EP3515456A1 - Compositions and methods for characterizing solid tumors responsiveness to anti-pd-l1 antibody monotherapy - Google Patents

Compositions and methods for characterizing solid tumors responsiveness to anti-pd-l1 antibody monotherapy

Info

Publication number
EP3515456A1
EP3515456A1 EP17853747.8A EP17853747A EP3515456A1 EP 3515456 A1 EP3515456 A1 EP 3515456A1 EP 17853747 A EP17853747 A EP 17853747A EP 3515456 A1 EP3515456 A1 EP 3515456A1
Authority
EP
European Patent Office
Prior art keywords
ifng
cxcl9
lag3
cancer
antibody
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP17853747.8A
Other languages
German (de)
French (fr)
Other versions
EP3515456A4 (en
Inventor
Brandon W. Higgs
Chris Morehouse
Philip Brohawn
Katie Streicher
Koustubh Ranade
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
MedImmune LLC
Original Assignee
MedImmune LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by MedImmune LLC filed Critical MedImmune LLC
Publication of EP3515456A1 publication Critical patent/EP3515456A1/en
Publication of EP3515456A4 publication Critical patent/EP3515456A4/en
Withdrawn legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • Cancer continues to be a major global health burden. Despite progress in the treatment of cancer, there continues to be an unmet medical need for more effective and less toxic therapies, especially for those patients with advanced disease or cancers that are resistant to existing therapeutics.
  • Lung cancer is among the most common forms of cancer and is the leading cause of cancer deaths among men and women. More people die of lung cancer annually than of colon, breast, and prostate cancers combined. Non-small cell lung cancer is the most common form of lung cancer. While the risk of acquiring lung cancer is higher among patients with a history of smoking, lung cancer also affects non-smokers. Improving survival of lung cancer patients remains difficult despite improved medical therapies. Most lung cancer is detected only in advanced stages when therapy options are limited. There is a growing recognition that lung cancer and other malignancies arise from a variety of pathogenic mechanisms. Methods of characterizing these malignancies at a molecular level are useful for stratifying patients, thereby quickly directing them to effective therapies. Improved methods for predicting the
  • Bladder cancer is among the five most common malignancies in North America and Europe. The overall incidence of bladder cancer appears to be rising, particularly among patients more than 55 years of age. More than 70% of the bladder cancers are non-muscle-invasive while about 20-30% are muscle-invasive which have a much less favorable prognosis.
  • T cell-mediated cytotoxicity The role of the immune system, in particular T cell-mediated cytotoxicity, in tumor control is well recognized. There is mounting evidence that T cells control tumor growth and survival in cancer patients, both in early and late stages of the disease. However, tumor-specific T-cell responses are difficult to mount and sustain in cancer patients.
  • PD-L1 is part of a complex system of receptors and ligands that are involved in controlling T-cell activation.
  • PD-L1 is expressed on T cells, B cells, dendritic cells, macrophages, mesenchymal stem cells, bone marrow-derived mast cells, as well as various non-hematopoietic cells. Its normal function is to regulate the balance between T-cell activation and tolerance through interaction with its two receptors: programmed death 1 (also known as PD-1 or CD279) and CD80 (also known as B7-1 or B7.1).
  • PD-L1 is also expressed by tumors and acts at multiple sites to help tumors evade detection and elimination by the host immune system.
  • PD-L1 is expressed in a broad range of cancers with a high frequency. In some cancers, expression of PD-L1 has been associated with reduced survival and unfavorable prognosis.
  • Antibodies that block the interaction between B7-H1 and its receptors are able to relieve PD-L1 - dependent immunosuppressive effects and enhance the cytotoxic activity of antitumor T cells in vitro.
  • Durvalumab is a human monoclonal antibody directed against human PD-L1 that is capable of blocking the binding of PD-L1 to both the PD-1 and CD80 receptors.
  • the present invention provides methods for selecting patients as having a solid tumor (e.g., bladder cancer, ovarian cancer, colorectal cancer, head and neck cancer, cervical cancer, renal cell carcinoma, and non-small cell lung cancer (NSCLC)) that is responsive to treatment with an anti-PD-Ll antibody, and methods of treating such patients.
  • a solid tumor e.g., bladder cancer, ovarian cancer, colorectal cancer, head and neck cancer, cervical cancer, renal cell carcinoma, and non-small cell lung cancer (NSCLC)
  • the method involves detecting expression of an IFNG polynucleotide and/or one or more of polynucleotide markers: CXCL9, CD274, LAG3, in a biological sample of the patient.
  • the present invention provides a method of treating a solid tumor in a subject, the method comprising administering an anti-PD-Ll antibody, or an antigen binding fragment thereof, to a patient identified as having increased levels of two or more polynucleotide markers selected from the group consisting of CXCL9, CD274, LAG3, and IFNG in a biological sample derived from the patient relative to a reference.
  • the present invention provides a method of treating lung cancer or bladder cancer in a subject, the method comprising administering an anti-PD-Ll antibody, or an antigen binding fragment thereof, to a patient identified by detecting increased levels of two or more polynucleotide markers selected from the group consisting of CXCL9, CD274, LAG3, and IFNG in a biological sample derived from the patient relative to a reference.
  • the present invention provides a method of identifying a subject having a solid tumor that is responsive to an anti-PD-Ll antibody, or an antigen binding fragment thereof, the method comprising detecting an increase in the expression levels of two or more polynucleotide markers selected from the group consisting of CXCL9, CD274, LAG3, and IFNG in a biological sample obtained from the subject relative to a reference, thereby identifying the solid tumor as responsive to anti-PD-Ll therapy.
  • the present invention provides a method of identifying a subject having a solid tumor that is responsive to anti-PD-Ll therapy, the method comprising detecting an increase in the expression levels of two or more polynucleotide markers selected from the group consisting of CXCL9, CD274, LAG3, and IFNG in a biological sample obtained from the subject, relative to a reference, thereby identifying the solid tumor as responsive to anti-PD-Ll therapy.
  • the present invention provides a method of identifying a subject having a lung cancer or bladder cancer that is responsive to anti-PD-Ll therapy, the method comprising detecting an increase in the expression levels of two or more polynucleotide markers selected from the group consisting of CXCL9, CD274, LAG3, and IFNG in a biological sample obtained from the subject, relative to a reference, thereby identifying the solid tumor as responsive to anti- PD-Ll therapy.
  • Devalumab an antibody or antigen binding fragment thereof that selectively binds a PD-L1 polypeptide and comprises at least a portion of a light chain variable region comprising the amino acid sequence of SEQ ID NO: 1 and/or at least a portion of a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 2.
  • Durvalumab (or antigen-binding fragments thereof) for use in the methods provided herein can be found in US Patent No. 8,779,108, the disclosure of which is incorporated herein by reference in its entirety.
  • the fragment crystallizable (Fc) domain of durvalumab contains a triple mutation in the constant domain of the IgGl heavy chain that reduces binding to the complement component Clq and the Fey receptors responsible for mediating antibody-dependent cell-mediated cytotoxicity (ADCC).
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • Durvalumab is selective for PD-L1 and blocks the binding of PD-L1 to the PD-1 and CD80 receptors.
  • Durvalumab can relieve PD-L1 -mediated suppression of human T-cell activation in vitro and inhibits tumor growth in a xenograft model via a T-cell dependent mechanism.
  • Durvalumab for use in the methods provided herein comprises a heavy chain and a light chain or a heavy chain variable region and a light chain variable region.
  • Durvalumab or an antigen-binding fragment thereof for use in the methods provided herein comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 1 and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 2.
  • durvalumab or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises the Kabat-defined CDRl, CDR2, and CDR3 sequences of SEQ ID NOs: 3-5, and wherein the light chain variable region comprises the Kabat- defined CDRl, CDR2, and CDR3 sequences of SEQ ID NOs: 6-8.
  • the heavy chain variable region comprises the Kabat-defined CDRl, CDR2, and CDR3 sequences of SEQ ID NOs: 3-5
  • the light chain variable region comprises the Kabat- defined CDRl, CDR2, and CDR3 sequences of SEQ ID NOs: 6-8.
  • Durvalumab or an antigen- binding fragment thereof for use in the methods provided herein comprises the variable heavy chain and variable light chain CDR sequences of the 2.14H90PT antibody as disclosed in US Patent No. 8,779,108, which is herein incorporated by reference in its entirety.
  • antigen binding fragment refers to a portion of an intact antibody and/or refers to the antigenic determining variable regions of an intact antibody. It is known that the antigen binding function of an antibody can be performed by fragments of a full-length antibody. Examples of antibody fragments include, but are not limited to, Fab, Fab', F(ab')2, and Fv fragments, linear antibodies, single chain antibodies, diabodies, and multispecific antibodies formed from antibody fragments.
  • Interferon gamma (IFNG) polypeptide is meant a protein or fragment thereof having at least about 85% amino acid sequence identity to NCBI Accession No. P01579 and having immunomodulatory activity.
  • An exemplary IFNG amino acid sequence (Uniprot Accession No. P01579) is provided as SEQ ID NO: 9.
  • IFNG polynucleotide is meant a nucleic acid molecule encoding an IFNG protein.
  • sequence of an exemplary IFNG polynucleotide is provided at NCBI Accession No.
  • NM_000619 which is reproduced as SEQ ID NO: 10.
  • anti-PD-Ll antibody an antibody or antigen binding fragment thereof that selectively binds a PD-L1 polypeptide.
  • Exemplary anti-PD-Ll antibodies are described for example at U.S. Patent No. 8,779,108, which is herein incorporated by reference.
  • Durvalumab is an exemplary PD-L1 antibody. Following treatment with Durvalumab, a patient achieves disease control (DC). Disease control can be a complete response (CR), partial response (PR), or stable disease (SD). Sequences of Durvalumab are provided in a sequence listing herein below.
  • PD-L1 polypeptide is meant a polypeptide or fragment thereof having at least about 85%, 95% or 100% amino acid identity to NCBI Accession No. NP_001254635 (SEQ ID NO: 11) and having PD-1 and CD80 binding activity.
  • PD-L1 nucleic acid molecule is meant a polynucleotide encoding a PD-L1 polypeptide.
  • An exemplary PD-L1 nucleic acid molecule sequence is provided at NCBI
  • C-X-C motif chemokine 9 precursor (CXCL9) polypeptide is meant a polypeptide or fragment thereof having at least about 85% amino acid sequence identity to NCBI Accession No. NP_002407.1 and having chemokine activity.
  • sequence of an exemplary CXCL9 polypeptide is provided below.
  • CXCL9 polynucleotide a polynucleotide encoding a CXCL9 polypeptide.
  • sequence of an exemplary CXCL9 polynucleotide NCBI Accession No. NM_002416.2 is provided below:
  • gagatcctta tcgaaactca ttttaggcaa atgagttt tattgtccgt ttacttgtttt
  • cagagtttgt attgtgatta tcaattacca caccatctcc catgaagaaa gggaacggtg 2041 aagtactaag cgctagagga agcagccaag tcggttagtg gaagcatgat tggtgcccag
  • CD274 polypeptide also known as “PD-Ll polypeptide” is meant a polypeptide or fragment thereof having at least about 85% amino acid sequence identity to GenBank:
  • EAW58763 The sequence of an exemplary CD274 or PD-Ll polypeptide is provided below:
  • CD274 polynucleotide also known as “PD-Ll polynucleotide” is meant a polynucleotide encoding a CD274 or PD-Ll polypeptide.
  • sequence of an exemplary CD274 polynucleotide is provided at NCBI Accession No. NM_014143, which is reproduced below:
  • LAG3 polypeptide is meant a polypeptide or fragment thereof having at least about 85% amino acid sequence identity to NCBI Accession No.
  • AAH52589 (LAG3 polypeptide).
  • the sequence of an exemplary LAG3 polypeptide is provided below.
  • LAG3 polynucleotide is meant a polynucleotide encoding a LAG3 polypeptide.
  • sequence of an exemplary LAG3 polynucleotide is provided at NCBI Accession No.
  • antibody refers to an immunoglobulin or a fragment or a derivative thereof, and encompasses any polypeptide comprising an antigen- binding site, regardless whether it is produced in vitro or in vivo.
  • the term includes, but is not limited to, polyclonal, monoclonal, monospecific, polyspecific, non-specific, humanized, single- chain, chimeric, synthetic, recombinant, hybrid, mutated, and grafted antibodies.
  • the term “antibody” also includes antibody fragments such as Fab, F(ab')2, Fv, scFv, Fd, dAb, and other antibody fragments that retain antigen-binding function, i.e., the ability to bind PD-Ll specifically. Typically, such fragments would comprise an antigen-binding domain.
  • the terms "antigen-binding domain,” “antigen-binding fragment,” and “binding fragment” refer to a part of an antibody molecule that comprises amino acids responsible for the specific binding between the antibody and the antigen.
  • an antigen-binding domain may only bind to a part of the antigen.
  • a portion of the antigen molecule that is responsible for specific interactions with the antigen-binding domain is referred to as "epitope" or "antigenic determinant.”
  • An antigen-binding domain typically comprises an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH), however, it does not necessarily have to comprise both.
  • VL antibody light chain variable region
  • VH antibody heavy chain variable region
  • Fd antibody fragment consists only of a V H domain, but still retains some antigen-binding function of the intact antibody.
  • Binding fragments of an antibody are produced by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact antibodies. Binding fragments include Fab, Fab', F(ab')2, Fv, and single-chain antibodies.
  • An antibody other than a "bispecific” or “bifunctional” antibody is understood to have each of its binding sites identical. Digestion of antibodies with the enzyme, papain, results in two identical antigen-binding fragments, known also as "Fab” fragments, and a "Fc” fragment, having no antigen-binding activity but having the ability to crystallize.
  • Fv when used herein refers to the minimum fragment of an antibody that retains both antigen-recognition and antigen-binding sites.
  • Fab when used herein refers to a fragment of an antibody that comprises the constant domain of the light chain and the CHI domain of the heavy chain.
  • mAb refers to monoclonal antibody.
  • Antibodies of the invention comprise without limitation whole native antibodies, bispecific antibodies; chimeric antibodies; Fab, Fab', single chain V region fragments (scFv), fusion polypeptides, and unconventional antibodies.
  • biological sample is meant any tissue, cell, fluid, or other material derived from an organism.
  • a biological sample is a tumor biopsy sample.
  • a “biomarker” or “marker” as used herein generally refers to a protein, nucleic acid molecule, clinical indicator, or other analyte that is associated with a disease.
  • a marker is differentially present in a biological sample obtained from a subject having a disease (e.g., lung cancer) relative to the level present in a control sample or reference.
  • a disease e.g., lung cancer
  • “comprises,” “comprising,” “containing” and “having” and the like can have the meaning ascribed to them in U.S. Patent law and can mean “includes,” “including,” and the like; “consisting essentially of” or “consists essentially” likewise has the meaning ascribed in U.S. Patent law and the term is open-ended, allowing for the presence of more than that which is recited so long as basic or novel characteristics of that which is recited is not changed by the presence of more than that which is recited, but excludes prior art embodiments.
  • Detect refers to identifying the presence, absence or amount of the analyte to be detected.
  • disease is meant any condition or disorder that damages or interferes with the normal function of a cell, tissue, or organ.
  • Lung cancer includes small cell lung cancer (SCLC) and non-small cell lung cancer (NSCLC).
  • SCLC small cell lung cancer
  • NSCLC non-small cell lung cancer
  • adenocarcinoma adenocarcinoma
  • large cell (undifferentiated) carcinoma adenocarcinoma
  • Other subtypes include
  • adenosquamous carcinoma and sarcomatoid carcinoma are adenosquamous carcinoma and sarcomatoid carcinoma.
  • isolated refers to material that is free to varying degrees from components which normally accompany it as found in its native state.
  • Isolate denotes a degree of separation from original source or surroundings.
  • Purify denotes a degree of separation that is higher than isolation.
  • a “purified” or “biologically pure” protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized.
  • Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid chromatography.
  • the term "purified” can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel.
  • modifications for example, phosphorylation or glycosylation
  • the level of interferon gamma present in a sample from a patient that is partially responsive to a therapy of the invention is compared to the level present in a corresponding sample obtained from a patient having progressive disease.
  • responsive in the context of therapy is meant susceptible to treatment.
  • binding is meant a compound (e.g., antibody) that recognizes and binds a molecule (e.g., polypeptide), but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample.
  • a molecule e.g., polypeptide
  • two molecules that specifically bind form a complex that is relatively stable under physiologic conditions.
  • Specific binding is characterized by a high affinity and a low to moderate capacity as distinguished from nonspecific binding which usually has a low affinity with a moderate to high capacity.
  • binding is considered specific when the affinity constant KA IS higher than 10 6 M _1 , or more preferably higher than 10 s M -1 . If necessary, non-specific binding can be reduced without substantially affecting specific binding by varying the binding conditions.
  • the appropriate binding conditions such as concentration of antibodies, ionic strength of the solution,
  • concentration of a blocking agent e.g., serum albumin, milk casein, etc.
  • concentration of a blocking agent e.g., serum albumin, milk casein
  • subject is meant a mammal, including, but not limited to, a human or non-human mammal, such as a bovine, equine, canine, ovine, or feline.
  • Ranges provided herein are understood to be shorthand for all of the values within the range.
  • a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.
  • treat refers to reducing or ameliorating a disorder and/or symptoms associated therewith. It will be appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition or symptoms associated therewith be completely eliminated.
  • Figures 1A-D are Kaplan-Meier plots of Overall Response (OS) for CXCL9, IFNG, LAG3, and CD274 (PD-Ll), respectively, in NSCLC patients. Each plot is cut into high (dashed line) or low (solid line) expression using the receiver operator characteristic (ROC)-identified cut points.
  • OS Overall Response
  • IFNG IFNG
  • LAG3 LAG3
  • CD274 PD-Ll
  • Figures 1E-H are Kaplan-Meier plots of progression-free response (PFS) for CXCL9, IFNG, LAG3, and CD274 (PD-Ll) in NSCLC patients. Each plot is cut into high (dashed line) or low (solid line) expression using the ROC-identified cut points.
  • PFS progression-free response
  • Figure 2 provides correlation scatter plots of the four genes CXCL9, IFNG, LAG3, and CD274 (Spearman's coefficient) in non-small cell lung cancer (NSCLC).
  • Figure 3A is a Kaplan-Meier plot of Overall Response (OS) for the four genes CXCL9, IFNG, LAG3, and CD274 signature in NSCLC patients. Each plot is cut into high (dashed line) or low (solid line) expression using the ROC-identified cut point.
  • OS Overall Response
  • Figure 3B is a Kaplan-Meier plot of progression-free response (PFS) for the four genes CXCL9, IFNG, LAG3, and CD274 signature in NSCLC patients. Each plot is cut into high (dashed line) or low (solid line) expression using the ROC-identified cut point.
  • PFS progression-free response
  • Figure 4 shows the on-treatment effects by durvalumab for gene signature in NSCLC before and after dosing.
  • Figure 5A shows the progression-free response of the four gene signature in bladder cancer patients. Each plot is cut into high (dashed line) or low (solid line) expression using the upper tertile cut point.
  • Figure 5B shows the progression-free response of IFNG gene signature in bladder cancer patients. Each plot is cut into high (dashed line) or low (solid line) expression using the upper tertile cut point.
  • the present invention provides methods for selecting patients as having a solid tumor (e.g., bladder cancer, ovarian cancer, colorectal cancer, head and neck cancer, cervical cancer, renal cell carcinoma, and non-small cell lung cancer (NSCLC)) that is responsive to treatment with an anti-PD-Ll antibody, and methods of treating such patients.
  • a solid tumor e.g., bladder cancer, ovarian cancer, colorectal cancer, head and neck cancer, cervical cancer, renal cell carcinoma, and non-small cell lung cancer (NSCLC)
  • NSCLC non-small cell lung cancer
  • the invention is based, at least in part, on the discovery that patients having lung cancer (e.g., non-squamous cell or squamous cell non-small cell lung cancer) or bladder cancer that is responsive to treatment with an anti-PD-Ll antibody may be identified by detecting increased levels of CXCL9, CD274, LAG3, and IFNG mRNA in a tumor or blood sample of a subject.
  • the patients may be identified by detecting increased levels of one or more of CXCL9, CD274, LAG3, and IFNG mRNA in a tumor or blood sample of the patient.
  • the patient is identified by detecting increased levels of the combination of CXCL9, CD274, LAG3, and IFNG mRNA in a tumor or blood sample of the patient.
  • the invention provides methods for identifying subjects that have a solid tumor (e.g., breast, colon, colorectal, lung, renal, including renal cell carcinoma, gastric, bladder, non-small cell lung cancer (NSCLC), hepatocellular cancer (HCC), pancreatic cancer, melanoma) that is likely to respond to anti-PD-Ll antibody treatment based on an increase in the level of one or more of CXCL9, CD274, LAG3, and IFNG mRNA in a subject tumor or blood sample.
  • a solid tumor e.g., breast, colon, colorectal, lung, renal, including renal cell carcinoma, gastric, bladder, non-small cell lung cancer (NSCLC), hepatocellular cancer (HCC), pancreatic cancer, melanoma
  • the invention provides methods for identifying subjects that have lung cancer or bladder cancer that is likely to respond to anti-PD-Ll antibody treatment based on an increase in the level of the combination of CXCL9, CD274, LAG3, and IFNG mRNAs in a subject tumor or blood sample.
  • aspects of the present invention provide methods for treating lung cancer (e.g., non- squamous cell or squamous cell non- small cell lung cancer) with an anti-PD-Ll antibody in a patient identified by detecting an increase in the level of one or more of CXCL9, CD274, LAG3, and IFNG polynucleotides in a tumor or blood sample of the patient.
  • the patient is identified by detecting an increase in the levels of a combination of CXCL9, CD274, LAG3, and IFNG polynucleotides in a tumor or blood sample of the patient.
  • aspects of the present invention provide methods for treating bladder cancer with an anti- PD-L1 antibody in a patient identified by detecting an increase in the level of one or more of CXCL9, CD274, LAG3, and IFNG polynucleotides in a tumor or blood sample of the patient.
  • the patient is identified by detecting an increase in the levels of a
  • CXCL9, CD274, LAG3, and IFNG polynucleotides in a tumor or blood sample of the patient.
  • B7-H1 also known as CD274 and PD-L1
  • CD274 and PD-L1 is a type I transmembrane protein of approximately 53kDa in size.
  • B7-H1 is expressed on a number of immune cell types including activated and anergic/exhausted T cells, on naive and activated B cells, as well as on myeloid dendritic cells (DC), monocytes and mast cells. It is also expressed on non-immune cells including islets of the pancreas, Kupffer cells of the liver, vascular endothelium and selected epithelia, for example airway epithelia and renal tubule epithelia, where its expression is enhanced during inflammatory episodes.
  • DC myeloid dendritic cells
  • B7-H1 expression is also found at increased levels on a number of tumors including, but not limited to breast, colon, colorectal, lung, renal, including renal cell carcinoma, gastric, bladder, non-small cell lung cancer (NSCLC), hepatocellular cancer (HCC), and pancreatic cancer, as well as melanoma.
  • tumors including, but not limited to breast, colon, colorectal, lung, renal, including renal cell carcinoma, gastric, bladder, non-small cell lung cancer (NSCLC), hepatocellular cancer (HCC), and pancreatic cancer, as well as melanoma.
  • NSCLC non-small cell lung cancer
  • HCC hepatocellular cancer
  • pancreatic cancer pancreatic cancer
  • B7-H1 is known to bind two alternative ligands, the first of these, PD-1, is a 50-55 kDa type I transmembrane receptor that was originally identified in a T cell line undergoing activation-induced apoptosis. PD-1 is expressed on activated T cells, B cells, and monocytes, as well as other cells of the immune system and binds both B7-H1 (PD-L1) and the related B7-DC (PD-L2). The second is the B7 family member B7-1, which is expressed on activated T cells, B cells, monocytes and antigen presenting cells.
  • B7-H1 functions in this respect via several alternative mechanisms including driving exhaustion and anergy of tumor infiltrating T lymphocytes, stimulating secretion of immune repressive cytokines into the tumor micro-environment, stimulating repressive regulatory T cell function and protecting B7-H1 expressing tumor cells from lysis by tumor cell specific cytotoxic T cells.
  • Antibodies that specifically bind and inhibit PD-Ll activity e.g., binding to PD-1 and/or
  • CD80 are useful for the treatment of lung cancer (e.g., non-small cell lung cancer).
  • Durvalumab is an exemplary anti-PD-Ll antibody that is selective for B7-H1 and blocks the binding of B7- Hl to the PD-1 and CD80 receptors.
  • Durvalumab can relieve B7-H1 -mediated suppression of human T-cell activation in vitro and inhibits tumor growth in a xenograft model via a T-cell dependent mechanism.
  • Other agents that could be used include agents that inhibit PD-Ll and/or PD-1 (AB or other).
  • the fragment crystallizable (Fc) domain of durvalumab contains a triple mutation in the constant domain of the IgGl heavy chain that reduces binding to the complement component Clq and the Fey receptors responsible for mediating antibody-dependent cell-mediated cytotoxicity (ADCC).
  • Durvalumab and antigen-binding fragments thereof for use in the methods provided herein comprises a heavy chain and a light chain or a heavy chain variable region and a light chain variable region.
  • Durvalumab or an antigen-binding fragment thereof for use in the methods provided herein comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 1 and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 2.
  • Durvalumab or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises the Kabat- defined CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 3-5, and wherein the light chain variable region comprises the Kabat-defined CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 6-8.
  • the heavy chain variable region comprises the Kabat- defined CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 3-5
  • the light chain variable region comprises the Kabat-defined CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 6-8.
  • Durvalumab or an antigen-binding fragment thereof for use in the methods provided herein comprises the variable heavy chain and variable light chain CDR sequences of the 2.14H90PT antibody as disclosed in U.S. Patent No. 8,779, 108, which is herein incorporated by reference in its entirety.
  • a solid tumor e.g., breast, colon, colorectal, lung, renal, including renal cell carcinoma, gastric, bladder, non-small cell lung cancer (NSCLC), hepatocellular cancer (HCC), pancreatic cancer, melanoma
  • NSCLC non-small cell lung cancer
  • HCC hepatocellular cancer
  • pancreatic cancer pancreatic cancer, melanoma
  • the level of expression of one or more of CXCL9, CD274, LAG3 and IFNG polynucleotides is measured in different types of biologic samples (e.g., tumor, blood, and/or lymph node samples).
  • the polynucleotide expression of one or more of polynucleotide markers CXCL9, CD274, LAG3 and IFNG is higher in a tumor or blood sample obtained from a subject that is responsive to anti-PD-Ll antibody than the level of expression in a non-responsive subject (e.g., a subject with progressive disease).
  • levels of polynucleotide markers IFNG and CXCL9 are measured.
  • levels of polynucleotide markers IFNG and CD274 are measured.
  • levels of polynucleotide markers IFNG and LAG3 are measured.
  • levels of polynucleotide markers IFNG, CXCL9, and either LAG3 or CD274 are measured.
  • an alteration in expression is calculated using cycle threshold (Ct) values.
  • Ct cycle threshold
  • the Ct value of an IFNG gene is obtained and from that value the Ct value of a reference gene (e.g., B2M, ACTB, GAPDH) is subtracted from the mean Ct value for each gene to obtain a Delta-Ct value.
  • the final gene expression score is defined as (20 - ACt).
  • expression of a marker of the invention is increased by at least about 2, 3, 4, 5 or 10-fold in a responsive patient relative to the level in a non-responsive subject (e.g., a subject with progressive disease).
  • CXCL9, CD274, LAG3 and IFNG polynucleotide fold change values are determined using any method known in the art, including but not limited to quantitative PCR, RT-PCR, Northern blotting, in situ hybridization, fluorescence in situ hybridization (FISH), microarray, and/or RN A- sequencing.
  • Subjects suffering a solid tumor may be tested for one or more of CXCL9, CD274, LAG3 and IFNG polynucleotide expression in the course of selecting a treatment method.
  • a solid tumor e.g., breast, colon, colorectal, lung, renal, including renal cell carcinoma, gastric, bladder, non-small cell lung cancer (NSCLC), hepatocellular cancer (HCC), pancreatic cancer, melanoma
  • NSCLC non-small cell lung cancer
  • HCC hepatocellular cancer
  • pancreatic cancer pancreatic cancer
  • Patients characterized as having high expression (e.g., as defined by Ct score) or increased expression relative to a reference level are identified as responsive to anti-PD-Ll treatment.
  • Patients identified as having tumors or blood samples that express one or more of CXCL9, CD274, LAG3 and IFNG polynucleotides particularly at high levels, are likely to be responsive to anti-PD-Ll antibody therapy.
  • Such patients are administered an anti-PD-Ll antibody, such as Durvalumab, or an antigen-binding fragment thereof.
  • the anti-PD-Ll antibody, such as Durvalumab, or an antigen-binding fragment thereof can be administered only once or infrequently while still providing benefit to the patient.
  • the patient is administered additional follow-on doses.
  • Follow-on doses can be administered at various time intervals depending on the patient's age, weight, clinical assessment, tumor burden, and/or other factors, including the judgment of the attending physician.
  • At least two doses of Durvalumab, or an antigen-binding fragment thereof are administered to the patient.
  • at least three doses, at least four doses, at least five doses, at least six doses, at least seven doses, at least eight doses, at least nine doses, at least ten doses, or at least fifteen doses or more can be administered to the patient.
  • Durvalumab or an antigen-binding fragment thereof is administered over a two-week treatment period, over a four-week treatment period, over a six-week treatment period, over an eight-week treatment period, over a twelve-week treatment period, over a twenty-four- week treatment period, or over a one-year or more treatment period.
  • Durvalumab or an antigen-binding fragment thereof is administered over a three-week treatment period, a six-week treatment period, over a nine-week treatment period, over a twelve-week treatment period, over a twenty-four-week treatment period, or over a one-year or more treatment period. In some embodiments, Durvalumab or an antigen-binding fragment thereof is administered over a two-month treatment period, over a four-month treatment period, or over a six-month or more treatment period (e.g., during a maintenance phase).
  • the amount of Durvalumab, or an antigen-binding fragment thereof, to be administered to the patient will depend on various parameters, such as the patient's age, weight, clinical assessment, tumor burden and/or other factors, including the judgment of the attending physician.
  • administration of Durvalumab, or an antigen-binding fragment thereof, according to the methods provided herein is through parenteral administration.
  • Durvalumab or an antigen-binding fragment thereof can be administered by intravenous infusion or by subcutaneous injection. In some embodiments, the administration is by intravenous infusion.
  • the methods provided herein can decrease tumor size, retard tumor growth or maintain a steady state.
  • the reduction in tumor size can be significant based on appropriate statistical analyses.
  • a reduction in tumor size can be measured by comparison to the size of patient's tumor at baseline, against an expected tumor size, against an expected tumor size based on a large patient population, or against the tumor size of a control population.
  • the administration of Durvalumab can reduce a tumor size by at least 25%.
  • the administration of Durvalumab can reduce a tumor size by at least 25% within about 6 weeks of the first treatment.
  • the administration of Durvalumab can reduce a tumor size by at least 50%.
  • the administration of Durvalumab can reduce a tumor size by at least 50% within about 10 weeks of the first treatment. In certain aspects provided herein, the administration of Durvalumab can reduce a tumor size by at least 75%. In certain aspects provided herein, the administration of Durvalumab can reduce a tumor size by at least 75% within about 10 weeks of the first treatment.
  • Durvalumab or an antigen-binding fragment thereof, can decrease tumor size within 6 weeks, within 7 weeks, within 8 weeks, within 9 weeks, within 10 weeks, within 12 weeks, within 16 weeks, within 20 weeks, within 24 weeks, within 28 weeks, within 32 weeks, within 36 weeks, within 40 weeks, within 44 weeks, within 48 weeks, or within 52 weeks of the first treatment.
  • the methods provided herein can decrease or retard tumor growth.
  • the reduction or retardation can be statistically significant.
  • a reduction in tumor growth can be measured by comparison to the growth of patient's tumor at baseline, against an expected tumor growth, against an expected tumor growth based on a large patient population, or against the tumor growth of a control population.
  • a patient achieves disease control (DC).
  • Disease control can be a complete response (CR), partial response (PR), or stable disease (SD).
  • CR complete response
  • a “partial response” refers to a decrease in tumor burden > 50% relative to baseline. Confirmation can be obtained using a consecutive repeat assessment at least 4 weeks from the date of first documentation
  • PD Progressive disease
  • “Stable disease” refers to not meeting the criteria for CR, PR, or PD.
  • administering can increase progression-free survival (PFS).
  • PFS progression-free survival
  • administering can increase overall survival (OS).
  • Durvalumab or an antigen-binding fragment thereof can also decrease free B7-H1 levels.
  • Free B7-H1 refers to B7-H1 that is not bound (e.g., by
  • B7-H1 levels are reduced by at least 80%. In some embodiments, B7-H1 levels are reduced by at least 90%. In some embodiments, B7-H1 levels are reduced by at least 95%. In some embodiments, B7-H1 levels are reduced by at least 99%. In some embodiments, B7-H1 levels are eliminated following administration of Durvalumab or an antigen-binding fragment thereof. In some embodiments, administration of Durvalumab or an antigen-binding fragment thereof reduces the rate of increase of B7-H1 levels as compared, e.g., to the rate of increase of B7-H1 levels prior to the administration of Durvalumab or an antigen- binding fragment thereof. Kits
  • kits for characterizing the responsiveness of a subject to anti-PD- Ll antibody treatment includes a therapeutic composition containing an effective amount of an antibody that specifically binds a PD-Ll polypeptide in unit dosage form.
  • a diagnostic kit of the invention provides a reagent (e.g., TaqMan primers/ probes for one or more of CXCL9, CD274, LAG3 and IFNG polynucleotide and housekeeping reference genes) for measuring relative expression of CXCL9, CD274, LAG3 and IFNG polynucleotides.
  • a reagent e.g., TaqMan primers/ probes for one or more of CXCL9, CD274, LAG3 and IFNG polynucleotide and housekeeping reference genes
  • the kit comprises a sterile container which contains a therapeutic and/or diagnostic composition; such containers can be boxes, ampoules, bottles, vials, tubes, bags, pouches, blister-packs, or other suitable container forms known in the art.
  • a sterile container which contains a therapeutic and/or diagnostic composition
  • Such containers can be boxes, ampoules, bottles, vials, tubes, bags, pouches, blister-packs, or other suitable container forms known in the art.
  • Such containers can be made of plastic, glass, laminated paper, metal foil, or other materials suitable for holding medicaments.
  • a kit of the invention comprises reagents for measuring
  • kits further comprises instructions for measuring
  • lung cancer e.g., squamous cell or non-squamous cell carcinoma non-small cell lung cancer
  • bladder cancer selected as responsive to anti-PD-Ll antibody treatment.
  • the instructions include at least one of the following: description of the therapeutic agent; dosage schedule and administration for treatment or prevention of a solid tumor, bladder cancer or lung cancer (e.g., non-small cell lung cancer, small cell lung cancer) or symptoms thereof; precautions; warnings; indications; counter- indications; over dosage information;
  • the instructions may be printed directly on the container (when present), or as a label applied to the container, or as a separate sheet, pamphlet, card, or folder supplied in or with the container.
  • Example 1 CXCL9, CD274, LAG3 and IFNG correlate with the objective response rate (ORR) in NSCLC
  • RNA sequencing data was generated on patient tumors with available clinical data, where 30 had pre/post NSCLC patient tumor pair as well as 30 bladder patient tumors pre-treatment with available clinical data and subjected to bioinformatics analysis.
  • the following genes were evaluated: CXCL9, PD-Ll (CD274), LAG-3, IFNG, PD-1 (PDCDl), NKG7, CD8A, SLAMF7, PD-L2 (PDCD1LG2), TIM-3 (HAVCR2), CD80, CD86, CTLA-4, CD2, TLR8, GZMK,
  • TNFRSF4 TNFRSF4, FOXP3, CD276, B7-H4 (VTCN1), and CD37.
  • ROC receiver operator characteristic
  • AUC area under the curve
  • PH Cox proportional hazards
  • the 21 candidate genes were subsequently correlated with objective response rate (ORR), both without and with adjustment for age, gender, previous therapy lines, smoking status and histology (squamous or non-squamous). Results are presented in Tables 1 and 2, where the top 4 genes in each (ranked by area under the curve (AUC) or p-value) include CXCL9, CD274,
  • Example 2 CXCL9, CD274, LAG3 and IFNG are correlated with the overall response (OS) or progression-free response (PFS) in NSCLC
  • OS overall response
  • PFS progression-free response
  • Figures 1A-H Kaplan Meier estimator
  • Figures 1A-D show the overall response plots for CXCL9, IFNG, LAG3, and CD274 (PDLl) in NSCLC patients. Each plot is cut into high or low expression using the ROC- identified cut points.
  • Figures 1E-H show the progression free survival plots for CXCL9, IFNG, LAG3, and CD274 (PDLl) in NSCLC patients. Each plot is cut into high or low expression using the ROC -identified cut points.
  • NSCLC Patients are stratified into high or low groups using the upper tertile of expression.
  • Example 4 IFNG and CXCL9 showed the highest correlation Pretreatment levels of each of the four genes, CXCL9, CD274, LAG3 and IFNG, were correlated with each other to show shared information.
  • Figure 2 shows Correlation scatter plot of four genes (Spearman's coefficient) in NSCLC.
  • the Spearman's coefficient is a nonparametric measure of statistical dependence between two variables.
  • Each x and y axis for a plot indicates the specific gene regressed against one of the four other genes.
  • Each data point is a NSCLC patient tumor sample at baseline.
  • Example 5 A composite signature from the four genes CXCL9, CD274, LAG3 and IFNG in NSCLC
  • a gene signature was calculated using the median expression of the four genes CXCL9, CD274, LAG3 and IFNG and the previous analyses were repeated using this signature as a predictor of objective response rate (ORR) and overall response/progression free survival.
  • Results are shown in Tables 4 and 5 and Figure 3.
  • the gene signature is shown to be highly correlated with both objective response as well as overall (Figure 3A) and progression- free (Figure 3B) survival in NSCLC.
  • the y-axis indicates probability of overall survival while the x-axis indicates time in days.
  • the dashed line indicates patients with expression of the gene signature at the upper tertile of expression.
  • the four gene signature was cut into low or high groups using the upper tertile of expression (top 33%) and subsequently correlated with objective response rate. Due to the small sample size, the adjusted model was not calculated. Results for all comers, IFNG alone, and the four gene signature are presented in Table 6. The enrichment of responders is apparent in both the IFNG group and the gene signature positive group in bladder cancer patients treated with durvalumab, as was demonstrated in the NSCLC patient cohort.
  • Example 7 Correlation of gene signature and IFNG with progression free survival in bladder cancer
  • Tissues were homogenized in 600 ⁇ RLT lysis buffer (Qiagen, Valencia, CA) supplemented with ⁇ -mercaptoethanol ( ⁇ -me) using PowerGen 500 cryogenic homogenizer (Fisher Scientific, Pittsburgh, PA). Homogenized tissue lysates were centrifuged for 3 min at 13,000 x g at room temperature to remove insoluble tissue debris. The supernatant was transferred into a fresh microcentrifuge tube and 1 volume of 100% ethanol was added to the supernatant. The supernatant-ethanol mixture was applied to a Zymo-Spin IC column (Zymo Research, Irvine, CA) for the binding of RNA.
  • RNA-seq libraries were prepared using the TruSeq Stranded Total RNA Prep Kit according to the manufacturer's instructions (Illumina, San Diego, CA). Ribosomal RNAs were depleted from total RNA (150 ng per sample) using the Ribo-Zero Gold rRNA removal solution containing biotinylated probes targeting eukaryotic cytoplasmic and mitochondrial rRNAs. The rRNA-probe complexes were removed from the sample using streptavidin-coated magnetic beads and the resulting rRNA-depleted sample was subjected to thermal RNA fragmentation prior to cDNA synthesis.
  • the first strand cDNA was synthesized using Superscript III reverse transcriptase (Thermo Fisher Scientific, Waltham MA) and random primers, followed by second strand cDNA synthesis.
  • a single adenylate (A) residue was added to 3' end of the double- stranded cDNA molecules and the resulting A-tailed double stranded cDNAs were ligated to 3'- dT-tailed Illumina TruSeq paired-end adaptors containing unique index barcode sequences.
  • the ligated products were purified and enriched with 15 cycles of Polymerase Chain Reaction (PCR) using the primers provided in the Illumina library prep kit.
  • RNA-seq libraries The size distribution of the RNA-seq libraries was analyzed on a 2100 Bioanalyzer (Agilent Technologies, Santa Clara, CA) and the library concentrations were determined using Kapa Library Quantification kit (Kapa Biosystems, Woburn, MA). Each library was normalized to 4 nM in 10 mM Tris-HCl, pH 8.0 and denatured in 0. IN NaOH for 5 min prior to the final dilution. Paired-end sequencing runs (2 x 100 cycles) were performed on either HiSeq 2000 or
  • NextSeq 500 sequencing instruments (Illumina, San Diego, CA).
  • denatured libraries (12 pM final concentration) were clustered on a TruSeq v3 Paired-End with a cBot system and sequenced using TruSeq v3 SBS reagents (Illumina, San Diego, CA).
  • Sequencing runs on NextSeq 500 system was carried out with 1.8 pM denatured libraries loaded onto a NextSeq 500/550 v2 flowcell and reagents (Illumina, San Diego, CA).
  • CP1108/NCT01693562 is a nonrandomized, open-label, multicenter phase 1/2 clinical trial evaluating safety and clinical activity of durvalumab in multiple advanced solid tumors.
  • RNA sequencing data was generated on 97 NSCLC patient tumors with available clinical data, where 30 had pre/post NSCLC patient tumor pair as well as 30 bladder patient tumors pre- treatment with available clinical data.
  • ROC receiver operator characteristic
  • AUC area under the curve
  • PH Cox proportional hazards
  • gagatcctta tcgaaactca ttttaggcaa atgagttt tattgtccgt ttacttgtttt

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Biochemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

The present invention provides methods for selecting patients as having a solid tumor (e.g., bladder cancer, ovarian cancer, colorectal cancer, head and neck cancer, cervical cancer, renal cell carcinoma, and non-small cell lung cancer (NSCLC)) that is responsive to treatment with an anti-PD-L1 antibody, and methods of treating such patients. The method involves detecting expression of an IFNG polynucleotide and/or one or more of polynucleotide markers: CXCL9, CD274, and LAG3, in a biological sample of the patient.

Description

COMPOSITIONS AND METHODS FOR CHARACTERIZING SOLID TUMORS RESPONSIVENESS TO ANTI-PD-L1 ANTIBODY MONOTHERAPY
BACKGROUND OF THE INVENTION
Cancer continues to be a major global health burden. Despite progress in the treatment of cancer, there continues to be an unmet medical need for more effective and less toxic therapies, especially for those patients with advanced disease or cancers that are resistant to existing therapeutics.
Lung cancer is among the most common forms of cancer and is the leading cause of cancer deaths among men and women. More people die of lung cancer annually than of colon, breast, and prostate cancers combined. Non-small cell lung cancer is the most common form of lung cancer. While the risk of acquiring lung cancer is higher among patients with a history of smoking, lung cancer also affects non-smokers. Improving survival of lung cancer patients remains difficult despite improved medical therapies. Most lung cancer is detected only in advanced stages when therapy options are limited. There is a growing recognition that lung cancer and other malignancies arise from a variety of pathogenic mechanisms. Methods of characterizing these malignancies at a molecular level are useful for stratifying patients, thereby quickly directing them to effective therapies. Improved methods for predicting the
responsiveness of subjects having lung cancer, including NSCLC, are urgently required.
Bladder cancer is among the five most common malignancies in North America and Europe. The overall incidence of bladder cancer appears to be rising, particularly among patients more than 55 years of age. More than 70% of the bladder cancers are non-muscle-invasive while about 20-30% are muscle-invasive which have a much less favorable prognosis.
The role of the immune system, in particular T cell-mediated cytotoxicity, in tumor control is well recognized. There is mounting evidence that T cells control tumor growth and survival in cancer patients, both in early and late stages of the disease. However, tumor-specific T-cell responses are difficult to mount and sustain in cancer patients.
PD-L1 is part of a complex system of receptors and ligands that are involved in controlling T-cell activation. In normal tissue, PD-L1 is expressed on T cells, B cells, dendritic cells, macrophages, mesenchymal stem cells, bone marrow-derived mast cells, as well as various non-hematopoietic cells. Its normal function is to regulate the balance between T-cell activation and tolerance through interaction with its two receptors: programmed death 1 (also known as PD-1 or CD279) and CD80 (also known as B7-1 or B7.1). PD-L1 is also expressed by tumors and acts at multiple sites to help tumors evade detection and elimination by the host immune system. PD-L1 is expressed in a broad range of cancers with a high frequency. In some cancers, expression of PD-L1 has been associated with reduced survival and unfavorable prognosis. Antibodies that block the interaction between B7-H1 and its receptors are able to relieve PD-L1 - dependent immunosuppressive effects and enhance the cytotoxic activity of antitumor T cells in vitro. Durvalumab, is a human monoclonal antibody directed against human PD-L1 that is capable of blocking the binding of PD-L1 to both the PD-1 and CD80 receptors.
Despite the significant progress made over the past decade in developing strategies for combatting cancer and other diseases, patients with advanced, refractory and metastatic disease have limited clinical options. Chemotherapy, irradiation, and high dose chemotherapy have become dose limiting. There remains a substantial unmet need for new less-toxic methods and therapeutics that have better therapeutic efficacy, longer clinical benefit, and improved safety profiles, particularly for those patients with advanced disease or cancers that are resistant to existing therapeutics.
SUMMARY OF THE INVENTION
The present invention provides methods for selecting patients as having a solid tumor (e.g., bladder cancer, ovarian cancer, colorectal cancer, head and neck cancer, cervical cancer, renal cell carcinoma, and non-small cell lung cancer (NSCLC)) that is responsive to treatment with an anti-PD-Ll antibody, and methods of treating such patients. The method involves detecting expression of an IFNG polynucleotide and/or one or more of polynucleotide markers: CXCL9, CD274, LAG3, in a biological sample of the patient.
In one aspect, the present invention provides a method of treating a solid tumor in a subject, the method comprising administering an anti-PD-Ll antibody, or an antigen binding fragment thereof, to a patient identified as having increased levels of two or more polynucleotide markers selected from the group consisting of CXCL9, CD274, LAG3, and IFNG in a biological sample derived from the patient relative to a reference.
In another aspect, the present invention provides a method of treating lung cancer or bladder cancer in a subject, the method comprising administering an anti-PD-Ll antibody, or an antigen binding fragment thereof, to a patient identified by detecting increased levels of two or more polynucleotide markers selected from the group consisting of CXCL9, CD274, LAG3, and IFNG in a biological sample derived from the patient relative to a reference.
In a further aspect, the present invention provides a method of identifying a subject having a solid tumor that is responsive to an anti-PD-Ll antibody, or an antigen binding fragment thereof, the method comprising detecting an increase in the expression levels of two or more polynucleotide markers selected from the group consisting of CXCL9, CD274, LAG3, and IFNG in a biological sample obtained from the subject relative to a reference, thereby identifying the solid tumor as responsive to anti-PD-Ll therapy.
In an additional aspect, the present invention provides a method of identifying a subject having a solid tumor that is responsive to anti-PD-Ll therapy, the method comprising detecting an increase in the expression levels of two or more polynucleotide markers selected from the group consisting of CXCL9, CD274, LAG3, and IFNG in a biological sample obtained from the subject, relative to a reference, thereby identifying the solid tumor as responsive to anti-PD-Ll therapy.
In another aspect, the present invention provides a method of identifying a subject having a lung cancer or bladder cancer that is responsive to anti-PD-Ll therapy, the method comprising detecting an increase in the expression levels of two or more polynucleotide markers selected from the group consisting of CXCL9, CD274, LAG3, and IFNG in a biological sample obtained from the subject, relative to a reference, thereby identifying the solid tumor as responsive to anti- PD-Ll therapy.
Definitions
Unless defined otherwise, all technical and scientific terms used herein have the meaning commonly understood by a person skilled in the art to which this invention belongs. The following references provide one of skill with a general definition of many of the terms used in this invention: Singleton et al., Dictionary of Microbiology and Molecular Biology (2nd ed. 1994); The Cambridge Dictionary of Science and Technology (Walker ed., 1988); The Glossary of Genetics, 5th Ed., R. Rieger et al. (eds.), Springer Verlag (1991); and Hale & Marham, The Harper Collins Dictionary of Biology (1991). As used herein, the following terms have the meanings ascribed to them below, unless specified otherwise. By "Durvalumab" is meant an antibody or antigen binding fragment thereof that selectively binds a PD-L1 polypeptide and comprises at least a portion of a light chain variable region comprising the amino acid sequence of SEQ ID NO: 1 and/or at least a portion of a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 2.
Information regarding Durvalumab (or antigen-binding fragments thereof) for use in the methods provided herein can be found in US Patent No. 8,779,108, the disclosure of which is incorporated herein by reference in its entirety. The fragment crystallizable (Fc) domain of durvalumab contains a triple mutation in the constant domain of the IgGl heavy chain that reduces binding to the complement component Clq and the Fey receptors responsible for mediating antibody-dependent cell-mediated cytotoxicity (ADCC). Durvalumab is selective for PD-L1 and blocks the binding of PD-L1 to the PD-1 and CD80 receptors. Durvalumab can relieve PD-L1 -mediated suppression of human T-cell activation in vitro and inhibits tumor growth in a xenograft model via a T-cell dependent mechanism.
Durvalumab for use in the methods provided herein comprises a heavy chain and a light chain or a heavy chain variable region and a light chain variable region. In a specific aspect, Durvalumab or an antigen-binding fragment thereof for use in the methods provided herein comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 1 and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 2. In a specific aspect, durvalumab or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises the Kabat-defined CDRl, CDR2, and CDR3 sequences of SEQ ID NOs: 3-5, and wherein the light chain variable region comprises the Kabat- defined CDRl, CDR2, and CDR3 sequences of SEQ ID NOs: 6-8. Those of ordinary skill in the art would easily be able to identify Chothia-defined, Abm-defined or other CDR definitions known to those of ordinary skill in the art. In a specific aspect, Durvalumab or an antigen- binding fragment thereof for use in the methods provided herein comprises the variable heavy chain and variable light chain CDR sequences of the 2.14H90PT antibody as disclosed in US Patent No. 8,779,108, which is herein incorporated by reference in its entirety.
The term "antigen binding fragment" refers to a portion of an intact antibody and/or refers to the antigenic determining variable regions of an intact antibody. It is known that the antigen binding function of an antibody can be performed by fragments of a full-length antibody. Examples of antibody fragments include, but are not limited to, Fab, Fab', F(ab')2, and Fv fragments, linear antibodies, single chain antibodies, diabodies, and multispecific antibodies formed from antibody fragments.
By "Interferon gamma (IFNG) polypeptide" is meant a protein or fragment thereof having at least about 85% amino acid sequence identity to NCBI Accession No. P01579 and having immunomodulatory activity. An exemplary IFNG amino acid sequence (Uniprot Accession No. P01579) is provided as SEQ ID NO: 9.
By "IFNG polynucleotide" is meant a nucleic acid molecule encoding an IFNG protein. The sequence of an exemplary IFNG polynucleotide is provided at NCBI Accession No.
NM_000619, which is reproduced as SEQ ID NO: 10.
By "anti-PD-Ll antibody" is meant an antibody or antigen binding fragment thereof that selectively binds a PD-L1 polypeptide. Exemplary anti-PD-Ll antibodies are described for example at U.S. Patent No. 8,779,108, which is herein incorporated by reference. Durvalumab is an exemplary PD-L1 antibody. Following treatment with Durvalumab, a patient achieves disease control (DC). Disease control can be a complete response (CR), partial response (PR), or stable disease (SD). Sequences of Durvalumab are provided in a sequence listing herein below.
By "PD-L1 polypeptide" is meant a polypeptide or fragment thereof having at least about 85%, 95% or 100% amino acid identity to NCBI Accession No. NP_001254635 (SEQ ID NO: 11) and having PD-1 and CD80 binding activity.
By "PD-L1 nucleic acid molecule" is meant a polynucleotide encoding a PD-L1 polypeptide. An exemplary PD-L1 nucleic acid molecule sequence is provided at NCBI
Accession No. NM_001267706 (SEQ ID NO: 12).
By "C-X-C motif chemokine 9 precursor (CXCL9) polypeptide" is meant a polypeptide or fragment thereof having at least about 85% amino acid sequence identity to NCBI Accession No. NP_002407.1 and having chemokine activity. The sequence of an exemplary CXCL9 polypeptide is provided below.
DEFINITION C-X-C motif chemokine 9 precursor [Homo sapiens] .
ACCESSION NP_002407
1 mkksgvlfll giillvligv qgtp vrkgr cscistnqgt ihlqslkdlk qfapspscek 61 ieiiatlkng vqtclnpdsa dvkelikkwe kqvsqkkkqk ngkkhqkkkv lkvrksqrsr
121 qkktt (SEQ ID NO: 13) By "CXCL9 polynucleotide" is meant a polynucleotide encoding a CXCL9 polypeptide. The sequence of an exemplary CXCL9 polynucleotide (NCBI Accession No. NM_002416.2) is provided below:
1 aaaatgtgtt ctctaaagaa tttctcaggc tcaaaatcca atacaggagt gacttggaac
61 tccattctat cactatgaag aaaagtggtg ttcttttcct cttgggcatc atcttgctgg
121 ttctgattgg agtgcaagga accccagtag tgagaaaggg tcgctgttcc tgcatcagca
181 ccaaccaagg gactatccac ctacaatcct tgaaagacct taaacaattt gccccaagcc
241 cttcctgcga gaaaattgaa atcattgcta cactgaagaa tggagttcaa acatgtctaa
301 acccagattc agcagatgtg aaggaactga ttaaaaagtg ggagaaacag gtcagccaaa
361 agaaaaagca aaagaatggg aaaaaacatc aaaaaaagaa agttctgaaa gttcgaaaat
421 ctcaacgttc tcgtcaaaag aagactacat aagagaccac ttcaccaata agtattctgt
481 gttaaaaatg ttctatttta attataccgc tatcattcca aaggaggatg gcatataata
541 caaaggctta ttaatttgac tagaaaattt aaaacattac tctgaaattg taactaaagt
601 tagaaagttg attttaagaa tccaaacgtt aagaattgtt aaaggctatg attgtctttg
661 ttcttctacc acccaccagt tgaatttcat catgcttaag gccatgattt tagcaatacc
721 catgtctaca cagatgttca cccaaccaca tcccactcac aacagctgcc tggaagagca
781 gccctaggct tccacgtact gcagcctcca gagagtatct gaggcacatg tcagcaagtc
841 ctaagcctgt tagcatgctg gtgagccaag cagtttgaaa ttgagctgga cctcaccaag
901 ctgctgtggc catcaacctc tgtatttgaa tcagcctaca ggcctcacac acaatgtgtc
961 tgagagattc atgctgattg ttattgggta tcaccactgg agatcaccag tgtgtggctt
1021 tcagagcctc ctttctggct ttggaagcca tgtgattcca tcttgcccgc tcaggctgac
1081 cactttattt ctttttgttc ccctttgctt cattcaagtc agctcttctc catcctacca
1141 caatgcagtg cctttcttct ctccagtgca cctgtcatat gctctgattt atctgagtca
1201 actcctttct catcttgtcc ccaacacccc acagaagtgc tttcttctcc caattcatcc
1261 tcactcagtc cagcttagtt caagtcctgc ctcttaaata aacctttttg gacacacaaa
1321 ttatcttaaa actcctgttt cacttggttc agtaccacat gggtgaacac tcaatggtta
1381 actaattctt gggtgtttat cctatctctc caaccagatt gtcagctcct tgagggcaag
1441 agccacagta tatttccctg tttcttccac agtgcctaat aatactgtgg aactaggttt
1501 taataatttt ttaattgatg ttgttatggg caggatggca accagaccat tgtctcagag
1561 caggtgctgg ctctttcctg gctactccat gttggctagc ctctggtaac ctcttactta
1621 ttatcttcag gacactcact acagggacca gggatgatgc aacatccttg tctttttatg
1681 acaggatgtt tgctcagctt ctccaacaat aagaagcacg tggtaaaaca cttgcggata
1741 ttctggactg tttttaaaaa atatacagtt taccgaaaat catataatct tacaatgaaa
1801 aggactttat agatcagcca gtgaccaacc ttttcccaac catacaaaaa ttccttttcc
1861 cgaaggaaaa gggctttctc aataagcctc agctttctaa gatctaacaa gatagccacc
1921 gagatcctta tcgaaactca ttttaggcaa atatgagttt tattgtccgt ttacttgttt
1981 cagagtttgt attgtgatta tcaattacca caccatctcc catgaagaaa gggaacggtg 2041 aagtactaag cgctagagga agcagccaag tcggttagtg gaagcatgat tggtgcccag
2101 ttagcctctg caggatgtgg aaacctcctt ccaggggagg ttcagtgaat tgtgtaggag
2161 aggttgtctg tggccagaat ttaaacctat actcactttc ccaaattgaa tcactgctca
2221 cactgctgat gatttagagt gctgtccggt ggagatccca cccgaacgtc ttatctaatc
2281 atgaaactcc ctagttcctt catgtaactt ccctgaaaaa tctaagtgtt tcataaattt
2341 gagagtctgt gacccactta ccttgcatct cacaggtaga cagtatataa ctaacaacca
2401 aagactacat attgtcactg acacacacgt tataatcatt tatcatatat atacatacat
2461 gcatacactc tcaaagcaaa taatttttca cttcaaaaca gtattgactt gtataccttg
2521 taatttgaaa tattttcttt gttaaaatag aatggtatca ataaatagac cattaatcag
2581 aaaacagatc ttgatttttt ttctcttgaa tgtacccttc aactgttgaa tgtttaatag
2641 taaatcttat atgtccttat ttacttttta gctttctctc aaataaagtg taacactagt
2701 tgagataaaa aaaaaaaaaa aaa (SEQ ID NO: 14)
By "CD274 polypeptide", also known as "PD-Ll polypeptide", is meant a polypeptide or fragment thereof having at least about 85% amino acid sequence identity to GenBank:
EAW58763. The sequence of an exemplary CD274 or PD-Ll polypeptide is provided below:
1 mrifavfifm tywhllnaft vtvpkdly v eygsnmtiec kfpvekqldl aalivyweme 61 dkniiqfvhg eedlkvqhss yrqrarllkd qlslgnaalq itdvklqdag vyrcmisygg 121 adykritvkv napynkinqr il vdpvtse heltcqaegy pkaeviwtss dhqvlsgktt 181 ttnskreekl fnvtstlrin tttneifyct frrldpeenh taelvipelp lahppnerth 241 lvilgaillc lgvaltfifr lrkgrmmdvk kcgiqdtnsk kqsdthleet (SEQ ID NO:
15)
By "CD274 polynucleotide", also known as "PD-Ll polynucleotide", is meant a polynucleotide encoding a CD274 or PD-Ll polypeptide. The sequence of an exemplary CD274 polynucleotide is provided at NCBI Accession No. NM_014143, which is reproduced below:
1 ggcgcaacgc tgagcagctg gcgcgtcccg cgcggcccca gttctgcgca gcttcccgag
61 gctccgcacc agccgcgctt ctgtccgcct gcagggcatt ccagaaagat gaggatattt
121 gctgtcttta tattcatgac ctactggcat ttgctgaacg catttactgt cacggttccc
181 aaggacctat atgtggtaga gtatggtagc aatatgacaa ttgaatgcaa attcccagta
241 gaaaaacaat tagacctggc tgcactaatt gtctattggg aaatggagga taagaacatt
301 attcaatttg tgcatggaga ggaagacctg aaggttcagc atagtagcta cagacagagg
361 gcccggctgt tgaaggacca gctctccctg ggaaatgctg cacttcagat cacagatgtg
421 aaattgcagg atgcaggggt gtaccgctgc atgatcagct atggtggtgc cgactacaag
481 cgaattactg tgaaagtcaa tgccccatac aacaaaatca accaaagaat tttggttgtg
541 gatccagtca cctctgaaca tgaactgaca tgtcaggctg agggctaccc caaggccgaa
601 gtcatctgga caagcagtga ccatcaagtc ctgagtggta agaccaccac caccaattcc 661 aagagagagg agaagctttt caatgtgacc agcacactga gaatcaacac aacaactaat
721 gagattttct actgcacttt taggagatta gatcctgagg aaaaccatac agctgaattg
781 gtcatcccag aactacctct ggcacatcct ccaaatgaaa ggactcactt ggtaattctg
841 ggagccatct tattatgcct tggtgtagca ctgacattca tcttccgttt aagaaaaggg
901 agaatgatgg atgtgaaaaa atgtggcatc caagatacaa actcaaagaa gcaaagtgat
961 acacatttgg aggagacgta atccagcatt ggaacttctg atcttcaagc agggattctc
1021 aacctgtggt ttaggggttc atcggggctg agcgtgacaa gaggaaggaa tgggcccgtg
1081 ggatgcaggc aatgtgggac ttaaaaggcc caagcactga aaatggaacc tggcgaaagc
1141 agaggaggag aatgaagaaa gatggagtca aacagggagc ctggagggag accttgatac
1201 tttcaaatgc ctgaggggct catcgacgcc tgtgacaggg agaaaggata cttctgaaca
1261 aggagcctcc aagcaaatca tccattgctc atcctaggaa gacgggttga gaatccctaa
1321 tttgagggtc agttcctgca gaagtgccct ttgcctccac tcaatgcctc aatttgtttt
1381 ctgcatgact gagagtctca gtgttggaac gggacagtat ttatgtatga gtttttccta
1441 tttattttga gtctgtgagg tcttcttgtc atgtgagtgt ggttgtgaat gatttctttt
1501 gaagatatat tgtagtagat gttacaattt tgtcgccaaa ctaaacttgc tgcttaatga
1561 tttgctcaca tctagtaaaa catggagtat ttgtaaggtg cttggtctcc tctataacta
1621 caagtataca ttggaagcat aaagatcaaa ccgttggttg cataggatgt cacctttatt
1681 taacccatta atactctggt tgacctaatc ttattctcag acctcaagtg tctgtgcagt
1741 atctgttcca tttaaatatc agctttacaa ttatgtggta gcctacacac ataatctcat
1801 ttcatcgctg taaccaccct gttgtgataa ccactattat tttacccatc gtacagctga
1861 ggaagcaaac agattaagta acttgcccaa accagtaaat agcagacctc agactgccac
1921 ccactgtcct tttataatac aatttacagc tatattttac tttaagcaat tcttttattc
1981 aaaaaccatt tattaagtgc ccttgcaata tcaatcgctg tgccaggcat tgaatctaca
2041 gatgtgagca agacaaagta cctgtcctca aggagctcat agtataatga ggagattaac
2101 aagaaaatgt attattacaa tttagtccag tgtcatagca taaggatgat gcgaggggaa
2161 aacccgagca gtgttgccaa gaggaggaaa taggccaatg tggtctggga cggttggata
2221 tacttaaaca tcttaataat cagagtaatt ttcatttaca aagagaggtc ggtacttaaa
2281 ataaccctga aaaataacac tggaattcct tttctagcat tatatttatt cctgatttgc
2341 ctttgccata taatctaatg cttgtttata tagtgtctgg tattgtttaa cagttctgtc
2401 ttttctattt aaatgccact aaattttaaa ttcatacctt tccatgattc aaaattcaaa
2461 agatcccatg ggagatggtt ggaaaatctc cacttcatcc tccaagccat tcaagtttcc
2521 tttccagaag caactgctac tgcctttcat tcatatgttc ttctaaagat agtctacatt
2581 tggaaatgta tgttaaaagc acgtattttt aaaatttttt tcctaaatag taacacattg
2641 tatgtctgct gtgtactttg ctatttttat ttattttagt gtttcttata tagcagatgg
2701 aatgaatttg aagttcccag ggctgaggat ccatgccttc tttgtttcta agttatcttt
2761 cccatagctt ttcattatct ttcatatgat ccagtatatg ttaaatatgt cctacatata
2821 catttagaca accaccattt gttaagtatt tgctctagga cagagtttgg atttgtttat
2881 gtttgctcaa aaggagaccc atgggctctc cagggtgcac tgagtcaatc tagtcctaaa 2941 aagcaatctt attattaact ctgtatgaca gaatcatgtc tggaactttt gttttctgct 3001 ttctgtcaag tataaacttc actttgatgc tgtacttgca aaatcacatt ttctttctgg 3061 aaattccggc agtgtacctt gactgctagc taccctgtgc cagaaaagcc tcattcgttg 3121 tgcttgaacc cttgaatgcc accagctgtc atcactacac agccctccta agaggcttcc 3181 tggaggtttc gagattcaga tgccctggga gatcccagag tttcctttcc ctcttggcca 3241 tattctggtg tcaatgacaa ggagtacctt ggctttgcca catgtcaagg ctgaagaaac 3301 agtgtctcca acagagctcc ttgtgttatc tgtttgtaca tgtgcatttg tacagtaatt 3361 ggtgtgacag tgttctttgt gtgaattaca ggcaagaatt gtggctgagc aaggcacata 3421 gtctactcag tctattccta agtcctaact cctccttgtg gtgttggatt tgtaaggcac 3481 tttatccctt ttgtctcatg tttcatcgta aatggcatag gcagagatga tacctaattc 3541 tgcatttgat tgtcactttt tgtacctgca ttaatttaat aaaatattct tatttatttt 3601 gttacttggt acaccagcat gtccattttc ttgtttattt tgtgtttaat aaaatgttca 3661 gtttaacatc ccagtggaga aagttaaaaa a (SEQ ID NO: 16)
By "Lymphocyte activating 3 (LAG3) polypeptide" is meant a polypeptide or fragment thereof having at least about 85% amino acid sequence identity to NCBI Accession No.
AAH52589 (LAG3 polypeptide). The sequence of an exemplary LAG3 polypeptide is provided below.
DEFINITION LAG3 protein [Homo sapiens] .
ACCESSION AAH52589
1 mweaqflgll flqplwvapv kplqpgaevp vwaqegapa qlpcsptipl qdlsllrrag
61 vtwqhqpdsg ppaaapghpl apgphpaaps swgprprryt vlsvgpgglr sgrlplqprv
121 qldergrqrg dfslwlrpar radageyraa vhlrdralsc rlrlrlgqas mtasppgslr
181 asdwvilncs fsrpdrpasv hwfrnrgqgr vpvresphhh laesflflpq vspmdsgpwg
241 ciltyrdgfn vsimynltvl glepptpltv yagagsrvgl pcrlpagvgt rsfltakwtp
301 pgggpdllvt gdngdftlrl edvsqaqagt ytchihlqeq qlnatvtlai itgqpqvgke
(SEQ ID NO: 17)
By "LAG3 polynucleotide" is meant a polynucleotide encoding a LAG3 polypeptide. The sequence of an exemplary LAG3 polynucleotide is provided at NCBI Accession No.
NM_002286, which is reproduced below:
1 acaggggtga aggcccagag accagcagaa cggcatccca gccacgacgg ccactttgct 61 ctgtctgctc tccgccacgg ccctgctctg ttccctggga cacccccgcc cccacctcct 121 caggctgcct gatctgccca gctttccagc tttcctctgg attccggcct ctggtcatcc 181 ctccccaccc tctctccaag gccctctcct ggtctccctt cttctagaac cccttcctcc 241 acctccctct ctgcagaact tctcctttac cccccacccc ccaccactgc cccctttcct 301 tttctgacct ccttttggag ggctcagcgc tgcccagacc ataggagaga tgtgggaggc 361 tcagttcctg ggcttgctgt ttctgcagcc gctttgggtg gctccagtga agcctctcca 421 gccaggggct gaggtcccgg tggtgtgggc ccaggagggg gctcctgccc agctcccctg
481 cagccccaca atccccctcc aggatctcag ccttctgcga agagcagggg tcacttggca
541 gcatcagcca gacagtggcc cgcccgctgc cgcccccggc catcccctgg cccccggccc
601 tcacccggcg gcgccctcct cctgggggcc caggccccgc cgctacacgg tgctgagcgt
661 gggtcccgga ggcctgcgca gcgggaggct gcccctgcag ccccgcgtcc agctggatga
721 gcgcggccgg cagcgcgggg acttctcgct atggctgcgc ccagcccggc gcgcggacgc
781 cggcgagtac cgcgccgcgg tgcacctcag ggaccgcgcc ctctcctgcc gcctccgtct
841 gcgcctgggc caggcctcga tgactgccag ccccccagga tctctcagag cctccgactg
901 ggtcattttg aactgctcct tcagccgccc tgaccgccca gcctctgtgc attggttccg
961 gaaccggggc cagggccgag tccctgtccg ggagtccccc catcaccact tagcggaaag
1021 cttcctcttc ctgccccaag tcagccccat ggactctggg ccctggggct gcatcctcac
1081 ctacagagat ggcttcaacg tctccatcat gtataacctc actgttctgg gtctggagcc
1141 cccaactccc ttgacagtgt acgctggagc aggttccagg gtggggctgc cctgccgcct
1201 gcctgctggt gtggggaccc ggtctttcct cactgccaag tggactcctc ctgggggagg
1261 ccctgacctc ctggtgactg gagacaatgg cgactttacc cttcgactag aggatgtgag
1321 ccaggcccag gctgggacct acacctgcca tatccatctg caggaacagc agctcaatgc
1381 cactgtcaca ttggcaatca tcacagtgac tcccaaatcc tttgggtcac ctggatccct
1441 ggggaagctg ctttgtgagg tgactccagt atctggacaa gaacgctttg tgtggagctc
1501 tctggacacc ccatcccaga ggagtttctc aggaccttgg ctggaggcac aggaggccca
1561 gctcctttcc cagccttggc aatgccagct gtaccagggg gagaggcttc ttggagcagc
1621 agtgtacttc acagagctgt ctagcccagg tgcccaacgc tctgggagag ccccaggtgc
1681 cctcccagca ggccacctcc tgctgtttct catccttggt gtcctttctc tgctcctttt
1741 ggtgactgga gcctttggct ttcacctttg gagaagacag tggcgaccaa gacgattttc
1801 tgccttagag caagggattc accctccgca ggctcagagc aagatagagg agctggagca
1861 agaaccggag ccggagccgg agccggaacc ggagcccgag cccgagcccg agccggagca
1921 gctctgacct ggagctgagg cagccagcag atctcagcag cccagtccaa ataaactccc 1981 tgtcagcagc aaaaa (SEQ ID NO: 18)
The term "antibody," as used in this disclosure, refers to an immunoglobulin or a fragment or a derivative thereof, and encompasses any polypeptide comprising an antigen- binding site, regardless whether it is produced in vitro or in vivo. The term includes, but is not limited to, polyclonal, monoclonal, monospecific, polyspecific, non-specific, humanized, single- chain, chimeric, synthetic, recombinant, hybrid, mutated, and grafted antibodies. Unless otherwise modified by the term "intact," as in "intact antibodies," for the purposes of this disclosure, the term "antibody" also includes antibody fragments such as Fab, F(ab')2, Fv, scFv, Fd, dAb, and other antibody fragments that retain antigen-binding function, i.e., the ability to bind PD-Ll specifically. Typically, such fragments would comprise an antigen-binding domain. The terms "antigen-binding domain," "antigen-binding fragment," and "binding fragment" refer to a part of an antibody molecule that comprises amino acids responsible for the specific binding between the antibody and the antigen. In instances, where an antigen is large, the antigen-binding domain may only bind to a part of the antigen. A portion of the antigen molecule that is responsible for specific interactions with the antigen-binding domain is referred to as "epitope" or "antigenic determinant." An antigen-binding domain typically comprises an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH), however, it does not necessarily have to comprise both. For example, a so-called Fd antibody fragment consists only of a VH domain, but still retains some antigen-binding function of the intact antibody.
Binding fragments of an antibody are produced by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact antibodies. Binding fragments include Fab, Fab', F(ab')2, Fv, and single-chain antibodies. An antibody other than a "bispecific" or "bifunctional" antibody is understood to have each of its binding sites identical. Digestion of antibodies with the enzyme, papain, results in two identical antigen-binding fragments, known also as "Fab" fragments, and a "Fc" fragment, having no antigen-binding activity but having the ability to crystallize. Digestion of antibodies with the enzyme, pepsin, results in an F(ab')2 fragment in which the two arms of the antibody molecule remain linked and comprise two-antigen binding sites. The F(ab')2 fragment has the ability to crosslink antigen. "Fv" when used herein refers to the minimum fragment of an antibody that retains both antigen-recognition and antigen-binding sites. "Fab" when used herein refers to a fragment of an antibody that comprises the constant domain of the light chain and the CHI domain of the heavy chain.
The term "mAb" refers to monoclonal antibody. Antibodies of the invention comprise without limitation whole native antibodies, bispecific antibodies; chimeric antibodies; Fab, Fab', single chain V region fragments (scFv), fusion polypeptides, and unconventional antibodies.
By "biologic sample" is meant any tissue, cell, fluid, or other material derived from an organism. In one embodiment, a biological sample is a tumor biopsy sample.
A "biomarker" or "marker" as used herein generally refers to a protein, nucleic acid molecule, clinical indicator, or other analyte that is associated with a disease. In one
embodiment, a marker is differentially present in a biological sample obtained from a subject having a disease (e.g., lung cancer) relative to the level present in a control sample or reference. In this disclosure, "comprises," "comprising," "containing" and "having" and the like can have the meaning ascribed to them in U.S. Patent law and can mean "includes," "including," and the like; "consisting essentially of" or "consists essentially" likewise has the meaning ascribed in U.S. Patent law and the term is open-ended, allowing for the presence of more than that which is recited so long as basic or novel characteristics of that which is recited is not changed by the presence of more than that which is recited, but excludes prior art embodiments.
"Detect" refers to identifying the presence, absence or amount of the analyte to be detected.
By "disease" is meant any condition or disorder that damages or interferes with the normal function of a cell, tissue, or organ.
Lung cancer includes small cell lung cancer (SCLC) and non-small cell lung cancer (NSCLC). There are three main subtypes of NSCLC: squamous cell carcinoma,
adenocarcinoma, and large cell (undifferentiated) carcinoma. Other subtypes include
adenosquamous carcinoma and sarcomatoid carcinoma.
The terms "isolated," "purified," or "biologically pure" refer to material that is free to varying degrees from components which normally accompany it as found in its native state. "Isolate" denotes a degree of separation from original source or surroundings. "Purify" denotes a degree of separation that is higher than isolation. A "purified" or "biologically pure" protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid chromatography. The term "purified" can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. For a protein that can be subjected to modifications, for example, phosphorylation or glycosylation, different
modifications may give rise to different isolated proteins, which can be separately purified.
By "reference" is meant a standard of comparison. In one embodiment, the level of interferon gamma present in a sample from a patient that is partially responsive to a therapy of the invention is compared to the level present in a corresponding sample obtained from a patient having progressive disease.
By "responsive" in the context of therapy is meant susceptible to treatment.
By "specifically binds" is meant a compound (e.g., antibody) that recognizes and binds a molecule (e.g., polypeptide), but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample. For example, two molecules that specifically bind form a complex that is relatively stable under physiologic conditions. Specific binding is characterized by a high affinity and a low to moderate capacity as distinguished from nonspecific binding which usually has a low affinity with a moderate to high capacity. Typically, binding is considered specific when the affinity constant KA IS higher than 106 M_1, or more preferably higher than 10s M-1. If necessary, non-specific binding can be reduced without substantially affecting specific binding by varying the binding conditions. The appropriate binding conditions such as concentration of antibodies, ionic strength of the solution,
temperature, time allowed for binding, concentration of a blocking agent (e.g., serum albumin, milk casein), etc., may be optimized by a skilled artisan using routine techniques.
By "subject" is meant a mammal, including, but not limited to, a human or non-human mammal, such as a bovine, equine, canine, ovine, or feline.
Ranges provided herein are understood to be shorthand for all of the values within the range. For example, a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.
As used herein, the terms "treat," treating," "treatment," and the like refer to reducing or ameliorating a disorder and/or symptoms associated therewith. It will be appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition or symptoms associated therewith be completely eliminated.
Unless specifically stated or obvious from context, as used herein, the term "or" is understood to be inclusive. Unless specifically stated or obvious from context, as used herein, the terms "a", "an", and "the" are understood to be singular or plural.
Unless specifically stated or obvious from context, as used herein, the term "about" is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from context, all numerical values provided herein are modified by the term about. Any compositions or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein.
BRIEF DESCRIPTION OF THE DRAWINGS
Figures 1A-D are Kaplan-Meier plots of Overall Response (OS) for CXCL9, IFNG, LAG3, and CD274 (PD-Ll), respectively, in NSCLC patients. Each plot is cut into high (dashed line) or low (solid line) expression using the receiver operator characteristic (ROC)-identified cut points.
Figures 1E-H are Kaplan-Meier plots of progression-free response (PFS) for CXCL9, IFNG, LAG3, and CD274 (PD-Ll) in NSCLC patients. Each plot is cut into high (dashed line) or low (solid line) expression using the ROC-identified cut points.
Figure 2 provides correlation scatter plots of the four genes CXCL9, IFNG, LAG3, and CD274 (Spearman's coefficient) in non-small cell lung cancer (NSCLC).
Figure 3A is a Kaplan-Meier plot of Overall Response (OS) for the four genes CXCL9, IFNG, LAG3, and CD274 signature in NSCLC patients. Each plot is cut into high (dashed line) or low (solid line) expression using the ROC-identified cut point.
Figure 3B is a Kaplan-Meier plot of progression-free response (PFS) for the four genes CXCL9, IFNG, LAG3, and CD274 signature in NSCLC patients. Each plot is cut into high (dashed line) or low (solid line) expression using the ROC-identified cut point.
Figure 4 shows the on-treatment effects by durvalumab for gene signature in NSCLC before and after dosing.
Figure 5A shows the progression-free response of the four gene signature in bladder cancer patients. Each plot is cut into high (dashed line) or low (solid line) expression using the upper tertile cut point.
Figure 5B shows the progression-free response of IFNG gene signature in bladder cancer patients. Each plot is cut into high (dashed line) or low (solid line) expression using the upper tertile cut point. DETAILED DESCRIPTION OF THE INVENTION
The present invention provides methods for selecting patients as having a solid tumor (e.g., bladder cancer, ovarian cancer, colorectal cancer, head and neck cancer, cervical cancer, renal cell carcinoma, and non-small cell lung cancer (NSCLC)) that is responsive to treatment with an anti-PD-Ll antibody, and methods of treating such patients. The method involves detecting expression of an IFNG polynucleotide and/or or more polynucleotide markers:
CXCL9, CD274, LAG3, in a biological sample of the patient.
The invention is based, at least in part, on the discovery that patients having lung cancer (e.g., non-squamous cell or squamous cell non-small cell lung cancer) or bladder cancer that is responsive to treatment with an anti-PD-Ll antibody may be identified by detecting increased levels of CXCL9, CD274, LAG3, and IFNG mRNA in a tumor or blood sample of a subject. In some embodiments, the patients may be identified by detecting increased levels of one or more of CXCL9, CD274, LAG3, and IFNG mRNA in a tumor or blood sample of the patient. In some embodiments, the patient is identified by detecting increased levels of the combination of CXCL9, CD274, LAG3, and IFNG mRNA in a tumor or blood sample of the patient.
Accordingly, the invention provides methods for identifying subjects that have a solid tumor (e.g., breast, colon, colorectal, lung, renal, including renal cell carcinoma, gastric, bladder, non-small cell lung cancer (NSCLC), hepatocellular cancer (HCC), pancreatic cancer, melanoma) that is likely to respond to anti-PD-Ll antibody treatment based on an increase in the level of one or more of CXCL9, CD274, LAG3, and IFNG mRNA in a subject tumor or blood sample. In some embodiments, the invention provides methods for identifying subjects that have lung cancer or bladder cancer that is likely to respond to anti-PD-Ll antibody treatment based on an increase in the level of the combination of CXCL9, CD274, LAG3, and IFNG mRNAs in a subject tumor or blood sample.
Aspects of the present invention provide methods for treating lung cancer (e.g., non- squamous cell or squamous cell non- small cell lung cancer) with an anti-PD-Ll antibody in a patient identified by detecting an increase in the level of one or more of CXCL9, CD274, LAG3, and IFNG polynucleotides in a tumor or blood sample of the patient. In some embodiments, the patient is identified by detecting an increase in the levels of a combination of CXCL9, CD274, LAG3, and IFNG polynucleotides in a tumor or blood sample of the patient. Aspects of the present invention provide methods for treating bladder cancer with an anti- PD-L1 antibody in a patient identified by detecting an increase in the level of one or more of CXCL9, CD274, LAG3, and IFNG polynucleotides in a tumor or blood sample of the patient. In some embodiments, the patient is identified by detecting an increase in the levels of a
combination of CXCL9, CD274, LAG3, and IFNG polynucleotides in a tumor or blood sample of the patient.
B7-H1/CD274/PD-L1
B7-H1, also known as CD274 and PD-L1, is a type I transmembrane protein of approximately 53kDa in size. In humans B7-H1 is expressed on a number of immune cell types including activated and anergic/exhausted T cells, on naive and activated B cells, as well as on myeloid dendritic cells (DC), monocytes and mast cells. It is also expressed on non-immune cells including islets of the pancreas, Kupffer cells of the liver, vascular endothelium and selected epithelia, for example airway epithelia and renal tubule epithelia, where its expression is enhanced during inflammatory episodes. B7-H1 expression is also found at increased levels on a number of tumors including, but not limited to breast, colon, colorectal, lung, renal, including renal cell carcinoma, gastric, bladder, non-small cell lung cancer (NSCLC), hepatocellular cancer (HCC), and pancreatic cancer, as well as melanoma.
B7-H1 is known to bind two alternative ligands, the first of these, PD-1, is a 50-55 kDa type I transmembrane receptor that was originally identified in a T cell line undergoing activation-induced apoptosis. PD-1 is expressed on activated T cells, B cells, and monocytes, as well as other cells of the immune system and binds both B7-H1 (PD-L1) and the related B7-DC (PD-L2). The second is the B7 family member B7-1, which is expressed on activated T cells, B cells, monocytes and antigen presenting cells.
Signaling via the PD-1/B7-H1 axis is believed to serve important, non-redundant functions within the immune system, by negatively regulating T cell responses. B7-H1 expression on tumor cells is believed to aid tumors in evading detection and elimination by the immune system. B7-H1 functions in this respect via several alternative mechanisms including driving exhaustion and anergy of tumor infiltrating T lymphocytes, stimulating secretion of immune repressive cytokines into the tumor micro-environment, stimulating repressive regulatory T cell function and protecting B7-H1 expressing tumor cells from lysis by tumor cell specific cytotoxic T cells.
Anti-PD-Ll Antibodies
Antibodies that specifically bind and inhibit PD-Ll activity (e.g., binding to PD-1 and/or
CD80) are useful for the treatment of lung cancer (e.g., non-small cell lung cancer). Durvalumab is an exemplary anti-PD-Ll antibody that is selective for B7-H1 and blocks the binding of B7- Hl to the PD-1 and CD80 receptors. Durvalumab can relieve B7-H1 -mediated suppression of human T-cell activation in vitro and inhibits tumor growth in a xenograft model via a T-cell dependent mechanism. Other agents that could be used include agents that inhibit PD-Ll and/or PD-1 (AB or other).
Information regarding Durvalumab (or fragments thereof) for use in the methods provided herein can be found in U.S. Patent No. 8,779,108, the disclosure of which is incorporated herein by reference in its entirety. The fragment crystallizable (Fc) domain of durvalumab contains a triple mutation in the constant domain of the IgGl heavy chain that reduces binding to the complement component Clq and the Fey receptors responsible for mediating antibody-dependent cell-mediated cytotoxicity (ADCC).
Durvalumab and antigen-binding fragments thereof for use in the methods provided herein comprises a heavy chain and a light chain or a heavy chain variable region and a light chain variable region. In a specific aspect, Durvalumab or an antigen-binding fragment thereof for use in the methods provided herein comprises a light chain variable region comprising the amino acid sequence of SEQ ID NO: 1 and a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 2. In a specific aspect, Durvalumab or an antigen-binding fragment thereof for use in the methods provided herein comprises a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region comprises the Kabat- defined CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 3-5, and wherein the light chain variable region comprises the Kabat-defined CDR1, CDR2, and CDR3 sequences of SEQ ID NOs: 6-8. Those of ordinary skill in the art would easily be able to identify Chothia-defined, Abm-defined or other CDR definitions known to those of ordinary skill in the art. In a specific aspect, Durvalumab or an antigen-binding fragment thereof for use in the methods provided herein comprises the variable heavy chain and variable light chain CDR sequences of the 2.14H90PT antibody as disclosed in U.S. Patent No. 8,779, 108, which is herein incorporated by reference in its entirety.
Characterizing Responsiveness to Anti-PD-Ll Antibody
In characterizing the responsiveness of a solid tumor (e.g., breast, colon, colorectal, lung, renal, including renal cell carcinoma, gastric, bladder, non-small cell lung cancer (NSCLC), hepatocellular cancer (HCC), pancreatic cancer, melanoma) to anti-PD-Ll antibody treatment, the level of expression of one or more of CXCL9, CD274, LAG3 and IFNG polynucleotides is measured in different types of biologic samples (e.g., tumor, blood, and/or lymph node samples).
In some embodiments, the polynucleotide expression of one or more of polynucleotide markers CXCL9, CD274, LAG3 and IFNG is higher in a tumor or blood sample obtained from a subject that is responsive to anti-PD-Ll antibody than the level of expression in a non-responsive subject (e.g., a subject with progressive disease). In one embodiment, levels of polynucleotide markers IFNG and CXCL9 are measured. In one embodiment, levels of polynucleotide markers IFNG and CD274 are measured. In one embodiment, levels of polynucleotide markers IFNG and LAG3 are measured. In one embodiment, levels of polynucleotide markers IFNG, CXCL9, and either LAG3 or CD274 are measured. In one embodiment, an alteration in expression is calculated using cycle threshold (Ct) values. For example, the Ct value of an IFNG gene is obtained and from that value the Ct value of a reference gene (e.g., B2M, ACTB, GAPDH) is subtracted from the mean Ct value for each gene to obtain a Delta-Ct value. The final gene expression score is defined as (20 - ACt). In other embodiments, expression of a marker of the invention is increased by at least about 2, 3, 4, 5 or 10-fold in a responsive patient relative to the level in a non-responsive subject (e.g., a subject with progressive disease). CXCL9, CD274, LAG3 and IFNG polynucleotide fold change values are determined using any method known in the art, including but not limited to quantitative PCR, RT-PCR, Northern blotting, in situ hybridization, fluorescence in situ hybridization (FISH), microarray, and/or RN A- sequencing.
Selection of a Treatment Method
Subjects suffering a solid tumor (e.g., breast, colon, colorectal, lung, renal, including renal cell carcinoma, gastric, bladder, non-small cell lung cancer (NSCLC), hepatocellular cancer (HCC), pancreatic cancer, melanoma) may be tested for one or more of CXCL9, CD274, LAG3 and IFNG polynucleotide expression in the course of selecting a treatment method.
Patients characterized as having high expression (e.g., as defined by Ct score) or increased expression relative to a reference level are identified as responsive to anti-PD-Ll treatment. Treatment with an Anti-PD-Ll Antibody
Patients identified as having tumors or blood samples that express one or more of CXCL9, CD274, LAG3 and IFNG polynucleotides particularly at high levels, are likely to be responsive to anti-PD-Ll antibody therapy. Such patients are administered an anti-PD-Ll antibody, such as Durvalumab, or an antigen-binding fragment thereof. In some embodiments, the anti-PD-Ll antibody, such as Durvalumab, or an antigen-binding fragment thereof can be administered only once or infrequently while still providing benefit to the patient. In further aspects the patient is administered additional follow-on doses. Follow-on doses can be administered at various time intervals depending on the patient's age, weight, clinical assessment, tumor burden, and/or other factors, including the judgment of the attending physician.
In some embodiments, at least two doses of Durvalumab, or an antigen-binding fragment thereof, are administered to the patient. In some embodiments, at least three doses, at least four doses, at least five doses, at least six doses, at least seven doses, at least eight doses, at least nine doses, at least ten doses, or at least fifteen doses or more can be administered to the patient. In some embodiments, Durvalumab or an antigen-binding fragment thereof is administered over a two-week treatment period, over a four-week treatment period, over a six-week treatment period, over an eight-week treatment period, over a twelve-week treatment period, over a twenty-four- week treatment period, or over a one-year or more treatment period. In some embodiments, Durvalumab or an antigen-binding fragment thereof is administered over a three-week treatment period, a six-week treatment period, over a nine-week treatment period, over a twelve-week treatment period, over a twenty-four-week treatment period, or over a one-year or more treatment period. In some embodiments, Durvalumab or an antigen-binding fragment thereof is administered over a two-month treatment period, over a four-month treatment period, or over a six-month or more treatment period (e.g., during a maintenance phase).
The amount of Durvalumab, or an antigen-binding fragment thereof, to be administered to the patient will depend on various parameters, such as the patient's age, weight, clinical assessment, tumor burden and/or other factors, including the judgment of the attending physician.
In certain aspects, administration of Durvalumab, or an antigen-binding fragment thereof, according to the methods provided herein is through parenteral administration. For example, Durvalumab or an antigen-binding fragment thereof, can be administered by intravenous infusion or by subcutaneous injection. In some embodiments, the administration is by intravenous infusion.
The methods provided herein can decrease tumor size, retard tumor growth or maintain a steady state. In certain aspects the reduction in tumor size can be significant based on appropriate statistical analyses. A reduction in tumor size can be measured by comparison to the size of patient's tumor at baseline, against an expected tumor size, against an expected tumor size based on a large patient population, or against the tumor size of a control population. In certain aspects provided herein, the administration of Durvalumab can reduce a tumor size by at least 25%. In certain aspects provided herein, the administration of Durvalumab can reduce a tumor size by at least 25% within about 6 weeks of the first treatment. In certain aspects provided herein, the administration of Durvalumab can reduce a tumor size by at least 50%. In certain aspects provided herein, the administration of Durvalumab can reduce a tumor size by at least 50% within about 10 weeks of the first treatment. In certain aspects provided herein, the administration of Durvalumab can reduce a tumor size by at least 75%. In certain aspects provided herein, the administration of Durvalumab can reduce a tumor size by at least 75% within about 10 weeks of the first treatment.
In certain aspects, use of the methods provided herein, i.e., administration of
Durvalumab, or an antigen-binding fragment thereof, can decrease tumor size within 6 weeks, within 7 weeks, within 8 weeks, within 9 weeks, within 10 weeks, within 12 weeks, within 16 weeks, within 20 weeks, within 24 weeks, within 28 weeks, within 32 weeks, within 36 weeks, within 40 weeks, within 44 weeks, within 48 weeks, or within 52 weeks of the first treatment.
The methods provided herein can decrease or retard tumor growth. In some aspects the reduction or retardation can be statistically significant. A reduction in tumor growth can be measured by comparison to the growth of patient's tumor at baseline, against an expected tumor growth, against an expected tumor growth based on a large patient population, or against the tumor growth of a control population. In certain aspects, a patient achieves disease control (DC). Disease control can be a complete response (CR), partial response (PR), or stable disease (SD).
A "complete response" (CR) refers to the disappearance of all lesions, whether measurable or not, and no new lesions. Confirmation can be obtained using a repeat, consecutive assessment no less than four weeks from the date of first documentation. New, non-measurable lesions preclude CR.
A "partial response" (PR) refers to a decrease in tumor burden > 50% relative to baseline. Confirmation can be obtained using a consecutive repeat assessment at least 4 weeks from the date of first documentation
"Progressive disease" (PD) refers to an increase in tumor burden > 25% relative to the minimum recorded (nadir). Confirmation can be obtained by a consecutive repeat assessment at least 4 weeks from the date of first documentation. New, non-measurable lesions do not define PD.
"Stable disease" (SD) refers to not meeting the criteria for CR, PR, or PD.
In certain aspects, administration of Durvalumab or an antigen-binding fragment thereof can increase progression-free survival (PFS).
In certain aspects, administration of Durvalumab or an antigen-binding fragment thereof can increase overall survival (OS).
As provided herein, Durvalumab or an antigen-binding fragment thereof can also decrease free B7-H1 levels. Free B7-H1 refers to B7-H1 that is not bound (e.g., by
Durvalumab). In some embodiments, B7-H1 levels are reduced by at least 80%. In some embodiments, B7-H1 levels are reduced by at least 90%. In some embodiments, B7-H1 levels are reduced by at least 95%. In some embodiments, B7-H1 levels are reduced by at least 99%. In some embodiments, B7-H1 levels are eliminated following administration of Durvalumab or an antigen-binding fragment thereof. In some embodiments, administration of Durvalumab or an antigen-binding fragment thereof reduces the rate of increase of B7-H1 levels as compared, e.g., to the rate of increase of B7-H1 levels prior to the administration of Durvalumab or an antigen- binding fragment thereof. Kits
The invention provides kits for characterizing the responsiveness of a subject to anti-PD- Ll antibody treatment. In one embodiment, the kit includes a therapeutic composition containing an effective amount of an antibody that specifically binds a PD-Ll polypeptide in unit dosage form.
A diagnostic kit of the invention provides a reagent (e.g., TaqMan primers/ probes for one or more of CXCL9, CD274, LAG3 and IFNG polynucleotide and housekeeping reference genes) for measuring relative expression of CXCL9, CD274, LAG3 and IFNG polynucleotides.
In some embodiments, the kit comprises a sterile container which contains a therapeutic and/or diagnostic composition; such containers can be boxes, ampoules, bottles, vials, tubes, bags, pouches, blister-packs, or other suitable container forms known in the art. Such containers can be made of plastic, glass, laminated paper, metal foil, or other materials suitable for holding medicaments.
In one embodiment, a kit of the invention comprises reagents for measuring
polynucleotide expression of one or more of CXCL9, CD274, LAG3 and IFNG and a therapeutic anti-PD-Ll antibody. If desired, the kit further comprises instructions for measuring
polynucleotide expression of one or more of CXCL9, CD274, LAG3 and IFNG and/or instructions for administering the anti-PD-Ll antibody to a subject having a solid tumor, lung cancer (e.g., squamous cell or non-squamous cell carcinoma non-small cell lung cancer) or bladder cancer selected as responsive to anti-PD-Ll antibody treatment. In particular
embodiments, the instructions include at least one of the following: description of the therapeutic agent; dosage schedule and administration for treatment or prevention of a solid tumor, bladder cancer or lung cancer (e.g., non-small cell lung cancer, small cell lung cancer) or symptoms thereof; precautions; warnings; indications; counter- indications; over dosage information;
adverse reactions; animal pharmacology; clinical studies; and/or references. The instructions may be printed directly on the container (when present), or as a label applied to the container, or as a separate sheet, pamphlet, card, or folder supplied in or with the container.
The practice of the present invention employs, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry and immunology, which are well within the purview of the skilled artisan. Such techniques are explained fully in the literature, such as, "Molecular Cloning: A Laboratory Manual", second edition (Sambrook, 1989); "Oligonucleotide Synthesis" (Gait, 1984); "Animal Cell Culture" (Freshney, 1987); "Methods in Enzymology" "Handbook of Experimental
Immunology" (Weir, 1996); "Gene Transfer Vectors for Mammalian Cells" (Miller and Calos, 1987); "Current Protocols in Molecular Biology" (Ausubel, 1987); "PCR: The Polymerase Chain Reaction", (Mullis, 1994); "Current Protocols in Immunology" (Coligan, 1991). These techniques are applicable to the production of the polynucleotides and polypeptides of the invention, and, as such, may be considered in making and practicing the invention. Particularly useful techniques for particular embodiments will be discussed in the sections that follow.
The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the assay, screening, and therapeutic methods of the invention, and are not intended to limit the scope of what the inventors regard as their invention.
EXAMPLES
Example 1: CXCL9, CD274, LAG3 and IFNG correlate with the objective response rate (ORR) in NSCLC
The safety and clinical activity of durvalumab on advanced solid tumors was assessed. RNA sequencing data was generated on patient tumors with available clinical data, where 30 had pre/post NSCLC patient tumor pair as well as 30 bladder patient tumors pre-treatment with available clinical data and subjected to bioinformatics analysis. The following genes were evaluated: CXCL9, PD-Ll (CD274), LAG-3, IFNG, PD-1 (PDCDl), NKG7, CD8A, SLAMF7, PD-L2 (PDCD1LG2), TIM-3 (HAVCR2), CD80, CD86, CTLA-4, CD2, TLR8, GZMK,
TNFRSF4, FOXP3, CD276, B7-H4 (VTCN1), and CD37.
Among the 21 candidate genes evaluated, each was cut into low or high groups using receiver operator characteristic (ROC) calculations with area under the curve (AUC), logistic regression, time-to-event analysis such as Kaplan-Meiers and Cox proportional hazards (PH) models, paired Student's t-tests for pre/post comparisons, and correlation analysis using a Spearman's rank coefficient.
The 21 candidate genes were subsequently correlated with objective response rate (ORR), both without and with adjustment for age, gender, previous therapy lines, smoking status and histology (squamous or non-squamous). Results are presented in Tables 1 and 2, where the top 4 genes in each (ranked by area under the curve (AUC) or p-value) include CXCL9, CD274,
LAG3, and IFNG.
Table 1. ROC analysis results for candidate 21 genes correlating with ORR in NSCLC pre treatment
Table 2. Linear model analysis results for candidate 21 genes correlating with ORR in NSCLC treatment adjusting for age, gender, previous treatment lines, histology, and smoking status
Example 2: CXCL9, CD274, LAG3 and IFNG are correlated with the overall response (OS) or progression-free response (PFS) in NSCLC The same cut points for each of the top four genes identified from the ORR analysis (CXCL9, CD274, LAG3 and IFNG) were used to partition the patients into high or low expressing groups. Then Kaplan Meier estimator (KM) analysis was conducted using overall response (OS) or progression-free response (PFS) as an endpoint for each gene individually (Figures 1A-H). Figures 1A-D show the overall response plots for CXCL9, IFNG, LAG3, and CD274 (PDLl) in NSCLC patients. Each plot is cut into high or low expression using the ROC- identified cut points. Figures 1E-H show the progression free survival plots for CXCL9, IFNG, LAG3, and CD274 (PDLl) in NSCLC patients. Each plot is cut into high or low expression using the ROC -identified cut points.
Using a log-rank test, all four genes showed a statistical difference between high expressing and low expressing groups associating with outcome at an alpha=0.05. The y-axis indicates the outcome, which is probability of either overall (Figures 1A-1D) or progression - free (Figures 1E-1H) survival and the x-axis indicates days. NSCLC Patients are stratified into high or low groups using the upper tertile of expression.
Example 3: CD274 (PDLl) showed no significant induction post treatment
Each of the four genes (CXCL9, CD274, LAG3 and IFNG) was evaluated for significant induction post treatment with durvalumab. A paired t-test was calculated between the post and pre- treatment time points for each gene individually. Results are reported in Table 3. Only CD274 (PDLl) showed no significant induction post treatment at an alpha=0.05. These results indicate that three of four genes are induced by durvalumab in the tumor, suggesting immune activation of relevant immune-specific genes caused by treatment of this molecule.
Table 3. On-treatment effects by durvalumab for four genes in NSCLC
Example 4: IFNG and CXCL9 showed the highest correlation Pretreatment levels of each of the four genes, CXCL9, CD274, LAG3 and IFNG, were correlated with each other to show shared information.
Figure 2 shows Correlation scatter plot of four genes (Spearman's coefficient) in NSCLC. The Spearman's coefficient is a nonparametric measure of statistical dependence between two variables. As evident in Figure 2, the highest correlated genes were IFNG and CXCL9 (r=0.717), which is biologically relevant as IFNG induced the chemokine CXCL9, thus one expects these two genes to be most correlated. Each x and y axis for a plot indicates the specific gene regressed against one of the four other genes. Each data point is a NSCLC patient tumor sample at baseline.
Example 5: A composite signature from the four genes CXCL9, CD274, LAG3 and IFNG in NSCLC
A gene signature was calculated using the median expression of the four genes CXCL9, CD274, LAG3 and IFNG and the previous analyses were repeated using this signature as a predictor of objective response rate (ORR) and overall response/progression free survival.
Results are shown in Tables 4 and 5 and Figure 3. The gene signature is shown to be highly correlated with both objective response as well as overall (Figure 3A) and progression- free (Figure 3B) survival in NSCLC. In the survival figure, the y-axis indicates probability of overall survival while the x-axis indicates time in days. The dashed line indicates patients with expression of the gene signature at the upper tertile of expression.
Table 4. ROC analysis results for gene signature correlating with ORR in NSCLC pre treatment
Table 5. Linear model analysis results gene signature correlating with ORR in NSCLC pretreatment adjusting for age, gender, previous treatment lines, histology, and smoking status The on-treatment effects by durvalumab are illustrated in Figure 4. There is an increase in expression of the gene signature post durvalumab treatment, which indicates immune activation with treatment in NSCLC patients. Example 6: Correlation of the gene signature with objective response rate (ORR) in bladder cancer
The four gene signature was cut into low or high groups using the upper tertile of expression (top 33%) and subsequently correlated with objective response rate. Due to the small sample size, the adjusted model was not calculated. Results for all comers, IFNG alone, and the four gene signature are presented in Table 6. The enrichment of responders is apparent in both the IFNG group and the gene signature positive group in bladder cancer patients treated with durvalumab, as was demonstrated in the NSCLC patient cohort.
Table 6. Correlation results for all comers, 4-gene signature, and IFNG with ORR in bladder cancer pre treatment
Example 7: Correlation of gene signature and IFNG with progression free survival in bladder cancer
The four gene signature was used to partition the patients into high or low expressing groups at the upper tertile of expression. Then Kaplan-Meier analysis was conducted using progression-free survival with the gene signature (Figure 5A) or the IFNG mRNA (Figure 5B) in bladder cancer patients. There was a higher correlation between the gene signature high patients and overall or progression-free survival as compared to IFNG high patients, suggesting that bladder cancer patients with high gene signature may have improved survival when treated with durvalumab, compared to only those with high IFNG mRNA. OS data was not mature, indicating that the follow up time for certain patients had not reached a mature time point to allow comparisons. Using a log-rank test, all gene signature showed a statistical difference between high and low groups at an alpha=0.05.
The results were obtained using the following materials and methods
RNA extraction and RNA-sequencing
Tissues were homogenized in 600 μΐ RLT lysis buffer (Qiagen, Valencia, CA) supplemented with β-mercaptoethanol (β-me) using PowerGen 500 cryogenic homogenizer (Fisher Scientific, Pittsburgh, PA). Homogenized tissue lysates were centrifuged for 3 min at 13,000 x g at room temperature to remove insoluble tissue debris. The supernatant was transferred into a fresh microcentrifuge tube and 1 volume of 100% ethanol was added to the supernatant. The supernatant-ethanol mixture was applied to a Zymo-Spin IC column (Zymo Research, Irvine, CA) for the binding of RNA. On-column DNase digestion was performed with RNase-free DNase I (Qiagen, Valencia, CA) for 15 min at room temperature. RNA was eluted in 15 - 20 μΐ RNase-free water, and the quantity and quality of RNA samples were determined using Nanodrop-1000 Spectrophotometer (Thermo Fisher Scientific, Waltham MA) and 2100 Bioanalyzer (Agilent Technologies, Santa Clara, CA).
RNA-seq libraries were prepared using the TruSeq Stranded Total RNA Prep Kit according to the manufacturer's instructions (Illumina, San Diego, CA). Ribosomal RNAs were depleted from total RNA (150 ng per sample) using the Ribo-Zero Gold rRNA removal solution containing biotinylated probes targeting eukaryotic cytoplasmic and mitochondrial rRNAs. The rRNA-probe complexes were removed from the sample using streptavidin-coated magnetic beads and the resulting rRNA-depleted sample was subjected to thermal RNA fragmentation prior to cDNA synthesis. The first strand cDNA was synthesized using Superscript III reverse transcriptase (Thermo Fisher Scientific, Waltham MA) and random primers, followed by second strand cDNA synthesis. Next, a single adenylate (A) residue was added to 3' end of the double- stranded cDNA molecules and the resulting A-tailed double stranded cDNAs were ligated to 3'- dT-tailed Illumina TruSeq paired-end adaptors containing unique index barcode sequences. The ligated products were purified and enriched with 15 cycles of Polymerase Chain Reaction (PCR) using the primers provided in the Illumina library prep kit. The size distribution of the RNA-seq libraries was analyzed on a 2100 Bioanalyzer (Agilent Technologies, Santa Clara, CA) and the library concentrations were determined using Kapa Library Quantification kit (Kapa Biosystems, Woburn, MA). Each library was normalized to 4 nM in 10 mM Tris-HCl, pH 8.0 and denatured in 0. IN NaOH for 5 min prior to the final dilution. Paired-end sequencing runs (2 x 100 cycles) were performed on either HiSeq 2000 or
NextSeq 500 sequencing instruments (Illumina, San Diego, CA). For HiSeq 2000 sequencing runs, denatured libraries (12 pM final concentration) were clustered on a TruSeq v3 Paired-End with a cBot system and sequenced using TruSeq v3 SBS reagents (Illumina, San Diego, CA). Sequencing runs on NextSeq 500 system was carried out with 1.8 pM denatured libraries loaded onto a NextSeq 500/550 v2 flowcell and reagents (Illumina, San Diego, CA).
Bioinformatics analysis
CP1108/NCT01693562 is a nonrandomized, open-label, multicenter phase 1/2 clinical trial evaluating safety and clinical activity of durvalumab in multiple advanced solid tumors. RNA sequencing data was generated on 97 NSCLC patient tumors with available clinical data, where 30 had pre/post NSCLC patient tumor pair as well as 30 bladder patient tumors pre- treatment with available clinical data. Candidate genes evaluated included CXCL9, PD-L1 (CD274), LAG-3, IFNG, PD-1 (PDCD1), NKG7, CD8A, SLAMF7, PD-L2 (PDCD1LG2), TIM- 3 (HAVCR2), CD80, CD86, CTLA-4, CD2, TLR8, GZMK, TNFRSF4, FOXP3, CD276, B7-H4 (VTCNl), and CD37. Analyses included receiver operator characteristic (ROC) calculations with area under the curve (AUC), logistic regression, time-to-event analysis such as Kaplan-Meiers and Cox proportional hazards (PH) models, paired Student's t-tests for pre/post comparisons, and correlation analysis using a Spearman's rank coefficient. Other Embodiments
From the foregoing description, it will be apparent that variations and modifications may be made to the invention described herein to adopt it to various usages and conditions. Such embodiments are also within the scope of the following claims.
The recitation of a listing of elements in any definition of a variable herein includes definitions of that variable as any single element or combination (or subcombination) of listed elements. The recitation of an embodiment herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof.
All patents and publications mentioned in this specification are herein incorporated by reference to the same extent as if each independent patent and publication was specifically and individually indicated to be incorporated by reference.
SEQUENCE LISTING
SEQ ID NO: 2
> PCT/US2010/058007_72 Sequence 72 from PCT/US2010/058007 Organism: Homo sapiens
SEQ ID NO: 3 - VH CDR1
> PCT/US2010/058007_73 Sequence 73 from PCT/US2010/058007 Organism: Homo sapiens
GFTFSRYWMS SEQ ID NO: 4 - VH CDR2
> PCT/US2010/058007_74 Sequence 74 from PCT/US2010/058007 Organism: Homo sapiens NIKQDGSEKYYVDSVKG
SEQ ID NO: 5 - VH CDR3
> PCT/US2010/058007_75 Sequence 75 from PCT/US2010/058007 Organism: Homo sapiens
EGGWFGELAFDY
SEQ ID NO: 6 - VL CDR1
> PCT/US2010/058007_78 Sequence 78 from PCT/US2010/058007 Organism: Homo sapiens
RASQRVSSSYLA
SEQ ID NO: 7 - VL CDR2
> PCT/US2010/058007_79 Sequence 79 from PCT/US2010/058007 Organism: Homo sapiens
DASSRAT
SEQ ID NO: 8 - VL CDR3
> PCT/US2010/058007_80 Sequence 80 from PCT/US2010/058007 Organism: Homo sapiens
QQYGSLPWT
SEQ ID NO: 9
>sp I P01579 I IFNG_HUMAN Interferon gamma OS=Homo sapiens GN=IFNG PE=1 SV=1 MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK EESDRKIMQSQIVSFYFKLFKNFKDDQS IQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
SEQ ID NO: 10
1 cacattgttc tgatcatctg aagatcagct attagaagag aaagatcagt taagtccttt
61 ggacctgatc agcttgatac aagaactact gatttcaact tctttggctt aattctctcg
121 gaaacgatga aatatacaag ttatatcttg gcttttcagc tctgcatcgt tttgggttct
181 cttggctgtt actgccagga cccatatgta aaagaagcag aaaaccttaa gaaatatttt
241 aatgcaggtc attcagatgt agcggataat ggaactcttt tcttaggcat tttgaagaat
301 tggaaagagg agagtgacag aaaaataatg cagagccaaa ttgtctcctt ttacttcaaa
361 ctttttaaaa actttaaaga tgaccagagc atccaaaaga gtgtggagac catcaaggaa
421 gacatgaatg tcaagttttt caatagcaac aaaaagaaac gagatgactt cgaaaagctg
481 actaattatt cggtaactga cttgaatgtc caacgcaaag caatacatga actcatccaa
541 gtgatggctg aactgtcgcc agcagctaaa acagggaagc gaaaaaggag tcagatgctg
601 tttcgaggtc gaagagcatc ccagtaatgg ttgtcctgcc tgcaatattt gaattttaaa
661 tctaaatcta tttattaata tttaacatta tttatatggg gaatatattt ttagactcat
721 caatcaaata agtatttata atagcaactt ttgtgtaatg aaaatgaata tctattaata
781 tatgtattat ttataattcc tatatcctgt gactgtctca cttaatcctt tgttttctga
841 ctaattaggc aaggctatgt gattacaagg ctttatctca ggggccaact aggcagccaa
901 cctaagcaag atcccatggg ttgtgtgttt atttcacttg atgatacaat gaacacttat
961 aagtgaagtg atactatcca gttactgccg gtttgaaaat atgcctgcaa tctgagccag
1021 tgctttaatg gcatgtcaga cagaacttga atgtgtcagg tgaccctgat gaaaacatag
1081 catctcagga gatttcatgc ctggtgcttc caaatattgt tgacaactgt gactgtaccc
1141 aaatggaaag taactcattt gttaaaatta tcaatatcta atatatatga ataaagtgta 1201 tcacaac aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
SSQ ID NO: II
1 mrifavfifm tywhllnapy nkinqril v dpvtsehelt cqaegypkae viwtssdhqv
61 lsgkttttns kreeklfnvt stlrintttn eifyctfrrl dpeenhtael vipelplahp 121 pnerthlvil gaillclgva ltfifrlrkg rmmdvkkcgi qdtnskkqsd thleet
SEQ ID NO: 12
1 ggcgcaacgc tgagcagctg gcgcgtcccg cgcggcccca gttctgcgca gcttcccgag 61 gctccgcacc agccgcgctt ctgtccgcct gcagggcatt ccagaaagat gaggatattt
121 gctgtcttta tattcatgac ctactggcat ttgctgaacg ccccatacaa caaaatcaac
181 caaagaattt tggttgtgga tccagtcacc tctgaacatg aactgacatg tcaggctgag
241 ggctacccca aggccgaagt catctggaca agcagtgacc atcaagtcct gagtggtaag
301 accaccacca ccaattccaa gagagaggag aagcttttca atgtgaccag cacactgaga 361 atcaacacaa caactaatga gattttctac tgcactttta ggagattaga tcctgaggaa
421 aaccatacag ctgaattggt catcccagaa ctacctctgg cacatcctcc aaatgaaagg
481 actcacttgg taattctggg agccatctta ttatgccttg gtgtagcact gacattcatc
541 ttccgtttaa gaaaagggag aatgatggat gtgaaaaaat gtggcatcca agatacaaac
601 tcaaagaagc aaagtgatac acatttggag gagacgtaat ccagcattgg aacttctgat 661 cttcaagcag ggattctcaa cctgtggttt aggggttcat cggggctgag cgtgacaaga
721 ggaaggaatg ggcccgtggg atgcaggcaa tgtgggactt aaaaggccca agcactgaaa
781 atggaacctg gcgaaagcag aggaggagaa tgaagaaaga tggagtcaaa cagggagcct
841 ggagggagac cttgatactt tcaaatgcct gaggggctca tcgacgcctg tgacagggag
901 aaaggatact tctgaacaag gagcctccaa gcaaatcatc cattgctcat cctaggaaga 961 cgggttgaga atccctaatt tgagggtcag ttcctgcaga agtgcccttt gcctccactc
1021 aatgcctcaa tttgttttct gcatgactga gagtctcagt gttggaacgg gacagtattt
1081 atgtatgagt ttttcctatt tattttgagt ctgtgaggtc ttcttgtcat gtgagtgtgg
1141 ttgtgaatga tttcttttga agatatattg tagtagatgt tacaattttg tcgccaaact
1201 aaacttgctg cttaatgatt tgctcacatc tagtaaaaca tggagtattt gtaaggtgct 1261 tggtctcctc tataactaca agtatacatt ggaagcataa agatcaaacc gttggttgca
1321 taggatgtca cctttattta acccattaat actctggttg acctaatctt attctcagac
1381 ctcaagtgtc tgtgcagtat ctgttccatt taaatatcag ctttacaatt atgtggtagc
1441 ctacacacat aatctcattt catcgctgta accaccctgt tgtgataacc actattattt 1501 tacccatcgt acagctgagg aagcaaacag attaagtaac ttgcccaaac cagtaaatag
1561 cagacctcag actgccaccc actgtccttt tataatacaa tttacagcta tattttactt
1621 taagcaattc ttttattcaa aaaccattta ttaagtgccc ttgcaatatc aatcgctgtg
1681 ccaggcattg aatctacaga tgtgagcaag acaaagtacc tgtcctcaag gagctcatag 1741 tataatgagg agattaacaa gaaaatgtat tattacaatt tagtccagtg tcatagcata
1801 aggatgatgc gaggggaaaa cccgagcagt gttgccaaga ggaggaaata ggccaatgtg
1861 gtctgggacg gttggatata cttaaacatc ttaataatca gagtaatttt catttacaaa
1921 gagaggtcgg tacttaaaat aaccctgaaa aataacactg gaattccttt tctagcatta
1981 tatttattcc tgatttgcct ttgccatata atctaatgct tgtttatata gtgtctggta 2041 ttgtttaaca gttctgtctt ttctatttaa atgccactaa attttaaatt catacctttc
2101 catgattcaa aattcaaaag atcccatggg agatggttgg aaaatctcca cttcatcctc
2161 caagccattc aagtttcctt tccagaagca actgctactg cctttcattc atatgttctt
2221 ctaaagatag tctacatttg gaaatgtatg ttaaaagcac gtatttttaa aatttttttc
2281 ctaaatagta acacattgta tgtctgctgt gtactttgct atttttattt attttagtgt 2341 ttcttatata gcagatggaa tgaatttgaa gttcccaggg ctgaggatcc atgccttctt
2401 tgtttctaag ttatctttcc catagctttt cattatcttt catatgatcc agtatatgtt
2461 aaatatgtcc tacatataca tttagacaac caccatttgt taagtatttg ctctaggaca
2521 gagtttggat ttgtttatgt ttgctcaaaa ggagacccat gggctctcca gggtgcactg
2581 agtcaatcta gtcctaaaaa gcaatcttat tattaactct gtatgacaga atcatgtctg 2641 gaacttttgt tttctgcttt ctgtcaagta taaacttcac tttgatgctg tacttgcaaa
2701 atcacatttt ctttctggaa attccggcag tgtaccttga ctgctagcta ccctgtgcca
2761 gaaaagcctc attcgttgtg cttgaaccct tgaatgccac cagctgtcat cactacacag
2821 ccctcctaag aggcttcctg gaggtttcga gattcagatg ccctgggaga tcccagagtt
2881 tcctttccct cttggccata ttctggtgtc aatgacaagg agtaccttgg ctttgccaca 2941 tgtcaaggct gaagaaacag tgtctccaac agagctcctt gtgttatctg tttgtacatg
3001 tgcatttgta cagtaattgg tgtgacagtg ttctttgtgt gaattacagg caagaattgt
3061 ggctgagcaa ggcacatagt ctactcagtc tattcctaag tcctaactcc tccttgtggt
3121 gttggatttg taaggcactt tatccctttt gtctcatgtt tcatcgtaaa tggcataggc
3181 agagatgata cctaattctg catttgattg tcactttttg tacctgcatt aatttaataa 3241 aatattctta tttattttgt tacttggtac accagcatgt ccattttctt gtttattttg 3301 tgtttaataa aatgttcagt ttaacatccc agtggagaaa gttaaaaaa
SEQ ID NO: 13
DEFINITION C-X-C motif chemokine 9 precursor [Homo sapiens] .
ACCESSION NP_002407
1 mkksgvlfll giillvligv qgtp vrkgr cscistnqgt ihlqslkdlk qfapspscek
61 ieiiatlkng vqtclnpdsa dvkelikkwe kqvsqkkkqk ngkkhqkkkv lkvrksqrsr
121 qkktt
SEQ ID NO: 14
1 aaaatgtgtt ctctaaagaa tttctcaggc tcaaaatcca atacaggagt gacttggaac
61 tccattctat cactatgaag aaaagtggtg ttcttttcct cttgggcatc atcttgctgg
121 ttctgattgg agtgcaagga accccagtag tgagaaaggg tcgctgttcc tgcatcagca
181 ccaaccaagg gactatccac ctacaatcct tgaaagacct taaacaattt gccccaagcc
241 cttcctgcga gaaaattgaa atcattgcta cactgaagaa tggagttcaa acatgtctaa
301 acccagattc agcagatgtg aaggaactga ttaaaaagtg ggagaaacag gtcagccaaa
361 agaaaaagca aaagaatggg aaaaaacatc aaaaaaagaa agttctgaaa gttcgaaaat
421 ctcaacgttc tcgtcaaaag aagactacat aagagaccac ttcaccaata agtattctgt
481 gttaaaaatg ttctatttta attataccgc tatcattcca aaggaggatg gcatataata
541 caaaggctta ttaatttgac tagaaaattt aaaacattac tctgaaattg taactaaagt
601 tagaaagttg attttaagaa tccaaacgtt aagaattgtt aaaggctatg attgtctttg
661 ttcttctacc acccaccagt tgaatttcat catgcttaag gccatgattt tagcaatacc
721 catgtctaca cagatgttca cccaaccaca tcccactcac aacagctgcc tggaagagca
781 gccctaggct tccacgtact gcagcctcca gagagtatct gaggcacatg tcagcaagtc
841 ctaagcctgt tagcatgctg gtgagccaag cagtttgaaa ttgagctgga cctcaccaag
901 ctgctgtggc catcaacctc tgtatttgaa tcagcctaca ggcctcacac acaatgtgtc
961 tgagagattc atgctgattg ttattgggta tcaccactgg agatcaccag tgtgtggctt
1021 tcagagcctc ctttctggct ttggaagcca tgtgattcca tcttgcccgc tcaggctgac
1081 cactttattt ctttttgttc ccctttgctt cattcaagtc agctcttctc catcctacca
1141 caatgcagtg cctttcttct ctccagtgca cctgtcatat gctctgattt atctgagtca
1201 actcctttct catcttgtcc ccaacacccc acagaagtgc tttcttctcc caattcatcc
1261 tcactcagtc cagcttagtt caagtcctgc ctcttaaata aacctttttg gacacacaaa
1321 ttatcttaaa actcctgttt cacttggttc agtaccacat gggtgaacac tcaatggtta
1381 actaattctt gggtgtttat cctatctctc caaccagatt gtcagctcct tgagggcaag 1441 agccacagta tatttccctg tttcttccac agtgcctaat aatactgtgg aactaggttt
1501 taataatttt ttaattgatg ttgttatggg caggatggca accagaccat tgtctcagag
1561 caggtgctgg ctctttcctg gctactccat gttggctagc ctctggtaac ctcttactta
1621 ttatcttcag gacactcact acagggacca gggatgatgc aacatccttg tctttttatg
1681 acaggatgtt tgctcagctt ctccaacaat aagaagcacg tggtaaaaca cttgcggata
1741 ttctggactg tttttaaaaa atatacagtt taccgaaaat catataatct tacaatgaaa
1801 aggactttat agatcagcca gtgaccaacc ttttcccaac catacaaaaa ttccttttcc
1861 cgaaggaaaa gggctttctc aataagcctc agctttctaa gatctaacaa gatagccacc
1921 gagatcctta tcgaaactca ttttaggcaa atatgagttt tattgtccgt ttacttgttt
1981 cagagtttgt attgtgatta tcaattacca caccatctcc catgaagaaa gggaacggtg
2041 aagtactaag cgctagagga agcagccaag tcggttagtg gaagcatgat tggtgcccag
2101 ttagcctctg caggatgtgg aaacctcctt ccaggggagg ttcagtgaat tgtgtaggag
2161 aggttgtctg tggccagaat ttaaacctat actcactttc ccaaattgaa tcactgctca
2221 cactgctgat gatttagagt gctgtccggt ggagatccca cccgaacgtc ttatctaatc
2281 atgaaactcc ctagttcctt catgtaactt ccctgaaaaa tctaagtgtt tcataaattt
2341 gagagtctgt gacccactta ccttgcatct cacaggtaga cagtatataa ctaacaacca
2401 aagactacat attgtcactg acacacacgt tataatcatt tatcatatat atacatacat
2461 gcatacactc tcaaagcaaa taatttttca cttcaaaaca gtattgactt gtataccttg
2521 taatttgaaa tattttcttt gttaaaatag aatggtatca ataaatagac cattaatcag
2581 aaaacagatc ttgatttttt ttctcttgaa tgtacccttc aactgttgaa tgtttaatag
2641 taaatcttat atgtccttat ttacttttta gctttctctc aaataaagtg taacactagt
2701 tgagataaaa aaaaaaaaaa aaa
SEQ ID NO: 15
1 mrifavfifm tywhllnaft vtvpkdlyvv eygsnmtiec kfpvekqldl aalivyweme
61 dkniiqfvhg eedlkvqhss yrqrarllkd qlslgnaalq itdvklqdag vyrcmisygg 121 adykritvkv napynkinqr ilvvdpvtse heltcqaegy pkaeviwtss dhqvlsgktt 181 ttnskreekl fnvtstlrin tttneifyct frrldpeenh taelvipelp lahppnerth 241 lvilgaillc lgvaltfifr lrkgrmmdvk kcgiqdtnsk kqsdthleet
SEQ ID NO: 16
1 ggcgcaacgc tgagcagctg gcgcgtcccg cgcggcccca gttctgcgca gcttcccgag
61 gctccgcacc agccgcgctt ctgtccgcct gcagggcatt ccagaaagat gaggatattt 121 gctgtcttta tattcatgac ctactggcat ttgctgaacg catttactgt cacggttccc 181 aaggacctat atgtggtaga gtatggtagc aatatgacaa ttgaatgcaa attcccagta 241 gaaaaacaat tagacctggc tgcactaatt gtctattggg aaatggagga taagaacatt
301 attcaatttg tgcatggaga ggaagacctg aaggttcagc atagtagcta cagacagagg
361 gcccggctgt tgaaggacca gctctccctg ggaaatgctg cacttcagat cacagatgtg
421 aaattgcagg atgcaggggt gtaccgctgc atgatcagct atggtggtgc cgactacaag
481 cgaattactg tgaaagtcaa tgccccatac aacaaaatca accaaagaat tttggttgtg
541 gatccagtca cctctgaaca tgaactgaca tgtcaggctg agggctaccc caaggccgaa
601 gtcatctgga caagcagtga ccatcaagtc ctgagtggta agaccaccac caccaattcc
661 aagagagagg agaagctttt caatgtgacc agcacactga gaatcaacac aacaactaat
721 gagattttct actgcacttt taggagatta gatcctgagg aaaaccatac agctgaattg
781 gtcatcccag aactacctct ggcacatcct ccaaatgaaa ggactcactt ggtaattctg
841 ggagccatct tattatgcct tggtgtagca ctgacattca tcttccgttt aagaaaaggg
901 agaatgatgg atgtgaaaaa atgtggcatc caagatacaa actcaaagaa gcaaagtgat
961 acacatttgg aggagacgta atccagcatt ggaacttctg atcttcaagc agggattctc
1021 aacctgtggt ttaggggttc atcggggctg agcgtgacaa gaggaaggaa tgggcccgtg
1081 ggatgcaggc aatgtgggac ttaaaaggcc caagcactga aaatggaacc tggcgaaagc
1141 agaggaggag aatgaagaaa gatggagtca aacagggagc ctggagggag accttgatac
1201 tttcaaatgc ctgaggggct catcgacgcc tgtgacaggg agaaaggata cttctgaaca
1261 aggagcctcc aagcaaatca tccattgctc atcctaggaa gacgggttga gaatccctaa
1321 tttgagggtc agttcctgca gaagtgccct ttgcctccac tcaatgcctc aatttgtttt
1381 ctgcatgact gagagtctca gtgttggaac gggacagtat ttatgtatga gtttttccta
1441 tttattttga gtctgtgagg tcttcttgtc atgtgagtgt ggttgtgaat gatttctttt
1501 gaagatatat tgtagtagat gttacaattt tgtcgccaaa ctaaacttgc tgcttaatga
1561 tttgctcaca tctagtaaaa catggagtat ttgtaaggtg cttggtctcc tctataacta
1621 caagtataca ttggaagcat aaagatcaaa ccgttggttg cataggatgt cacctttatt
1681 taacccatta atactctggt tgacctaatc ttattctcag acctcaagtg tctgtgcagt
1741 atctgttcca tttaaatatc agctttacaa ttatgtggta gcctacacac ataatctcat
1801 ttcatcgctg taaccaccct gttgtgataa ccactattat tttacccatc gtacagctga
1861 ggaagcaaac agattaagta acttgcccaa accagtaaat agcagacctc agactgccac
1921 ccactgtcct tttataatac aatttacagc tatattttac tttaagcaat tcttttattc
1981 aaaaaccatt tattaagtgc ccttgcaata tcaatcgctg tgccaggcat tgaatctaca
2041 gatgtgagca agacaaagta cctgtcctca aggagctcat agtataatga ggagattaac
2101 aagaaaatgt attattacaa tttagtccag tgtcatagca taaggatgat gcgaggggaa
2161 aacccgagca gtgttgccaa gaggaggaaa taggccaatg tggtctggga cggttggata
2221 tacttaaaca tcttaataat cagagtaatt ttcatttaca aagagaggtc ggtacttaaa
2281 ataaccctga aaaataacac tggaattcct tttctagcat tatatttatt cctgatttgc
2341 ctttgccata taatctaatg cttgtttata tagtgtctgg tattgtttaa cagttctgtc
2401 ttttctattt aaatgccact aaattttaaa ttcatacctt tccatgattc aaaattcaaa
2461 agatcccatg ggagatggtt ggaaaatctc cacttcatcc tccaagccat tcaagtttcc 2521 tttccagaag caactgctac tgcctttcat tcatatgttc ttctaaagat agtctacatt
2581 tggaaatgta tgttaaaagc acgtattttt aaaatttttt tcctaaatag taacacattg
2641 tatgtctgct gtgtactttg ctatttttat ttattttagt gtttcttata tagcagatgg
2701 aatgaatttg aagttcccag ggctgaggat ccatgccttc tttgtttcta agttatcttt
2761 cccatagctt ttcattatct ttcatatgat ccagtatatg ttaaatatgt cctacatata
2821 catttagaca accaccattt gttaagtatt tgctctagga cagagtttgg atttgtttat
2881 gtttgctcaa aaggagaccc atgggctctc cagggtgcac tgagtcaatc tagtcctaaa
2941 aagcaatctt attattaact ctgtatgaca gaatcatgtc tggaactttt gttttctgct
3001 ttctgtcaag tataaacttc actttgatgc tgtacttgca aaatcacatt ttctttctgg
3061 aaattccggc agtgtacctt gactgctagc taccctgtgc cagaaaagcc tcattcgttg
3121 tgcttgaacc cttgaatgcc accagctgtc atcactacac agccctccta agaggcttcc
3181 tggaggtttc gagattcaga tgccctggga gatcccagag tttcctttcc ctcttggcca
3241 tattctggtg tcaatgacaa ggagtacctt ggctttgcca catgtcaagg ctgaagaaac
3301 agtgtctcca acagagctcc ttgtgttatc tgtttgtaca tgtgcatttg tacagtaatt
3361 ggtgtgacag tgttctttgt gtgaattaca ggcaagaatt gtggctgagc aaggcacata
3421 gtctactcag tctattccta agtcctaact cctccttgtg gtgttggatt tgtaaggcac
3481 tttatccctt ttgtctcatg tttcatcgta aatggcatag gcagagatga tacctaattc
3541 tgcatttgat tgtcactttt tgtacctgca ttaatttaat aaaatattct tatttatttt
3601 gttacttggt acaccagcat gtccattttc ttgtttattt tgtgtttaat aaaatgttca
3661 gtttaacatc ccagtggaga aagttaaaaa a
SEQ ID NO: 17
1 mweaqflgll flqplwvapv kplqpgaevp vwaqegapa qlpcsptipl qdlsllrrag
61 vtwqhqpdsg ppaaapghpl apgphpaaps swgprprryt vlsvgpgglr sgrlplqprv
121 qldergrqrg dfslwlrpar radageyraa vhlrdralsc rlrlrlgqas mtasppgslr
181 asdwvilncs fsrpdrpasv hwfrnrgqgr vpvresphhh laesflflpq vspmdsgpwg
241 ciltyrdgfn vsimynltvl glepptpltv yagagsrvgl pcrlpagvgt rsfltakwtp
301 pgggpdllvt gdngdftlrl edvsqaqagt ytchihlqeq qlnatvtlai itgqpqvgke
SEQ ID NO: 18
1 acaggggtga aggcccagag accagcagaa cggcatccca gccacgacgg ccactttgct
61 ctgtctgctc tccgccacgg ccctgctctg ttccctggga cacccccgcc cccacctcct
121 caggctgcct gatctgccca gctttccagc tttcctctgg attccggcct ctggtcatcc
181 ctccccaccc tctctccaag gccctctcct ggtctccctt cttctagaac cccttcctcc
241 acctccctct ctgcagaact tctcctttac cccccacccc ccaccactgc cccctttcct
301 tttctgacct ccttttggag ggctcagcgc tgcccagacc ataggagaga tgtgggaggc
361 tcagttcctg ggcttgctgt ttctgcagcc gctttgggtg gctccagtga agcctctcca 421 gccaggggct gaggtcccgg tggtgtgggc ccaggagggg gctcctgccc agctcccctg
481 cagccccaca atccccctcc aggatctcag ccttctgcga agagcagggg tcacttggca
541 gcatcagcca gacagtggcc cgcccgctgc cgcccccggc catcccctgg cccccggccc
601 tcacccggcg gcgccctcct cctgggggcc caggccccgc cgctacacgg tgctgagcgt
661 gggtcccgga ggcctgcgca gcgggaggct gcccctgcag ccccgcgtcc agctggatga
721 gcgcggccgg cagcgcgggg acttctcgct atggctgcgc ccagcccggc gcgcggacgc
781 cggcgagtac cgcgccgcgg tgcacctcag ggaccgcgcc ctctcctgcc gcctccgtct
841 gcgcctgggc caggcctcga tgactgccag ccccccagga tctctcagag cctccgactg
901 ggtcattttg aactgctcct tcagccgccc tgaccgccca gcctctgtgc attggttccg
961 gaaccggggc cagggccgag tccctgtccg ggagtccccc catcaccact tagcggaaag
1021 cttcctcttc ctgccccaag tcagccccat ggactctggg ccctggggct gcatcctcac
1081 ctacagagat ggcttcaacg tctccatcat gtataacctc actgttctgg gtctggagcc
1141 cccaactccc ttgacagtgt acgctggagc aggttccagg gtggggctgc cctgccgcct
1201 gcctgctggt gtggggaccc ggtctttcct cactgccaag tggactcctc ctgggggagg
1261 ccctgacctc ctggtgactg gagacaatgg cgactttacc cttcgactag aggatgtgag
1321 ccaggcccag gctgggacct acacctgcca tatccatctg caggaacagc agctcaatgc
1381 cactgtcaca ttggcaatca tcacagtgac tcccaaatcc tttgggtcac ctggatccct
1441 ggggaagctg ctttgtgagg tgactccagt atctggacaa gaacgctttg tgtggagctc
1501 tctggacacc ccatcccaga ggagtttctc aggaccttgg ctggaggcac aggaggccca
1561 gctcctttcc cagccttggc aatgccagct gtaccagggg gagaggcttc ttggagcagc
1621 agtgtacttc acagagctgt ctagcccagg tgcccaacgc tctgggagag ccccaggtgc
1681 cctcccagca ggccacctcc tgctgtttct catccttggt gtcctttctc tgctcctttt
1741 ggtgactgga gcctttggct ttcacctttg gagaagacag tggcgaccaa gacgattttc
1801 tgccttagag caagggattc accctccgca ggctcagagc aagatagagg agctggagca
1861 agaaccggag ccggagccgg agccggaacc ggagcccgag cccgagcccg agccggagca
1921 gctctgacct ggagctgagg cagccagcag atctcagcag cccagtccaa ataaactccc 1981 tgtcagcagc aaaaa

Claims

What is claimed is: 1. A method of treating a solid tumor in a subject, the method comprising administering an anti-PD-Ll antibody, or an antigen binding fragment thereof, to a patient identified as having increased levels of two or more polynucleotide markers selected from the group consisting of CXCL9, CD274, LAG3, and IFNG in a biological sample derived from the patient relative to a reference.
2. The method of claim 1, wherein the solid tumor is selected from the group consisting of breast, colon, colorectal, lung, renal, including renal cell carcinoma, gastric, bladder, non-small cell lung cancer (NSCLC), hepatocellular cancer (HCC), pancreatic cancer, and melanoma.
3. A method of treating lung cancer or bladder cancer in a subject, the method comprising administering an anti-PD-Ll antibody, or an antigen binding fragment thereof, to a patient identified by detecting increased levels of two or more polynucleotide markers selected from the group consisting of CXCL9, CD274, LAG3, and IFNG in a biological sample derived from the patient relative to a reference.
4. A method of identifying a subject having a solid tumor that is responsive to an anti-PD- Ll antibody, or an antigen binding fragment thereof, the method comprising detecting an increase in the expression levels of two or more polynucleotide markers selected from the group consisting of CXCL9, CD274, LAG3, and IFNG in a biological sample obtained from the subject relative to a reference, thereby identifying the solid tumor as responsive to anti-PD-Ll therapy.
5. A method of identifying a subject having a solid tumor that is responsive to anti-PD-Ll therapy, the method comprising detecting an increase in the expression levels of two or more polynucleotide markers selected from the group consisting of CXCL9, CD274, LAG3, and IFNG in a biological sample obtained from the subject, relative to a reference, thereby identifying the solid tumor as responsive to anti-PD-Ll therapy.
6. The method of claim 4 or 5, wherein the solid tumor is selected from the group consisting of breast, colon, colorectal, lung, renal, including renal cell carcinoma, gastric, bladder, non- small cell lung cancer (NSCLC), hepatocellular cancer (HCC), pancreatic cancer, and melanoma.
7. A method of identifying a subject having a lung cancer or bladder cancer that is responsive to anti-PD-Ll therapy, the method comprising detecting an increase in the expression levels of two or more polynucleotide markers selected from the group consisting of CXCL9, CD274, LAG3, and IFNG in a biological sample obtained from the subject, relative to a reference, thereby identifying the solid tumor as responsive to anti-PD-Ll therapy.
8. The method of any one of claims 1-7, wherein the anti-PD-Ll antibody is durvalumab.
9. The method of any one of claims 1-7, wherein the tumor expresses increased levels of IFNG and one or more of CXCL9, CD274, and LAG3 polynucleotide markers relative to a reference.
10. The method of any one of claims 1-9, wherein the method comprises detecting CXCL9, CD274, LAG3, and IFNG polynucleotide markers.
11. The method of any one of claims 1-10, wherein levels of CXCL9, CD274, LAG3, and IFNG polynucleotide markers are detected in a Real-Time PCR assay.
12. The method of any one of claims 1-11, wherein the detection of increased levels of two or more markers identifies the tumor as responsive to durvalumab.
13. The method of any one of claims 1-11, wherein the biological sample is a blood, plasma, serum, or tumor sample.
EP17853747.8A 2016-09-20 2017-09-19 COMPOSITIONS AND METHODS FOR CHARACTERIZING THE REACTIVITY OF SOLID TUMORS TO ANTI-PD-L1 ANTIBODY MONOTHERAPY Withdrawn EP3515456A4 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662397062P 2016-09-20 2016-09-20
PCT/US2017/052246 WO2018057506A1 (en) 2016-09-20 2017-09-19 Compositions and methods for characterizing solid tumors responsiveness to anti-pd-l1 antibody monotherapy

Publications (2)

Publication Number Publication Date
EP3515456A1 true EP3515456A1 (en) 2019-07-31
EP3515456A4 EP3515456A4 (en) 2020-06-17

Family

ID=61691137

Family Applications (1)

Application Number Title Priority Date Filing Date
EP17853747.8A Withdrawn EP3515456A4 (en) 2016-09-20 2017-09-19 COMPOSITIONS AND METHODS FOR CHARACTERIZING THE REACTIVITY OF SOLID TUMORS TO ANTI-PD-L1 ANTIBODY MONOTHERAPY

Country Status (4)

Country Link
EP (1) EP3515456A4 (en)
JP (1) JP2019529437A (en)
CN (1) CN109963572A (en)
WO (1) WO2018057506A1 (en)

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA3060984A1 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Treatment of lag-3 positive tumors
KR102721137B1 (en) 2017-05-30 2024-10-25 브리스톨-마이어스 스큅 컴퍼니 Composition comprising anti-LAG-3 antibody or anti-LAG-3 antibody and anti-PD-1 or anti-PD-L1 antibody
BR112019025188A2 (en) 2017-06-01 2020-06-23 Cytomx Therapeutics, Inc. ACTIVABLE ANTI-PDL1 ANTIBODIES AND METHODS OF USE OF THE SAME
WO2021030156A1 (en) * 2019-08-09 2021-02-18 The Regents Of The University Of California Compositions and methods for diagnosis and treatment of bladder cancer
EP4127244A4 (en) * 2020-03-31 2024-09-11 Cedars-Sinai Medical Center Biomarker panels for stratification of response to immune checkpoint blockade in cancer
US20240101666A1 (en) 2020-10-23 2024-03-28 Bristol-Myers Squibb Company Lag-3 antagonist therapy for lung cancer
EP4416308A4 (en) * 2021-10-12 2026-02-11 Found Medicine Inc CD274 reorganizations as predictors of response to immunocheckpoint inhibitor therapy

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AR095363A1 (en) * 2013-03-15 2015-10-14 Genentech Inc BIOMARKERS AND METHODS FOR THE TREATMENT OF CONDITIONS RELATED TO PD-1 AND PD-L1
WO2014151006A2 (en) * 2013-03-15 2014-09-25 Genentech, Inc. Biomarkers and methods of treating pd-1 and pd-l1 related conditions
US20170275347A1 (en) * 2014-09-05 2017-09-28 Medimmune Limited Methods for identifying patients responsive to anti-pd-l1 antibody therapy

Also Published As

Publication number Publication date
EP3515456A4 (en) 2020-06-17
WO2018057506A1 (en) 2018-03-29
CN109963572A (en) 2019-07-02
JP2019529437A (en) 2019-10-17

Similar Documents

Publication Publication Date Title
US12247982B2 (en) Markers selectively deregulated in tumor-infiltrating regulatory T cells
WO2018057506A1 (en) Compositions and methods for characterizing solid tumors responsiveness to anti-pd-l1 antibody monotherapy
JP7671248B2 (en) Diagnostic methods and compositions for cancer immunotherapy
US20180079814A1 (en) Combined anti-pld-1 and anti-ctla-4 antibodies for treating non-small lung cancer
KR20210088559A (en) Methods for Identification of Activating Antigen Receptor (aCAR)/Inhibiting Chimeric Antigen Receptor (iCAR) Pairs for Use in Cancer Therapy
US20170240632A1 (en) Compositions and methods for identifying and treating cachexia or pre-cachexia
JP6941561B2 (en) Multiple variable IL-2 dose regimens for treating immune disorders
EP3601600A2 (en) Tumor burden as measured by cell free dna
KR20220022050A (en) Cancer biomarkers for lasting clinical benefit
US20160060344A1 (en) Combination therapy for pd-l1 negative tumors
WO2016034718A1 (en) Methods for identifying patients responsive to anti-pd-l1 antibody therapy using markers (cxcl9, krt8.trim29, and ifngamma)
CN110945030A (en) Methods of Modulating Regulatory T Cells, Regulatory B Cells, and Immune Responses Using Modulators of APRIL-TACI Interactions
US20210071258A1 (en) Gene expression and assessment of risk of developing toxicity following cell therapy
KR20220031069A (en) Methods for diagnosing the effectiveness of anti-tumor treatment
CN111630182A (en) Diagnostic and therapeutic methods for the treatment of rheumatoid arthritis (RA)
WO2019164870A1 (en) Expression of signature mrnas for identifying patients responsive to anti-pd-l1 antibody therapy
US20250305053A1 (en) New nrg1 fusions, fusion junctions and methods for detecting them
WO2022120179A1 (en) Multi-tumor gene signatures and uses thereof
CA3023980C (en) Markers selectively deregulated in tumor-infiltrating regulatory t cells
HK40058894A (en) Diagnostic methods and compositions for cancer immunotherapy
HK40066912A (en) Cancer biomarkers for durable clinical benefit
GB2535256A (en) Combination therapy for PD-L1 negative tumors

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20190423

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

AX Request for extension of the european patent

Extension state: BA ME

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)
A4 Supplementary search report drawn up and despatched

Effective date: 20200514

RIC1 Information provided on ipc code assigned before grant

Ipc: C07K 16/28 20060101ALI20200508BHEP

Ipc: A61P 35/00 20060101ALI20200508BHEP

Ipc: C12N 15/113 20100101ALI20200508BHEP

Ipc: A61K 31/7088 20060101AFI20200508BHEP

Ipc: A61K 39/00 20060101ALI20200508BHEP

REG Reference to a national code

Ref country code: HK

Ref legal event code: DE

Ref document number: 40011692

Country of ref document: HK

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20201215

REG Reference to a national code

Ref country code: HK

Ref legal event code: WD

Ref document number: 40011692

Country of ref document: HK