EP3676288A1 - Modified yeast comprising glucose-specific, atp-mediated transporters - Google Patents

Modified yeast comprising glucose-specific, atp-mediated transporters

Info

Publication number
EP3676288A1
EP3676288A1 EP18773300.1A EP18773300A EP3676288A1 EP 3676288 A1 EP3676288 A1 EP 3676288A1 EP 18773300 A EP18773300 A EP 18773300A EP 3676288 A1 EP3676288 A1 EP 3676288A1
Authority
EP
European Patent Office
Prior art keywords
cells
atp
glucose
yeast
modified
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP18773300.1A
Other languages
German (de)
French (fr)
Inventor
Daniel Joseph Macool
Yehong Jamie Wang
Paula Johanna Maria Teunissen
Quinn Qun Zhu
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Danisco US Inc
Original Assignee
Danisco US Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Danisco US Inc filed Critical Danisco US Inc
Publication of EP3676288A1 publication Critical patent/EP3676288A1/en
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P7/00Preparation of oxygen-containing organic compounds
    • C12P7/02Preparation of oxygen-containing organic compounds containing a hydroxy group
    • C12P7/04Preparation of oxygen-containing organic compounds containing a hydroxy group acyclic
    • C12P7/06Ethanol, i.e. non-beverage
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/415Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02EREDUCTION OF GREENHOUSE GAS [GHG] EMISSIONS, RELATED TO ENERGY GENERATION, TRANSMISSION OR DISTRIBUTION
    • Y02E50/00Technologies for the production of fuel of non-fossil origin
    • Y02E50/10Biofuels, e.g. bio-diesel

Definitions

  • compositions and methods relate to modified yeast harboring glucose- specific, ATP-mediated transporters.
  • the modified yeast produces an increased amount of ethanol in a starch-hydrolysate-fermentation compared to otherwise identical yeast.
  • Such yeast is particularly useful for large-scale ethanol production from starch substrates.
  • yeast-based ethanol production converts sugars into fuel ethanol.
  • the annual fuel ethanol production by yeast is about 90 billion liters worldwide (Gombert, A.K. and van Maris. A.J. (2015) Curr. Opin. Biotechnol. 33:81-86). It is estimated that about 70% of the cost of ethanol production is the feedstock. Since the production volume is so large, even small yield improvements will have massive economic impact across the industry.
  • Monosaccharides and other simple sugars are the favored carbon and energy sources of Saccharomyces cerevisiae (Leandro, M.J., et al. (2009) FEMS Yeast Res. 9: 511-25).
  • Many monosaccharide transporters operate by facilitated diffusion to move such molecules along a favorable concentration gradient across the cell membrane, in an energy-independent manner.
  • Other monosaccharide transporters are energy-consuming, allowing the uptake of sugar molecules against a concentration gradient, coupled with the simultaneous movement of a proton.
  • Such transporters usually operate only when limited sugar is present in a growth medium.
  • the uptake of hexoses in S. cerevisiae occurs only through facilitated diffusion (Lagunas, R. (1993) FEMS Microbiol. Rev. 10:229-42) mediated by about twenty
  • S. cerevisiae strain has been engineered with an ATP-mediated sucrose transporter.
  • the ATP requirement for proton extrusion decreases the anaerobic ATP yield on sucrose, which results in increased ethanol yield (Basso, T.O. et al. (2011) Met. Eng. 13:694-703).
  • sucrose is not the major substrate in USA.
  • This invention provides compositions and methods for increasing ethanol production in yeast by expressing glucose-specific, ATP-mediated transporters. Aspects and
  • modified yeast cells derived from parental yeast cells comprising a genetic alteration that causes the modified cells to produce an increased amount of a glucose-specific, ATP-mediated transporter compared to the parental cells, wherein the modified cells produce during fermentation an increased amount of ethanol compared to the amount of ethanol produced by the parental cells under identical fermentation conditions.
  • the genetic alteration comprises the introduction into the parental cells of a nucleic acid capable of directing the expression of a glucose-specific, ATP-mediated transporter to a level above that of the parental cell grown under equivalent conditions.
  • the genetic alteration comprises the introduction of an expression cassette for expressing a glucose-specific, ATP- mediated transporter.
  • the genetic alteration comprises the introduction of an exogenous gene encoding a glucose-specific, ATP-mediated transporter.
  • the exogenous gene is from an organism selected from the group consisting of Arabidopsis thaliana, Arabidopsis lyrate, Arabis alpine, Brassica rapa, Capsella rubella, Camelina sativa, and Eutreme salsugineus.
  • the exogenous gene is selected from the group consisting oiAtSTP9, AaSTP9S, AISTP9S, BrSTP9S, CrSTP9S, CsSTP9S, and EsSTP9S.
  • the genetic alteration comprises the introduction of a stronger promoter in an endogenous gene encoding a glucose-specific, ATP-mediated transporter.
  • the amount of increase in ethanol he production is at least about 2% compared to the level in the parental cells grown under equivalent conditions.
  • the modified cells of paragraphs 1-8 further comprise a genetic alteration that introduces one or more polynucleotides encoding a polypeptide of an exogenous phosphoketolase pathway.
  • the cells further comprise an exogenous gene encoding a carbohydrate processing enzyme.
  • the modified cells of any of paragraphs 1-10 further comprise an alteration in the glycerol pathway and/or the acetyl-CoA pathway.
  • the cells are of a
  • a method for increasing the amount of ethanol produced by cells grown on a starch-hydrolysate substrate comprising: introducing into parental yeast cells a genetic alteration that increases the production of glucose-specific, ATP-mediated transporter polypeptides compared to the amount produced in the parental cells.
  • the cells do not produce a significant amount of additional glycerol compared to the amount produced by the parental cells.
  • the increased production of the glucose-specific, ATP-mediated transporter polypeptides increases ATP consumption in the cells.
  • the starch- hydrolysate comprises at least 5 g/L glucose.
  • the cells having the introduced genetic alteration are the modified cells of any of paragraphs 1-12.
  • Figure 1 is a map of an AtSTP9S expression cassette.
  • Figure 2 is a map of plasmid pZK41Wn-H3SP9.
  • yeast cells yeast strains, or simply “yeast” refer to organisms from the phyla Ascomycota and Basidiomycota. Exemplary yeast is budding yeast from the order Saccharomycetales. Particular examples of yeast are Saccharomyces spp., including but not limited to S. cerevisiae. Yeast include organisms used for the production of fuel alcohol as well as organisms used for the production of potable alcohol, including specialty and proprietary yeast strains used to make distinctive-tasting beers, wines, and other fermented beverages.
  • engineered yeast cells refer to yeast that include genetic modifications and characteristics described herein. Variant/modified yeast do not include naturally occurring yeast.
  • polypeptide and protein are used interchangeably to refer to polymers of any length comprising amino acid residues linked by peptide bonds.
  • the conventional one-letter or three-letter codes for amino acid residues are used herein and all sequence are presented from an N-terminal to C-terminal direction.
  • the polymer can comprise modified amino acids, and it can be interrupted by non- amino acids.
  • the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
  • polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids, etc.
  • proteins are considered to be "related proteins", or “homologs” Such proteins can be derived from organisms of different genera and/or species, or different classes of organisms (e.g., bacteria and fungi), or artificially designed. Related proteins also encompass homologs determined by primary sequence analysis, determined by secondary or tertiary structure analysis, or determined by immunological cross-reactivity, or determined by their functions.
  • homologous protein refers to a protein that has similar activity and/or structure to a reference protein. It is not intended that homologs necessarily be evolutionarily related. Thus, it is intended that the term encompass the same, similar, or corresponding enzyme(s) (i.e. , in terms of structure and function) obtained from different organisms. In some embodiments, it is desirable to identify a homolog that has a quaternary, tertiary and/or primary structure similar to the reference protein. In some embodiments, homologous proteins induce similar immunological response(s) as a reference protein. In some embodiments, homologous proteins are engineered to produce enzymes with desired activity (ies).
  • the degree of homology between sequences can be determined using any suitable method known in the art (see, e.g. , Smith and Waterman (1981) ⁇ 4 ⁇ iv. Appl. Math. 2.482; Needleman and Wunsch (1970) J. Mol. Biol., 48:443; Pearson and Lipman (1988) Proc. Natl. Acad. Sci. USA 85:2444; programs such as GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package (Genetics Computer Group, Madison, WI); and Devereux et al. (1984) Nucleic Acids Res . 12:387-95).
  • PILEUP is a useful program to determine sequence homology levels.
  • PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pair-wise alignments. It can also plot a tree showing the clustering relationships used to create the alignment.
  • PILEUP uses a simplification of the progressive alignment method of Feng and Doolittle, (Feng and Doolittle (1987) J. Mol. Evol. 35:351-60). The method is similar to that described by Higgins and Sharp ((1989) CABIOS 5: 151-53).
  • Useful PILEUP parameters including a default gap weight of 3.00, a default gap length weight of 0.10, and weighted end gaps.
  • BLAST program Another example of a useful algorithm is the BLAST algorithm, described by Altschul et al. ((1990) J. Mol. Biol. 215:403-10) and Karlin et al. ((1993) Proc. Natl. Acad. Sci. USA 90:5873-87).
  • One particularly useful BLAST program is the WU-BLAST-2 program (see, e.g., Altschul et al. (1996) Meth. Enzymol. 266:460-80). Parameters "W,” "T,” and "X” determine the sensitivity and speed of the alignment.
  • the BLAST program uses as defaults a word-length (W) of 11, the BLOSUM62 scoring matrix (see, e.g. , Henikoff and Henikoff (1989) Proc. Natl. Acad. Sci. USA 89: 10915) alignments (B) of 50, expectation (E) of 10, M'5, N'-4, and a comparison of both strands.
  • the phrases "substantially similar” and “substantially identical,” in the context of at least two nucleic acids or polypeptides, typically means that a polynucleotide or polypeptide comprises a sequence that has at least about 70% identity, at least about 75% identity, at least about 80% identity, at least about 85% identity, at least about 90% identity, at least about 91% identity, at least about 92% identity, at least about 93% identity, at least about 94% identity, at least about 95% identity, at least about 96% identity, at least about 97% identity, at least about 98% identity, or even at least about 99% identity, or more, compared to the reference (i.e. , wild-type) sequence.
  • Percent sequence identity is calculated using CLUSTAL W algorithm with default parameters. See Thompson et al. (1994) Nucleic Acids Res. 22:4673-4680. Default parameters for the CLUSTAL W algorithm are:
  • Gap extension penalty 0.05
  • polypeptides are substantially identical.
  • first polypeptide is immunologically cross-reactive with the second polypeptide.
  • polypeptides that differ by conservative amino acid substitutions are immunologically cross- reactive.
  • a polypeptide is substantially identical to a second polypeptide, for example, where the two peptides differ only by a conservative substitution.
  • Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions (e.g., within a range of medium to high stringency).
  • the term "gene” is synonymous with the term “allele” in referring to a nucleic acid that encodes and directs the expression of a protein or RNA. Vegetative forms of filamentous fungi are generally haploid, therefore a single copy of a specified gene (i.e. , a single allele) is sufficient to confer a specified phenotype.
  • the term “allele” is generally preferred when an organism contains more than one similar genes, in which case each different similar gene is referred to as a distinct "allele.”
  • expressing a polypeptide refers to the cellular process of producing a polypeptide using the translation machinery (e.g., ribosomes) of the cell.
  • translation machinery e.g., ribosomes
  • an "expression cassette” refers to a DNA fragment that includes a promoter, and amino acid coding region and a terminator (i.e., promoter: : amino acid coding region: : terminator) and other nucleic acid sequence needed to allow the encoded polypeptide to be produced in a cell.
  • Expression cassettes can be exogenous (i.e. , introduced into a cell) or endogenous (i.e. , extant in a cell).
  • wild-type and “native” are used interchangeably and refer to genes, proteins or strains found in nature, or that are not intentionally modified for the advantage of the presently described yeast.
  • protein of interest refers to a polypeptide that is desired to be expressed in modified yeast.
  • a protein can be an enzyme, a substrate-binding protein, a surface-active protein, a structural protein, a selectable marker, or the like, and can be expressed.
  • the protein of interest is encoded by an endogenous gene or a heterologous gene (i.e. , gene of interest") relative to the parental strain.
  • the protein of interest can be expressed intracellularly or as a secreted protein.
  • the terms “genetic manipulation” and “genetic alteration” are used interchangeably and refer to the alteration/change of a nucleic acid sequence.
  • the alteration can include but is not limited to a substitution, deletion, insertion or chemical modification of at least one nucleic acid in the nucleic acid sequence.
  • a "functional polypeptide/protein” is a protein that possesses an activity, such as an enzymatic activity, a binding activity, a surface-active property, or the like, and which has not been mutagenized, truncated, or otherwise modified to abolish or reduce that activity.
  • Functional polypeptides can be thermostable or thermolabile, as specified.
  • a functional gene is a gene capable of being used by cellular components to produce an active gene product, typically a protein.
  • Functional genes are the antithesis of disrupted genes, which are modified such that they cannot be used by cellular components to produce an active gene product, or have a reduced ability to be used by cellular components to produce an active gene product.
  • Attenuation of a pathway or “attenuation of the flux through a pathway” i.e. , a biochemical pathway, refers broadly to any genetic or chemical manipulation that reduces or completely stops the flux of biochemical substrates or intermediates through a metabolic pathway. Attenuation of a pathway may be achieved by a variety of well-known methods.
  • Such methods include but are not limited to: complete or partial deletion of one or more genes, replacing wild-type alleles of these genes with mutant forms encoding enzymes with reduced catalytic activity or increased Km values, modifying the promoters or other regulatory elements that control the expression of one or more genes, engineering the enzymes or the mRNA encoding these enzymes for a decreased stability, misdirecting enzymes to cellular compartments where they are less likely to interact with substrate and intermediates, the use of interfering RNA, and the like.
  • anaerobic fermentation refers to growth in the absence of oxygen.
  • end of fermentation refers to the stage of fermentation when the economic advantage of continuing fermentation to produce a small amount of additional alcohol is exceeded by the cost of continuing fermentation in terms of fixed and variable costs.
  • end of fermentation refers to the point where a fermentation will no longer produce a significant amount of additional alcohol, i.e., no more than about 1 % additional alcohol.
  • carbon flux refers to the rate of turnover of carbon molecules through a metabolic pathway. Carbon flux is regulated by enzymes involved in metabolic pathways, such as the pathway for glucose metabolism and the pathway for maltose metabolism.
  • compositions and methods are based on the discovery that modified yeast over-expressing a glucose-specific, ATP-mediated transporter produces more ethanol in a starch-hydrolysate-fermentation than an otherwise identical parental yeast. Without being limited to a theory, it is believed that the introduction of an ATP-mediated transporter affects both glucose uptake and ATP consumption, resulting in an overall increase in the desirable products of yeast metabolism.
  • the glucose-specific, ATP-mediated transporter is an endogenous transporter caused to be overexpressed by introducing into the parental yeast a nucleic acid sequence encoding an addition copy of the transporter, for example, in the form of an expression cassette.
  • the glucose-specific, ATP-mediated transporter is an endogenous transporter caused to be overexpressed by modifying the endogenous gene in the parental yeast, such as by introducing a stronger promoter.
  • the glucose-specific, ATP-mediated transporter is from Arabidopsis thaliana, Arabidopsis lyrate, Arabis alpine, Brassica rapa, Capsella rubella, Camelina sativa, Eutreme salsugineus, or a related organism.
  • the glucose-specific, ATP-mediated transporter is encoded by a gene selected irom AtSTP9, AaSTP9S, AISTP9S, BrSTP9S, CrSTP9S, CsSTP9S, and EsSTP9S.
  • the glucose-specific, ATP-mediated transporter is AtSTP9, AaSTP9S, A1STP9S, BrSTP9S, CrSTP9S, CsSTP9S, EsSTP9S, a structurally or functionally similar protein or a homologous protein.
  • the glucose-specific, ATP-mediated transporter is from Arabidopsis thaliana, for example, the glucose-specific, ATP-mediated transporter having the amino acid sequence of SEQ ID NO: 2.
  • the amino acid sequences of the glucose-specific, ATP-mediated transporter has at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or even at least 99% amino acid sequence identity to SEQ ID NO: 2.
  • the presence of a glucose-specific, ATP-mediated transporter expression cassette results in an increase in ethanol production, of at least 0.5%, at least 1.0%, at least 1.5%, at least 2.0%, at least 2.1%, at least 2.5%, at least 3.0%, at least 4.0%, at least 4.5%, at least 4.8%, or more.
  • the presence of a glucose-specific, ATP-mediated transporter expression cassette does not additionally result in a significant increase in glycerol production, for example, a less than 10%, less than 9%, less than 8%, less than 7%, less than 6%, less than 5%, less than 4%, less than 3%, less than 2%, or even less than 1% increase in glycerol production.
  • the presence of a glucose-specific, ATP-mediated transporter expression cassette does not additionally result in a significant increase in acetate production, for example, a less than 10%, less than 9%, less than 8%, less than 7%, less than 6%, less than 5%, less than 4%, less than 3%, less than 2%, or even less than 1% increase in acetate production.
  • the presence of a glucose-specific, ATP-mediated transporter expression cassette results in a decrease in acetate production.
  • the present modified yeast and methods are associated with fermentations involving high-dissolved-solids and high glucose concentrations, i.e. , conditions under which glucose-specific, ATP-mediated transporters do not typically play a role in yeast metabolism.
  • the glucose concentration is at least 5 g/L, at least 10 g/L, at least 20 g/L, at least 30 g/L, at least 40 g/L, at least 50 g/L, at least 60 g/L, at least 70 g/L, at least 80 g/L, at least 90 g/L, or even at least 100 g/L. Peak glucose levels during fermentation are typically 100-120 g/L (10-12% w/v).
  • the present modified yeast may further include, or may expressly exclude, mutations that result in attenuation of the native glycerol biosynthesis pathway, which are known to increase alcohol production.
  • Methods for attenuation of the glycerol biosynthesis pathway in yeast are known and include reduction or elimination of endogenous NAD-dependent glycerol 3-phosphate dehydrogenase (GPD) or glycerol phosphate phosphatase activity (GPP), for example by disruption of one or more of the genes GPDl, GPD2, GPP I and/or GPP2. See, e.g. , U.S. Patent Nos. 9,175,270 (Elke et al), 8,795,998 (Pronk et al.) and 8,956,851 (Argyros et al).
  • the modified yeast may further feature increased acetyl-CoA synthase (also referred to acetyl-CoA ligase) activity (EC 6.2.1.1) to scavenge (i.e. , capture) acetate produced by chemical or enzymatic hydrolysis of acetyl-phosphate (or present in the culture medium of the yeast for any other reason) and converts it to acetyl-CoA.
  • acetyl-CoA synthase also referred to acetyl-CoA ligase activity
  • scavenge i.e. , capture
  • Increasing acetyl-CoA synthase activity may be accomplished by introducing a heterologous acetyl-CoA synthase gene into cells, increasing the expression of an endogenous acetyl-CoA synthase gene and the like.
  • a particularly useful acetyl-CoA synthase for introduction into cells can be obtained from Methanosaeta concilii
  • Homologs of this enzymes including enzymes having at least 85%, at least 90%, at least 92%, at least 95%, at least 97%, at least 98% and even at least 99% amino acid sequence identity to the aforementioned acetyl-CoA synthase from Methanosaeta concilii, are also useful in the present compositions and methods.
  • the present modified yeast does not have increased acetyl- CoA synthase.
  • the present modified yeast may further include a heterologous gene encoding a protein with NAD+-dependent acetylating acetaldehyde dehydrogenase activity and/or a heterologous gene encoding a pyruvate-formate lyase.
  • a heterologous gene encoding a protein with NAD+-dependent acetylating acetaldehyde dehydrogenase activity and/or a heterologous gene encoding a pyruvate-formate lyase.
  • the present yeast does not have a heterologous gene encoding an NAD+-dependent acetylating acetaldehyde dehydrogenase and/or encoding a pyruvate-formate lyase.
  • the present modified yeast further comprises a butanol biosynthetic pathway.
  • the butanol biosynthetic pathway is an isobutanol biosynthetic pathway.
  • the isobutanol biosynthetic pathway may comprise a polynucleotide encoding a polypeptide that catalyzes a substrate to product conversion selected from the group consisting of: (a) pyruvate to acetolactate; (b) acetolactate to 2,3- dihydroxyisovalerate; (c) 2,3-dihydroxyisovalerate to 2-ketoisovalerate; (d) 2-ketoisovalerate to isobutyraldehyde; and (e) isobutyraldehyde to isobutanol.
  • the isobutanol biosynthetic pathway may comprise polynucleotides encoding polypeptides having acetolactate synthase, keto acid reductoisomerase, dihydroxy acid dehydratase, ketoisovalerate decarboxylase, and alcohol dehydrogenase activity.
  • the modified yeast comprising a butanol biosynthetic pathway further comprise a modification in a polynucleotide encoding a polypeptide having pyruvate decarboxylase activity.
  • the yeast may comprise a deletion, mutation, and/or substitution in an endogenous polynucleotide encoding a polypeptide having pyruvate decarboxylase activity.
  • the polypeptide having pyruvate decarboxylase activity is selected from the group consisting of: PDC1, PDC5, PDC6, and combinations thereof.
  • the yeast cells further comprise a deletion, mutation, and/or substitution in one or more endogenous polynucleotides encoding FRA2, ALD6, ADH1, GPD2, BDH1, and YMR226C.
  • the present modified yeast cells do not further comprise a butanol biosynthetic pathway.
  • the present modified yeast may include any number of additional genes of interest encoding proteins of interest, including selectable markers, carbohydrate-processing enzymes, and other commercially-relevant polypeptides, including but not limited to an enzyme selected from the group consisting of a dehydrogenase, a transketolase, a
  • phosphoketolase a transladolase, an epimerase, a phytase, a xylanase, a ⁇ -glucanase, a phosphatase, a protease, an a-amylase, a ⁇ -amylase, a glucoamylase, a pullulanase, an isoamylase, a cellulase, a trehalase, a lipase, a pectinase, a polyesterase, a cutinase, an oxidase, a transferase, a reductase, a hemi cellulase, a mannanase, an esterase, an isomerase, a pectinases, a lactase, a peroxidase and a laccase. Proteins of interest may be secreted, glycosylated, and otherwise modified.
  • the present yeast, and methods of use, thereof, include methods for increasing alcohol production in fermentation reactions. Such methods are not limited to a particular fermentation process.
  • the present engineered yeast is expected to be a "drop-in" replacement for convention yeast in any alcohol fermentation facility. While primarily intended for fuel ethanol production, the present yeast can also be used for the production of potable alcohol, including wine and beer.
  • Yeast is a unicellular eukaryotic microorganism classified as members of the fungus kingdom and includes organisms from the phyla Ascomycota and Basidiomycota. Yeast that can be used for alcohol production include, but are not limited to, Saccharomyces spp., including S. cerevisiae, as well as Kluyveromyces, Lachancea and Schizosaccharomyces spp. Numerous yeast strains are commercially available, many of which have been selected or genetically engineered for desired characteristics, such as high alcohol production, rapid growth rate, and the like. Some yeast has been genetically engineered to produce
  • heterologous enzymes such as glucoamylase, a-amylase and cellulase.
  • Liquefact corn flour slurry was prepared by adding 600 ppm of urea, 0.124 SAPU/g ds FERMGENTM (acid fungal protease) 2.5x, 0.33 GAU/g ds TrGA (Trichoderma glucoamylase) and 1.46 SSU/g ds AKAA (Aspergillus a-amylase), adjusted to a pH of 5.4.
  • AtSTP9 The gene for glucose-specific, ATP-mediated transporter 9 from Arabidopsis thaliana (AtSTP9) was codon optimized and then synthesized to generate A tSTP9S.
  • AtSTP9S expression cassette consisting of a synthetic AtSTP9S (SEQ ID NO: 1) under control of a HXT3 promoter (SEQ ID NO: 3; YDR345C) and FBAlterminator (SEQ ID NO: 4; YKL060C), was made using standard procedures.
  • FIG. 1 A representation of the AtSTP9S expression cassette is illustrated in Figure 1.
  • Plasmid pK41Wn-H3SP9 shown in Figure 2, includes an integrated AtSTP9S expression cassette downstream of the Saccharomyces chromosome YHL041W locus.
  • the functional and structural composition of plasmid pK41Wn-H3SP9 is described in Table 1.
  • a plasmid (pYRH426; not shown) was constructed to express the CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) associated protein 9 (Cas9) and an sgRNA specific for downstream of the YHL041W locus specific using the sequence 5'-GCTGATAATACGCTAAACGA-3'; SEQ ID NO: 5).
  • CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
  • the FERMAX® GOLD yeast strain (Martrex, Inc., MD, USA; herein, "FG") was used as a parental strain to introduce the AtSTP9S expression cassette.
  • Cells were transformed with a 2,949-bp Swal fragment containing the AtSTP9S expression cassette from plasmid pZK41Wn-H3SP9 ( Figure 2) and plasmid pYRH426.
  • One transformant with the Swal fragment from pZK41Wn-H3SP9 integrated at the downstream of YHL041W locus was selected and designated as strain G027.
  • the new FG yeast strain, G027, and its parent strain, FG were grown in vial cultures and their fermentation products analyzed as described in Example 1. Performance in terms of ethanol, glycerol and acetate production is shown in Table 3.
  • Strain G027 produced about 2% more ethanol than the parental strain and produced similar amounts of glycerol and acetate.
  • strains G027 and FG were analyzed in An Kom assays, as described in Example 1. Performance in terms of ethanol, glycerol and acetate production is shown in Table 4.
  • AtSTP9 encodes a glucose-specific, ATP-mediated transporter that belongs to the major facilitator superfamily. Like other sugar transporters, AtSTP9 shares conserved structures, including twelve transmembrane domains and five sequence motifs (Leandro et al. (2009) Yeast Res. 9: 511-25). Using the amino acid sequence of AtSTP9 as a query, six homologs with more than 93% identity were found in public databases. The homologs are listed in Table 5. Table 5. AtSTP9 and homologs from public databases
  • AtSTP9 The six selected homologs of AtSTP9 (Table 5) were codon-optimized and then synthesized to generate AaSTP9S, AISTP9S, BrSTP9S, CrSTP9S, CsSTP9S, and EsSTP9S genes.
  • AtSTP9S homolog expression cassettes were under the control of HXT3 promoter (SEQ ID NO: 3; YDR345C) and FBAlterminator (SEQ ID NO: 4; YKL060C) and integrated into a suitable plasmid for propagation.
  • the FG strain was used as a parent to introduce the AaSTP9S, AISTP9S, BrSTP9S, CrSTP9S, CsSTP9S, and EsSTP9S expression cassettes, as described in Example 2.
  • Yeast were transformed with Swal fragments that individually contained the AaSTP9S, AISTP9S, BrSTP9S, CrSTP9S, CsSTP9S, and EsSTP9S expression cassettes along with plasmid pYRH426.
  • One transformant from each transformation was selected and designated as strain G304, G286, G293, G296, G300, and G303, respectively.
  • strains G286, G293, G296, G300, G303, G304, along with FG and G027 were analyzed in An Kom assays, as described in Example 1. Performance in terms of ethanol, glycerol and acetate production is summarized in Table 7.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • General Chemical & Material Sciences (AREA)
  • General Engineering & Computer Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biotechnology (AREA)
  • Botany (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

Described are compositions and methods relating to modified yeast expressing exogenous, or increased amounts, of glucose-specific, ATP-mediated transporters. The modified yeast produces an increased amount of ethanol compared to parental cells. Such yeast is particularly useful for large-scale ethanol production from starch substrates.

Description

MODIFIED YEAST COMPRISING GLUCOSE-SPECIFIC, A TP-MEDIATED
TRANSPORTERS
TECHNICAL FIELD
[01] The present compositions and methods relate to modified yeast harboring glucose- specific, ATP-mediated transporters. The modified yeast produces an increased amount of ethanol in a starch-hydrolysate-fermentation compared to otherwise identical yeast. Such yeast is particularly useful for large-scale ethanol production from starch substrates.
BACKGROUND
[02] The first generation of yeast-based ethanol production converts sugars into fuel ethanol. The annual fuel ethanol production by yeast is about 90 billion liters worldwide (Gombert, A.K. and van Maris. A.J. (2015) Curr. Opin. Biotechnol. 33:81-86). It is estimated that about 70% of the cost of ethanol production is the feedstock. Since the production volume is so large, even small yield improvements will have massive economic impact across the industry.
[03] Biochemically, the conversion of glucose to ethanol and carbon dioxide is redox- neutral, with the maximum theoretical yield being about 51%. However, during yeast growth, there is surplus of NADH that is used to produce glycerol for redox balance and osmotic protection. The current industrial yield of yeast fermentation from corn mash for ethanol production is about 45%, thus, there is opportunity to increase ethanol yield by another 10%, which can translate into an additional nine billion liters of ethanol. Apart from the unavoidable carbon dioxide, yeast biomass and glycerol are the two major by-products of this fermentation process.
[04] Monosaccharides and other simple sugars are the favored carbon and energy sources of Saccharomyces cerevisiae (Leandro, M.J., et al. (2009) FEMS Yeast Res. 9: 511-25). Many monosaccharide transporters operate by facilitated diffusion to move such molecules along a favorable concentration gradient across the cell membrane, in an energy-independent manner. Other monosaccharide transporters are energy-consuming, allowing the uptake of sugar molecules against a concentration gradient, coupled with the simultaneous movement of a proton. Such transporters usually operate only when limited sugar is present in a growth medium. The uptake of hexoses in S. cerevisiae occurs only through facilitated diffusion (Lagunas, R. (1993) FEMS Microbiol. Rev. 10:229-42) mediated by about twenty
transporters, including the Hxt proteins, with different kinetic properties and modes of regulation (Reifenberger, E. et al. (1997) Eur. J. Biochem. 245:324-33). Sugar uptake has a significant effect on metabolic flux (Elbing, K.D. et al. (2004) Eur. J. Biochem. 271 :4855- 64), impacting cell growth, catabolic repression, fermentation and respiration (Goffrini et al. (2002) J. Bacteriol. 184:427-32; Barnett, J. A. and Entian, K.D. (2005) Yeast 22:835-94).
[05] Engineering yeast for free energy conservation is one of the strategies to increase ethanol yield (Gombert and van Maris, supra). Yeast growth requires energy in the form of ATP. If the ATP consumption could be increased, it could increase ethanol yield on sugar, because more sugar would have to be converted to ethanol and carbon dioxide to provide the same amount of ATP for cellular maintenance, assuming that the increased fraction of the sugar is converted to ethanol, and not biomass and glycerol. It has been reported that overexpression of vacuole alkaline phosphatase (Ph08) increased ethanol yield (Semkiv, M.V. et al. (2014) BMC Biotechnol. 14:42). However, the challenge with the introduction of such non-stoichiometric ATP drains, especially for industrial implementation, is in the fine tuning between the positive impact and decreased cellular robustness (Gombert and van Maris, supra).
[06] S. cerevisiae strain has been engineered with an ATP-mediated sucrose transporter. In the engineered strains, the ATP requirement for proton extrusion decreases the anaerobic ATP yield on sucrose, which results in increased ethanol yield (Basso, T.O. et al. (2011) Met. Eng. 13:694-703). However, in the current ethanol production industry, sucrose is not the major substrate in USA.
[07] The opportunity continues to exist for linking the concept of free energy conservation with the increasing sugar uptake to increase ethanol yield.
SUMMARY
[08] This invention provides compositions and methods for increasing ethanol production in yeast by expressing glucose-specific, ATP-mediated transporters. Aspects and
embodiments of the compositions and methods are described in the following, independently- numbered, paragraphs. 1. In one aspect, modified yeast cells derived from parental yeast cells are provided, the modified cells comprising a genetic alteration that causes the modified cells to produce an increased amount of a glucose-specific, ATP-mediated transporter compared to the parental cells, wherein the modified cells produce during fermentation an increased amount of ethanol compared to the amount of ethanol produced by the parental cells under identical fermentation conditions.
2. In some embodiments of the modified cells of paragraph 1, the genetic alteration comprises the introduction into the parental cells of a nucleic acid capable of directing the expression of a glucose-specific, ATP-mediated transporter to a level above that of the parental cell grown under equivalent conditions.
3. In some embodiments of the modified cells of paragraph 1 or 2, the genetic alteration comprises the introduction of an expression cassette for expressing a glucose-specific, ATP- mediated transporter.
4. In some embodiments of the modified cells of paragraph 1 or 2, the genetic alteration comprises the introduction of an exogenous gene encoding a glucose-specific, ATP-mediated transporter.
5. In some embodiments of the modified cells of paragraph 4, the exogenous gene is from an organism selected from the group consisting of Arabidopsis thaliana, Arabidopsis lyrate, Arabis alpine, Brassica rapa, Capsella rubella, Camelina sativa, and Eutreme salsugineus.
6. In some embodiments of the modified cells of paragraph 4 or 5, the exogenous gene is selected from the group consisting oiAtSTP9, AaSTP9S, AISTP9S, BrSTP9S, CrSTP9S, CsSTP9S, and EsSTP9S.
7. In some embodiments of the modified cells of paragraph 1, the genetic alteration comprises the introduction of a stronger promoter in an endogenous gene encoding a glucose- specific, ATP-mediated transporter.
8. In some embodiments of the modified cells of paragraphs 1-7, the amount of increase in ethanol he production is at least about 2% compared to the level in the parental cells grown under equivalent conditions.
9. In some embodiments, the modified cells of paragraphs 1-8 further comprise a genetic alteration that introduces one or more polynucleotides encoding a polypeptide of an exogenous phosphoketolase pathway.
10. In some embodiments of the modified cells of paragraphs 1-9, the cells further comprise an exogenous gene encoding a carbohydrate processing enzyme. 11. In some embodiments the modified cells of any of paragraphs 1-10 further comprise an alteration in the glycerol pathway and/or the acetyl-CoA pathway.
12. In some embodiments of the modified cells of paragraphs 1-11, the cells are of a
Saccharomyces spp.
13. In another aspect, a method for increasing the amount of ethanol produced by cells grown on a starch-hydrolysate substrate is provided, comprising: introducing into parental yeast cells a genetic alteration that increases the production of glucose-specific, ATP-mediated transporter polypeptides compared to the amount produced in the parental cells.
14. In some embodiments of the method of paragraph 13, the cells do not produce a significant amount of additional glycerol compared to the amount produced by the parental cells.
15. In some embodiments of the method of paragraph 13 or 14, the increased production of the glucose-specific, ATP-mediated transporter polypeptides increases ATP consumption in the cells.
16. In some embodiments of the method of any of paragraphs 13-15, the starch- hydrolysate comprises at least 5 g/L glucose.
17. In some embodiments of the method of any of paragraphs 13-16, the cells having the introduced genetic alteration are the modified cells of any of paragraphs 1-12.
[09] These and other aspects and embodiments of present modified cells and methods will be apparent from the description, including the accompanying Figures.
BRIEF DESCRIPTION OF THE DRAWINGS
[010] Figure 1 is a map of an AtSTP9S expression cassette.
[011] Figure 2 is a map of plasmid pZK41Wn-H3SP9.
DETAILED DESCRIPTION
I. Definitions
[012] Prior to describing the present yeast and methods in detail, the following terms are defined for clarity. Terms not defined should be accorded their ordinary meanings as used in the relevant art.
[013] As used herein, the term "alcohol" refers to an organic compound in which a hydroxyl functional group (-OH) is bound to a saturated carbon atom. [014] As used herein, the terms "yeast cells", yeast strains, or simply "yeast" refer to organisms from the phyla Ascomycota and Basidiomycota. Exemplary yeast is budding yeast from the order Saccharomycetales. Particular examples of yeast are Saccharomyces spp., including but not limited to S. cerevisiae. Yeast include organisms used for the production of fuel alcohol as well as organisms used for the production of potable alcohol, including specialty and proprietary yeast strains used to make distinctive-tasting beers, wines, and other fermented beverages.
[015] As used herein, the phrase "engineered yeast cells," "variant yeast cells," "modified yeast cells," or similar phrases, refer to yeast that include genetic modifications and characteristics described herein. Variant/modified yeast do not include naturally occurring yeast.
[016] As used herein, the terms "polypeptide" and "protein" (and their respective plural forms) are used interchangeably to refer to polymers of any length comprising amino acid residues linked by peptide bonds. The conventional one-letter or three-letter codes for amino acid residues are used herein and all sequence are presented from an N-terminal to C-terminal direction. The polymer can comprise modified amino acids, and it can be interrupted by non- amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids, etc.), as well as other modifications known in the art.
[017] As used herein, functionally and/or structurally similar proteins are considered to be "related proteins", or "homologs" Such proteins can be derived from organisms of different genera and/or species, or different classes of organisms (e.g., bacteria and fungi), or artificially designed. Related proteins also encompass homologs determined by primary sequence analysis, determined by secondary or tertiary structure analysis, or determined by immunological cross-reactivity, or determined by their functions.
[018] As used herein, the term "homologous protein" refers to a protein that has similar activity and/or structure to a reference protein. It is not intended that homologs necessarily be evolutionarily related. Thus, it is intended that the term encompass the same, similar, or corresponding enzyme(s) (i.e. , in terms of structure and function) obtained from different organisms. In some embodiments, it is desirable to identify a homolog that has a quaternary, tertiary and/or primary structure similar to the reference protein. In some embodiments, homologous proteins induce similar immunological response(s) as a reference protein. In some embodiments, homologous proteins are engineered to produce enzymes with desired activity (ies).
[019] The degree of homology between sequences can be determined using any suitable method known in the art (see, e.g. , Smith and Waterman (1981) ^4<iv. Appl. Math. 2.482; Needleman and Wunsch (1970) J. Mol. Biol., 48:443; Pearson and Lipman (1988) Proc. Natl. Acad. Sci. USA 85:2444; programs such as GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package (Genetics Computer Group, Madison, WI); and Devereux et al. (1984) Nucleic Acids Res . 12:387-95).
[020] For example, PILEUP is a useful program to determine sequence homology levels. PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pair-wise alignments. It can also plot a tree showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng and Doolittle, (Feng and Doolittle (1987) J. Mol. Evol. 35:351-60). The method is similar to that described by Higgins and Sharp ((1989) CABIOS 5: 151-53). Useful PILEUP parameters including a default gap weight of 3.00, a default gap length weight of 0.10, and weighted end gaps. Another example of a useful algorithm is the BLAST algorithm, described by Altschul et al. ((1990) J. Mol. Biol. 215:403-10) and Karlin et al. ((1993) Proc. Natl. Acad. Sci. USA 90:5873-87). One particularly useful BLAST program is the WU-BLAST-2 program (see, e.g., Altschul et al. (1996) Meth. Enzymol. 266:460-80). Parameters "W," "T," and "X" determine the sensitivity and speed of the alignment. The BLAST program uses as defaults a word-length (W) of 11, the BLOSUM62 scoring matrix (see, e.g. , Henikoff and Henikoff (1989) Proc. Natl. Acad. Sci. USA 89: 10915) alignments (B) of 50, expectation (E) of 10, M'5, N'-4, and a comparison of both strands.
[021] As used herein, the phrases "substantially similar" and "substantially identical," in the context of at least two nucleic acids or polypeptides, typically means that a polynucleotide or polypeptide comprises a sequence that has at least about 70% identity, at least about 75% identity, at least about 80% identity, at least about 85% identity, at least about 90% identity, at least about 91% identity, at least about 92% identity, at least about 93% identity, at least about 94% identity, at least about 95% identity, at least about 96% identity, at least about 97% identity, at least about 98% identity, or even at least about 99% identity, or more, compared to the reference (i.e. , wild-type) sequence. Percent sequence identity is calculated using CLUSTAL W algorithm with default parameters. See Thompson et al. (1994) Nucleic Acids Res. 22:4673-4680. Default parameters for the CLUSTAL W algorithm are:
Gap opening penalty: 10.0
Gap extension penalty: 0.05
Protein weight matrix: BLOSUM series
DNA weight matrix: IUB
Delay divergent sequences %: 40
Gap separation distance: 8
DNA transitions weight: 0.50
List hydrophilic residues: GPSNDQEKR
Use negative matrix: OFF
Toggle Residue specific penalties: ON
Toggle hydrophilic penalties: ON
Toggle end gap separation penalty OFF
[022] Another indication that two polypeptides are substantially identical is that the first polypeptide is immunologically cross-reactive with the second polypeptide. Typically, polypeptides that differ by conservative amino acid substitutions are immunologically cross- reactive. Thus, a polypeptide is substantially identical to a second polypeptide, for example, where the two peptides differ only by a conservative substitution. Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions (e.g., within a range of medium to high stringency).
[023] As used herein, the term "gene" is synonymous with the term "allele" in referring to a nucleic acid that encodes and directs the expression of a protein or RNA. Vegetative forms of filamentous fungi are generally haploid, therefore a single copy of a specified gene (i.e. , a single allele) is sufficient to confer a specified phenotype. The term "allele" is generally preferred when an organism contains more than one similar genes, in which case each different similar gene is referred to as a distinct "allele."
[024] As used herein, the term "expressing a polypeptide" and similar terms refers to the cellular process of producing a polypeptide using the translation machinery (e.g., ribosomes) of the cell.
[025] As used herein, "overexpressing a polypeptide," "increasing the expression of a polypeptide," and similar terms, refer to expressing a polypeptide at higher-than-normal levels compared to those observed with parental or "wild-type cells that do not include a specified genetic modification. [026] As used herein, an "expression cassette" refers to a DNA fragment that includes a promoter, and amino acid coding region and a terminator (i.e., promoter: : amino acid coding region: : terminator) and other nucleic acid sequence needed to allow the encoded polypeptide to be produced in a cell. Expression cassettes can be exogenous (i.e. , introduced into a cell) or endogenous (i.e. , extant in a cell).
[027] As used herein, the terms "wild-type" and "native" are used interchangeably and refer to genes, proteins or strains found in nature, or that are not intentionally modified for the advantage of the presently described yeast.
[028] As used herein, the term "protein of interest" refers to a polypeptide that is desired to be expressed in modified yeast. Such a protein can be an enzyme, a substrate-binding protein, a surface-active protein, a structural protein, a selectable marker, or the like, and can be expressed. The protein of interest is encoded by an endogenous gene or a heterologous gene (i.e. , gene of interest") relative to the parental strain. The protein of interest can be expressed intracellularly or as a secreted protein.
[029] As used herein, the terms "genetic manipulation" and "genetic alteration" are used interchangeably and refer to the alteration/change of a nucleic acid sequence. The alteration can include but is not limited to a substitution, deletion, insertion or chemical modification of at least one nucleic acid in the nucleic acid sequence.
[030] As used herein, a "functional polypeptide/protein" is a protein that possesses an activity, such as an enzymatic activity, a binding activity, a surface-active property, or the like, and which has not been mutagenized, truncated, or otherwise modified to abolish or reduce that activity. Functional polypeptides can be thermostable or thermolabile, as specified.
[031] As used herein, "a functional gene" is a gene capable of being used by cellular components to produce an active gene product, typically a protein. Functional genes are the antithesis of disrupted genes, which are modified such that they cannot be used by cellular components to produce an active gene product, or have a reduced ability to be used by cellular components to produce an active gene product.
[032] As used herein, "attenuation of a pathway" or "attenuation of the flux through a pathway" i.e. , a biochemical pathway, refers broadly to any genetic or chemical manipulation that reduces or completely stops the flux of biochemical substrates or intermediates through a metabolic pathway. Attenuation of a pathway may be achieved by a variety of well-known methods. Such methods include but are not limited to: complete or partial deletion of one or more genes, replacing wild-type alleles of these genes with mutant forms encoding enzymes with reduced catalytic activity or increased Km values, modifying the promoters or other regulatory elements that control the expression of one or more genes, engineering the enzymes or the mRNA encoding these enzymes for a decreased stability, misdirecting enzymes to cellular compartments where they are less likely to interact with substrate and intermediates, the use of interfering RNA, and the like.
[033] As used herein, "aerobic fermentation" refers to growth in the presence of oxygen.
[034] As used herein, "anaerobic fermentation" refers to growth in the absence of oxygen.
[035] As used herein, the expression "end of fermentation" refers to the stage of fermentation when the economic advantage of continuing fermentation to produce a small amount of additional alcohol is exceeded by the cost of continuing fermentation in terms of fixed and variable costs. In a more general sense, "end of fermentation" refers to the point where a fermentation will no longer produce a significant amount of additional alcohol, i.e., no more than about 1 % additional alcohol.
[036] As used herein, the expression "carbon flux" refers to the rate of turnover of carbon molecules through a metabolic pathway. Carbon flux is regulated by enzymes involved in metabolic pathways, such as the pathway for glucose metabolism and the pathway for maltose metabolism.
[037] As used herein, the singular articles "a," "an" and "the" encompass the plural referents unless the context clearly dictates otherwise. All references cited herein are hereby incorporated by reference in their entirety. The following abbreviations/acronyms have the following meanings unless otherwise specified:
EC enzyme commission
EtOH ethanol
AA a-amylase
GA glucoamylase
°C degrees Centigrade
bp base pairs
DNA deoxyribonucleic acid
ds or DS dry solids
g or gm gram
g L grams per liter
H2O water
HPLC high performance liquid chromatography
hr or h hour kg kilogram
M molar
mg milligram
mL or ml milliliter
mm minute
mM millimolar
N normal
nm nanometer
PCR polymerase chain reaction
ppm parts per million
Δ relating to a deletion
g microgram
and μΐ microliter
μΜ micromolar
U/g units/gram
SAPU spectrophotometric acid protease unit
ssu soluble starch unit
II. Modified yeast harboring a glucose-specific, ATP-mediated transporter
[038] The present compositions and methods are based on the discovery that modified yeast over-expressing a glucose-specific, ATP-mediated transporter produces more ethanol in a starch-hydrolysate-fermentation than an otherwise identical parental yeast. Without being limited to a theory, it is believed that the introduction of an ATP-mediated transporter affects both glucose uptake and ATP consumption, resulting in an overall increase in the desirable products of yeast metabolism.
[039] Previous attempts to modify yeast to increase ethanol production have involved monosaccharide transporters that uptake monosaccharide via facilitated diffusion, which is energy (ATP)-independent. In addition, previous studies have shown that over-expression of facilitative yeast monosaccharide transporters increases sugar uptake and the ethanol production rate, but not the ultimate ethanol production yield. Accordingly, the present modified yeast and methods are clearly distinguishable from previously described yeast in that they do involve passive transporters and they affect ethanol yield, not merely rate of production.
[040] In some embodiments of the present composition and methods, the glucose-specific, ATP-mediated transporter is an endogenous transporter caused to be overexpressed by introducing into the parental yeast a nucleic acid sequence encoding an addition copy of the transporter, for example, in the form of an expression cassette. In some embodiments, the glucose-specific, ATP-mediated transporter is an endogenous transporter caused to be overexpressed by modifying the endogenous gene in the parental yeast, such as by introducing a stronger promoter.
[041] In some embodiments of the present composition and methods, the glucose-specific, ATP-mediated transporter is from Arabidopsis thaliana, Arabidopsis lyrate, Arabis alpine, Brassica rapa, Capsella rubella, Camelina sativa, Eutreme salsugineus, or a related organism. In some embodiments, the glucose-specific, ATP-mediated transporter is encoded by a gene selected irom AtSTP9, AaSTP9S, AISTP9S, BrSTP9S, CrSTP9S, CsSTP9S, and EsSTP9S. In some embodiments, the glucose-specific, ATP-mediated transporter is AtSTP9, AaSTP9S, A1STP9S, BrSTP9S, CrSTP9S, CsSTP9S, EsSTP9S, a structurally or functionally similar protein or a homologous protein.
[042] In some embodiments, the glucose-specific, ATP-mediated transporter is from Arabidopsis thaliana, for example, the glucose-specific, ATP-mediated transporter having the amino acid sequence of SEQ ID NO: 2. In some embodiments the amino acid sequences of the glucose-specific, ATP-mediated transporter has at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or even at least 99% amino acid sequence identity to SEQ ID NO: 2.
[043] In some embodiments, the presence of a glucose-specific, ATP-mediated transporter expression cassette results in an increase in ethanol production, of at least 0.5%, at least 1.0%, at least 1.5%, at least 2.0%, at least 2.1%, at least 2.5%, at least 3.0%, at least 4.0%, at least 4.5%, at least 4.8%, or more. In some embodiments, the presence of a glucose-specific, ATP-mediated transporter expression cassette does not additionally result in a significant increase in glycerol production, for example, a less than 10%, less than 9%, less than 8%, less than 7%, less than 6%, less than 5%, less than 4%, less than 3%, less than 2%, or even less than 1% increase in glycerol production. In some embodiments, the presence of a glucose- specific, ATP-mediated transporter expression cassette does not additionally result in a significant increase in acetate production, for example, a less than 10%, less than 9%, less than 8%, less than 7%, less than 6%, less than 5%, less than 4%, less than 3%, less than 2%, or even less than 1% increase in acetate production. In some embodiments, the presence of a glucose-specific, ATP-mediated transporter expression cassette results in a decrease in acetate production.
[044] In some embodiments, the present modified yeast and methods are associated with fermentations involving high-dissolved-solids and high glucose concentrations, i.e. , conditions under which glucose-specific, ATP-mediated transporters do not typically play a role in yeast metabolism. In some embodiments, the glucose concentration is at least 5 g/L, at least 10 g/L, at least 20 g/L, at least 30 g/L, at least 40 g/L, at least 50 g/L, at least 60 g/L, at least 70 g/L, at least 80 g/L, at least 90 g/L, or even at least 100 g/L. Peak glucose levels during fermentation are typically 100-120 g/L (10-12% w/v).
III. Additional mutations that affect alcohol production
[045] The present modified yeast may further include, or may expressly exclude, mutations that result in attenuation of the native glycerol biosynthesis pathway, which are known to increase alcohol production. Methods for attenuation of the glycerol biosynthesis pathway in yeast are known and include reduction or elimination of endogenous NAD-dependent glycerol 3-phosphate dehydrogenase (GPD) or glycerol phosphate phosphatase activity (GPP), for example by disruption of one or more of the genes GPDl, GPD2, GPP I and/or GPP2. See, e.g. , U.S. Patent Nos. 9,175,270 (Elke et al), 8,795,998 (Pronk et al.) and 8,956,851 (Argyros et al).
[046] The modified yeast may further feature increased acetyl-CoA synthase (also referred to acetyl-CoA ligase) activity (EC 6.2.1.1) to scavenge (i.e. , capture) acetate produced by chemical or enzymatic hydrolysis of acetyl-phosphate (or present in the culture medium of the yeast for any other reason) and converts it to acetyl-CoA. This avoids the undesirable effect of acetate on the growth of yeast cells and may further contribute to an improvement in alcohol yield. Increasing acetyl-CoA synthase activity may be accomplished by introducing a heterologous acetyl-CoA synthase gene into cells, increasing the expression of an endogenous acetyl-CoA synthase gene and the like. A particularly useful acetyl-CoA synthase for introduction into cells can be obtained from Methanosaeta concilii
(UniProt/TrEMBL Accession No. : WP_013718460). Homologs of this enzymes, including enzymes having at least 85%, at least 90%, at least 92%, at least 95%, at least 97%, at least 98% and even at least 99% amino acid sequence identity to the aforementioned acetyl-CoA synthase from Methanosaeta concilii, are also useful in the present compositions and methods. In other embodiments, the present modified yeast does not have increased acetyl- CoA synthase.
[047] In some embodiments the present modified yeast may further include a heterologous gene encoding a protein with NAD+-dependent acetylating acetaldehyde dehydrogenase activity and/or a heterologous gene encoding a pyruvate-formate lyase. The introduction of such genes in combination with attenuation of the glycerol pathway is described, e.g. , in U.S. Patent No. 8,795,998 (Pronk et al). In some embodiments, the present yeast does not have a heterologous gene encoding an NAD+-dependent acetylating acetaldehyde dehydrogenase and/or encoding a pyruvate-formate lyase.
[048] In some embodiments, the present modified yeast further comprises a butanol biosynthetic pathway. In some embodiments, the butanol biosynthetic pathway is an isobutanol biosynthetic pathway. The isobutanol biosynthetic pathway may comprise a polynucleotide encoding a polypeptide that catalyzes a substrate to product conversion selected from the group consisting of: (a) pyruvate to acetolactate; (b) acetolactate to 2,3- dihydroxyisovalerate; (c) 2,3-dihydroxyisovalerate to 2-ketoisovalerate; (d) 2-ketoisovalerate to isobutyraldehyde; and (e) isobutyraldehyde to isobutanol. The isobutanol biosynthetic pathway may comprise polynucleotides encoding polypeptides having acetolactate synthase, keto acid reductoisomerase, dihydroxy acid dehydratase, ketoisovalerate decarboxylase, and alcohol dehydrogenase activity.
[049] In some embodiments, the modified yeast comprising a butanol biosynthetic pathway further comprise a modification in a polynucleotide encoding a polypeptide having pyruvate decarboxylase activity. The yeast may comprise a deletion, mutation, and/or substitution in an endogenous polynucleotide encoding a polypeptide having pyruvate decarboxylase activity. In some embodiments, the polypeptide having pyruvate decarboxylase activity is selected from the group consisting of: PDC1, PDC5, PDC6, and combinations thereof. In some embodiments, the yeast cells further comprise a deletion, mutation, and/or substitution in one or more endogenous polynucleotides encoding FRA2, ALD6, ADH1, GPD2, BDH1, and YMR226C. In other embodiments, the present modified yeast cells do not further comprise a butanol biosynthetic pathway.
[050] The present modified yeast may include any number of additional genes of interest encoding proteins of interest, including selectable markers, carbohydrate-processing enzymes, and other commercially-relevant polypeptides, including but not limited to an enzyme selected from the group consisting of a dehydrogenase, a transketolase, a
phosphoketolase, a transladolase, an epimerase, a phytase, a xylanase, a β-glucanase, a phosphatase, a protease, an a-amylase, a β-amylase, a glucoamylase, a pullulanase, an isoamylase, a cellulase, a trehalase, a lipase, a pectinase, a polyesterase, a cutinase, an oxidase, a transferase, a reductase, a hemi cellulase, a mannanase, an esterase, an isomerase, a pectinases, a lactase, a peroxidase and a laccase. Proteins of interest may be secreted, glycosylated, and otherwise modified.
IV. Use of the modified yeast for increased alcohol production
[051] The present yeast, and methods of use, thereof, include methods for increasing alcohol production in fermentation reactions. Such methods are not limited to a particular fermentation process. The present engineered yeast is expected to be a "drop-in" replacement for convention yeast in any alcohol fermentation facility. While primarily intended for fuel ethanol production, the present yeast can also be used for the production of potable alcohol, including wine and beer.
V. Yeast suitable for modification
[052] Yeast is a unicellular eukaryotic microorganism classified as members of the fungus kingdom and includes organisms from the phyla Ascomycota and Basidiomycota. Yeast that can be used for alcohol production include, but are not limited to, Saccharomyces spp., including S. cerevisiae, as well as Kluyveromyces, Lachancea and Schizosaccharomyces spp. Numerous yeast strains are commercially available, many of which have been selected or genetically engineered for desired characteristics, such as high alcohol production, rapid growth rate, and the like. Some yeast has been genetically engineered to produce
heterologous enzymes, such as glucoamylase, a-amylase and cellulase.
VI. Substrates and products
[053] Alcohol production from a number of carbohydrate substrates, including but not limited to corn starch, sugar cane, cassava, and molasses, is well known, as are innumerable variations and improvements to enzymatic and chemical conditions and mechanical processes. The present compositions and methods are believed to be fully compatible with such substrates and conditions.
[054] These and other aspects and embodiments of the present strains and methods will be apparent to the skilled person in view of the present description. The following examples are intended to further illustrate, but not limit, the strains and methods. EXAMPLES
Example 1
Materials and methods
Liquefact preparation:
[055] Liquefact (corn flour slurry) was prepared by adding 600 ppm of urea, 0.124 SAPU/g ds FERMGEN™ (acid fungal protease) 2.5x, 0.33 GAU/g ds TrGA (Trichoderma glucoamylase) and 1.46 SSU/g ds AKAA (Aspergillus a-amylase), adjusted to a pH of 5.4.
Serum vial assays:
[056] 2 mL of YPD in 24-well plates were inoculated with yeast cells and the cultures allowed to grow overnight to an OD between 25-30. 2.5 mL liquefact was transferred to serum vials (Chemglass, Catalog #: CG-4904-01) and yeast was added to each vial to a final OD of about 0.4-0.6. The lids of the vials were installed and punctured with needle (BD, Catalog #305111) for ventilation (to release CC ), then incubated at 32°C with shaking at 200 RPM for 65 hours.
AnKom assays:
[057] 300 of concentrated yeast overnight culture was added to each of a number ANKOM bottles filled with 50 g prepared liquefact (see above) to a final OD of 0.3. The bottles were then incubated at 32°C with shaking at 150 RPM for 65 hours.
HPLC analysis:
[058] Samples of the cultures from serum vials and AnKom assays were collected in Eppendorf tubes by centrifugation for 12 minutes at 14,000 RPM. The supernatants were filtered using 0.2 μΜ PTFE filters and then used for HPLC (Agilent Technologies 1200 series) analysis with the following conditions: Bio-Rad Aminex HPX-87H columns, running temperature of 55C. 0.6 ml/min isocratic flow 0.01 N H2SO4, 2.5 μΐ injection volume.
Calibration standards were used for quantification of the of acetate, ethanol, glycerol, and glucose. All values are expressed in g/L. Example 2
Constructs for over-expression of a codon-optimized, glucose-specific, ATP-mediated transporter
[059] The gene for glucose-specific, ATP-mediated transporter 9 from Arabidopsis thaliana (AtSTP9) was codon optimized and then synthesized to generate A tSTP9S. The nucleotide and amino acid sequences ofAtSTP9S and its expression product, AtSTP9S, are shown, below, as SEQ ID NO: 1 and SEQ ID NO 2, respectively.
[060] Nucleotide sequence of the AtSTP9S gene (SEQ ID NO: 1):
ATGGCTGGTGGTGCCTTTGTCTCCGAAGGTGGCGGTGGAGGCAACTCTTACGAAGGTGGCGT TACCGTCTTTGTTATCATGACCTGTATTGTTGCCGCTATGGGAGGTTTGCTATTTGGTTACG ACTTGGGTATCTCTGGCGGTGTCACCTCTATGGAAGAGTTCTTGTCCAAGTTTTTCCCAGAA GTTGACAGACAAATGCACGAAGCCAGACGTGAAACTGCTTACTGCAAGTTCGATAACCAATT GCTACAATTGTTCACCTCTTCCTTGTACTTGGCTGCCTTAGTCTCTTCCTTTGTTGCTTCTG CTGTCACCAGAAAGTACGGTAGAAAGATTTCCATGTTTGTTGGTGGCGTCGCTTTCTTGATC GGTTCTTTGTTCAACGCCTTTGCTACCAACGTTGCTATGTTGATCATTGGTAGATTGCTATT GGGTGTCGGCGTCGGTTTTGCTAATCAATCTACTCCAGTTTACTTGTCCGAAATGGCTCCAG CCAAGATCAGAGGTGCTTTGAACATCGGTTTTCAAATGGCTATCACCATTGGTATCTTGGTT GCCAATTTGATCAACTACGGTACTTCTCAAATGGCTAGAAACGGTTGGAGAGTCTCCTTGGG TTTAGCTGCCGTTCCAGCTGTCGTTATGGTCATCGGTTCCTTTGTCTTGCCAGACACTCCCA ACTCTATGTTGGAAAGAGGCAAGTACGAACAAGCTAGAGAAATGTTGCAAAAGATTCGTGGT GCTGACAACGTTGATGAAGAGTTTCAAGACTTGTGTGATGCTTGCGAAGCTGCCAAGAAAGT CGAAAACCCTTGGAAGAACATCTTTCAACACGCCAAGTACAGACCAGCTTTGGTTTTCTGTT CTGCTATTCCATTCTTTCAACAGATCACTGGTATCAACGTCATCATGTTTTACGCTCCAGTT TTGTTCAAGACTTTGGGTTTTGCCGACGATGCTTCTTTGATTTCCGCTGTCATCACTGGTGC TGTCAATGTTGTCTCTACCTTGGTTTCCATCTACGCTGTTGACAGATACGGTAGACGTATCT TGTTCTTAGAAGGTGGCATTCAAATGATCATTAGCCAAATCGTTGTCGGTACCTTGATCGGT A GAAGTTTGGCACCACTGGTTC GGCACCTTGACTCCAGCTACAGCCGAC GGATTTTGGC TTTCATCTGTTTGTACGTTGCTGGATTTGCCTGGTCTTGGGGTCCATTGGGTTGGCTAGTTC CATCCGAAATCTGTCCATTGGAAATCAGACCAGCTGGTCAAGCCATCAACGTTTCTGTCAAC ATGTTCTTTACCTTCTTGATTGGTCAATTTTTCTTGACTATGTTGTGTCACATGAAGTTTGG TTTGTTTTACTTCTTTGG GGAA GGTTGCTG CA GAC G CTT A CTACT CT GT AC CAGAAACCAAGGGTGTTCCTATCGAAGAGATGGGCAGAGTCTGGAAGCAACACCCATTCTGG AAGAGATACATTCCAGACGATGCTGTTATCGGTGGCGGTGAAGAGAACTACGTCAAGGAAGT TTAA
[061] Amino acid sequence of the AtSTP9S polypeptide (SEQ ID NO: 2):
MAGGAFVSEGGGGGNSYEGGVTVFVIMTCIVAAMGGLLFGYDLGISGGVTSMEEFLSKFFPE VDRQMHEARRETAYCKFDNQLLQLFTSSLYLAALVSSFVASAVTRKYGRKISMFVGGVAFLI GSLFNAFATNVAMLIIGRLLLGVGVGFANQSTPVYLSEMAPAKIRGALNIGFQMAITIGILV ANLINYGTSQMARNGWRVSLGLAAVPAWMVIGSFVLPDTPNSMLERGKYEQAREMLQKIRG ADNVDEEFQDLCDACEAAKKVENPWKNIFQHAKYRPALVFCSAIPFFQQITGINVIMFYAPV LFKTLGFADDASLISAVITGAVNWSTLVSIYAVDRYGRRILFLEGGIQMIISQIWGTLIG MKFGTTGSGTLTPATADWILAFICLYVAGFAWSWGPLGWLVPSEICPLEIRPAGQAINVSVN MFFTFLIGQFFLTMLCHMKFGLFYFFGGMVAVMTVFIYFLLPETKGVPIEEMGRVWKQHPFW KRYIPDDAVIGGGEENYVKEV
[062] An AtSTP9S expression cassette consisting of a synthetic AtSTP9S (SEQ ID NO: 1) under control of a HXT3 promoter (SEQ ID NO: 3; YDR345C) and FBAlterminator (SEQ ID NO: 4; YKL060C), was made using standard procedures.
[063] The nucleotide sequence of the HXT3 promoter is shown, below, as SEQ ID NO 3:
GGAGGAGGAGCAATGAAATGAAAGGAAAAAAAATACTTTCTTTTTCTTGAAAAAAGAAAAAA ATTGTAAGATGAGCTATTCGCGGAACATTCTAGCTCGTTTGCATCTTCTTGCATTTGGTTGG TTTTCAATAGTTCGGTAATATTAACGGATACCTACTATTATCCCCTAGTAGGCTCTTTTCAC GGAGAAATTCGGGAGTGCTTTTTTTCCGTGCGCATTTTCTTAGCTATATTCTTCCAGCTTCG CCTGCTGCCCGGTCATCGTTCCTGTCACGTAGTTTTTCCGGATTCGTCCGGCTCATATAATA CCGCAATAAACACGGAATATCTCGTTCCGCGGATTCGGTTAAACTCTCGGTCGCGGATTATC ACAGAGAAAGCTTCGTGGAGAATTTTTCCAGATTTTCCGCTTTCCCCGATGTTGGTATTTCC GGAGGTCATTATACTGACCGCCATTATAATGACTGTACAACGACCTTCTGGAGAAAGAAACA ACTCAATAACGATGTGGGACATTGGAGGCCCACTCAAAAAATCTGGGGACTATATCCCCAGA GAATTTCTCCAGAAGAGAAGAAAAGTCAAAGTTTTTTTCACTTGGGGGTTGCATATAAATAC AGGCGCTGTTTTATCTTCAGCATGAATATTCCATAATTTTACTTAATA
[064] The nucleotide sequence of the FBA1 terminator is shown, below, as SEQ ID NO 4:
GTTAATTCAAATTAATTGATATAGTTTTTTAATGAGTATTGAATCTGTTTAGAAATAATGGA ATATTATTTTTATTTATTTATTTATATTATTGGTCGGCTCTTTTCTTCTGAAGGTCAATGAC AAAATGATATGAAGGAAATAATGATTTCTAAAATTTTACAACGTAAGATATTTTTACAAAAG CCTAGC CA CTTTTG CA GCACTATT AC CACGCTTGAAATTAACGGCCAGTCCAC G CGGAGTCATTTCAAAGTCATCCTAATCGATCTATCGTTTTTGATAGCT CATTTTGGAG
[065] A representation of the AtSTP9S expression cassette is illustrated in Figure 1.
Plasmid pK41Wn-H3SP9, shown in Figure 2, includes an integrated AtSTP9S expression cassette downstream of the Saccharomyces chromosome YHL041W locus. The functional and structural composition of plasmid pK41Wn-H3SP9 is described in Table 1.
Table 1. Functional and structural elements of plasmid pZK41Wn- H3SP9
[066] To facilitate the integration of the Swal fragment from plasmid pZK41Wn-H3SP9 into the downstream region of the YHL041W locus in yeast, a plasmid (pYRH426; not shown) was constructed to express the CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) associated protein 9 (Cas9) and an sgRNA specific for downstream of the YHL041W locus specific using the sequence 5'-GCTGATAATACGCTAAACGA-3'; SEQ ID NO: 5).
Example 3
Generation of a yeast strain expressing a glucose-specific, ATP-mediated transporter
[067] The FERMAX® GOLD yeast strain (Martrex, Inc., MD, USA; herein, "FG") was used as a parental strain to introduce the AtSTP9S expression cassette. Cells were transformed with a 2,949-bp Swal fragment containing the AtSTP9S expression cassette from plasmid pZK41Wn-H3SP9 (Figure 2) and plasmid pYRH426. One transformant with the Swal fragment from pZK41Wn-H3SP9 integrated at the downstream of YHL041W locus was selected and designated as strain G027. [068] The new FG yeast strain, G027, and its parent strain, FG, were grown in vial cultures and their fermentation products analyzed as described in Example 1. Performance in terms of ethanol, glycerol and acetate production is shown in Table 3.
Table 3. FG versus G027 in vial assays
[069] Strain G027 produced about 2% more ethanol than the parental strain and produced similar amounts of glycerol and acetate.
[070] To confirm the performance of the modified yeast, strains G027 and FG were analyzed in AnKom assays, as described in Example 1. Performance in terms of ethanol, glycerol and acetate production is shown in Table 4.
Table 4. FG versus G027 in AnKom assays
[071] The increase in ethanol production with the G027 was 2.1% compared to the parent, FG, confirming the results of vial assays (Table 3). The production of glycerol and acetate were similar to the parental yeast.
Example 4
Identification of Homologs of AtSTP9
[072] AtSTP9 encodes a glucose-specific, ATP-mediated transporter that belongs to the major facilitator superfamily. Like other sugar transporters, AtSTP9 shares conserved structures, including twelve transmembrane domains and five sequence motifs (Leandro et al. (2009) Yeast Res. 9: 511-25). Using the amino acid sequence of AtSTP9 as a query, six homologs with more than 93% identity were found in public databases. The homologs are listed in Table 5. Table 5. AtSTP9 and homologs from public databases
Example 5
Constructs for expressing of codon-optimized, glucose-specific, ATP-mediated transporter homologs
[073] The six selected homologs of AtSTP9 (Table 5) were codon-optimized and then synthesized to generate AaSTP9S, AISTP9S, BrSTP9S, CrSTP9S, CsSTP9S, and EsSTP9S genes.
[074] As was the case with the AtSTP9S expression cassette, the AtSTP9S homolog expression cassettes were under the control of HXT3 promoter (SEQ ID NO: 3; YDR345C) and FBAlterminator (SEQ ID NO: 4; YKL060C) and integrated into a suitable plasmid for propagation.
Example 6
Generation of AtSTP9 homolog strains from industrial yeast FERMAX™ Gold
[075] The FG strain was used as a parent to introduce the AaSTP9S, AISTP9S, BrSTP9S, CrSTP9S, CsSTP9S, and EsSTP9S expression cassettes, as described in Example 2. Yeast were transformed with Swal fragments that individually contained the AaSTP9S, AISTP9S, BrSTP9S, CrSTP9S, CsSTP9S, and EsSTP9S expression cassettes along with plasmid pYRH426. One transformant from each transformation was selected and designated as strain G304, G286, G293, G296, G300, and G303, respectively.
[076] The new FG yeast strains and the parent strain, FG, were grown in vial cultures and their fermentation products analyzed as described in Example 1. Performance in terms of ethanol, glycerol and acetate production is shown in Table 6. Table 6. FG versus G286, G293, G296, G300, G303 and G304 in vial assays
[077] Each of the new FG yeast strains produced more ethanol than the FG parent, which is desirable in terms of performance, however, all the new FG strains produced more glycerol and acetate, which are generally not desirable products.
[078] To confirm the performance of new FG strains, strains G286, G293, G296, G300, G303, G304, along with FG and G027 (from Example 3), were analyzed in AnKom assays, as described in Example 1. Performance in terms of ethanol, glycerol and acetate production is summarized in Table 7.
Table 7. FG versus G027, G286, G293, G296, G300, G303 and G304 in AnKom assays
[079] As demonstrated previously (e.g. , Example 3, Table 4), the increase in ethanol production with the G027 was about 2% compared to the parent, FG, without the production of a significant additional amount of glycerol and/or acetate. The increases in ethanol production with the G286, G293, G296, G300, G303 and G304 strains was more than 4.8% compared to the parent but was accompanied by the production of significantly more glycerol and acetate.

Claims

CLAIMS What is claimed is:
1. Modified yeast cells derived from parental yeast cells, the modified cells comprising a genetic alteration that causes the modified cells to produce an increased amount of a glucose- specific, ATP-mediated transporter compared to the parental cells, wherein the modified cells produce during fermentation an increased amount of ethanol compared to the amount of ethanol produced by the parental cells under identical fermentation conditions.
2. The modified cells of claim 1, wherein the genetic alteration comprises the introduction into the parental cells of a nucleic acid capable of directing the expression of a glucose-specific, ATP-mediated transporter to a level above that of the parental cell grown under equivalent conditions.
3. The modified cells of claim 1 or 2, wherein the genetic alteration comprises the introduction of an expression cassette for expressing a glucose-specific, ATP-mediated transporter.
4. The modified cells of claim 1 or 2, wherein the genetic alteration comprises the introduction of an exogenous gene encoding a glucose-specific, ATP-mediated transporter.
5. The modified cells of claim 4, wherein the exogenous gene is from an organism selected from the group consisting of Arabidopsis thaliana, Arabidopsis lyrate, Arabis alpine, Brassica rapa, Capsella rubella, Camelina sativa, and Eutreme salsugineus.
6. The modified cells of claim 4 or 5, wherein the exogenous gene is selected from the group consisting oiAtSTP9, AaSTP9S, ALSTP9S, BrSTP9S, CrSTP9S, CsSTP9S, and
EsSTP9S.
7. The modified cells of claim 1, wherein the genetic alteration comprises the introduction of a stronger promoter in an endogenous gene encoding a glucose-specific, ATP- mediated transporter.
8. The modified cells of any of claims 1-7, wherein the amount of increase in ethanol he production is at least about 2% compared to the level in the parental cells grown under equivalent conditions.
9. The modified cells of any of claims 1-8, further comprising a genetic alteration that introduces one or more polynucleotides encoding a polypeptide of an exogenous
phosphoketolase pathway.
10. The modified cells of any of claims 1-9, wherein the cells further comprise an exogenous gene encoding a carbohydrate processing enzyme.
11. The modified cells of any of claims 1-10, further comprising an alteration in the glycerol pathway and/or the acetyl-CoA pathway.
12. The modified cells of any of claims 1-11, wherein the cells are of a Saccharomyces spp.
13. A method for increasing the amount of ethanol produced by cells grown on a starch- hydrolysate substrate, comprising: introducing into parental yeast cells a genetic alteration that increases the production of glucose-specific, ATP-mediated transporter polypeptides compared to the amount produced in the parental cells.
14. The method of claim 13, wherein the cells do not produce a significant amount of additional glycerol compared to the amount produced by the parental cells.
15. The method of claim 13 or 14, wherein the increased production of the glucose- specific, ATP-mediated transporter polypeptides increases ATP consumption in the cells.
16. The method of any of claims 13-15, wherein the starch-hydrolysate comprises at least 5 g/L glucose.
17. The method of any of claims 13-16, wherein the cells having the introduced genetic alteration are the modified cells of any of claims 1-12.
EP18773300.1A 2017-08-29 2018-08-21 Modified yeast comprising glucose-specific, atp-mediated transporters Withdrawn EP3676288A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201762551678P 2017-08-29 2017-08-29
PCT/US2018/047259 WO2019046043A1 (en) 2017-08-29 2018-08-21 Modified yeast comprising glucose-specific, atp-mediated transporters

Publications (1)

Publication Number Publication Date
EP3676288A1 true EP3676288A1 (en) 2020-07-08

Family

ID=63643058

Family Applications (1)

Application Number Title Priority Date Filing Date
EP18773300.1A Withdrawn EP3676288A1 (en) 2017-08-29 2018-08-21 Modified yeast comprising glucose-specific, atp-mediated transporters

Country Status (7)

Country Link
EP (1) EP3676288A1 (en)
CN (1) CN111065648A (en)
AR (1) AR113105A1 (en)
BR (1) BR112020004021A2 (en)
CA (1) CA3073387A1 (en)
UY (1) UY37859A (en)
WO (1) WO2019046043A1 (en)

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ES2607891T3 (en) * 2004-07-16 2017-04-04 Dsm Ip Assets B.V. Metabolic engineering of eukaryotic cells that ferment xylose
EP2060632A1 (en) 2007-10-29 2009-05-20 Technische Universität Berlin Method of modifying a yeast cell for the production of ethanol
EP2277989A1 (en) 2009-07-24 2011-01-26 Technische Universiteit Delft Fermentative glycerol-free ethanol production
WO2011153516A2 (en) * 2010-06-03 2011-12-08 Mascoma Corporation Yeast expressing saccharolytic enzymes for consolidated bioprocessing using starch and cellulose
EP3483279A1 (en) 2011-04-05 2019-05-15 Lallemand Hungary Liquidity Management LLC Methods for the improvement of product yield and production in a microorganism through the addition of alternate electron acceptors

Also Published As

Publication number Publication date
UY37859A (en) 2019-03-29
WO2019046043A1 (en) 2019-03-07
CN111065648A (en) 2020-04-24
AR113105A1 (en) 2020-01-29
BR112020004021A2 (en) 2020-09-08
CA3073387A1 (en) 2019-03-07

Similar Documents

Publication Publication Date Title
US20230002793A1 (en) Reduction in acetate production by yeast over-expressing mig3
US11447783B2 (en) Reduction in acetate production by yeast over-expressing PAB1
US12606599B2 (en) Over-expression of GDS1 in yeast for increased ethanol and decreased acetate production
EP3802784B1 (en) Over-expression of transcriptional activator/repressor gis1 in yeast for increased ethanol production
US20210292734A1 (en) Increased alcohol production from yeast producing an increased amount of active crz1 protein
US20210395756A1 (en) Over expression of ribonucleotide reductase inhibitor in yeast for increased ethanol production
EP3555295A1 (en) Bifunctional phosphoketolase-phosphotransacetylase fusion polypeptides
US20210388397A1 (en) Selected phosphotransacetylase genes for increased ethanol production in engineered yeast
US20210207076A1 (en) Overexpression of fumarate reductase results in an increased fermentation rate in yeast
US12139704B2 (en) Yeast with improved alcohol production under high dissolved solids conditions
US20230116556A1 (en) Increased ethanol production by overexpression of jid1 in yeast
US20220073954A1 (en) Hybrid yeast with increased ethanol production
EP3676288A1 (en) Modified yeast comprising glucose-specific, atp-mediated transporters
US20210032642A1 (en) Increased alcohol production from yeast producing an increased amount of active hac1 protein
US20240318207A1 (en) Increased ethanol production by over-expression of kgd2 in yeast
EP4423262A1 (en) Reduction in acetate produced by yeast with reduced expression of rsf2 or tda9
WO2021022140A1 (en) Over-expression of pho13 for increased ethanol production by yeast
US20250043236A1 (en) Over-expression of cytochrome b2 in yeast for increased ethanol production
WO2021022097A1 (en) Over-expression of adh5p for increased ethanol production by yeast
EP3938519A1 (en) Over-expression of fumarate-succinate transporter in yeast for increased ethanol and reduced acetate production
CA3072306A1 (en) Increased ethanol production by yeast harboring constitutive transcriptional activator mal alleles
WO2018136385A1 (en) Modified yeast cells that overexpress a dna polymerase subunit

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20200310

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

AX Request for extension of the european patent

Extension state: BA ME

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION HAS BEEN WITHDRAWN

18W Application withdrawn

Effective date: 20210902