acting as a permeation enhancer.
- compositions for oral administration can comprise excipients that provide optimum solubility of a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) and permeation enhancing action to improve bioavailability and decrease variability.
- a GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)
- the GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)
- the GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)
- Such a sequential release can improve the bioavailability and reduce the variability of the GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)).
- GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)
- a pharmaceutical composition for oral administration is provided.
- a pharmaceutical composition for oral administration provided herein can be about 2 grams or less.
- a pharmaceutical composition for oral administration provided herein can be about 1.9 grams or less, about 1.8 grams or less, about 1.7 grams or less, about 1.6 grams or less, about 1.5 grams or less, about 1.4 grams or less, about 1.3 grams or less, about 1.2 grams or less, 1 about 1.1 grams or less, about 1 gram or less, about 0.9 grams or less, about 0.8 grams or less, about 0.7 grams or less, about 0.6 grams or less, or about 0.5 grams or less.
- a pharmaceutical composition for oral administration is provided.
- a composition provided herein can be about 400 mg to about 500 mg.
- a pharmaceutically acceptable amount can be about 400 mg to about 500 mg.
- composition for oral administration provided herein can be about 450 mg to about 500 mg. In certain embodiments, a pharmaceutical composition for oral administration provided herein can be about 475 mg to about 500 mg.
- a pharmaceutical composition for oral administration is provided.
- a pharmaceutical composition for oral administration provided herein can be about 2 grams. In certain embodiments, a pharmaceutical composition for oral administration provided herein can be about 1.5 grams. In certain embodiments, a pharmaceutical composition for oral administration provided herein can be about 1 gram. In certain embodiments, a pharmaceutical composition for oral administration provided herein can be about 0.5 grams.
- a pharmaceutical composition for oral administration is provided.
- provided herein can be about 488 milligrams.
- a GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)
- a subject in need thereof comprising administering a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) in an oral formulation provided herein to a subject in need thereof.
- a GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)
- oral administration of GLP-1 peptide analogs can be used to treat or prevent a disease or condition caused or characterized by hyperglycemia or impaired insulin release.
- the methods herein comprise treating diabetes by orally administering a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) to a subject in need thereof.
- a GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)
- the methods herein comprise treating type-2 diabetes by orally administering a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) to a subject in need thereof.
- a GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)
- oral administration of GLP-1 peptide analogs e.g., SEQ ID NO: 1
- NO:2 or an ammonium acetate salt thereof improves glycemic control, provides body weight control, improves ⁇ -cell function and/or mass, reduces the rate of gastric acid secretion and gastric emptying, or any combination thereof.
- a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) can inhibit gastric motility and/or promote insulin release.
- a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) can therefore act to accelerate elimination of excessive adipose tissue, induce sustainable weight loss, and improve glycemic control.
- the methods herein comprise treating obesity by orally administering a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) to a subject in need thereof.
- a GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)
- the subject has type 2 diabetes mellitus.
- the methods herein comprise reducing body weight by orally administering a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) to a subject in need thereof.
- a GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)
- the subject has type 2 diabetes mellitus.
- the methods herein comprise reducing body fat by orally administering a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)) to a subject in need thereof.
- a GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MED 17219)
- the fat is liver fat. The reduction of liver fat can lead to enhanced insulin sensitivity and/or improved liver function.
- the methods herein comprise managing weight by orally administering a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) to a subject in need thereof.
- a GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)
- the methods herein comprise preventing weight gain, preventing fat gain (e.g., liver fat), promoting weight loss, promoting fat loss (e.g., liver fat), reducing excess body weight, reducing fat (e.g., liver fat), or treating obesity (e.g. by control of appetite, feeding, food intake, and/or calorie intake), including morbid obesity by orally administering a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) to a subject in need thereof.
- a GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)
- the methods herein comprise treating or preventing a disease or condition caused or characterized by excess body weight or excess body fat by orally administering a GLP-1 peptide analog (e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)) to a subject in need thereof.
- a GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof (MEDI7219)
- the oral administration is an adjunct to diet and exercise.
- the administration can also reduce body weight or treat obesity.
- the subject has a BMI of 27 to 40 kg/m 2 .
- the subject has a BMI of 30 to 39.9 kg/m 2 .
- the subject has a BMI of at least 40.
- the subject is overweight.
- the subject is obese.
- NO: 2 or an ammonium acetate salt thereof (MEDI7219)) in the various methods described herein include mammals, for example, humans, dogs, cats, primates, cattle, sheep, horses, pigs, etc.
- the subject is a human.
- GLP-1 peptide analog e.g., SEQ ID NO:2 or an ammonium acetate salt thereof
- the pharmaceutical formulation can be orally administered as soon as possible after a suitable diagnosis, e.g., within hours or days.
- the pharmaceutical formulation is administered orally once per day.
- the pharmaceutical formulation is administered orally twice per day.
- compositions for oral administration are provided herein.
- a pharmaceutical composition for oral administration comprises
- composition for oral administration comprising
- the pharmaceutical composition further comprises sodium chenodeoxycholate.
- the ratio of sodium chenodeoxycholate to propyl gallate is 145: 1. In one instance (16) of 14, the ratio of sodium chenodeoxycholate to propyl gallate is 29: 1. In one instance (17) of 14, the ratio of sodium chenodeoxycholate to propyl gallate is 14: 1. In one instance (18) of 14, the ratio of sodium chenodeoxycholate to propyl gallate is 6.5: 1. In one instance (19) of 14, the ratio of sodium chenodeoxycholate to propyl gallate is 4: 1. In one instance (110) of 14, the ratio of sodium chenodeoxycholate to propyl gallate is 2: 1.
- the ratio of sodium chenodeoxycholate to propyl gallate is 1 : 1. In one instance (112) of 13, the ratio of sodium chenodeoxycholate to propyl gallate is 2: 1 to 1:4. In one instance (113) of 112, the ratio of sodium chenodeoxycholate to propyl gallate is 1:2.
- the amount of sodium chenodeoxycholate is about 1 mg to about 1500 mg. In one instance (115) of 114, the amount of sodium chenodeoxycholate is about 100 mg to about 800 mg. In one instance (116) of 114, the amount of sodium chenodeoxycholate is about 100 mg, about 200 mg, about 300 mg, about 400 mg, about 500 mg, about 600 mg, about 700 mg, or about 800 mg. In one instance (117) of 114, the amount of sodium chenodeoxycholate is about 50 mg, about 65 mg, about 120 mg, about 130 mg, about 140 mg, about 150 mg, about 260 mg, about 280 mg, about 290 mg, or about 299 mg. In one instance (118) of 114, the amount of sodium chenodeoxycholate is about 100 mg.
- sodium chenodeoxycholate is about 20% to about 21% of the pharmaceutical composition by weight.
- the amount of propyl gallate is about 1 mg to about 3000 mg. In one instance (123) of 122, the amount of propyl gallate is about 200 mg to about 1600 mg. In one instance (124) of 122, the amount of propyl gallate is about 2 mg, about 10 mg, about 20 mg, about 30 mg, about 40 mg, about 50 mg, about 100 mg, about 150 mg, or about 200 mg.
- the amount of propyl gallate is about 200 mg, about 300 mg, about 400 mg, about 500 mg, about 600 mg, about 700 mg, about 800 mg, about 900 mg, about 1000 mg, about 1100 mg, about 1200 mg, about 1300 mg, about 1400 mg, about 1500 mg, or about 1600 mg. In one instance (126) of 122, the amount of propyl gallate is about 200 mg.
- propyl gallate is about 45% to about 55% of the pharmaceutical composition by weight. In one instance (128) of 127, propyl gallate is about 40% to about 41% of the pharmaceutical composition by weight. [0250] In one instance (129) of any one of II and 141-121, the pharmaceutical composition does not comprise propyl gallate.
- the pharmaceutical composition further comprises a pH modifier.
- the pharmaceutical composition further comprises Tris base.
- the amount of Tris base is up to 300 mg.
- the amount of Tris base is about 30 mg to about 40 mg.
- the amount of Tris base is about 36 mg to about 37 mg.
- Tris base is about 5% to about 10% of the pharmaceutical composition by weight.
- Tris base is about 7% to about 8% of the pharmaceutical composition by weight.
- the pharmaceutical composition does not comprise a pH modifier. In one instance (138) of any one of 11-129, the pharmaceutical composition does not comprise Tris base.
- the pharmaceutical composition comprises an enteric coating that dissolves at a pH of about 5 to about 7.5. In one instance (140) of any one of 11-138, the pharmaceutical composition comprises an enteric coating that dissolves at a pH of about 5.5 or above. In one instance (141) of any one of 11-138, the pharmaceutical composition comprises an enteric coating that dissolves at a pH of about 7.0 or above.
- the pharmaceutical composition further comprises a bioadhesive.
- the pharmaceutical composition further comprises cross-linked polyacrylic polymers.
- the cross-linked polyacrylic polymers are in a powder form or a granular from.
- the pharmaceutical composition further comprises Carbopol ® .
- the amount of bioadhesive or cross- linked polyacrylic polymers or Carbopol ® is about 1 mg to about 50 mg.
- the amount of bioadhesive or cross-linked polyacrylic polymers or Carbopol ® is about 1 mg to about 2 mg. In one instance (148) of any one of 142-145, the amount of bioadhesive or cross-linked polyacrylic polymers or Carbopol ® is about 4 mg to about 5 mg. In one instance (149) of any one of 142-145, the amount of bioadhesive or cross- linked polyacrylic polymers or Carbopol ® is about 14 mg to about 15 mg. In one instance or Carbopol ® is about 48 mg to about 49 mg.
- the bioadhesive or cross-linked polyacrylic polymers or Carbopol ® is about 0.3% to about 10% of the pharmaceutical composition by weight.
- the bioadhesive or cross-linked polyacrylic polymers or Carbopol ® is about 0.3% to about 3% of the pharmaceutical composition by weight or about 1% to about 10% of the pharmaceutical composition by weight.
- the bioadhesive or cross-linked polyacrylic polymers or Carbopol ® is about 0.3%, about 1%, about 3%, or about 10% of the pharmaceutical composition by weight.
- the bioadhesive or cross-linked polyacrylic polymers or Carbopol ® is about 0.3%, about 0.9%, or about 1.2% of the pharmaceutical composition by weight.
- the Carbopol ® is Carbopol® 71G.
- the amount of Carbopol ® 71G is about 4 mg to about 5 mg.
- the amount of Carbopol ® 71G is about 48 mg to about 49 mg.
- Carbopol ® 71G is about 1% to about 10% of the pharmaceutical composition by weight.
- the Carbopol ® is Carbopol ® 97 IP.
- the amount of Carbopol ® 971P is about 1 mg to about 2 mg.
- the amount of Carbopol ® 97 IP is about 14 mg to about 15 mg.
- Carbopol ® 97 IP is about 0.3% to about 3% of the pharmaceutical composition by weight.
- the pharmaceutical composition does not comprise a bioadhesive. In one instance (164) of any one of 11-141, the pharmaceutical composition does not comprise cross-linked polyacrylic polymers.
- the pharmaceutical composition further comprises an enteric coat.
- the pharmaceutical composition further comprises methacrylic acid copolymers.
- the pharmaceutical composition further comprising Eudragit ® .
- the amount of enteric coat or methacrylic acid copolymers or Eudragit ® is about 10 mg to about 65 mg.
- the amount of enteric coat or methacrylic acid copolymers or Eudragit ® is about 61 mg to about 62 mg.
- the amount of enteric coat or methacrylic acid copolymers or Eudragit ® is about 10 mg to about 53 mg. In one instance (171) of any one of 165-167, the enteric coat or methacrylic acid copolymers or Eudragit ® is about 5% to about 15% of the pharmaceutical composition by weight. In one instance (172) of any one of 165-167, the enteric coat or methacrylic acid copolymers or Eudragit ® dissolves at pH 5.5 or above.
- the pharmaceutical composition further comprises a filler.
- the pharmaceutical composition further comprises a diluent.
- the pharmaceutical composition further comprises mannitol.
- the amount of the filler, diluent, or mannitol is about 1 mg to about 150 mg.
- the amount of the filler, diluent, or mannitol is about 50 mg to about 100 mg.
- the amount of the filler, diluent, or mannitol is about 75 mg to about 150 mg.
- the filler, diluent, or mannitol is about 5% to about 30% of the pharmaceutical composition by weight. In one instance (180) of 179, the filler, diluent, or mannitol is about 5% to about 20% of the pharmaceutical composition by weight. In one instance (181) of 179, the filler, diluent, or mannitol is about 10% to about 20% of the pharmaceutical composition by weight. In one instance (182) of 179, the filler, diluent, or mannitol is about 15% to about 30% of the pharmaceutical composition by weight.
- the pharmaceutical composition further comprises a disintegrant.
- the pharmaceutical composition further comprises crospovidone.
- the amount of disintegrant or crospovidone is about 25 mg to about 35 mg.
- the amount of disintegrant or crospovidone is about 28 mg to about 29 mg.
- the disintegrant or crospovidone is about 1% to about 10% of the pharmaceutical composition by weight.
- the disintegrant or crospovidone is about 5% to about 6% of the pharmaceutical composition by weight.
- the pharmaceutical composition further comprises a glidant.
- the pharmaceutical composition further comprises fumed silica.
- the amount of glidant or fumed silica is about 1 mg to about 10 mg.
- the amount of glidant or fumed silica is about 4 mg to about 5 mg.
- the glidant or fumed silica is about 1% of the pharmaceutical composition by weight.
- the pharmaceutical composition further comprises a lubricant.
- the pharmaceutical composition further comprises sodium stearyl fumarate.
- the amount of lubricant or sodium stearyl fumarate is about 20 mg to about 30 mg.
- the amount of lubricant or sodium stearyl fumarate is about 24 mg to about 25 mg.
- the lubricant or sodium stearyl fumarate is about 5% of the pharmaceutical composition by weight.
- a pharmaceutical composition for oral administration comprises a bislipidated GLP-1 peptide analog and sodium N-(8-(2- hydroxybenzoyl)amino)caprylate (SNAC).
- a pharmaceutical composition for oral administration comprises a bislipidated GLP-1 peptide analog and sodium caprate.
- the composition comprises about 300 mg to about 2400 mg sodium caprate.
- the composition comprises about 300 mg sodium caprate.
- the composition comprises about 600 mg sodium caprate.
- the composition comprises about 900 mg sodium caprate.
- the composition comprises about 1200 mg sodium caprate.
- the composition comprises about 2400 mg sodium caprate.
- the amount of the GLP-1 peptide analog is about 0.1 mg to about 100 mg. In one instance (1109) of any one of 11-1107, the amount of the GLP-1 peptide analog is about 0.0625 mg to about 36 mg. In one instance (1110) of any one of 11-1107, the amount of the GLP-1 peptide analog is about 0.25 mg to about 36 mg. In one instance (1111), the amount of the GLP-1 peptide analog is about 0.125 mg, about 4.5 mg, or about 36 mg. In one instance (1112) of any one of 11-1107, the GLP-1 peptide analog is about 0.2% to about 10% of the pharmaceutical composition by weight.
- a pharmaceutical composition for oral administration comprises (i) about 0.1 mg to about 100 mg of a bislipidated GLP-1 peptide analog (ii) about 1 mg to about 1500 mg sodium chenodeoxycholate, (iii) about 1 mg to about 3000 mg propyl gallate, and (iv) 0 to about 300 mg Tris base.
- the pharmaceutical composition further comprising a filler, disintegrant, glidant, lubricant, bioadhesive and/or enteric coat.
- the pharmaceutical composition further comprises mannitol, crospovidone, fumed silica, sodium stearyl fumarate, cross-linked polyacrylic acid polymers, and/or methacrylic acid copolymers.
- a pharmaceutical composition for oral administration comprises (i) about 0.1 % to about 10% of a bishpidated GLP-1 peptide analog (ii) about 10% to about 30% sodium chenodeoxycholate, and (iii) about 20% to about 60% propyl gallate.
- a pharmaceutical composition for oral administration comprises (i) about 0.1 % to about 10% of a bishpidated GLP-1 peptide analog (ii) about 15% to about 25% sodium chenodeoxycholate, and (iii) about 30% to about 50% propyl gallate.
- the pharmaceutical composition further comprises (iv) about 5% to about 20% mannitol, (v) 0 to about 10% Tris base; (vi) about 2% to about 10% crospovidone, (vii) about 0.5% to about 5% fumed silica, and/or (viii) about 1% to about 15% sodium stearyl fumarate.
- the pharmaceutical composition comprises about 3% to about 10 % crospovidone. In one instance(I120) of any one of II 16- 1119, the pharmaceutical composition comprises about 1% to about 5% fumed silica.
- a pharmaceutical composition for oral administration comprises (i) about 0.256% to about 7.364% of a bishpidated GLP-1 peptide analog (ii) about 20.5% sodium chenodeoxycholate, (iii) about 40.9% propyl gallate, (iv) about 6.833% to about 18.903% mannitol, (v) 0 to about 7.815% Tris base; (vi) about 5.81% crospovidone, (vii) about 1% fumed silica, and (viii) about 2% to about 10% sodium stearyl fumarate.
- a bishpidated GLP-1 peptide analog ii) about 20.5% sodium chenodeoxycholate, (iii) about 40.9% propyl gallate, (iv) about 6.833% to about 18.903% mannitol, (v) 0 to about 7.815% Tris base; (vi) about 5.81% crospovidone, (vii) about 1% fumed silica, and (viii)
- a pharmaceutical composition for oral administration comprises (i) about 0.256% to about 7.364% of a bishpidated GLP-1 peptide analog (ii) about 20.5% sodium chenodeoxycholate, (iii) about 40.9% propyl gallate, (iv) about 6.833% to about 18.903% mannitol, (v) 0 to about 7.815% Tris base; (vi) about 5.81% crospovidone, (vii) about 0.3% to about 10% cross-linked polyacrylic acid polymers, (viii) about 1% fumed silica, and (ix) about 2% to about 10% sodium stearyl fumarate.
- a pharmaceutical composition for oral administration comprises (i) about 0.1 mg to about 40 mg of a bislipidated GLP-1 peptide analog; (ii) about 75 mg to about 125 mg of sodium chenodeoxycholate, and (iii) about 150 mg to about 250 mg propyl gallate.
- the pharmaceutical composition further comprises (iv) about 40 mg to about 125 mg mannitol, (v) 0 to about 45 mg Tris base, (vi) about 25 mg to about 35 mg crospovidone, (vii) about 1 mg to about 10 mg fumed silica, and (viii) about 20 mg to about 30 mg sodium stearyl fumarate.
- a pharmaceutical composition for oral administration comprises (i) about 1.25 mg, about 4.5 mg, or about 36 mg of a bislipidated GLP-1 peptide analog; (ii) about 100 mg of sodium chenodeoxycholate, (iii) about 200 mg propyl gallate, (iv) about 94.7 mg, about 89.6 mg, or about 51.8 mg mannitol, (v) 0 to about 36.2 mg Tris base, (vi) about 28.4 mg crospovidone, (vii) about 4.9 mg fumed silica, and (viii) about 24.4 mg sodium stearyl fumarate.
- a pharmaceutical composition for oral administration comprises (i) about 1 mg to about 10 mg of a bislipidated GLP-1 peptide analog; (ii) about 50 mg to about 150 mg of sodium chenodeoxycholate, and (iii) about 100 mg to about 300 mg propyl gallate.
- 1126 further comprises (iv) about 50 mg to about 150 mg mannitol, (v) 0 to about 50 mg Tris base (vi) about 10 mg to about 45 mg crospovidone, (vii) about 1 mg to about 10 mg fumed silica, and (viii) about 5 mg to about 25 mg sodium stearyl fumarate.
- a pharmaceutical composition for oral administration comprises (i) about 4.5 mg of a bislipidated GLP-1 peptide analog; (ii) about 100 mg of sodium chenodeoxycholate, (iii) about 200 mg propyl gallate, (iv) about 101.8 mg to about 138 mg, about 88.1 mg to about 124.3 mg, or about 75 mg or 11.2 mg mannitol, (v) 0 to about 36.2 mg Tris base, (vi) 0 mg, about 1.5 mg, or about 14. 6 mg cross-linked polyacrylic acid polymers, (vii) about 28.4 mg crospovidone, (viii) about 4.9 mg fumed silica, and (ix) about 12.2 mg or 24.4 mg sodium stearyl fumarate.
- a pharmaceutical composition for oral administration comprises (i) about 1 to about 15 mg of a bislipidated GLP-1 peptide analog; (ii) about 100 mg to about 800 mg of sodium chenodeoxycholate, and (iii) about 200 mg to about 1600 mg propyl gallate.
- the pharmaceutical composition comprises about 300 mg to about 400 mg of sodium chenodeoxycholate and about 600 mg to about 800 mg propyl gallate.
- the pharmaceutical composition further comprises mannitol, Tris, fumed silica, and/or sodium stearyl fumarate.
- the pharmaceutical composition further comprises about 50 mg to about 150 mg mannitol, 0 to about 50 mg Tris base about 10 mg to about 45 mg crospovidone, about 1 mg to about 10 mg fumed silica, and/or about 5 mg to about 25 mg sodium stearyl fumarate. In one instance (1133) of any one of 1129-1132, the pharmaceutical composition further comprises cross-linked polyacrylic acid polymers.
- the pharmaceutical composition comprises an enteric coat.
- the enteric coat comprises methacrylic acid copolymers.
- the ratio of sodium chenodeoxycholate to propyl gallate is about 1:2.
- the pharmaceutical composition comprises Tris base.
- the pharmaceutical composition does not comprise Tris base.
- the GLP-1 peptide analog comprises any one of SEQ ID NOs: 2-10 or 12-15 or a salt thereof.
- the GLP- 1 peptide analog comprises SEQ ID NO:2 or a salt thereof.
- the GLP-1 peptide comprises SEQ ID NO: 2 and an ammonium acetate salt thereof.
- the GLP-1 peptide comprises an ammonium acetate salt of SEQ ID NO:2.
- the pharmaceutical composition is a solid dosage form. In one instance (1144) of any one of 11-1142, the pharmaceutical composition is in the form of a tablet, a hard capsule, or a soft capsule.
- the pharmaceutical composition is an immediate release, enterically coated, sustained release, or delayed release composition.
- the GLP-1 peptide analog is absorbed in the proximal colon. In one instance (1147) of any one of 11-1146, the GLP-1 peptide analog is absorbed in the proximal small bowel region. In one instance (1148) of any one of 11-1147, the GLP-1 peptide analog is absorbed in the proximal colon and the proximal small bowel region. [0285] In one instance (1149) of any one of 11-1148, administration of the pharmaceutical composition to a human results in a bioavailability of about 0.5% to about 35%. In one instance (1150) of any one of 11-1149, administration of the pharmaceutical composition results in a pK variability that does not exceed 100% or above, 50% or above 25% or above and that is decreasing upon repeated daily dosing.
- the pharmaceutical composition has a disintegration time of about 5 minutes to about 100 minutes in disintegration test assay. In one instance (1152) of any one of 11-1151, the pharmaceutical composition has a dissolution time of about 10 minutes to about 500 minutes in dissolution test assay.
- the pharmaceutical composition is less than 2 grams, less than 1.5 grams, less than 1.0 grams, or less than 0.5 grams. In one instance (1155) of any one of 11-1152, the pharmaceutical composition is about 400 mg to about 500 mg.
- a method of improving glycemic control comprises administering the pharmaceutical composition of any one of 11-1154 to a subject in need thereof.
- a method of treating or preventing a disease or condition caused or characterized by hyperglycemia or impaired insulin release comprises administering the pharmaceutical composition of any one of 11-1154 to a subject in need thereof.
- a method of treating or preventing diabetes comprises administering the pharmaceutical composition of any one of 11-1154 to a subject in need thereof.
- the diabetes is type-2 diabetes.
- a method of reducing body weight comprises administering the pharmaceutical composition of any one of 11-1154 to a subject in need thereof.
- a method of reducing body fat comprises administering the pharmaceutical composition of any one of 11-1154 to a subject in need thereof.
- a method of treating obesity comprises administering the pharmaceutical composition of any one of 11-1154 to a subject in need thereof.
- a method of treating or preventing a disease or condition caused or characterized by excess body weight comprises administering the pharmaceutical composition of any one of 11-1154 to a subject in need thereof.
- a method of managing weight comprises administering the pharmaceutical composition of any one of 11-1154 to a subject in need thereof.
- a method of increasing lipid oxidation comprises administering the pharmaceutical composition of any one 11-1154 to a subject in need thereof.
- the subject has diabetes.
- the diabetes is type 2 diabetes mellitus.
- the subject's appetite is reduced.
- the pharmaceutical composition is administered once per day.
- the subject is human.
- a method of making the pharmaceutical composition of any one of 13-128, 130-199, and 1108-1156 comprises combining the GLP-1 peptide analog, the sodium chenodeoxycholate, and the propyl gallate into an oral pharmaceutical composition.
- GLP-1 peptide analogs in plasma e.g., rat or dog plasma
- SCIEX 6600 TripleTOF mass spectrometer coupled with a Shimadzu ultrahigh performance liquid chromatography (UHPLC).
- SRM Single-Reaction-Monitoring
- MS 2 MS/MS
- MEDI7219 SEQ ID NO:2
- variants thereof have a complicated fragmentation pattern. There are over 20 fragment ions with similar signal intensity. However, the ability to collect all fragment ions with Triple time-of-flight (TOF) and sum multiple high resolution fragment ions significantly enhanced assay sensitivity.
- the analytes of interest were analyzed from plasma, a complex biological matrix. Although protein precipitation using organic solvent can reduce matrix interference, significant background still persists.
- the high mass accuracy offered by the TripleTOF mass spectrometers further eliminated background noise, thus enhancing signal: noise (S/N) and allowing improved quantification.
- GLP-1 agonist peptide SEQ ID NO:3, MEDI7219 (SEQ ID NO:2), etc.
- the plate was carefully removed, and the upper clear supernatant was extracted with a 200 uL multichannel pipette into a new 96-well protein lobind plate. The supernatant was extracted twice for each well, and the supernatants were combined. The Plate was placed in TurboVap and the extracted supernatant was dried completely with heated (65°C) Nitrogen gas at 60 Fahrenheit (Fh).
- the plates were covered and incubated at room temperature for at least 30 minutes until the plate returned back to ambient temperature.
- 150 ⁇ L ⁇ of Reconstitution solution was added to each well.
- the plate was covered with a pierceable place seal and shaken at 600 rpm for 10 minutes.
- Experiment 1 or Experiment 2 could be used for the quantification of the GLP- 1 peptide analogs in high resolution mode.
- the Caco-2 cell line is a continuous cell line of heterogeneous human epithelial colorectal adenocarcinoma cells, which when cultured under specific conditions, become differentiated and polarized such that their phenotype, morphologically and functionally, resembles the enterocytes lining the small intestine. Caco-2 cells express tight junctions, microvilli, and a number of enzymes and transporters that are characteristic of such enterocytes.
- Caco-2 cells are most commonly used as a tight junction monolayer that provides a physical and biochemical barrier to the passage of drugs and thus serves as an in vitro model of the human small intestinal mucosa to predict the absorption of orally administered drugs.
- Caco-2 permeability assays were performed by Cyprotex US, LLC (MA, USA) to assess the efficacy of different permeation enhancers.
- Caco-2 cells were grown on Transwell filters until a transepithelial electric resistance of ⁇ 1000 ohms/cm 2 was achieved. The cells were incubated for three hours with media containing test samples on the apical (top) side of the cell layer, and with blank media on the basolateral (lower) side of the cell layer.
- Co is the solute concentration in the apical compartment at time zero
- A is the cross- sectional area of the epithelium in contact with apical solution.
- Lauroglycol FCC Kolliphor EL : Transcutol HP 5:4:3 (v/v) 0
- Table 3 Influence of various permeation enhancers on permeability of SEQ ID NO: 3 peptide in Caco-2 study.
- Table 4 Influence of various permeation enhancers on permeability of lipidated peptides in Caco-2 study.
- Intraduodenal (ID) studies were performed in rats as an in vivo system to demonstrate the efficacy of permeation enhancers attained in the Caco-2 studies.
- Solution formulations comprising GLP-1 peptide analogs were injected into rats in the duodenum segment of the small intestine.
- the first ID study involved the use of sodium caprate as the permeation enhancer and the SEQ ID NO: 3 GLP-1 peptide analog.
- Table 5 provides details of this rat ID study.
- Absolute bioavailability (%F) is a percentage-expressed measure of systemic drug exposure after oral, or in the current example intraduodenal, administration to the systemic exposure generated with intravenous (IV) administration of drug solution.
- Absolute bioavailability, (%F) is calculated as a percentage of systemic, or blood, drug concentration area under curve (AUC) of the AUC of IV administration adjusted to the amounts of drug given via these routes of administration.
- AUC drug concentration area under curve
- Formulation details and pharmacokinetic parameters attained are listed in Table 5.
- SEQ ID NO:3 has low absolute bioavailability (%F) with intraduodenal administration (0.035%) without any formulation intervention, the bioavailability of SEQ ID NO: 3 peptide was increased ⁇ 20-fold (to 0.71%) by addition of 50 mg/kg sodium caprate (see Table 5.)
- Gastrointestinal (GI) tract tissues looked normal upon microscopic evaluation following administration of 50 mg/kg sodium caprate.
- Table 5 Design and outcomes of rat intraduodenal study to test the in vivo efficacy of sodium caprate as a permeation enhancer.
- Table 6 Design and pharmacokinetic parameters of SEQ ID NO:3 peptide solution formulations in intraduodenal study to evaluate the in vivo efficacy of permeation enhancers identified in the Caco-2 studies.
- FASSIF fasted-state simulated intestinal fluid
- Pancreatin ® A fresh suspension of FASSIF/P (Fasted-State Simulated Intestinal Fluid + USP Pancreatin ® ) was prepared as described by Galia, Nicolaides, Horter, Lobenberg, Reppas and Dressman: Pharm. Res. 15 (1998) 698- 705. The resulting preparation is proteolytically equivalent to -375 units/mL (375kU/L) and was used immediately without storage.
- LC/MS method Agilent Polaris C8-A column (4.6 x 100 mm, 3 micron) was eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min-1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI+ mode). Peptide fragments deriving from enzymatic hydrolysis were identified by molecular weight, allowing location of the site of cleavage.
- Table 7 Design and outcomes of rat intraduodenal study to compare bioavailability of MEDI7219
- SEQ ID NO:2 SEQ ID NO:2
- SEQ ID NO:6 SEQ ID NO:6 peptide formulations with that of semaglutide formulations.
- chenodeoxycholate and propyl gallate providing 2.14 % and 1.96 % bioavailability, respectively.
- the control of sodium chenodeoxycholate with propyl gallate resulted in 1.45 % bioavailability.
- Table 8 Study design and pharmacokinetic parameters of rat intraduodenal study to assess oral bioavailability of the MEDI7219 (SEQ ID NO:2) peptide formulated with various permeation enhancers.
- MED 17219 SEQ ID NO: 2
- new gallate derivatives sodium 2-(3,4,5-trihydroxybenzoyloxy) acetate and butanoate
- sodium cholate with propyl gallate sodium caprate with propyl gallate
- sodium caprate with propyl gallate sodium caprate with propyl gallate and citric acid
- sucrose monododecanoate sucrose monododecanoate
- Table 9 Design and outcomes of rat intraduodenal study to assess oral bioavailability of the
- MEDI7219 (SEQ ID NO:2) peptide formulated with various permeation enhancers.
- the combination of sodium chenodeoxycholate and propyl gallate was soluble above pH 7.0.
- the solubility of MEDI7219 (SEQ ID NO:2) peptide increased in the range of pH 7.0 to 9.0.
- the addition of sodium chenodeoxycholate and propyl gallate did not change solubility profile of the MED 17219 (SEQ ID NO:2) peptide, which remained in the range of pH 7.0 to 9.0.
- the pH of solution upon stabilization of dosage form should be in the range of 7.0 to 9.0.
- This optimal pH may be achieved by the addition of buffer salts that create and maintain the correct pH range at the site of dosage form disintegration/dissolution in the gastrointestinal (GI) tract.
- the excipients identified in this composition enable optimum solubility of the peptide thereby enabling better absorption.
- pharmaceutical excipients identified herein act as a dual agent in maintaining the solubility of the peptide as well as disrupting the tight junctions and providing the action of a permeation enhancer.
- able 11 Solubility of sodium chenodeoxycholate in phosphate buffer.
- Table 14 Solubility of MEDI7219 (SEQ ID NO:2) peptide in the presence of propyl gallate and sodium chenodeoxycholate in phosphate buffer.
- the IntelliCap ® system an electronic oral drug delivery and monitoring device, was used to determine regional absorption for solution formulations.
- the IntelliCap ® incorporates a microprocessor, battery, pH sensor, temperature sensor, radio frequency (RF) wireless transceiver, fluid pump, and drug reservoir.
- the IntelliCap ® system can determine the drug's position in the gastrointestinal (GI) tract by a pH monitoring sensor in the capsule, thereby eliminating the need for in vivo imaging. This system was employed to assess the site of absorption of GLP- 1 peptide analogs in the GI tract following oral delivery to canines (Beagle dogs).
- Solution formulations without permeation enhancer excipients were used as intravenous (IV) and subcutaneous (SC) controls in the study.
- IV intravenous
- SC subcutaneous
- Table 15 The design and pharmacokinetic parameters details of this study are provided in Table 15.
- solution formulations were prepared and transferred to the IntelliCap ® capsule which was dosed to canines, wherein the formulation was released at a specific site in the GI tract.
- Table 15 Design and pharmacokinetic parameters of SEQ ID NO: 3 in canine site of absorption study.
- Group Formulation Dosing route F (%) (mg/Kg) (hr) (ng/mL) (ng.hr/mL)
- a third site of absorption study was performed to evaluate the absorption sites and tablet formulations in acid-resistant capsules in canines.
- Tablet formulation compositions dosed to dogs are provided in Table 17.
- the tablet manufacturing process was as follows: All ingredients were passed through a US sieve # 35 (0.5 mm opening), and the resultant powder was compacted using a pellet press. Compacted material was again passed through a US sieve # 35 (0.5 mm opening) to form granules. Tablets were then compressed at a load of 0.30 to 0.45 ton and a hardness of 34 to 42 N to determine tablet disintegration time, which was found to be 4.40 to 6.30 minutes under these conditions.
- Tablets in this study were either placed in acid-resistant capsules (Table 18, Groups 1 and 2) or in IntelliCap ® (Table 18, Groups 3 and 4). PK parameters are described in Table 18, and PK profiles are provided in FIGs. 6-8. Table 17 provides gastrointestinal transit times obtained using IntelliCap ® .
- Table 17 Tablet formulations compositions tested in site of absorption canine study.
- formulations tested in this study contained the MEDI7219 (SEQ ID NO:2) peptide, whereas the SEQ ID NO: 6 peptide was used in tablet formulations for the previous canine study in Example 12. Tablets were placed in acid-resistant capsules (one tablet/capsule) prior to dosing. Bioavailability was highest for the Group 8 formulation at 10.7% with minimal PK variability of 26%. (Table 20).
- This formulation contained 0.1 mg/kg MEDI7219 (SEQ ID NO:2) peptide and 300 mg total permeation enhancer (PE) consisting of a 1 :2 ratio of sodium chenodeoxycholate to propyl gallate. This ratio worked better compared to a 2: 1 ratio of these permeation enhancers (Group 9, Table 20). This study also confirmed the utility of Tris base as a pH stabilizer.
- Table 20 Design and pharmacokinetic parameters of MEDI7219 (SEQ ID NO: 2) after tablet resistant capsules dosing in canine study.
- Tablet optimization was further established in the following canine study.
- the goals of this study were to evaluate the performance of the group 8 tablet formulation (Example 13, Table 20) as an enterically-coated (EC) tablet and to evaluate repeated dosing of this formulation.
- a Eudragit formula dissolving at pH 5.5 or above was applied to the tablets as enteric coating.
- Formulations tested in this canine study are listed in Table 21. Repeated dosing schedule is shown in FIG. 9. Enterically-coated tablets were administered on day 0 followed by a 1 week wash-out. Following wash-out, animals received additional doses on days 7, 8, 9, 10 and 1 1.
- Pharmacokinetic profiles of MEDI7219 (SEQ ID NO:2) in multiple dosing arm of the study are shown in FIG. 10.
- MEDI7219 (SEQ ID NO:2), 100 mg sodium chenodeoxycholate, and 200 mg propyl gallate, resulted in absolute bioavailability of 4.6%, but with high PK variability of 92%. Repeated dosing of enterically coated tablet resulted in consistent bioavailability with reduced PK variability in subsequent dosing days.
- bioavailability > 4% for the Group 2 formulation (1 mg MEDI7219 (SEQ ID NO:2) peptide, 100 mg sodium chenodeoxycholate, and 200 mg propyl gallate) in an enterically- coated tablet has been confirmed.
- the results show that peptide bioavailability was dependent on dose, at 4.2% for a 1 mg dose, 15.5% for a 3 mg dose, and 7.5% for a 10 mg dose.
- a lower amount of permeation enhancers compared to the Group 2 formulation that is, 50 mg sodium chenodeoxycholate and 100 mg propyl gallate
- MUPS Multi-unit particulate
- Table 23 Ten different Multi-unit particulate (MUPS) formulations were prepared (Table 23) using the MEDI7219 (SEQ ID NO:2) peptide and permeation enhancers.
- the manufacturing process for the MUPS formulation was as follows. A solution of MEDI7219 (SEQ ID NO:2) peptide, sodium chenodeoxycholate and propyl gallate was prepared in water and sprayed onto sugar spheres in a Glatt Mini fluid bed coater. Following drying, sugar spheres coated with peptide and permeation enhancers were coated to result in the compositions described in Table 23. Details of the design and outcomes of this canine study are provided in Table 23.
- Table 23 Design and pharmacokinetic parameters of MEDI7219 (SEQ ID NO: 2) MUPS
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Endocrinology (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Diabetes (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Emergency Medicine (AREA)
- Obesity (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Hematology (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
Claims
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762579186P | 2017-10-31 | 2017-10-31 | |
| PCT/IB2018/058514 WO2019087083A2 (en) | 2017-10-31 | 2018-10-30 | Oral delivery of glp-1 peptide analogs |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| EP3703817A2 true EP3703817A2 (en) | 2020-09-09 |
| EP3703817A4 EP3703817A4 (en) | 2021-08-18 |
Family
ID=66331379
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP18874364.5A Withdrawn EP3703817A4 (en) | 2017-10-31 | 2018-10-30 | Oral delivery of glp-1 peptide analogs |
Country Status (23)
| Country | Link |
|---|---|
| US (1) | US11173124B2 (en) |
| EP (1) | EP3703817A4 (en) |
| JP (1) | JP2021501172A (en) |
| KR (1) | KR20200081411A (en) |
| CN (1) | CN111655338A (en) |
| AR (1) | AR116451A1 (en) |
| AU (1) | AU2018360382A1 (en) |
| BR (1) | BR112020008220A2 (en) |
| CA (1) | CA3079376A1 (en) |
| CL (1) | CL2020001131A1 (en) |
| CO (1) | CO2020005485A2 (en) |
| CR (1) | CR20200185A (en) |
| DO (1) | DOP2020000082A (en) |
| EA (1) | EA202091095A1 (en) |
| IL (1) | IL274096A (en) |
| MA (1) | MA50047A (en) |
| MX (1) | MX2020004497A (en) |
| PE (1) | PE20210116A1 (en) |
| PH (1) | PH12020551018A1 (en) |
| SG (1) | SG11202003627PA (en) |
| TW (1) | TW201932139A (en) |
| WO (1) | WO2019087083A2 (en) |
| ZA (1) | ZA202003149B (en) |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN111655338A (en) | 2017-10-31 | 2020-09-11 | 免疫医疗有限公司 | Oral delivery of GLP-1 peptide analogs |
| EP4252781A1 (en) * | 2020-11-27 | 2023-10-04 | D&D Pharmatech Inc. | Oral formulation of biologically active material conjugate having biotin moiety, fatty acid moiety, or combination thereof coupled thereto |
| FR3120189B1 (en) * | 2021-03-01 | 2024-11-29 | Farid Bennis | Pharmaceutical composition for oral administration of a GLP-1 receptor agonist |
| KR20230010571A (en) | 2021-07-12 | 2023-01-19 | 한미약품 주식회사 | A composition for oral administration comprising GLP-1 analog |
| WO2023065231A1 (en) * | 2021-10-21 | 2023-04-27 | Guangzhou Dazhou Biomedicine Ltd. | Oral delivery of therapeutic agents |
| US20250152516A1 (en) * | 2022-02-22 | 2025-05-15 | Astrazeneca Ab | Compressible sodium caprate formulations |
| US12605427B2 (en) * | 2023-05-15 | 2026-04-21 | Red Mountain Med Spa, LLC | Sublingual semaglutide-BPC 157 combination for weight loss |
Family Cites Families (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5556837A (en) * | 1994-08-01 | 1996-09-17 | Regeneron Pharmaceuticals Inc. | Methods for treating addictive disorders |
| GB0308734D0 (en) * | 2003-04-15 | 2003-05-21 | Axcess Ltd | Uptake of macromolecules |
| WO2012115208A1 (en) * | 2011-02-24 | 2012-08-30 | 久光製薬株式会社 | Glp-1 analogue composition for microneedle devices |
| EP2844269A4 (en) * | 2012-03-28 | 2016-01-06 | Amylin Pharmaceuticals Llc | TRANSMUCULOUS ADMINISTRATION OF GENETICALLY MODIFIED POLYPEPTIDES |
| KR20210086717A (en) * | 2013-05-02 | 2021-07-08 | 노보 노르디스크 에이/에스 | Oral dosing of glp-1 compounds |
| WO2014191545A1 (en) * | 2013-05-30 | 2014-12-04 | Novo Nordisk A/S | Novel oral pharmaceutical composition for treatment of diabetes |
| TWI726889B (en) * | 2015-06-10 | 2021-05-11 | 英商梅迪繆思有限公司 | Protease-resistant lipidated peptides |
| CN106366166A (en) * | 2016-08-30 | 2017-02-01 | 苏州普罗达生物科技有限公司 | Brain-derived-neurotrophic-factor accelerant polypeptide and application |
| CN111655338A (en) * | 2017-10-31 | 2020-09-11 | 免疫医疗有限公司 | Oral delivery of GLP-1 peptide analogs |
-
2018
- 2018-10-30 CN CN201880083797.2A patent/CN111655338A/en active Pending
- 2018-10-30 SG SG11202003627PA patent/SG11202003627PA/en unknown
- 2018-10-30 MA MA050047A patent/MA50047A/en unknown
- 2018-10-30 PE PE2020000457A patent/PE20210116A1/en unknown
- 2018-10-30 CA CA3079376A patent/CA3079376A1/en not_active Abandoned
- 2018-10-30 EA EA202091095A patent/EA202091095A1/en unknown
- 2018-10-30 JP JP2020524064A patent/JP2021501172A/en active Pending
- 2018-10-30 MX MX2020004497A patent/MX2020004497A/en unknown
- 2018-10-30 AU AU2018360382A patent/AU2018360382A1/en not_active Abandoned
- 2018-10-30 WO PCT/IB2018/058514 patent/WO2019087083A2/en not_active Ceased
- 2018-10-30 BR BR112020008220-1A patent/BR112020008220A2/en not_active Application Discontinuation
- 2018-10-30 CR CR20200185A patent/CR20200185A/en unknown
- 2018-10-30 US US16/760,250 patent/US11173124B2/en not_active Expired - Fee Related
- 2018-10-30 KR KR1020207014548A patent/KR20200081411A/en not_active Ceased
- 2018-10-30 EP EP18874364.5A patent/EP3703817A4/en not_active Withdrawn
- 2018-10-31 TW TW107138546A patent/TW201932139A/en unknown
- 2018-10-31 AR ARP180103167A patent/AR116451A1/en unknown
-
2020
- 2020-04-21 IL IL274096A patent/IL274096A/en unknown
- 2020-04-29 CL CL2020001131A patent/CL2020001131A1/en unknown
- 2020-04-29 PH PH12020551018A patent/PH12020551018A1/en unknown
- 2020-04-30 CO CONC2020/0005485A patent/CO2020005485A2/en unknown
- 2020-05-06 DO DO2020000082A patent/DOP2020000082A/en unknown
- 2020-05-27 ZA ZA2020/03149A patent/ZA202003149B/en unknown
Also Published As
| Publication number | Publication date |
|---|---|
| IL274096A (en) | 2020-06-30 |
| CL2020001131A1 (en) | 2020-10-23 |
| WO2019087083A3 (en) | 2019-08-08 |
| KR20200081411A (en) | 2020-07-07 |
| CA3079376A1 (en) | 2019-05-09 |
| JP2021501172A (en) | 2021-01-14 |
| US20200323782A1 (en) | 2020-10-15 |
| MA50047A (en) | 2020-07-08 |
| CR20200185A (en) | 2020-06-19 |
| AR116451A1 (en) | 2021-05-12 |
| WO2019087083A2 (en) | 2019-05-09 |
| US11173124B2 (en) | 2021-11-16 |
| CN111655338A (en) | 2020-09-11 |
| EA202091095A1 (en) | 2020-09-18 |
| MX2020004497A (en) | 2020-08-13 |
| PE20210116A1 (en) | 2021-01-19 |
| ZA202003149B (en) | 2021-06-30 |
| BR112020008220A2 (en) | 2020-10-27 |
| AU2018360382A1 (en) | 2020-06-18 |
| SG11202003627PA (en) | 2020-05-28 |
| DOP2020000082A (en) | 2020-08-31 |
| TW201932139A (en) | 2019-08-16 |
| PH12020551018A1 (en) | 2021-05-31 |
| CO2020005485A2 (en) | 2020-05-15 |
| EP3703817A4 (en) | 2021-08-18 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2019087083A2 (en) | Oral delivery of glp-1 peptide analogs | |
| KR101200227B1 (en) | Glucagon-like-peptide-2glp-2 analogues | |
| US8765675B2 (en) | Use of calcitonin in osteoarthritis | |
| JP6910950B2 (en) | Solid oral dosage form | |
| KR100679677B1 (en) | Delivery agent for enhancing mucosal absorption of biologically active agents | |
| JP2006517542A (en) | Improved oral peptide delivery | |
| JP2022513176A (en) | Oxintmodulin peptide analog preparation | |
| Emeh et al. | Impact of chemical structure, lipidation and formulation on luminal stability and intestinal absorption of GLP-1 analogues | |
| JP2024509829A (en) | Pharmaceutical composition for oral administration of GLP-1 receptor agonist | |
| HK40112314A (en) | Pharmaceutical composition comprising large physiologically active substance and excipient | |
| JP4476544B6 (en) | Improved oral delivery of peptides using enzyme-cleavable membrane translocators | |
| JP4476544B2 (en) | Improved oral delivery of peptides using enzyme-cleavable membrane translocators | |
| GB2625490A (en) | Pharmaceutical composition comprising large physiologically active substance and excipient | |
| HK1152229B (en) | Use of calcitonin in osteoarthritis | |
| HK1089935B (en) | Use of calcitonin in osteoarthritis |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20200602 |
|
| AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| AX | Request for extension of the european patent |
Extension state: BA ME |
|
| RAV | Requested validation state of the european patent: fee paid |
Extension state: MD Effective date: 20200602 Extension state: MA Effective date: 20200602 Extension state: TN Effective date: 20200602 |
|
| REG | Reference to a national code |
Ref country code: HK Ref legal event code: DE Ref document number: 40037080 Country of ref document: HK |
|
| A4 | Supplementary search report drawn up and despatched |
Effective date: 20210719 |
|
| RIC1 | Information provided on ipc code assigned before grant |
Ipc: A61K 47/10 20170101AFI20210713BHEP Ipc: A61P 3/10 20060101ALI20210713BHEP Ipc: A61K 38/26 20060101ALI20210713BHEP Ipc: A61K 38/22 20060101ALI20210713BHEP Ipc: A61K 9/20 20060101ALI20210713BHEP Ipc: A61K 9/28 20060101ALI20210713BHEP Ipc: A61K 9/48 20060101ALI20210713BHEP Ipc: A61K 9/50 20060101ALI20210713BHEP |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20220216 |