EP3129055A1 - Bispecific her2 antibodies - Google Patents

Bispecific her2 antibodies

Info

Publication number
EP3129055A1
EP3129055A1 EP15777404.3A EP15777404A EP3129055A1 EP 3129055 A1 EP3129055 A1 EP 3129055A1 EP 15777404 A EP15777404 A EP 15777404A EP 3129055 A1 EP3129055 A1 EP 3129055A1
Authority
EP
European Patent Office
Prior art keywords
seq
her2
antibody
amino acids
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Granted
Application number
EP15777404.3A
Other languages
German (de)
French (fr)
Other versions
EP3129055B1 (en
EP3129055A4 (en
Inventor
John Li
Nazzareno Dimasi
Steven Coats
Melissa Damschroder
Changshou Gao
Godfrey Rainey
Cuihua Gao
Dorin Toader
Lakshmaiah GINGIPALLI
Fengjiang Wang
Ryan FLEMING
Binyam Bezabeh
Andy Qingan Yuan
Srinath Kasturirangan
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
MedImmune LLC
Original Assignee
MedImmune LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=54288419&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=EP3129055(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Application filed by MedImmune LLC filed Critical MedImmune LLC
Publication of EP3129055A1 publication Critical patent/EP3129055A1/en
Publication of EP3129055A4 publication Critical patent/EP3129055A4/en
Application granted granted Critical
Publication of EP3129055B1 publication Critical patent/EP3129055B1/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6817Toxins
    • A61K47/6829Bacterial toxins, e.g. diphteria toxins or Pseudomonas exotoxin A
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A61K47/6855Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from breast cancer cell
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/40Immunoglobulins specific features characterized by post-translational modification
    • C07K2317/41Glycosylation, sialylation, or fucosylation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/522CH1 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/54F(ab')2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/626Diabody or triabody
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/77Internalization into the cell
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present invention provides compositions that specifically bind to HER2 and methods for the use of such compositions for the treatment of cancer.
  • the HER family of receptor tyrosine kinases are important mediators of cell growth, differentiation and survival.
  • the receptor family includes four distinct members including epidermal growth factor receptor (EGFR, ErbBl, or HERl), HER2 (ErbB2 or pl85neu), HER3 (ErbB3) and HER4 (ErbB4 or tyro2).
  • HER2 was originally identified as the product of the transforming gene from neuroblastomas of chemically treated rats. Amplification of the human homolog has observed in breast and ovarian cancers and correlates with a poor prognosis. Overexpression of HER2 (frequently but not uniformly due to gene amplification) has also been observed in other carcinomas including carcinomas of the stomach, endometrium, salivary gland, lung, kidney, colon, thyroid, pancreas and bladder. HER2 can also be overexpressed in prostate cancer.
  • the HER receptors are generally found in various combinations in cells and heterodimerization is thought to increase the diversity of cellular responses to a variety of HER ligands (Earp et al. Breast Cancer Research and Treatment 35: 115-132 (1995)). While EGF and TGFa do not bind HER2, EGF stimulates EGFR and HER2 to form a heterodimer, which activates EGFR and results in transphosphorylation of HER2 in the heterodimer. Dimerization and/or transphosphorylation appear to activate the HER2 tyrosine kinase. See Earp et al, supra.
  • HER2 antibodies with various properties have been described in Tagliabue et al. Int. J. Cancer 47:933-937 (1991); McKenzie et al. Oncogene 4:543-548 (1989); Maier et al. Cancer Res. 51 :5361-5369 (1991); Bacus et al. Molecular Carcinogenesis 3:350-362 (1990); Stancovski et al. PNAS (USA) 88:8691-8695 (1991); Bacus et al. Cancer Research 52:2580-2589 (1992); Xu et al. Int. J. Cancer 53:401-408 (1993); WO94/00136; Kasprzyk et al.
  • trasstuzumab (HE CEPTIN®; see U.S. Pat. No. 5,821,337), a recombinant humanized version of the murine HER2 antibody 4D5, is clinically active in patients with HER2-overexpressing metastatic breast cancers that have received extensive prior anticancer therapy (Baselga et al, J. Clin. Oncol. 14:737-744 (1996)).
  • Pertuzumab (PERJETATM; see Patent Publication WO2001/00245) was developed as a humanized version of the murine antibody 2C4 that inhibits the dimerization of HER2 with other HER receptors, thereby inhibiting ligand-driven phosphorylation and activation, and downstream activation of the RAS and AKT pathways.
  • Ado-trastuzumab emtansine (T-DM1 ; KADCYLA®) is an antibody drug conjugate of trastuzumab linked to the cytotoxic agent mertansine approved for use in patients with HER2-overexpressing metastatic breast cancers resistant to trastuzumab.
  • trastuzumab in breast carcinoma is well demonstrated, it is strictly limited and only approved for 30% of breast cancer patients whose tumor overexpress HER2. 70% of the breast cancer patients do not or insufficiently respond to trastuzumab because their individual tumor do not overexpress or do not sufficiently express HER2.
  • HER2 is overexpressed in a significant percentage of cases ranging from 43 to 69%.
  • the levels of HER2 expression are in principle low in the majority of tumors.
  • the-overexpression of HER2 receptors is often caused by encoding gene amplification (Hynes et al., Nat Rev Cancer 5:341 (2005)).
  • anti-HER2 monoclonal antibody therapy is inefficient in tumors with low HER2 expression or missing overexpression.
  • resistance to these anti- HER2 antibodies is a significant problem.
  • ADCC Antibody-Dependent Cell-Mediated Cytotoxicity
  • ADC Antibody Drug Conjugates
  • ADC inhibiting receptor mediating signaling (e.g. by inhibiting receptor dimerization and/or mediating receptor internalization).
  • the present disclosure provides an anti-HER2 binding molecule comprising an immunoglobulin heavy chain (VH) and an immunoglobulin light chain (VL), wherein the VH comprises the amino acid sequence of SEQ ID NO: 15. Also provided is an anti- HER2 binding molecule comprising a VH and a VL, wherein the VL comprises the amino acid sequence of SEQ ID NO: 16. In some aspects, the VH comprises the amino acid sequence of SEQ ID NO: 15 and the VL comprises the amino acid sequence of SEQ ID NO: 16. In some aspects, the anti-HER2 binding molecule comprises an antibody, or antigen-binding fragment thereof.
  • the present disclosure also provides a bispecific anti-HER2 antibody comprising a first immunoglobulin antigen-binding domain and a second immunoglobulin antigen- binding domain, wherein (i) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 antibody binding sites, (ii) the first immunoglobulin antigen-binding domain binds to a first HER2 antibody binding site which comprises an epitope within domain II of HER2, and (iii) the first HER2 antibody binding site is distinct from the antibody binding site of pertuzumab.
  • the second immunoglobulin antigen-binding domain binds to a second HER2 antibody binding site which comprises an epitope within domain IV of HER2.
  • the second HER2 antibody binding site is identical the HER2 antibody binding site of trastuzumab. In some aspects, the second HER2 antibody binding site partially overlaps with the HER2 antibody binding site of trastuzumab. In other aspects, the second HER2 antibody binding site is distinct from the HER antibody binding site of trastuzumab.
  • the present disclosure also provides a bispecific anti-HER2 antibody comprising a first immunoglobulin antigen-binding domain and a second immunoglobulin antigen- binding domain, wherein the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes; and wherein the first immunoglobulin antigen-binding domain binds HER2 at an epitope comprising one or more amino acid residues in SEQ ID NO: 52.
  • the first immunoglobulin antigen-binding domain binds HER2 at an epitope comprising one or more amino acid residues in SEQ ID NO: 52 and the second immunoglobulin antigen-binding domain specifically binds HER2 at an epitope within domain IV.
  • the second immunoglobulin antigen-binding domain binds HER2 at an epitope comprising one or more amino acid residues in SEQ ID NO: 53.
  • the first immunoglobulin antigen-binding domain comprises a heavy chain variable region (VH) and a light chain variable region (VL) comprising: (i) a variable heavy chain CDR-1 (VH-CDR1) sequence identical to SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions; (ii) a variable heavy chain CDR-2 (VH-CDR2) sequence identical to SEQ ID NO: 2 or identical to SEQ ID NO: 2 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VH-CDR3 variable heavy chain CDR-3
  • VL-CDR1 variable light chain CDR-1 sequence identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VL-CDR2 variable light chain CDR-2
  • VL-CDR3 variable light chain CDR-3
  • the first immunoglobulin antigen-binding domain comprises at least one heterologous variable domain framework region (FW) relative to the immunoglobulin antigen-binding domain comprising a VH comprising the amino acid sequence SEQ ID NO:43 and a VL comprising the amino acid sequence of SEQ ID NO:44.
  • FW heterologous variable domain framework region
  • the first immunoglobulin antigen-binding domain comprises an scFv antibody fragment.
  • the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment.
  • HER2 antibody comprises a first immunoglobulin antigen-binding domain further comprising (i) a variable light chain framework 1 (VL-FW1) amino acid sequence comprising SEQ ID NO: 11; (ii) a VH-FW2 amino acid sequence comprising SEQ ID NO: 12; (iii) a VH-FW3 amino acid sequence comprising SEQ ID NO: 13; (iv) a VH-FW4 amino acid sequence at comprising SEQ ID NO: 14; or (vi) any combination thereof.
  • VL-FW1 variable light chain framework 1
  • the bispecific anti-HER2 antibody comprises a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein the first immunoglobulin antigen-binding domain comprises a VH and a VL, wherein the VH amino acid sequence comprises SEQ ID NO: 15; wherein the first or the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment, and wherein the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
  • the bispecific anti-HER2 antibody comprises a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein the first immunoglobulin antigen-binding domain comprises a VH and a VL, wherein the VL amino acid sequence comprises SEQ ID NO: 16; wherein the first or the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment, and wherein the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
  • the bispecific anti-HER2 antibody comprises a VH and a VL, wherein the VH amino acid sequence comprises SEQ ID NO: 15; and wherein the VL amino acid sequence comprises SEQ ID NO: 16, wherein the first or the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment, and wherein the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
  • the bispecific anti-HER2 antibody disclosed herein comprises a first immunoglobulin antigen binding domain comprising or consisting of (a) a VH further comprising a heavy chain constant region or a fragment thereof and a VL comprising a light chain constant region or a fragment thereof; (b) a single chain Fv ("scFv"); (c) a diabody; (d) a minibody; (e) an F(ab') 2 ; or (f) F(ab).
  • the heavy chain constant region or fragment thereof is an IgG constant region.
  • the IgG constant region or fragment thereof is an IgGl constant region.
  • the LC constant region is a kappa constant region.
  • the LC constant region is a lambda constant region.
  • the first immunoglobulin antigen-binding domain is a monoclonal antibody. In some aspects, the first immunoglobulin antigen-binding domain is a humanized antibody. In some aspects, the first immunoglobulin antigen-binding domain is a human antibody. In some aspects, the first immunoglobulin antigen-binding domain is a chimeric antibody. In some aspects, the first immunoglobulin antigen-binding domain is an affinity optimized antibody. In some aspects, the first immunoglobulin antigen-binding domain does not compete with trastuzumab or pertuzumab for epitope binding. In some aspects, the first and second immunoglobulin antigen binding domains specifically bind to distinct non-overlapping HER2 epitopes.
  • the bispecific anti-HER2 antibody comprises a first and a second immunoglobulin antigen-binding domain, wherein (a) the second immunoglobulin antigen-binding domain specifically binds to the same epitope in domain IV of HER2 as the trastuzumab antibody; (b) the second immunoglobulin antigen-binding domain competitively inhibits HER2 binding by the trastuzumab antibody; and/or (c) the second immunoglobulin antigen-binding domain comprises at least one, at least two, at least three, at least four, at least five, or at least six complementarity determining regions (CDRs) having amino acids selected from the group consisting of SEQ ID NOs: 54 to 59.
  • CDRs complementarity determining regions
  • the second immunoglobulin antigen-binding domain comprises an scFv comprising: (i) a VH-CDR1 comprising the amino acids of SEQ ID NO:54; (ii) a VH-CDR2 comprising the amino acids of SEQ ID NO:55; (iii) a VH-CDR3 comprising the amino acids of SEQ ID NO:56; (iv) a VL-CDR1 comprising the amino acids of SEQ ID NO:57; (v) a VL-CDR2 comprising the amino acids of SEQ ID NO:58; and (vi) a VL- CDR3 comprising the amino acids of SEQ ID NO:59.
  • the scFv is a disulfide stabilized scFv.
  • the scFv comprises a VH comprising the amino acids of SEQ ID NO: 17, and a VL comprising the amino acids of SEQ ID NO: 18 .
  • the VH and VL of the scFv are covalently linked via a peptide linker.
  • the peptide linker comprises the amino acid sequence of SEQ ID NO: 19.
  • the second immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody is covalently linked to the carboxy-terminus of the HC of the first immunoglobulin antigen-binding domain.
  • the bispecific anti- HER2 antibody comprises a linker interposed between the second immunoglobulin antigen binding domain and the carboxy-terminus of the HC of the first immunoglobulin antigen-binding domain.
  • the second immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody is covalently linked to the amino-terminus of the HC of the first immunoglobulin antigen-binding domain.
  • the bispecific anti-HER2 antibody comprises a linker interposed between the second immunoglobulin antigen-binding domain and the amino-terminus of the HC of the first immunoglobulin antigen-binding domain.
  • the second immunoglobulin antigen binding domain of the bispecific anti-HER2 antibody is covalently intercalated in the polypeptide chain of the HC of the first immunoglobulin antigen-binding domain. In some aspects, the second immunoglobulin antigen binding domain is covalently intercalated between the CHI region and CH2 region of the HC of the first immunoglobulin antigen-binding domain.
  • the bispecific anti-HER2 antibody comprises a linker interposed between the CHI region of the HC of the first immunoglobulin antigen binding domain and the second immunoglobulin antigen binding domain, and a second linker interposed between the second immunoglobulin antigen binding domain and the CH2 region of the HC of the of the first immunoglobulin antigen-binding domain.
  • the first linker and the second linker are identical. In other aspects, the first linker and the second linker are different. In some aspects, one or more of the linkers comprise a peptide linker. In some aspects, the peptide linker comprises at least one, at least two, at least three, at least four, at least five, at least 10, at least 20, or at least 30 amino acids. In other aspects, the peptide linker comprises a peptide having the formula Ser x [(Gly) y -Ser 4 ] z where x is from 0 to 1, y is from 1 to 4, and z is from 1 to 10. In some aspects, the peptide linker comprises SEQ ID NOS: 19, 20, 21, or 22.
  • the bispecific anti-HER2 antibody comprises a heavy chain which can include an Fc domain comprising a CH2 and a CH3 region.
  • the Fc domain is an IgGl Fc domain.
  • the IgGl Fc domain is a native IgGl Fc domain.
  • the native IgGl Fc domain comprises the amino acid sequence of SEQ ID NO: 23.
  • the Fc domain is a mutant IgGl Fc domain.
  • the mutant IgGl Fc domain comprises at least one mutation capable of reducing the ADCC activity of the bispecific antibody.
  • at least one mutation capable of reducing the ADCC activity of the bispecific antibody is an amino acid substitution.
  • at least one amino acid substitution comprises L234F, S239A, S239C, or any combination thereof.
  • the mutant IgGl Fc domain comprises at least one amino acid substitution introducing a derivatizable group. In some aspects, the derivatizable group in a sulfhydryl group.
  • the at least one amino acid substitution comprises S239C, 248C, 254C, 273C, 279C, 282C, 284C, 286C, 287C, 289C, 297C, 298C, 312C, 324C, 326C, 330C, 335C, 337C, 339C, 350C, 355C, 356C, 359C, 360C, 361C, 375C, 383C, 384C, 389C, 398C, 400C, 413C, 415C, 418C, 422C, 440C, 441C, S442C, 443C and 446C, or any combination thereof.
  • the mutant Fc domain comprises the amino acids of SEQ ID NO: 24 or SEQ ID NO:25.
  • bispecific anti-HER2 antibody comprising a first and a second polypeptide chain associated with each other, wherein the first polypeptide chain comprises a sequence selected from:
  • TZs is an scFv that binds the same epitope as trastuzumab
  • L 1; L 2 , L 3 , and L 4 are peptide linkers
  • Fcx is an Fc domain
  • B VH and B CH are the VH and CHI regions, respectively, of an antibody capable of binding to an HER2 epitope distinct from the epitope recognized by the trastuzumab antibody.
  • the distinct epitope comprises one or more amino acid residues in SEQ ID NO: 52.
  • a hinge polypeptide links [ B CH] and [Fc x ].
  • the hinge polypeptide comprises or alternatively consists of the amino acids of SEQ ID NO: 26.
  • the second chain of the bispecific anti-HER2 antibody comprises the sequence [ B VL]-[CL] wherein B VL is the VL region of an antibody capable of binding to an HER2 epitope distinct from the epitope recognized by the trastuzumab antibody, and CL is an IgG light chain constant region.
  • CL is selected from the group consisting of a human kappa constant region and a human lambda constant region.
  • the B VL comprises (i) a variable light chain CDR-1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions; (ii) a variable light chain CDR-2 (VL-CDR2) identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1, 2, 3, or 4 amino acid substitutions; and, (iii) a variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions.
  • B VL comprises the amino acids of SEQ ID NO: 16 or SEQ ID NO:44.
  • CL is a kappa light chain comprising the amino acid sequence of
  • CL is a lambda light chain comprising the amino acid sequence of SEQ ID NO:27B.
  • [TZ S ] comprises (i) a VH-CDR1 comprising the amino acids of
  • [TZs] is a disulfide stabilized scFv.
  • [TZs] comprises a VH comprising the amino acid sequence of SEQ ID NO: 17 and a VL comprising the amino acid sequence of SEQ ID NO: 18, covalently linked by a peptide linker.
  • the peptide linker comprises the amino acid sequence of SEQ ID NO: 19.
  • [TZs] comprises of the amino acid sequence of SEQ ID NO:28.
  • the amino acid sequence of [Fc x ] is selected from the group consisting of SEQ ID NOs: 23, 24A, 24B, 24C, 25A, 25B and 25C.
  • the amino acids of [L , [L 2 ], [L 3 ], and [L 4 ] is independently selected from the group consisting of SEQ ID NOs: 19, 20, 21, and 22.
  • [Li] comprises the amino acids of SEQ ID NO:20;
  • [L 2 ] comprises the amino acids of SEQ ID NO:20;
  • [iii) [L 3 ] comprises the amino acids of SEQ ID NO:21;
  • [iv) [L 4 ] comprises the amino acids of SEQ ID NO:22.
  • [ B VH] comprises (i) a variable heavy chain CDR-1 (VH-CDR1) identical to SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions; (ii) a variable heavy chain CDR-2 (VH-CDR2) identical to SEQ ID NO: 2 or identical to SEQ ID NO: 2 except for up to 1, 2, 3, or 4 amino acid substitutions; and (iii) a variable heavy chain CDR-3 (VH-CDR3) identical to SEQ ID NO: 3 or identical to SEQ ID NO: 3 except for up to 1, 2, 3, or 4 amino acid substitutions.
  • [ B VH] comprises SEQ ID NO: 15 or SEQ ID NO:43.
  • [ B CH] comprises the amino acid sequence of SEQ ID NO: 29.
  • [ B VL] comprises (i) a variable light chain CDR-1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions; (ii) a variable light chain CDR-2 (VL-CDR2) identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1, 2, 3, or 4 amino acid substitutions; and (iii) a variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions.
  • [ B VL] comprises the amino acids of SEQ ID NO: 16.
  • the first polypeptide chain of the bispecific anti-HER2 antibody comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 30, 31 A, 3 IB, 32A, 32B, 32C 33A, 33B, 33C, 34, 35A, 35B, 36A, 36B, 36C 37A, 37B, 37C 38, 39A, 39B, 40A, 40B, 40C, 41A, 41B and 41C, and the second polypeptide chain of the bispecific anti-HER2 antibody comprises the amino acids of SEQ ID NO:42A or 42B.
  • the second immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody induces internalization upon binding to the HER2 target. In some aspects, the second immunoglobulin antigen-binding domain of the bispecific HER2 antibody promotes effective lysosomal trafficking following internalization. In some aspects, the second immunoglobulin antigen-binding domain of the bispecific HER2 antibody induces HER2 target degradation. In some aspects, the second immunoglobulin antigen-binding domain of the bispecific HER2 antibody blocks ligand- induced AKT phosphorylation in low HER2-expressing cancer cells. In some aspects, the first immunoglobulin antigen-binding domain of the bispecific HER2 antibody disrupts ligand-induced HER2:HER3 dimerization.
  • the present disclosure also provides an ADC comprising an anti-HER2 binding molecule disclosed herein, or an anti-HER2 bispecific antibody disclosed herein, further comprising at least one therapeutic moiety.
  • the ADC further comprises at least one optional spacer.
  • the at least one spacer is a peptidic spacer.
  • the at least one spacer is a nonpeptidic spacer.
  • the ADC is randomly conjugated to a therapeutic moiety.
  • site-specific conjugation of therapeutic moieties to antibodies using reactive amino acid residues at specific positions yields homogeneous ADC preparations with uniform stoichiometry.
  • the ADC comprises two, three, or four or more therapeutic moieties. In some aspects, all therapeutic moieties are the same.
  • each therapeutic moiety is chemically conjugated to the side chain of an amino acid at a specific Kabat position in the Fc region of the bispecific antibody.
  • the specific Kabat positions are 239, 442, or both. In some aspects, the specific positions are Kabat position442, an amino acid insertion between Kabat positions 239 and 240, or both. In some aspects, the amino acid side chain is a sulfhydryl side chain.
  • the therapeutic moiety comprises a cytotoxin, a radioisotope, an auristatin, a maytansinoid or a pyrrolobenzodiazepine (PBD), or combinations thereof.
  • the cytotoxin is tubulysin. In certain aspects, the tubulysin is Compound T32 (also referred to herein as "tubulysin 1508" or simply "1508").
  • the present disclosure also provides an ADC comprising a bispecific anti-HER2 antibody, wherein said antibody comprises:
  • a first polypeptide chain comprising the amino acids of SEQ ID NO: 32 and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a tubulysin molecule covalently linked to a cysteine amino acid at Kabat position 239.
  • a first polypeptide chain comprising the amino acids of SEQ ID NO:41 and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two tubulysin molecules covalently linked to cysteine amino acids respectively located at Kabat positions 239 and 442.
  • the instant disclosure also provides an isolated nucleic acid molecule or a set of nucleic acid molecules encoding an anti-HER2 binding molecule (e.g., a bispecific anti- HER2 antibody disclosed herein), or a complement thereof. Also provided is a vector or a set of vectors comprising such nucleic acid molecule or set of the nucleic acid molecules, or a complement thereof. Also provided is a host cell comprising the isolated nucleic acid molecule or a set of nucleic acid molecules, or the vector or set of vectors. Also provided is a host cell expressing an anti-HER2 binding molecule or bispecific anti-HER2 antibody disclosed herein. Also provided is a method for producing an anti-HER2 binding molecule or bispecific anti-HER2 antibody comprising culturing the host cell and recovering the antibody from the culture medium.
  • an anti-HER2 binding molecule e.g., a bispecific anti- HER2 antibody disclosed herein
  • the instant disclosure also provides a pharmaceutical composition comprising an anti-HER2 binding molecule or anti-HER2 bispecific antibody, and a pharmaceutically acceptable carrier. Also provided is a method of treating a HER2-expressing cancer comprising administering an anti-HER2 binding molecule disclosed herein, an anti-HER2 bispecific antibody disclosed herein, an ADC disclosed herein, or a pharmaceutical composition disclosed herein to a subject in need thereof.
  • the cancer is a low HER2-expressing cancer.
  • the method further comprises administering at least one additional therapeutic agent.
  • the at least one additional therapeutic agent is a radionuclide or a chemotherapeutic agent.
  • a method to target a therapeutic or prophylactic agent to the surface of cells expressing HER2 comprising conjugating the agent to an anti-HER2 binding molecule disclosed herein, or an anti-HER2 bispecific antibody disclosed herein.
  • a method to increase the activity of a therapeutic moiety comprising conjugating the agent to an anti-HER2 binding molecule disclosed herein, or an anti-HER2 bispecific antibody disclosed herein.
  • a method to improve the pharmacokinetic properties of a therapeutic or prophylactic agent comprising conjugating the agent to an anti-HER2 binding molecule disclosed herein, or an anti-HER2 bispecific antibody disclosed herein.
  • the therapeutic moiety is a cytotoxin.
  • the cytotoxin is tubulysin.
  • the tubulysin is Compound T32, also referred to herein as "tubulysin 1508" or simply "1508".
  • a method to treat resistance to a HER2-targeting therapeutic agent comprising administering a bispecific HER2 antibody disclosed herein, an anti-HER2 binding molecule disclosed herein, or an ADC disclosed herein to a patient in need thereof.
  • the patient is resistant to a HER2- targeting therapeutic agent comprising trastuzumab and/or the maytansinoid DM1.
  • FIG. 1 shows a sequence alignment corresponding to the amino acid sequences of the VL and VH regions of the lead optimized 39S antibody (LO) and the parent AZ 1.39.1 antibody (WT). The location of CDR1, CDR2, and CDR3 is indicated. Amino acid residues which differ with respect to the parent antibody are highlighted. Replaced framework regions in VL region are also highlighted.
  • FIG. 2. shows that changing the light chain frameworks to germline IGKV2D resulted in a doubling of expression.
  • FIG. 3. Shows a ribbon representation of the structure of the extracellular domain of HER2.
  • the binding sites of the 39S, pertuzumab and the domain IV scFv are indicated with arrows.
  • the binding site of 39S includes amino acids within domain II that are distinct from those of pertuzumab.
  • FIG. 4 shows FACS competition assays using DL-680-labeled 39S (2 iglm ⁇ ) and varying concentrations of unlabeled monoclonal antibodies (R347 control, trastuzumab, pertuzumab, AZ 1.39.1, and 39S).
  • FIG. 5 shows ligand-dependent proliferation assays using different antibody combinations and the cell line MCF-7, demonstrating that 39S synergistically inhibits the growth of the assayed cell lines when administered in combination with trastuzumab and/or pertuzumab.
  • the antibody samples plotted are: R347 control, trastuzumab, pertuzumab plus trastuzumab, 39S, 39S plus trastuzumab, and 39S plus pertuzumab.
  • FIG. 6 shows ligand-dependent proliferation assays using different antibody combinations and the cell line NCI-N87 demonstrating that 39S synergistically inhibits the growth of the assayed cell lines when administered in combination with trastuzumab and/or pertuzumab.
  • the antibody samples plotted are: R347 control, trastuzumab, pertuzumab plus trastuzumab, 39S, 39S plus trastuzumab, and 39S plus pertuzumab.
  • FIG. 7 depicts bispecific constructs in which an HER2-binding moiety (a cysteine- stabilized scFv that binds within domain IV) has been genetically fused to different locations within the structure of the 39S antibody.
  • the scFv was fused to the carboxy-terminus of each one of the heavy chains of the 39S antibody (referred to as "Bs3Ab-39SH”) (FIG. 7B), fused to the amino-terminus of each one of the heavy chains of the 39S antibody (referred to as "Bs2Ab-39SH”) (FIG. 7A), or intercalated between the CHI and CH2 regions of each one of the heavy chains of the 39S antibody (referred to as "Bs4Ab-39SH”) (FIG. 7C).
  • Bs3Ab-39SH the carboxy-terminus of each one of the heavy chains of the 39S antibody
  • Bs2Ab-39SH fused to the amino-terminus of each one of the heavy chains of the 39S antibody
  • FIG. 8A shows the sequences of the heavy chains of Bs2 antibodies, indicating the amino acids at Kabat locations 234, 239, 239-ins, 330, 332 and 442 in wild-type heavy chains and heavy chains which may be optimized for ADCC activity or for the production of ADCs that have reduced ADCC activity and/or site specific conjugation.
  • FIG. 8B shows the sequences of the heavy chains of Bs3 antibodies, indicating the amino acids at Kabat locations 234, 239, 239-ins, 330, 332 and 442 in wild-type heavy chains and heavy chains which may be optimized for ADCC activity or for the production of ADCs that have reduced ADCC activity and/or site specific conjugation.
  • FIG. 8C shows the sequences of the heavy chains of Bs4 antibodies, indicating the amino acids at Kabat locations 234, 239, 239-ins, 330, 332 and 442 in wild-type heavy chains and heavy chains which may be optimized for ADCC activity or for the production of ADCs that have reduced ADCC activity and/or site specific conjugation.
  • FIG. 9A shows ligand-dependent proliferation assays using different bispecific antibody constructs and MDA-MB-361 cells demonstrating that Bs2Ab-39SH, Bs3Ab- 39SH and Bs4Ab-39SH have similar potency in MDA-MB-361 and MCF-7 cells (FIG. 9A and 9B, respectively), which is also comparable to the activity of parental antibody combination (39S plus trastuzumab).
  • the antibody samples plotted are: R347 control, Bs2Ab-39SH, Bs3Ab-39SH, Bs4Ab-39SH, and 39S plus trastuzumab.
  • FIG. 9B shows ligand-dependent proliferation assays using different bispecific antibody constructs and MCF-7 cells demonstrating that Bs2Ab-39SH, Bs3Ab-39SH and Bs4Ab-39SH have similar potency in MDA-MB-361 and MCF-7 cells (FIG. 9A and 9B, respectively), which is also comparable to the activity of parental antibody combination (39S plus trastuzumab).
  • the antibody samples plotted are: R347 control, Bs2Ab-39SH, Bs3Ab-39SH, Bs4Ab-39SH, and 39S plus trastuzumab.
  • FIG. 10 shows immunoprecipitation (IP) of HER2 from T47D cells followed by
  • FIG. 11 shows the representative HPLC size-exclusion chromatography profiles showing the size separation of immune complexes derived from antibody: HER2 molar ratio of 1: 1.
  • Bs2Ab-39SH can cross-link many HER2 molecules to form complexes as large as 1716 kDa in size, while trastuzumab can only bind to two HER2 molecules in maximal to form a 320 kDa complex.
  • FIG. 12 presents FACS -based receptor internalization assays showing that the three formats of HER2 bispecific antibodies presented in FIG. 6 internalized rapidly in the cell line BT-474. Plotted on the graph are: R347 control, trastuzumab, 39S, trastuzumab plus 39S, Bs2Ab-39SH, Bs3Ab-39SH, and BsAb-39SH. Similar results were seen in MCF-7 , T47D , RT-112 , MDA-MB-361, and NCI-N87 cell lines (data not shown)..
  • FIG. 13 shows the kinetics of Bs2Ab-39SH internalization by BT-474 cells.
  • FIG. 14 is a Western immunoblot showing the degree of degradation of HER2, or lack thereof, 2 hours, 6 hours, and 24 hours after incubation of BT-474 cells with antibody samples. GAPDH was used as control.
  • the tested antibody samples were: (lane 1) R347 control antibody, (lane 2) trastuzumab, (lane 3) pertuzumab, (lane 4) trastuzumab and pertuzumab, (lane 5) 39S, (lane 6) trastuzumab and 39S, (lane 7) pertuzumab and 39S, (lane 8) trastuzumab, pertuzumab and 39S, (lane 9) Bs2Ab-39SH, (lane 10) Bs2Ab-39SH_aFuc (homogenously afucosylated Bs2Ab-39SH), (lane 11) Bs3Ab-39SH, (lane 12) Bs3Ab-39SH_aFuc (homogenously afucosylated Bs3Ab- 39SH_aFuc), (lane 13) Bs4Ab-39SH, and (lane 14) Bs4Ab-39SH_aFuc (homogenously afucosylated Bs4Ab-
  • FIG. 15 is a detailed cartoon representations of exemplary ADCs derived from the Bs2Ab-39SH (panel A), the Bs3Ab-39SH (panel B) and the Bs4Ab-39SH (panel C) anti-HER2 constructs.
  • Two potential engineered cytotoxic agent conjugation sites in the CH2 and CH3 domains of the ADC constructs are indicated by circles. Where the desired drug-to-antibody ratio (DAR) is 2 to 1 either site 1 or site 2 may be used. Where a DAR of 4 is desirable both sites 1 and 2 are utilized. Alternative and/or additional sites may be engineered.
  • DAR drug-to-antibody ratio
  • bispecific anti-HER2 ADCs are abbreviated herein as "Bs2Ab-2T”, “Bs3Ab-2T” and “Bs4Ab-2T” (or simply as “Bs2-2T”, “Bs3-2T” and “Bs4-2T”) for the ADCs having a DAR of ⁇ 2 and as “Bs2Ab-4T”, “Bs3Ab-4T” and “Bs4Ab-4T” (or simply as “Bs2-4T”, “Bs3-4T” and “Bs4-4T”) for the ADCs having a DAR of ⁇ 4.
  • the bispecific constructs lacking any cytotoxic agent are referred by the designations provided in Figure 7 and may be identified as "unarmed.”
  • the engineered conjugate sites may be selected to reduce or ablate ADCC functions.
  • Fc portion of the antibody may further comprise additional mutations which reduce or ablate ADCC activity.
  • an ADC may be generated using a classic conjugation method such as conjugating to antibodies through the often-numerous lysine residues or native cysteine residues of an antibody, generating a heterogeneous antibody-drug conjugate mixture.
  • FIG. 16A presents immunofluorescence images of SKOV-3 cells treated with 1 ⁇ g/ml of the antibody indicated under each image, showing the disruption of the intracellular microtubule network or lack thereof. Microtubule staining is shown. The following samples were tested: media control without any antibody (image i), R347 control antibody (image ii), trastuzumab (image iii), Bs2Ab-39SH (image iv), R347-DM1 (R347 control antibody conjugated to the cytotoxic agent maytansinoid DM1) (image v), R347-4T (R347 control antibody conjugated to 4 molecules of the cytotoxic agent tubulysin) (image vi), T-DMl (trastuzumab conjugated to maytansinoid DM1) (image vii), and Bs2-4T (Bs2Ab-39SH conjugated to 4 molecules of the cytotoxic agent tubulysin) (image viii).
  • FIG. 16B presents immunofluorescence images of JIMT-1 cells treated with 1 ⁇ g/ml of the antibody indicated under each image, showing the disruption of the intracellular microtubule network or lack thereof. Microtubule staining is shown. The following samples were tested: media control without any antibody (image i), R347 control antibody (image ii), trastuzumab (image iii), Bs2Ab-39SH (image iv), R347-DM1 (R347 control antibody conjugated to the cytotoxic agent maytansinoid DM1) (image v), R347-4T (R347 control antibody conjugated to 4 molecules of the cytotoxic agent tubulysin) (image vi), T-DMl (trastuzumab conjugated to maytansinoid DM1) (image vii), and Bs2-4T (Bs2Ab-39SH conjugated to 4 molecules of the cytotoxic agent tubulysin) (image viii).
  • FIG. 16C presents immunofluorescence images of RT-112 cells treated with 1 ⁇ g/ml of the antibody indicated under each image, showing the disruption of the intracellular microtubule network or lack thereof. Microtubule staining is shown. The following samples were tested: media control without any antibody (image i), R347 control antibody (image ii), trastuzumab (image iii), Bs2Ab-39SH (image iv), R347-DM1 (R347 control antibody conjugated to the cytotoxic agent maytansinoid DM1) (image v), R347-4T (R347 control antibody conjugated to 4 molecules of the cytotoxic agent tubulysin) (image vi), T-DMl (trastuzumab conjugated to maytansinoid DM1) (image vii), and Bs2-4T (Bs2Ab-39SH conjugated to 4 molecules of the cytotoxic agent tubulysin) (image viii).
  • FIG. 17A shows the cytotoxic activity of the Bs2Ab format with a DAR of 2 or 4 relative to the T-DMl, non conjugated (unarmed) Bs2Ab-39SH and trastuzumab on the SKBR-3 human breast cancer cell line. Also shown are the curves for R347 (R347 control antibody), R347 conjugated with 2 or 4 tubulysins (R347-2T and R3474T respectively) R347 conjugated to DM1. Both Bs2-2T and Bs2-4T are more potent than T- DM1.
  • FIG. 17B shows the cytotoxic activity the Bs4Ab format with a DAR of 2 or 4
  • FIG. 18A shows the cytotoxic activity of the Bs2Ab format with a DAR of 2 or 4 relative to the T-DM1, non conjugated (unarmed) Bs2Ab-39SH and trastuzumab on the JIMT-1 human breast cancer cell line. Also shown are the curves for R347 (R347 control antibody), R347 conjugated with 2 or 4 tubulysins (R347-2T and R3474T respectively) R347 conjugated to DM1. Both Bs2-2T and Bs2-4T are very potent in killing JIMT-1 cells, while T-DM1 shows no activity.
  • FIG. 18B shows the cytotoxic activity of the Bs4Ab format with a DAR of 2 or 4
  • FIG. 19A shows the cytotoxic activity of the Bs2Ab format with a DAR of 2 or 4 relative to the T-DM1, non conjugated (unarmed) Bs2Ab-39SH and trastuzumab on the ZR-75-1 human breast cancer cell line. Also shown are the curves for R347 (R347 control antibody), R347 conjugated with 2 or 4 tubulysins (R347-2T and R3474T respectively) R347 conjugated to DM1.
  • Bs2-4T is the most active in killing ZR-75-1 cells, while Bs2-2T has a lower level of activity and T-DM1 shows no or limited cytotoxic activity.
  • FIG. 19B shows the cytotoxic activity of the Bs4Ab format with a DAR of 2 or 4
  • FIG. 20 shows the cytotoxic activity of the Bs2Ab format with a DAR of 2 or 4
  • FIG. 21A shows the activity of anti-HER2 ADC activity in the MDA-MB-361 tumor model. Shown are the tumor growth curves corresponding to mice treated with (1) vehicle control, (2) R347-4T (R347 control antibody conjugated to 4 tubulysin molecules) at 3 mg/kg, (3) T-DMl (trastuzumab-DMl ADC) at 3 mg/kg, (4) Bs2 ADMix (Bs2Ab-39SH-(FCC) construct mixed with tubulysin) at 3 mg/kg, and (5) Bs2-4T (Bs2Ab-39SH-(FCC) construct conjugated to 4 tubulysins) at 0.3, 1 and 3 mg/kg. Concentrations are indicated between parenthesis.
  • FIG. 21B shows the activity of anti-HER2 ADC activity in the MDA-MB-361 tumor model. Shown are the tumor growth curves corresponding to mice treated with (1) vehicle control, (2) R347-4T (R347 control antibody conjugated to 4 tubulysin molecules) at 3 mg/kg, (3) T-DMl (trastuzumab-DMl ADC) at 3 mg/kg, (4) Bs4 ADMix (Bs4Ab-39SH-(FCC) construct mixed with tubulysin) at 3 mg/kg, and (5) Bs4-4T (Bs4Ab-39SH-(FCC) conjugated to 4 tubulysins) at 0.3, 1 and 3 mg/kg. Concentrations are indicated between parenthesis.
  • FIG. 22 shows the activity of anti-HER2 ADC in the ST996 triple-negative (ER-1)
  • PDX tumor model Shown are the tumor growth curves corresponding to mice treated with (1) vehicle control (CTRL), (2) isotype R347-2T CTRL (R347 control antibody conjugated to 2 tubulysin molecules), (3) isotype R347-4T CTRL (R347 control antibody conjugated to 4 tubulysin molecules), (4) T-DMl (trastuzumab-DMl ADC), (5) ADMix (construct mixed with tubulysin), (6) Bs2-2T, i.e., Bs2Ab-39SH-(FCC) construct conjugated to 2 tubulysins, or (7) Bs2-4T, i.e., Bs2Ab-39SH-(FCC) construct conjugated to 4 tubulysins. Concentrations are indicated between parenthesis. Time of dosing is also indicated by arrows. Tumor growth curves in response to the various treatments are presented as the mean tumor volume (mm ) ⁇ SEM.
  • FIG. 23 shows the activity of anti-HER2 ADC activity in the ST225 (HER2-3+)
  • BrCa PDX tumor model Shown are the tumor growth curves corresponding to mice treated with (1) vehicle control, (2) R347-4T (R347 control antibody conjugated to 4 tubulysin molecules), (3) T-DM1 (trastuzumab-DMl ADC), (4) BS2 ADMix (Bs2Ab- 39SH-(FCC) construct mixed with tubulysin), and (5) Bs2-4T (Bs2Ab-39SH-(FCC) construct conjugated to 4 tubulysins. Concentrations are indicated between parenthesis.
  • FIG. 24 shows the activity of anti-HER2 ADC activity in the T-DM-1 non- responder JIMT-1 (HER2-3+) BrCa CBX tumor model. Shown are the tumor growth curves corresponding to mice treated with (1) vehicle control, (2) R347-4T (R347 control antibody conjugated to 4 tubulysin molecules), (3) T-DM1 (trastuzumab-DMl ADC), (4) BS2 ADMix (Bs2Ab-39SH-(FCC) construct mixed with tubulysin), and (5) Bs2-4T (Bs2Ab-39SH-(FCC) construct conjugated to 4 tubulysins. Concentrations are indicated between parenthesis.
  • FIG. 25 shows the activity of anti-HER2 ADC activity in the ST455B triple- negative (ER-/PR-/HER2-1+) BrCa PDX tumor model. Shown are the tumor growth curves corresponding to mice treated with (1) vehicle control (CTRL), (2) isotype CTRL (R347 control antibody conjugated to 4 tubulysin molecules), (3) T-DM1 (trastuzumab- DMl ADC), (4) BS2 ADMix (Bs2Ab-39SH-(FCC) construct mixed with tubulysin), and (5) Bs2-4T (Bs2Ab-39SH-(FCC) construct conjugated to 4 tubulysins. Concentrations are indicated between parenthesis.
  • FIG. 26A shows the cytotoxic activity Bs2-4T and T-DM1 on a parental NCI-
  • N87 cell line left panel
  • NCI-N87 cell line with acquired resistance to T-DM1 right panel
  • Bs2-4T has more potent activity in the parent cell line and is still active in killing the T-DM1 resistant cells.
  • FIG. 28A shows a schematic for an assay to evaluate the bystander effect of the
  • FIG. 28B shows FACS analysis results of cells treated with (i) media alone; (ii)
  • FIG. 29 shows the activity of Bs2-4T on cancer stem cell (CSC) sphere formation
  • FIG. 30A shows ligand-dependent proliferation assays using the cell line MDA-
  • FIG. 30B shows ligand-dependent proliferation assays using the cell line MCF-7
  • FIG. 31A shows ADCC cytotoxicity assays using the MDA-MB-361 cells as the target and engineered NK effector cells (stably expressing CD 16), which showed that each of the afucosylated bispecific antibodies has more potent ADCC activity as compared to the same construct having fucosylated glycoforms.
  • the antibody samples used were: (1) R347 control, (2) trastuzumab, (3) trastuzumab_aFuc, (4) Bs2Ab-39SH, and (5) Bs2Ab-39SH_aFuc,
  • FIG. 31B shows ADCC cytotoxicity assays using the MDA-MB-361 cells as the target and engineered NK effector cells (stably expressing CD 16), which showed that each of the afucosylated bispecific antibodies has more potent ADCC activity as compared to the same construct having fucosylated glycoforms.
  • the antibody samples used were: (1) R347 control, (2) trastuzumab, (3) trastuzumab_aFuc, (4) Bs3Ab-39SH, and (5) Bs3Ab-39SH_aFuc.
  • FIG. 31C shows ADCC cytotoxicity assays using the MDA-MB-361 cells as the target and engineered NK effector cells (stably expressing CD 16), which showed that each of the afucosylated bispecific antibodies has more potent ADCC activity as compared to the same construct having fucosylated glycoforms.
  • the antibody samples used were: (1) R347 control, (2) trastuzumab, (3) trastuzumab_aFuc, (4) Bs4Ab-39SH, and (5) Bs4Ab-39SH_aFuc.
  • FIG. 32 shows the structure of the tubulysin 1508 payload.
  • the double bond of the maleimide group at the far right readily reacts with the thiol group found on cysteine to form a stable carbon-sulfur bond.
  • FIG. 33 shows an exemplary site-specific antibody drug conjugation process, using the Bs2Ab-FCC construct as the derivatizable platform.
  • the process comprises the steps of (a) uncapping the size chains of the derivatizable amino acids (e.g., cysteines), (b) oxidizing, (c) conjugating a payload (e.g., a cytotoxic agent such as tubulysin), and (d) polishing by removing conjugation reagents and non-reacted payload.
  • a payload e.g., a cytotoxic agent such as tubulysin
  • the present disclosure provides optimized anti-HER2 antibodies, and bispecific antibodies derived from such optimized anti-HER2 antibodies.
  • Related polynucleotides, vectors, cells, and pharmaceutical compositions comprising such optimized anti-HER2 antibodies or bispecific anti-HER2 antibodies are also provided.
  • methods of making such optimized anti-HER2 antibodies or bispecific antibodies are also provided.
  • the disclosure provides are methods of using the optimized anti-HER2 antibodies or bispecific anti-HER2 antibodies, for example, methods of treating cancer in a subject in need thereof.
  • the present disclosure also provides antibody-drug conjugates (ADC) derived from optimized anti-HER2 antibodies and bispecific antibodies derived from such optimized anti-HER2 antibodies. Also provided are methods of making ADC derived from such optimized antibodies and bispecific antibodies. Also provided are methods of using the ADC derived from optimized anti-HER2 antibodies and bispecific antibodies, for example, methods of treating cancer in a subject in need thereof. Also provided are methods to treat patients with cancers resistant to chemotherapy (e.g., tumors in T-DM1 non-responder or poor-responder patients); to treat patients that are relapsed, refractory, on non-eligible to be treated with other therapies, in particular mono- specific ADC therapies (e.g. T-DM1); or to treat patients after pretreatment with other therapies (e.g. T- DM1).
  • ADC antibody-drug conjugates
  • the instant disclosure provides anti-HER2 binding molecules that are suitable for treating cancer expressing low levels of HER2.
  • HER2 and "HER2 receptor” are used interchangeably herein, and refer to the ErbB2 protein (also referred to as HER2/neu in the literature). As used herein, the terms are intended to include variants (e.g., splice variants), isoforms, and homologs of HER2 (both orthologs and paralogs).
  • binding of an anti-HER2 binding molecule disclosed herein to HER2 inhibits the growth of cells expressing HER2 (i.e. typically tumor cells, and in particular cancer cells expressing low levels of HER2) by inhibiting formation of heteromeric complexes between HER2 and other ErbB family members, e.g. inhibiting heterodimerization with EGFR or HER3.
  • HER2 i.e. typically tumor cells, and in particular cancer cells expressing low levels of HER2
  • HER2 is a receptor tyrosine kinase and is composed of an extracellular domain
  • ECD which consists of (i) two leucine-rich domains (domain I/Ll and domain III/L2) responsible for ligand binding, and (ii) two cysteine-rich domains (domain II/CR1 and domain IV/CR2) responsible for receptor dimerization; a transmembrane domain; and an intracellular tyrosine kinase domain.
  • Alternative splice variants of HER2 exist. Examples of alternative splice variants of HER2 include pi 00 and herstatin (two soluble forms), as well as 611-CTF, 687-CTF, 648-CTF, and A16HER2.
  • HER2 can interact of with full-length receptors (pi 85) and inhibit receptor dimerization; 687-CTF is inactive; 611-CTF and 648-CTF can activate several intracellular signal transduction pathways; and A16HER2 lacks the amino acids 634-649 in domain IV, which induce a conformational change that promotes the formation of constitutively activated HER2 homodimers.
  • the pertuzumab antibody binds to an epitope within domain II of HER2.
  • Antibodies that do not bind to the pertuzumab binding epitope within domain II include trastuzumab, which binds to an epitope within domain IV.
  • inhibitor refers to any statistically significant decrease in biological activity, including full blocking of the activity.
  • inhibitor can refer to a decrease of about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100% in biological activity.
  • the term refers to the ability of an anti-HER2 antibody or a HER2-binding molecule comprising an antigen binding fragment thereof, to statistically significantly decrease the phosphorylation of HER2 induced by an EGF-like ligand, relative to the phosphorylation in an untreated (control) cell.
  • the cell which expresses HER2 can be a naturally occurring cell or cell line (e.g. , a cancer cell) or can be recombinantly produced by introducing a nucleic acid encoding HER2 into a host cell.
  • the anti-HER2 binding molecule e.g.
  • an anti-HER2 antibody or a HER2-binding molecule comprising an antigen binding fragment thereof inhibits ligand mediated phosphorylation of HER2 by at least 10%, or at least 20%, or at least 30%, or at least 40%, or at least 50%, or at least 60%, or at least 70%, or at least 80%, or at least 905, or about 100%, as determined, for example, by Western blotting followed by probing with an anti-phosphotyrosine antibody or by ELISA.
  • HER2 refers to the ability of anti-HER2 binding molecule, e.g. , an anti- HER2 antibody or a HER2-binding molecule comprising an antigen-binding fragment thereof, to statistically significantly decrease proliferation of cells expressing HER2 relative to the proliferation in the absence of the anti-HER2 binding molecule.
  • the proliferation of cells expressing HER2 e.g., cancer cells
  • an anti-HER2 antibody or a HER2- binding molecule comprising an antigen-binding fragment thereof relative to the proliferation measured in the absence of the anti-HER2 binding molecule (control conditions).
  • Cell proliferation can be measured according to various methods known in the art, e.g., by counting the number of viable cells, identifying the presence of markers of growth markers, measuring the incorporation of molecules (e.g., radioactively labelled molecules such a H-thymidine), by measuring the size of a tumor (e.g, by volume or by weight), etc.
  • growth suppression refers to reduction in the number, size, or distribution of metastases.
  • anti-HER2 binding molecule refers, for example, to (i) antibodies and antigen-binding fragments thereof which bind the same epitope as or are derived from the 1.39.1 antibody (see PCT Publ. No.
  • WO 2008/019290 disclosed in the instant application, e.g., the 39S antibody and antigen-binding fragments thereof, and in general molecules comprising such antibodies and antigen-binding fragments thereof; (ii) anti-HER2 antibodies and other HER2- binding molecules which bind the same epitope as or are derived from the 39S antibody which incorporate additional antigen-binding moieties, e.g., bispecific antibodies; (iii) antibody-drug conjugates (ADC) comprising at least one of the molecules according to (i) or (ii) conjugated to a cytotoxic moiety ⁇ e.g., a small molecule anticancer agent, a radionuclide, etc.), and (iv) anti-HER2 molecules according to (i) or (ii) having enhanced ADCC.
  • ADC antibody-drug conjugates
  • 39S antibody refers to a lead optimized monoclonal antibody derived from the 1.39.1 antibody disclosed in PCT Publ. No. WO 2008/019290, wherein said optimized antibody comprises a VH comprising the amino acids of SEQ ID NO: 15 and a VL comprising the amino acids of SEQ ID NO: 16.
  • tubulysin refers both collectively and individually to the naturally occurring tubulysins, and analogs and derivatives of tubulysins.
  • Illustrative examples of tubulysins are disclosed, for example, in WO2004005326A2, WO2012019123A1, WO2009134279A1, WO2009055562A1, WO2004005327A1, US7754885, US20100240701, US7816377, US20110021568, and US20110263650 and in the Examples provided herein.
  • such derivatives include, for example, tubulysin prodrugs or tubulysins that include one or more protection or protecting groups, one or more linking moieties.
  • Cellular proliferation can be assayed using art recognized techniques which measure rate of cell division, and/or the fraction of cells within a cell population undergoing cell division, and/or rate of cell loss from a cell population due to terminal differentiation or cell death ⁇ e.g., thymidine incorporation).
  • antibody or “immunoglobulin,” as used interchangeably herein, include whole antibodies and any antigen binding fragment or single chains thereof and combinations thereof (e.g., bispecific antibodies).
  • a typical antibody comprises at least two heavy (H) chains and two light (L) chains interconnected by disulfide bonds.
  • Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region (abbreviated herein as CH).
  • the heavy chain constant region is comprised of three domains, CHI, CH2, and CH3.
  • Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region.
  • the light chain constant region is comprised of one domain, CL.
  • VH and VL regions can be further subdivided into regions of hypervariability, termed Complementarity Determining Regions (CDR), interspersed with regions that are more conserved, termed framework regions (FW).
  • CDR Complementarity Determining Regions
  • FW framework regions
  • Each VH and VL is composed of three CDRs and four FWs, arranged from amino-terminus to carboxy-terminus in the following order: FW1, CDR1, FW2, CDR2, FW3, CDR3, FW4.
  • the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g. , effector cells) and the first component (Clq) of the classical complement system.
  • Exemplary antibodies of the present disclosure include typical antibodies, scFvs, and combinations thereof where, for example, an scFv is covalently linked (for example, via peptidic bonds or via a chemical linker) to the N- terminus of either the heavy chain and/or the light chain of a typical antibody, or intercalated in the heavy chain and/or the light chain of a typical antibody.
  • an scFv is covalently linked (for example, via peptidic bonds or via a chemical linker) to the N- terminus of either the heavy chain and/or the light chain of a typical antibody, or intercalated in the heavy chain and/or the light chain of a typical antibody.
  • antibody means an immunoglobulin molecule that recognizes and specifically binds to a target, such as a protein, polypeptide, peptide, carbohydrate, polynucleotide, lipid, or combinations of the foregoing through at least one antigen recognition site within the variable region of the immunoglobulin molecule.
  • antibody encompasses intact polyclonal antibodies, intact monoclonal antibodies, antibody fragments (such as Fab, Fab', F(ab')2, and Fv fragments), single chain variable fragment (scFv), disulfide stabilized scFvs, multispecific antibodies such as bispecific antibodies generated from at least two intact antibodies and/or antigen binding fragments thereof, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antigen determination portion of an antibody, and any other modified immunoglobulin molecule comprising an antigen recognition site so long as the antibodies exhibit the desired biological activity.
  • antibody fragments such as Fab, Fab', F(ab')2, and Fv fragments
  • scFv single chain variable fragment
  • disulfide stabilized scFvs multispecific antibodies such as bispecific antibodies generated from at least two intact antibodies and/or antigen binding fragments thereof, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antigen determination portion of an antibody, and any other modified immunoglob
  • An antibody can be of any the five major classes of immunoglobulins: IgA, IgD,
  • IgE, IgG, and IgM or subclasses (isotypes) thereof (e.g. IgGl, IgG2, IgG3, IgG4, IgAl and IgA2), based on the identity of their heavy-chain constant domains referred to as alpha, delta, epsilon, gamma, and mu, respectively.
  • the different classes of immunoglobulins have different and well known subunit structures and three- dimensional configurations.
  • Antibodies can be naked or conjugated to other molecules such as toxins, radioisotopes, etc. to form ADCs.
  • a “blocking" antibody or an “antagonist” antibody is one which inhibits or reduces biological activity of the antigen it binds, such as HER2.
  • blocking antibodies or antagonist antibodies substantially or completely inhibit the biological activity of the antigen. Desirably, the biological activity is reduced by 10%, 20%, 30%, 50%, 70%, 80%, 90%, 95%, or even 100%.
  • anti-HER2 antibody refers to an antibody that is capable of binding HER2 with sufficient affinity such that the antibody is useful as a therapeutic agent or diagnostic reagent in targeting HER2.
  • the extent of binding of an anti-HER2 antibody to an unrelated, non-HER2 protein is less than about 10% of the binding of the antibody to HER2 as measured, e.g., by a radioimmunoassay (RIA), or BIACORETM (using recombinant HER2 as the analyte and antibody as the ligand, or vice versa), or other binding assays known in the art.
  • RIA radioimmunoassay
  • BIACORETM using recombinant HER2 as the analyte and antibody as the ligand, or vice versa
  • an antibody that binds to HER2 has a dissociation constant (K D ) of ⁇ 1 ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 10 pM, ⁇ 1 pM, or ⁇ 0.1 pM.
  • antigen binding fragment refers to a portion of an intact antibody and refers to the antigenic determining variable regions of an intact antibody. It is known in the art that the antigen binding function of an antibody can be performed by fragments of a full-length antibody. Examples of antibody fragments include, but are not limited to Fab, Fab', F(ab')2, and Fv fragments, linear antibodies, single chain antibodies, and multispecific antibodies formed from antibody fragments.
  • a "monoclonal antibody” refers to a homogeneous antibody population involved in the highly specific recognition and binding of a single antigenic determinant, or epitope. This is in contrast to polyclonal antibodies that typically include different antibodies directed against different antigenic determinants.
  • the term "monoclonal antibody” encompasses both intact and full-length monoclonal antibodies as well as antibody fragments (such as Fab, Fab', F(ab')2, Fv), single chain variable fragments (scFv), fusion proteins comprising an antibody portion, and any other modified immunoglobulin molecule comprising an antigen recognition site.
  • “monoclonal antibody” refers to such antibodies made in any number of ways including, but not limited to, by hybridoma, phage selection, recombinant expression, and transgenic animals (e.g., expression of a human antibody in a transgenic mouse).
  • humanized antibody refers to an antibody derived from a non-human
  • humanized antibodies are human immunoglobulins in which residues from the CDRs are replaced by residues from the CDRs of a non-human species (e.g., mouse, rat, rabbit, or hamster) that have the desired specificity, affinity, and capability (Jones et al., 1986, Nature, 321:522-525; Riechmann et al, 1988, Nature, 332:323-32 ' / '; Verhoeyen et al, 1988, Science, 239: 1534-1536).
  • the FW residues of a human immunoglobulin are replaced with the corresponding residues in an antibody from a non-human species that has the desired specificity, and/or affinity, and/or capability.
  • the humanized antibody can be further modified by the substitution of additional residues either in the FW regions and/or within the replaced non-human residues to refine and optimize antibody specificity, and/or affinity, and/or capability.
  • the humanized antibody will comprise substantially all of at least one, and typically two or three, variable domains containing all or substantially all of the CDR regions that correspond to the non-human immunoglobulin whereas all or substantially all of the FW regions are those of a human immunoglobulin consensus sequence.
  • the humanized antibody can also comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin. Examples of methods used to generate humanized antibodies are described in U.S. Pat. Nos. 5,225,539 or 5,639,641.
  • variable region of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination.
  • the variable regions of the heavy and light chain each consist of four FW regions connected by three CDR regions.
  • the CDRs in each chain are held together in close proximity by the FW regions and, with the CDRs from the other chain, contribute to the formation of the antigen -binding site of antibodies.
  • amino acid position numbering as in Kabat
  • Kabat position refers to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al. , Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991). Using this numbering system, the actual linear amino acid sequence can contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FW or CDR of the variable domain.
  • a heavy chain variable domain can include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g., residues 82a, 82b, and 82c, etc. according to Kabat) after heavy chain FW residue 82.
  • H3 H95-H102 H95-H102 H95-H102 H95-H102 [00129] The Kabat numbering of residues can be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard” Kabat numbered sequence. Chothia refers instead to the location of the structural loops (Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)).
  • the end of the Chothia CDR-H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35 A nor 35B is present, the loop ends at 32; if only 35 A is present, the loop ends at 33; if both 35 A and 35B are present, the loop ends at 34).
  • the AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software.
  • IMGT immunoglobulin variable regions
  • CDR the numbering system for the immunoglobulin variable regions. See e.g., Lefranc, M.P. et al., Dev. Comp. Immunol. 27: 55-77(2003), which is herein incorporated by reference.
  • the IMGT numbering system was based on an alignment of more than 5,000 sequences, structural data, and characterization of hypervariable loops and allows for easy comparison of the variable and CDR regions for all species.
  • VH-CDR1 is at positions 26 to 35
  • VH-CDR2 is at positions 51 to 57
  • VH-CDR3 is at positions 93 to 102
  • VL-CDRl is at positions 27 to 32
  • VL-CDR2 is at positions 50 to 52
  • VL-CDR3 is at positions 89 to 97.
  • variable domains both heavy chain and light chain
  • light chain constant region amino acid sequence is that set forth in Kabat 1991.
  • the Fc region includes the polypeptides comprising the constant region of an antibody excluding the first constant region immunoglobulin domain.
  • Fc refers to the last two constant region immunoglobulin domains of IgA, IgD, and IgG, and the last three constant region immunoglobulin domains of IgE and IgM, and the flexible hinge N-terminal to these domains.
  • IgA and IgM Fc can include the J chain.
  • Fc comprises immunoglobulin domains Cgamma2 and Cgamma3 (Cy2 and Cy3) and the hinge between Cgammal (Cyl) and Cgamma2 (Cy2).
  • the human IgG heavy chain Fc region is usually defined to comprise residues C226 or P230 to its carboxyl-terminus, wherein the numbering is according to the EU index as set forth in Kabat.
  • Fc can refer to this region in isolation, or this region in the context of an antibody, antibody fragment, or Fc fusion protein.
  • Gm Glm (1, 2, 3, 17) or Glm (a, x, f, z), G2m (23) or G2m (n), G3m (5, 6, 10, 11, 13, 14, 15, 16, 21, 24, 26, 27, 28) or G3m (bl, c3, b3, bO, b3, b4, s, t, gl, c5, u, v, g5)
  • Glm 1, 2, 3, 17
  • Glm a, x, f, z
  • G2m G2m (23) or G2m (n)
  • G3m 5, 6, 10, 11, 13, 14, 15, 16, 21, 24, 26, 27, 28
  • G3m bl, c3, b3, bO, b3, b4, s, t, gl, c5, u, v, g5)
  • Lefranc, et al. The human IgG subclasses: molecular analysis of structure, function and regulation. Pergamon, Oxford, pp. 43-
  • antibodies of the present invention may be incorporate any allotype, isoallotype, or haplotype of any immunoglobulin gene, and are not limited to the allotype, isoallotype or haplotype of the sequences provided herein.
  • human antibody means an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any technique known in the art (e.g., recombinant expression in cultures cells, or expression in transgenic animals).
  • human antibody also encompasses an antibody having an amino acid sequence corresponding to an antibody originally produced by a human (or an engineered variant or derivative thereof) but expressed in a non-human system (e.g., produced by chemical synthesis; recombinantly expressed in microbial, mammal, or insect cells; or expressed in an animal subject).
  • an antibody obtained from a human subject or from human cells e.g., hybridoma or cell line expressing a recombinant antibody or fragment thereof
  • an animal e.g., mice
  • a human antibody includes intact or full-length antibodies, fragments thereof, and/or antibodies comprising at least one human heavy and/or light chain polypeptide such as, for example, an antibody comprising murine light chain and human heavy chain polypeptides.
  • chimeric antibodies refers to antibodies wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more animal species.
  • the variable region of both light and heavy chains corresponds to the variable region of antibodies derived from one species of mammals (e.g. , mouse, rat, rabbit, etc.) with the desired specificity, and/or affinity, and/or capability while the constant regions are homologous to the sequences in antibodies derived from another species (usually human) to avoid eliciting an immune response in that species.
  • epitope refers to an antigenic protein determinant capable of binding to an HER2 antibody or HER2 binding molecule disclosed herein.
  • Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.
  • the part of an antibody or binding molecule that recognizes the epitope is called a paratope.
  • the epitopes of protein antigens are divided into two categories, conformational epitopes and linear epitopes, based on their structure and interaction with the paratope.
  • a conformational epitope is composed of discontinuous sections of the antigen's amino acid sequence.
  • linear epitopes interact with the paratope based on their primary structure.
  • a linear epitope is formed by a continuous sequence of amino acids from the antigen.
  • antibody binding site refers to a region in the antigen (e.g., HER2) comprising a continuous or discontinuous site (i.e. , an epitope) to which a complementary antibody specifically binds.
  • the antibody binding site can contain additional areas in the antigen which are beyond the epitope and which can determine properties such as binding affinity and/or stability, or affect properties such as antigen enzymatic activity or dimerization. Accordingly, even if two antibodies bind to the same epitope within an antigen, if the antibody molecules establish distinct intermolecular contacts with amino acids outside of the epitope, such antibodies are considered to bind to distinct antibody binding sites.
  • Binding affinity generally refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g. , an antibody) and its binding partner (e.g. , an antigen). Unless indicated otherwise, as used herein, "binding affinity” refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen).
  • the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (KD). Affinity can be measured by common methods known in the art, including those described herein.
  • Low-affinity antibodies generally bind antigen slowly and tend to dissociate readily, whereas high- affinity antibodies generally bind antigen faster and tend to remain bound longer.
  • a variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present disclosure.
  • IC 50 is the median inhibitory concentration of an antigen-binding molecule. In functional assays, IC 50 is the concentration that reduces a biological response by 50% of its maximum. In ligand-binding studies, IC 50 is the concentration that reduces receptor binding by 50% of maximal specific binding level. IC 50 can be calculated by any number of means known in the art. Improvement in potency can be determined by measuring, e.g. , against the 39S parent antibody.
  • the fold improvement in potency for the anti-HER2 binding molecule disclosed herein can be at least about 2-fold, at least about 4-fold, at least about 6- fold, at least about 8-fold, at least about 10-fold, at least about 20-fold, at least about 30- fold, at least about 40-fold, at least about 50-fold, at least about 60-fold, at least about 70- fold, at least about 80-fold, at least about 90-fold, at least about 100-fold, at least about 110-fold, at least about 120-fold, at least about 130-fold, at least about 140-fold, at least about 150-fold, at least about 160-fold, at least about 170-fold, or at least about 180-fold or more.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • FcRs Fc receptors
  • cytotoxic cells e.g., Natural Killer (NK) cells, neutrophils, and macrophages
  • NK Natural Killer
  • IgG antibodies directed to the surface of target cells "arm" the cytotoxic cells and are absolutely required for such killing. Lysis of the target cell is extracellular, requires direct cell-to-cell contact, and does not involve complement.
  • ADCC activity the cell-mediated cytotoxicity resulting from the activity of an Fc fusion protein is also referred to herein as ADCC activity.
  • isolated is a polypeptide, antibody, polynucleotide, vector, cell, or composition which is in a form not found in nature.
  • Isolated polypeptides, antibodies, polynucleotides, vectors, cells or compositions include those which have been purified to a degree that they are no longer in a form in which they are found in nature.
  • an antibody, polynucleotide, vector, cell, or composition which is isolated is substantially pure.
  • the term "subject” refers to any animal (e.g. , a mammal), including, but not limited to humans, non-human primates, rodents, and the like, which is to be the recipient of a particular treatment. Typically, the terms “subject” and “patient” are used interchangeably herein in reference to a human subject.
  • pharmaceutical composition refers to a preparation which is in such form as to permit the biological activity of the active ingredient (e.g., an anti-HER2 binding molecule disclosed herein) to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the composition would be administered. Such composition can be sterile.
  • an “effective amount” of an anti-HER2 binding molecule as disclosed herein is an amount sufficient to carry out a specifically stated purpose.
  • An “effective amount” can be determined empirically and in a routine manner, in relation to the stated purpose.
  • terapéuticaally effective amount refers to an amount of an anti-HER2 binding molecule disclosed herein or other drug effective to "treat” a disease or disorder in a subject or mammal.
  • label when used herein refers to a detectable compound or composition which is conjugated directly or indirectly to an anti-HER2 binding molecule disclosed herein so as to generate a "labeled" anti-HER2 binding molecule.
  • the label can be detectable by itself (e.g. , radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, can catalyze chemical alteration of a substrate compound or composition which is detectable.
  • ком ⁇ онент and “derivatizable functional group” are used interchangeably and refer to a functional group that is capable of reacting to permit the formation of a covalent bond between an anti-HER2 binding molecule disclosed herein (e.g., a HER2 antibody) and another substance.
  • an anti-HER2 binding molecule disclosed herein e.g., a HER2 antibody
  • another substance is a therapeutic moiety (e.g., a cytotoxin), a detectable label, a polymer (e.g., PEG), etc.
  • exemplary derivatizable groups include thiol, hydroxyl, amino, carboxy, and amide, as well as modified forms thereof, such as activated or protected forms.
  • Terms such as “treating” or “treatment” or “to treat” or “alleviating” or “to alleviate” refer to both (1) therapeutic measures that cure, slow down, lessen symptoms of, and/or halt progression of a diagnosed pathologic condition or disorder and (2) prophylactic or preventative measures that prevent and/or slow the development of a targeted pathologic condition or disorder.
  • those in need of treatment include those already with the disorder; those prone to have the disorder; and those in whom the disorder is to be prevented.
  • a subject is successfully "treated” for cancer according to the methods of the present disclosure if the patient shows, e.g., total, partial, or transient remission of a certain type of cancer.
  • cancer refers to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth.
  • cancers include but are not limited to, carcinoma including adenocarcinomas, lymphomas, blastomas, melanomas, sarcomas, and leukemias.
  • cancers include squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, gastrointestinal cancer, Hodgkin's and non-Hodgkin's lymphoma, pancreatic cancer, glioblastoma, glioma, cervical cancer, ovarian cancer, liver cancer such as hepatic carcinoma and hepatoma, bladder cancer, breast cancer (including hormonally mediated breast cancer, see, e.g., Innes et al. (2006) Br. J.
  • the term cancer as used herein specifically refers to cancer expressing HER2. In some specific aspects, the term cancer refers to cancers expression low levels of HER2.
  • a "low level of HER2" as used herein, refers to a cancer cell, subject, or patient exhibiting a score of less than 2+ ⁇ e.g., 1+) when using a HERCEPTEST® (DakoCytomation California Inc., Carpenteria, CA) classification, or a cancer, cancer cell, subject or patient that has been identified as such, for example, by FISH.
  • HERCEPTEST® DeakoCytomation California Inc., Carpenteria, CA
  • HER2 overexpression can be analyzed by IHC, e.g., by using HERCEPTEST® (Dako). Paraffin embedded tissue sections from a tumor biopsy can be subjected to the IHC assay and accorded a HER2 protein staining intensity criteria as follows/ Alternatively, or additionally, FISH assays such as the INFORMTM (sold by Ventana, Ariz.) or PATHVISIONTM (Vysis, 111.) can be carried out on formalin-fixed, paraffin-embedded tumor tissue to determine the extent (if any) of HER2 overexpression in the tumor.
  • INFORMTM sold by Ventana, Ariz.
  • PATHVISIONTM Vysis, 111.
  • Low is a term that refers to a measure that is less than normal, less than a standard such as a predetermined measure or a subgroup measure that is relatively less than another subgroup measure.
  • low HER2 means a measure of HER2 that is less than a normal HER2 measure in a particular set of samples of patients that is HER2 positive.
  • a normal HER2 measure can be determined according to any method available to one skilled in the art.
  • Low HER2 can also mean a measure of HER2 that is less than a predetermined measure, such as a predetermined cutoff
  • Low HER2 can also mean a measure wherein a low HER2 subgroup is relatively lower than another subgroup.
  • two distinct patient subgroups can be created by dividing samples around a mathematically determined point, such as, without limitation, a median, thus creating a group whose measure is low (i.e., less than the median) with respect to another group whose measure is high.
  • HER2 can be measured by any method known to one skilled in the art such as, for example, without limitation, using the eTag method or using any standard IHC method such as HE CEPTEST®.
  • low level of HER2 refers to a low level of HER2 homodimers, which means a measure of HER2 homodimers that is less than a normal measure of HER2 homodimers in a particular set of samples or patients that is HER2 positive.
  • Low HER2 homodimers can also mean a measure that is less than a predetermined measure, such as a predetermined cutoff.
  • Low HER2 homodimers can also mean a measure wherein a low HER2 homodimer subgroup is relatively less than another subgroup.
  • HER2 homodimers can be measured by any method known in the art such as Fluorescence resonance energy transfer (FRET), Bioluminescent resonance energy transfer (BRET), proximity ligation assay (PLA), dimer- specific antibodies or eTag or any other method that is well known to one skilled in the art.
  • FRET Fluorescence resonance energy transfer
  • BRET Bioluminescent resonance energy transfer
  • PHA proximity ligation assay
  • dimer- specific antibodies or eTag any other method that is well known to one skilled in the art.
  • carcinomas refers to cancers of epithelial cells, which are cells that cover the surface of the body, produce hormones, and make up glands. Examples of carcinomas are cancers of the skin, lung, colon, stomach, breast, prostate and thyroid gland.
  • Polynucleotide or “nucleic acid,” as used interchangeably herein, refer to polymers of nucleotides of any length, and include DNA and RNA.
  • the nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase.
  • a polynucleotide can comprise modified nucleotides, such as methylated nucleotides and their analogs. The preceding description applies to all polynucleotides referred to herein, including RNA and DNA.
  • vector means a construct, which is capable of delivering, and in some aspects, expressing, one or more gene(s) or sequence(s) of interest in a host cell.
  • vectors include, but are not limited to, viral vectors, naked DNA or RNA expression vectors, plasmid, cosmid or phage vectors, DNA or RNA expression vectors associated with cationic condensing agents, DNA or RNA expression vectors encapsulated in liposomes, and certain eukaryotic cells, such as producer cells.
  • polypeptide polypeptide
  • peptide protein
  • the terms “polypeptide,” “peptide,” and “protein” are used interchangeably herein to refer to polymers of amino acids of any length.
  • the polymer can be linear or branched, it can comprise modified amino acids, and it can be interrupted by non-amino acids.
  • the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
  • polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids, etc.
  • the polypeptides of the instant disclosure are based upon antibodies, in certain aspects, the polypeptides can occur as single chains or associated chains.
  • a "recombinant" polypeptide or protein refers to a polypeptide or protein produced via recombinant DNA technology. Recombinantly produced polypeptides and proteins expressed in engineered host cells are considered isolated for the purpose of the invention, as are native or recombinant polypeptides which have been separated, fractionated, or partially or substantially purified by any suitable technique.
  • the polypeptides disclosed herein can be recombinantly produced using methods known in the art. Alternatively, the proteins and peptides disclosed herein can be chemically synthesized.
  • substituted as used herein in the context of modifications to the chemical structure of the cytotoxic agents, i.e. tubulysins pertains to a parent group which bears one or more substituents.
  • substituted is used herein in the conventional sense and refers to a chemical moiety which is covalently attached to, or if appropriate, fused to, a parent group.
  • substituents are well known, and methods for their formation and introduction into a variety of parent groups are also well known. Examples of chemical substituents are described in more detail below.
  • substitution refers to replacing an amino acid residue present in a parent polypeptide with another amino acid residue.
  • An amino acid can be substituted in a parent polypeptide, for example, via chemical peptide synthesis or through recombinant methods known in the art. Accordingly, references to a "substitution at position X” or “substitution at position X” refer to the substitution of an amino acid present at position X with an alternative amino acid residue.
  • substitution patterns can described according to the schema AXY, wherein A is the single letter code corresponding to the amino acid naturally present at position X, and Y is the substituting amino acid residue.
  • L234F would refer to the substitution of the leucine amino acid (L) at position 234 with a phenylalanine (F).
  • substitution patterns can described according to the schema XY, wherein Y is the single letter code corresponding to the amino acid residue substituting the amino acid naturally present at position X.
  • 239C would refer to the substitution of the native amino acid at position 239 with a cysteine (C).
  • a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • basic side chains e
  • a string of amino acids can be conservatively replaced with a structurally similar string that differs in order and/or composition of side chain family members.
  • Non-conservative amino acid substitutions include those in which (i) a residue having an electropositive side chain (e.g., Arg, His or Lys) is substituted for, or by, an electronegative residue (e.g., Glu or Asp), (ii) a hydrophilic residue (e.g., Ser or Thr) is substituted for, or by, a hydrophobic residue (e.g., Ala, Leu, He, Phe or Val), (iii) a cysteine or proline is substituted for, or by, any other residue, or (iv) a residue having a bulky hydrophobic or aromatic side chain (e.g., Val, His, He or Trp) is substituted for, or by, one having a smaller side chain (e.g., Ala, Ser) or no side chain (e.g., Gly).
  • an electropositive side chain e.g., Arg, His or Lys
  • an electronegative residue e.g., Glu or Asp
  • amino acid substitutions can be readily identified by workers of ordinary skill.
  • a substitution can be taken from any one of D-alanine, glycine, beta-alanine, L-cysteine and D-cysteine.
  • a replacement can be any one of D-lysine, arginine, D-arginine, homo-arginine, methionine, D- methionine, ornithine, or D- ornithine.
  • substitutions in functionally important regions that can be expected to induce changes in the properties of isolated polypeptides are those in which (i) a polar residue, e.g., serine or threonine, is substituted for (or by) a hydrophobic residue, e.g., leucine, isoleucine, phenylalanine, or alanine; (ii) a cysteine residue is substituted for (or by) any other residue; (iii) a residue having an electropositive side chain, e.g., lysine, arginine or histidine, is substituted for (or by) a residue having an electronegative side chain, e.g., glutamic acid or aspartic acid; or (iv) a residue having a bulky side chain, e.g., phenylalanine, is substituted for (or by) one not having such a side chain, e.g., glycine.
  • a polar residue e.g
  • amino acid insertion refers to introducing a new amino acid residue between two amino acid residues present in the parent sequence.
  • An amino acid can be inserted in a parent sequence, for example, via chemical peptide synthesis or through recombinant methods known in the art. Accordingly as used herein, the phrases “insertion between positions X and Y” or “insertion between Kabat positions X and Y,” wherein X and Y correspond to amino acid positions (e.g.
  • a cysteine amino acid insertion between positions 239 and 240 refers to the insertion of an amino acid between the X and Y positions, and also to the insertion in a nucleic acid sequence of a codon encoding an amino acid between the codons encoding the amino acids at positions X and Y. Insertion patterns can be described according to the schema AXins, wherein A is the single letter code corresponding to the amino acid being inserted, and X is the position preceding the insertion. Accordingly, C239ins would refer to the insertion of a cysteine amino acid (C) after position 239 (i.e., an insertion between position 239 and 240).
  • percent sequence identity between two polypeptide or polynucleotide sequences refers to the number of identical matched positions shared by the sequences over a comparison window, taking into account additions or deletions (i.e., gaps) that must be introduced for optimal alignment of the two sequences.
  • a matched position is any position where an identical nucleotide or amino acid is presented in both the target and reference sequence. Gaps presented in the target sequence are not counted since gaps are not nucleotides or amino acids. Likewise, gaps presented in the reference sequence are not counted since target sequence nucleotides or amino acids are counted, not nucleotides or amino acids from the reference sequence.
  • the percentage of sequence identity is calculated by determining the number of positions at which the identical amino-acid residue or nucleic acid base occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
  • the comparison of sequences and determination of percent sequence identity between two sequences can be accomplished using readily available software both for online use and for download. Suitable software programs are available from various sources, and for alignment of both protein and nucleotide sequences.
  • One suitable program to determine percent sequence identity is bl2seq, part of the BLAST suite of program available from the U.S.
  • B12seq performs a comparison between two sequences using either the BLASTN or BLASTP algorithm.
  • BLASTN is used to compare nucleic acid sequences
  • BLASTP is used to compare amino acid sequences.
  • Other suitable programs are, e.g., Needle, Stretcher, Water, or Matcher, part of the EMBOSS suite of bioinformatics programs and also available from the European Bioinformatics Institute (EBI) at www.ebi.ac.uk/Tools/psa.
  • Different regions within a single polynucleotide or polypeptide target sequence that aligns with a polynucleotide or polypeptide reference sequence can each have their own percent sequence identity. It is noted that the percent sequence identity value is rounded to the nearest tenth. For example, 80.11, 80.12, 80.13, and 80.14 are rounded down to 80.1, while 80.15, 80.16, 80.17, 80.18, and 80.19 are rounded up to 80.2. It also is noted that the length value will always be an integer.
  • the percentage identity "X" of a first amino acid sequence to a second sequence amino acid is calculated as 100 x (Y/Z), where Y is the number of amino acid residues scored as identical matches in the alignment of the first and second sequences (as aligned by visual inspection or a particular sequence alignment program) and Z is the total number of residues in the second sequence. If the length of a first sequence is longer than the second sequence, the percent identity of the first sequence to the second sequence will be higher than the percent identity of the second sequence to the first sequence.
  • sequence alignments are not limited to binary sequence- sequence comparisons exclusively driven by primary sequence data. Sequence alignments can be derived from multiple sequence alignments.
  • One suitable program to generate multiple sequence alignments is ClustalW2, available from www.clustal.org.
  • Another suitable program is MUSCLE, available from www.drive5.com muscle/.
  • ClustalW2 and MUSCLE are alternatively available, e.g., from the EBI.
  • sequence alignments can be generated by integrating sequence data with data from heterogeneous sources such as structural data (e.g., cry stallo graphic protein structures), functional data (e.g., location of mutations), or phylogenetic data.
  • a suitable program that integrates heterogeneous data to generate a multiple sequence alignment is T-Coffee, available at www.tcoffee.org, and alternatively available, e.g., from the EBI. It will also be appreciated that the final alignment used to calculate percent sequence identity can be curated either automatically or manually.
  • anti-HER2 binding molecules e.g., anti-HER2 antibodies or molecules comprising HER2-binding fragments thereof, that specifically bind HER2.
  • HER2 full-length amino acid (aa) and nucleotide (nt) sequences for HER2 are known in the art (see, e.g., UniProt Acc. No. P04626 for human HER2). See, e.g., Yamamoto et al, Nature 319:230-234 (1986); Coussens et al, Science 230: 1132-1139 (1985); Tal et al, Mol. Cell. Biol. 7:2597-2601 (1987); Semba et al, Proc. Natl. Acad. Sci. U.S.A. 82:6497-6501 (1985); King et al, Science 229:974-976 (1985); Sarkar et al, DNA Cell Biol.
  • the anti-HER2 binding molecules are antibodies or antigen- binding fragments thereof.
  • the anti-HER2 binding molecules e.g., anti- HER2 antibodies or molecules comprising HER2 -binding fragments thereof, comprise a Fab, a Fab', a F(ab') 2 , a Fd, a single chain Fv, scFv, disulfide stabilized scFv, a disulfide linked Fv, a V-NAR domain, an IgNar, an intrabody, an IgGACH2, a minibody, a F(ab') 3; a tetrabody, a triabody, a diabody, a single-domain antibody, DVD-Ig, Fcab, mAb , a (scFv) 2 , or a scFv-Fc.
  • the antibody is of the IgG type, for example of the IgGl type.
  • the anti-HER2 binding molecules are monospecific. In other aspects, the anti-HER2 binding molecules are bispecific, trispecific, tetraspecific, etc. In other aspects, the anti-HER2 binding molecules are multispecific. In some aspects, the anti-HER2 binding molecules are monovalent, bivalent, trivalent, tetravalent, etc. In yet other aspects, the anti-HER2 binding molecules are multivalent. In specific aspects, the anti-HER2 binding molecules are bivalent, e.g., an antibody comprising two HER2 specific antigen binding sites. In specific aspects, the anti-HER2 binding molecules are bispecific, i.e. , the molecule can specifically bind to two different antigens (e.g.
  • the anti- HER2 binding molecules are bivalent and tetravalent, e.g. , an antibody comprising four antigen-binding sites that are capable of binding to two different antigens (e.g., two different epitopes on the same or different molecules).
  • the anti-HER2 binding molecules comprise antibodies or antigen-binding fragments thereof have a binding site that is substantially the same as the binding site of the 1.39.1 antibody (see PCT Publ. No. WO 2008/019290, which is herein incorporated by reference in its entirety).
  • the anti-HER2 binding molecules comprise antibodies or antigen-binding fragments thereof bind one or more amino acid residues of SEQ ID NO: 52.
  • the anti-HER2 binding molecules comprise antibodies or antigen-binding fragments thereof have a binding site that overlaps the binding site of the 1.39.1 antibody.
  • the anti-HER2 binding molecules comprise antibodies or antigen-binding fragments thereof comprising a VH and/or a VL that have been modified compared to the VH (SEQ ID NO:43) and/or the VL (SEQ ID NO:44) of the parent 1.39.1 antibody (see PCT Publ. No. WO 2008/019290).
  • the modifications introduced in the parent antibody can include mutations (e.g., point mutations or replacement of an entire subsequence) in the CDR regions and/or in the FW regions of the VH and VL as compared to the parent 1.39.1 antibody.
  • VH-CDR1 (SEQ ID NO:45) of the parent 1.39.1 antibody has been replaced with a VH-CDR1 comprising the amino acids of SEQ ID NO: 1.
  • VH-CDR1 (SEQ ID NO:45) of the parent 1.39.1 antibody has been replaced with a VH-CDR1 consisting of the amino acids of SEQ ID NO: 1.
  • VH-CDR3 (SEQ ID NO:46) of the parent 1.39.1 antibody has been replaced with a VH-CDR3 comprising the amino acids of SEQ ID NO: 3.
  • VH-CDR3 (SEQ ID NO:46) of the parent 1.39.1 antibody has been replaced with a VH-CDR3 consisting of the amino acids of SEQ ID NO: 3.
  • VH-CDR1 SEQ ID NO:45
  • VH-CDR3 SEQ ID NO:46
  • VH-CDR1 and VH-CDR3 comprising or consisting of the amino acids of SEQ ID NO: 1 and the amino acids of SEQ ID NO:3, respectively.
  • VL-CDRl (SEQ ID NO:47) of the parent 1.39.1 antibody has been replaced with a VL-CDRl comprising the amino acids of SEQ ID NO:4.
  • VL-CDRl (SEQ ID NO:3) of the parent 1.39.1 antibody has been replaced with a VH-CDR1 consisting of the amino acids of SEQ ID NO: 4.
  • the VL FWl region (SEQ ID NO:48) of the parent 1.39.1 antibody has been replaced with a VL FWl comprising the amino acids of SEQ ID NO: 11.
  • the VL FWl region (SEQ ID NO:48) of the parent 1.39.1 antibody has been replaced with a FWl consisting of the amino acids of SEQ ID NO: 11.
  • the VL FW2 region (SEQ ID NO:49) of the parent 1.39.1 antibody has been replaced with a FW2 comprising the amino acids of SEQ ID NO: 12.
  • the VL FW2 region (SEQ ID NO:49) of the parent 1.39.1 antibody has been replaced with a FW2 consisting of the amino acids of SEQ ID NO: 12.
  • the VL FW3 region (SEQ ID NO:50) of the parent 1.39.1 antibody has been replaced with a FW3 comprising the amino acids of SEQ ID NO: 13.
  • the VL FW3 region (SEQ ID NO:50) of the parent 1.39.1 antibody has been replaced with a VL FW2 consisting of the amino acids of SEQ ID NO: 13.
  • VL FWl region SEQ ID NO:48
  • FW2 region FW2 region
  • SEQ ID NO:49 and/or the FW3 region (SEQ ID NO:50) of the parent 1.39.1 antibody have been replaced with a FWl and/or a FW2 and/or a FW3 independently comprising or consisting of the amino acids of SEQ ID NOS: 11, 12, or 13, respectively.
  • the present disclosure provides an anti-HER2 binding molecule comprising an immunoglobulin heavy chain variable region (VH) and an immunoglobulin light chain variable region (VL), wherein the VH comprises the amino acids of SEQ ID NO: 15.
  • the present disclosure provides an anti-HER2 binding molecule comprising a VH and a VL, wherein the VL comprises the amino acids of SEQ ID NO: 16.
  • the VH comprises the amino acids of SEQ ID NO: 15 and the VL comprises the amino acids of SEQ ID NO: 16.
  • an anti-HER2 binding molecule disclosed herein comprises an antibody, or a HER2-binding fragment thereof.
  • an anti-HER2 binding molecule of the instant disclosure comprises an immunoglobulin heavy chain (VH) and an immunoglobulin light chain (VL), wherein the binding molecule comprises:
  • VH-CDR1 comprising the amino acids of SEQ ID NO: 1;
  • VH-CDR2 comprising the amino acids of SEQ ID NO: 2;
  • VH-CDR3 comprising the amino acids of SEQ ID NO: 3;
  • VL-CDR1 comprising the amino acids of SEQ ID NO: 4;
  • VL-CDR2 comprising the amino acids of SEQ ID NO: 5;
  • VL-CDR3 comprising the amino acids of SEQ ID NO: 6.
  • an anti-HER2 binding molecule of the instant disclosure comprises an antibody VL and an antibody VH, wherein the VL comprises an amino acid sequence at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% identical to a reference VL comprising or consisting of the amino acids of SEQ ID NO: 16.
  • an anti-HER2 binding molecule of the instant disclosure comprises an antibody VL and an antibody VH, wherein the VH comprises an amino acid sequence at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% identical to a reference VH comprising or consisting of the amino acids of SEQ ID NO: 15.
  • an anti-HER2 binding molecule of the instant disclosure comprises a VL comprising a sequence at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% identical to a reference VL comprising or consisting of the amino acids of SEQ ID NO: 16, and further comprises a VH comprising a sequence at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% identical to a reference VH comprising or consisting of the amino acids of SEQ ID NO: 15.
  • the anti-HER2 binding molecule of the instant disclosure comprises a heavy chain constant region or fragment thereof.
  • the heavy chain constant region is an IgG constant region.
  • the IgG constant region can comprise a light chain constant region selected from the group consisting of a kappa constant region and a lambda constant region.
  • an anti-HER2 binding molecule of the instant disclosure e.g., an anti-HER2 antibody or HER2-binding fragment thereof, or a bispecific anti-HER2 antibody
  • an anti-HER2 binding molecule of the instant disclosure can bind HER2 with substantially the same or better affinity as the 1.39.1 parent antibody.
  • an anti-HER2 binding molecule of the instant disclosure specifically binds HER2 and antigenic fragments thereof with a dissociation constant or k ⁇ j (k 0 ff/k on ) of less than 10 ⁇ 6 M, or of less than 10 ⁇ 7 M, or of less than 10 "8 M, or of less than 10 "9 M, or of less than 10 "10 M, or of less than 10 "11 M, or of less than 10 "12 M, or of less than 10 "13 M.
  • an anti-HER2 binding molecule of the instant disclosure binds to HER2 and/or antigenic fragments thereof with a k Q ff of less than
  • an anti-HER2 binding molecule of the instant disclosure binds to HER2 and antigenic fragments thereof with a k 0 of less than 10 ⁇ 3 s "1 , less than 5xl0 ⁇ 3 s "1 , less than lO -4 s "1 , less than 5xl0 ⁇ 4 s "1 , less than 10 "5 s "1 , less than 5xl0 "5 s "1 , less than 10 "6 s "1 , less than 5xl0 “6 s “1 , less than 5xl0 "6 s “1 , less than less than 5xl0 "7 s "1 , less than 10 "8 s "1 , less than 5xl0 "8 s "1 , less than 10 "9 s "1 , less than 5xl0 "9 s -1
  • an anti-HER2 binding molecule of the instant disclosure binds to HER2 and/or antigenic fragments thereof with an association rate constant or k on rate of at least 10 5 M "1 s “1 , at least 5xl0 5 M “1 s “1 , at least 10 6 M “1 s “1 , at least 5xl0 6 M “1 s “1 , at least 10 7 M “1 s “1 , at least 5xl0 7 M “1 s “1 , or at least 10 8 M “1 s "1 , or at least 10 9 M “1 s "1 .
  • VH and/or VL amino acid sequences can be 85%, 90%, 95%,
  • An anti-HER2 binding molecule disclosed herein having VH and VL regions having high (i.e. , 80% or greater) similarity to the VH region of SEQ ID NOs: 16 and/or VL region of SEQ ID NOs: 15, respectively, can be obtained by mutagenesis (e.g., site-directed or PCR-mediated mutagenesis) of their respective encoding nucleic acid molecules, followed by testing of the altered antibody for retained function using the functional assays described herein.
  • mutagenesis e.g., site-directed or PCR-mediated mutagenesis
  • the affinity and/or avidity of an anti-HER2 binding molecule disclosed herein for an antigen can be determined experimentally using any suitable method well known in the art, e.g. , flow cytometry, enzyme-linked immunosorbent assay (ELISA), or radioimmunoassay (RIA), or kinetics (e.g. , BIACORETM analysis).
  • ELISA enzyme-linked immunosorbent assay
  • RIA radioimmunoassay
  • kinetics e.g. , BIACORETM analysis
  • Direct binding assays as well as competitive binding assay formats can also be readily employed. See, for example, Berzofsky et ah , "Antibody- Antigen Interactions," In Fundamental Immunology, Paul, W. E., Ed., Raven Press: New York, N.Y. (1984); Kuby, Immunology, W. H. Freeman and Company: New York, N.Y. (1992); and methods described herein.
  • the measured affinity of the interaction of a particular anti-HER2 binding molecule disclosed herein with a HER2 antigen can vary if measured under different conditions (e.g. , salt concentration, pH, temperature).
  • affinity and other antigen-binding parameters e.g. , K D or Kd, k on , k Qff
  • affinity and other antigen-binding parameters are made with standardized solutions of anti-HER2 binding molecule and antigen, and a standardized buffer, as known in the art and such as the buffer described herein.
  • affinities measured using BIACORETM analysis can vary depending on which one of the reactants is bound to the chip.
  • affinity can be measured using a format in which the targeting anti-HER2 binding molecule is immobilized onto the chip (referred to as an "IgG down” format) or using a format in which the target protein (e.g. , HER2) is immobilized onto the chip (referred to as, e.g. , a "HER2 down” format).
  • the present disclosure also provides bispecific anti-HER2 antibodies comprising a first immunoglobulin antigen-binding domain and a second immunoglobulin antigen- binding domain, wherein:
  • the first immunoglobulin antigen-binding domain binds to a first HER2 antibody binding site which comprises an epitope within domain II of HER2;
  • the first HER2 antibody binding site is distinct from the antibody binding site of pertuzumab.
  • the first immunoglobulin antigen-binding domain binds to a
  • the first HER2 antibody binding site which comprises an epitope within domain II of HER2.
  • the first HER2 antibody binding site is identical the HER2 antibody binding site of the 1.39.1 or 39S antibodies.
  • the first HER2 antibody binding site partially overlaps with the HER2 antibody binding site of the 1.39.1 or 39S antibodies.
  • the first HER2 antibody binding site is distinct from the HER antibody binding site of the 1.39.1 or 39S antibodies.
  • the second immunoglobulin antigen-binding domain binds to a second HER2 antibody binding site which comprises an epitope within domain IV of HER2.
  • the second HER2 antibody binding site is identical the HER2 antibody binding site of trastuzumab.
  • the second HER2 antibody binding site partially overlaps with the HER2 antibody binding site of trastuzumab.
  • the second HER2 antibody binding site is distinct from the HER antibody binding site of trastuzumab.
  • the bispecific anti-HER2 antibody comprises a comprising a first immunoglobulin antigen-binding domain and a second immunoglobulin antigen-binding domain, wherein (i) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 antibody binding sites, (ii) the first immunoglobulin antigen-binding domain binds to a first HER2 antibody binding site which comprises an epitope within domain II of HER2 and is distinct from the antibody binding site of pertuzumab, and (iii) the second immunoglobulin antigen-binding domain competes with HERCEPTIN® for binding to domain IV of HER2.
  • the present disclosure also provides bispecific anti-HER2 molecules which bind the same epitope as or are derived from the anti-HER2 binding molecules disclosed above (i.e., lead optimized antibodies derived from the 1.39.1 parent antibody, for example, the 39S antibody).
  • bispecific anti-HER2 molecules are bispecific anti-HER2 antibodies and molecules derived from such bispecific antibodies.
  • such molecules derived from the bispecific anti-HER2 molecules described herein are antibody-drug conjugates (ADC).
  • the ADCs provided herein have reduced ADCC activity.
  • such molecules derived from the bispecific anti-HER2 molecules described herein have enhanced ADCC activity.
  • the present disclosure also provides a bispecific HER antibody comprising a first immunoglobulin and a second immunoglobulin antigen-binding domain wherein (i) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes; and (ii) wherein the first immunoglobulin antigen-binding domain binds HER2 to one or more amino acid residues in SEQ ID NO: 52.
  • the second immunoglobulin antigen-binding domain binds HER2 at an epitope within domain IV.
  • the second immunoglobulin antigen-binding domain binds HER2 to one or more amino acid residues in SEQ ID NO: 53.
  • the instant disclosure provides bispecific anti-HER2 antibodies comprising a first immunoglobulin antigen-binding domain and a second immunoglobulin antigen-binding domain, wherein the first immunoglobulin antigen- binding domain comprises a heavy chain (HC) variable region (VH), and a light chain (LC) variable region (VL) comprising:
  • VH-CDR1 variable heavy chain CDR-1
  • SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VH-CDR2 variable heavy chain CDR-2
  • variable heavy chain CDR-3 (VH-CDR3) sequence identical to SEQ ID NO: 3 or identical to SEQ ID NO: 3 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VL-CDR1 variable light chain CDR-1 (VL-CDR1) sequence identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VL-CDR2 variable light chain CDR-2
  • VL-CDR3 variable light chain CDR-3 sequence identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions; wherein the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment; and, wherein the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
  • the first immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody comprises at least one heterologous variable domain framework region (FW) different relative to the FW regions of an immunoglobulin antigen-binding domain comprising a VH comprising the amino acids of SEQ ID NO:43 and a VL comprising the amino acids of SEQ ID NO:44;
  • FW heterologous variable domain framework region
  • the first immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody comprises (i) a variable light chain framework 1 (VL- FWl) comprising the amino acids of SEQ ID NO: 11; (ii) a variable light chain framework 2 (VL-FW2) comprising the amino acids of SEQ ID NO: 12; (iii) a VL- variable light chain framework 3 (VL-FW3) comprising the amino acids of SEQ ID NO: 13; (iv) a variable light chain framework 4 (VL-FW4) comprising the amino acids of SEQ ID NO: 14; or (v) any combination thereof.
  • VL- FWl variable light chain framework 1
  • VL-FW2 variable light chain framework 2
  • VL-FW3 variable light chain framework 3
  • VL-FW4 variable light chain framework 4
  • the first immunoglobulin antigen-binding domain of the bispecific HER2 antibody comprises (i) a VL-FWl consisting of the amino acids of SEQ ID NO: 11; (ii) a VL-FW2 consisting of the amino acids of SEQ ID NO: 12; (iii) a VL- FW3 consisting of the amino acids of SEQ ID NO: 13; (iv) a VL-FW4 consisting of the amino acids of SEQ ID NO: 14; or (v) any combination thereof.
  • the bispecific anti-HER2 antibody disclosed herein comprises a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen- binding domain, wherein:
  • the first immunoglobulin antigen-binding domain comprises a VH and a VL, wherein the VH comprises the amino acids of SEQ ID NO: 15 or SEQ ID NO:43;
  • the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment;
  • the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
  • the bispecific anti-HER2 antibody comprises a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein:
  • the first immunoglobulin antigen-binding domain comprises a VH and a VL, wherein the VH consists of the amino acids of SEQ ID NO: 15 or SEQ ID NO:43;
  • the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment
  • the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
  • the bispecific anti-HER2 antibody comprises a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein:
  • the first immunoglobulin antigen-binding domain comprises a VH and a VL, wherein the VL comprises the amino acids of SEQ ID NO: 16 or SEQ ID NO:44;
  • the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment
  • the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
  • the bispecific anti-HER2 antibody comprises a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein:
  • the first immunoglobulin antigen-binding domain comprises a VH and a VL, wherein the VL consists of the amino acids of SEQ ID NO: 16 or SEQ ID NO:44;
  • the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment
  • the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
  • the bispecific anti-HER2 antibody comprises a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein:
  • the first immunoglobulin antigen-binding domain comprises a VH and a VL, wherein the VL comprises the amino acids of SEQ ID NO: 16 or SEQ ID NO:44, and the VH comprises the amino acids of SEQ ID NO: 15 or SEQ ID NO:45;
  • the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment
  • the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
  • the bispecific anti-HER2 antibody comprises a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein:
  • the first immunoglobulin antigen-binding domain comprises a VH and a VL, wherein the VL consists of the amino acids of SEQ ID NO: 16 or SEQ ID NO:44, and the VH consists of the amino acids of SEQ ID NO: 15 or SEQ ID NO: 43;
  • the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment
  • the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
  • the first immunoglobulin antigen binding domain of the bispecific anti-HER2 antibody comprises or consists of:
  • VH further comprising a heavy chain constant region or a fragment thereof, and a VL comprising a light chain constant region (LC) or a fragment thereof;
  • the heavy chain constant region or fragment thereof of the bispecific anti-HER2 antibody is an IgG constant region.
  • the IgG constant region or fragment thereof is an IgGl, IgG2, IgG3, or IgG4 constant region.
  • the IgG constant region is an IgGl constant region.
  • the first immunoglobulin antigen binding domain of the bispecific anti-HER2 antibody comprises a VL comprising a light chain constant region (LC), wherein the LC constant region is a kappa constant region.
  • the first immunoglobulin antigen binding domain of the bispecific anti-HER2 antibody comprises a VL comprising a light chain constant region (LC), wherein the LC constant region is a lambda constant region.
  • the first immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody is, for example, a monoclonal antibody, a humanized antibody, a chimeric antibody, or an affinity optimized antibody.
  • the first immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody is, for example, a human antibody.
  • the human antibody is expressed in a transgenic mouse (see, for example, Bruggemann, "Human antibody expression in transgenic mice, " Arch. Immunol. Therap. Exper. 49: 203-208, 2001, which is herein incorporated by reference in its entirety).
  • the first immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody does not compete with trastuzumab or pertuzumab for epitope binding.
  • the first and second immunoglobulin antigen binding domains of the bispecific anti-HER2 antibody specifically bind to distinct HER2 epitopes.
  • the distinct HER2 epitopes are non-overlapping.
  • the second immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody (i) specifically binds to the same HER2 epitope as the trastuzumab antibody; and/or (ii) competitively inhibits HER2 binding by the trastuzumab antibody; and/or (iii) comprises at least one, at least two, at least three, at least four, at least five, or at least six complementarity determining regions (CDRs) of comprising the amino acids of any one of SEQ ID NOs: 54 to 59.
  • CDRs complementarity determining regions
  • the second immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody comprises an scFv.
  • the second immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody comprises a disulfide stabilized scFv (ds-scFv).
  • the disulfide stabilized scFv specifically binds to the same HER2 epitope as the trastuzumab antibody.
  • a stabilizing disulfide can be engineered between the VH and VL regions of an scFv by introducing cysteine substitutions at positions selected such that the cysteine residues can form a disulfide bond.
  • such a disulfide can be introduced in the framework regions such that the VL and VH regions are linked by a disulfide bond.
  • the position of representing but not limiting residues in the VH and VL regions meeting these criteria are provided in TABLE 2.
  • the scFv disclosed herein are obtainable from or produced by any suitable source, whether natural or not, or it may be a recombinant scFv, a synthetic scFv, a semisynthetic scFv, a derivatized scFv, a fermentation optimized scFv, a fusion protein or equivalents, mutants and derivatives thereof as long as it retains the required binding specificity of the scFv's of the present disclosure.
  • These include a scFv with binding specificity which has amino acid substitutions or has sugars or other molecules attached to amino acid functional groups.
  • the second immunoglobulin antigen-binding domain is an scFv comprising:
  • VH-CDR1 comprising the amino acids of SEQ ID NO:54;
  • VH-CDR2 comprising the amino acids of SEQ ID NO:55;
  • VH-CDR3 comprising the amino acids of SEQ ID NO:56
  • VL-CDR1 comprising the amino acids of SEQ ID NO:57
  • VL-CDR2 comprising the amino acids of SEQ ID NO:58;
  • VL-CDR3 comprising the amino acids of SEQ ID NO:59.
  • the second immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody consists of a scFv that specifically binds to the same HER2 epitope as the trastuzumab antibody and comprises VH and VL derived from the VH and VL of the trastuzumab antibody (e.g., the native VH and/or VL present in the trastuzumab antibody, or VH and/or VL mutants with stabilizing mutations, e.g., the pairs of mutations shown in TABLE 2). See Goldenger, Clin. Ther. 21:309-18 (1999).
  • the scFv that binds the same epitope as trastuzumab comprises a VH comprising the amino acids of SEQ ID NO: 17, and a VL comprising the amino acids of SEQ ID NO: 18.
  • the scFv that binds the same epitope as trastuzumab comprises a VH consisting of the amino acids SEQ ID NO: 17, and a VL consisting of the amino acids of SEQ ID NO: 18.
  • the VH and VL of the scFv that binds the same epitope as trastuzumab are covalently linked via a peptide linker.
  • the peptide linker comprises the amino acids of SEQ ID NO: 19.
  • the peptide linker consists of the amino acids of SEQ ID NO: 19.
  • scFv's that bind the same epitope as trastuzumab include sequences derived from trastuzumab, comprising for example mutant sequences wherein at least one amino acid has been deleted or substituted with respect to a parent sequence in the trastuzumab antibody, as long as the resulting molecule is capable of specifically binding to the same HER2 epitope as the trastuzumab antibody, e.g., mutations designed to introduce at least one stabilizing disulfide between the VH and VL of the scFv.
  • the second immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody is covalently linked to the carboxy-terminus of the HC of the first immunoglobulin antigen-binding domain.
  • the bispecific anti- HER2 antibody comprises at least one linker interposed between the second immunoglobulin antigen binding domain and the carboxy-terminus of the HC of the first immunoglobulin antigen-binding domain.
  • one linker is interposed between the second immunoglobulin antigen binding domain and the carboxy- terminus of the HC of the first immunoglobulin antigen-binding domain.
  • the second immunoglobulin antigen-binding domain is covalently linked to the amino-terminus of the HC of the first immunoglobulin antigen- binding domain.
  • the bispecific anti-HER2 antibody comprises at least one linker interposed between the second immunoglobulin antigen-binding domain and the amino-terminus of the HC of the first immunoglobulin antigen-binding domain.
  • one linker is interposed between the second immunoglobulin antigen- binding domain and the amino-terminus of the HC of the first immunoglobulin antigen- binding domain.
  • the second immunoglobulin antigen binding domain of the bispecific anti-HER2 antibody is covalently intercalated in the sequence of the HC of the first immunoglobulin antigen-binding domain. In some aspects, the second immunoglobulin antigen binding domain of the bispecific anti-HER2 antibody is covalently intercalated between the CHI region and CH2 region of the HC of the first immunoglobulin antigen-binding domain. In some aspects, one or more linkers connect the second immunoglobulin antigen binding domain of the bispecific anti-HER2 antibody to the CHI region and/or the CH2 region of the HC of the first immunoglobulin antigen- binding domain.
  • the bispecific anti-HER2 antibody comprises (i) a linker interposed between the CHI region of the HC of the first immunoglobulin antigen binding domain and the second immunoglobulin antigen binding domain; and (ii) a second linker interposed between the second immunoglobulin antigen binding domain and the CH2 region of the HC of the of the first immunoglobulin antigen-binding domain.
  • the first linker and the second linker are identical.
  • the first linker and the second linker are different.
  • one or more of the linkers comprise a peptide linker.
  • the peptide linker comprises at least one, at least two, at least three, at least four, at least five, at least 10, at least 15, at least 20, at least 25, or at least 30 amino acids. In some aspects, the peptide linker comprises more than 20 amino acids. In some aspects, the peptide linker comprises a peptide having the formula Ser x [(Gly) y -Ser 4 ] z where x is from 0 to 1, y is from 1 to 4, and z is from 1 to 10. In some aspects, the peptide linker comprises a sequence selected from SEQ ID NOS: 19, 20, 21 or 22.
  • the bispecific anti-HER2 antibody comprises a heavy chain comprising a constant region comprising an Fc domain.
  • the Fc domain comprises a CH2 region, and/or a CH3 region, and/or fragments thereof.
  • the Fc domain comprises a CH2 region and a CH3 region.
  • the Fc domain consists of a CH2 region and a CH region.
  • the Fc domain is an IgG Fc domain, from example, an Fc domain from an IgGl, IgG2, IgG3, or IgG4.
  • the IgG Fc domain is a human or humanized IgG Fc domain.
  • the Fc domain is an IgGl Fc domain.
  • the IgG Fc domain for example an IgGl Fc domain, is a native
  • the native IgGl Fc domain comprises the amino acids of SEQ ID NO: 23. In other aspects, the native IgGl Fc domain consists of the amino acids of SEQ ID NO: 23. In other aspects, the Fc domain is a mutant IgG domain, for example, a mutant IgGl, IgG2, IgG3, or IgG4 domain. In some specific aspects, the mutant Fc domain is a mutant IgGl Fc domain.
  • mutant IgG domain for example, a human or humanized
  • IgGl Fc domain comprises at least one mutation capable of reducing the ADCC activity of the bispecific anti-HER2 antibody.
  • at least one mutation capable of reducing the ADCC activity of the anti-HER2 bispecific antibody is an amino acid substitution.
  • the bispecific anti-HER2 antibody with reduced ADCC activity comprises at least one amino acid substitution selected from L234F, S239C, S239A, a cysteine amino acid insertion between positions 239 and 240, or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat. Numerous mutations capable of reducing the ADCC activity of an antibody are known in the art.
  • Antibodies with reduced ADCC effector function also include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Pat. No. 6,737,056), wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
  • Fc mutants also include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including Fc mutant with substitution of residues 265 and 297 to alanine (U.S. Pat. No. 7,332,581, wherein the amino acid position numbering is according to the EU index as set forth in Kabat).
  • mutant IgG domain for example, a human or humanized
  • IgGl Fc domain comprises at least one mutation capable of enhancing the ADCC activity of the bispecific anti-HER2 antibody.
  • at least one mutation capable of enhancing the ADCC activity of the anti-HER2 bispecific antibody is an amino acid substitution.
  • the bispecific anti-HER2 antibody with enhanced ADCC activity comprises at least one amino acid substitution selected from S239A, S239D, A330L, I332E, E333A, K334A or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
  • the mutant IgGl Fc domain can comprise at least one amino acid substitution introducing a derivatizable functional group. In some aspects, the mutant IgGl Fc domain comprises one to three amino acid substitutions introducing a derivatizable functional group. In some aspects, the derivatizable group is the sulfhydryl side chain of a cysteine amino acid. In particular aspects, the substituted amino acid or amino acids occur at accessible sites of the anti-HER2 binding molecule.
  • reactive thiol groups are thereby positioned at accessible sites of the anti-HER2 binding molecule and can be used to conjugate the anti- HER2 binding molecule to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein.
  • Cysteine engineered antibodies can be generated as described, e.g., in U.S. Pat. No. 7,521,541.
  • the derivatizable group is introduced at Kabat position 239, 248,
  • the amino acid or amino acid substitution introducing a derivatizable sulfhydryl group is selected from the group consisting of S239C, 248C, 254C, 258C, 273C, 279C, 282C, 284C, 286C, 287C, 289C, 297C, 298C, 312C, 324C, 326C, 330C, 335C, 337C, 339C, 350C, 355C, 356C, 359C, 360C, 361C, 375C, 383C, 384C, 389C, 398C, 400C, 413C, 415C, 418C, 422C, 435C, 440C, 441C, S442C, 443C and 446C, a cysteine amino acid insertion between positions 239 and 240, or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
  • Selectively derivatizable groups are well known in the art, such as an amino group, sulfhydryl group, pendant oxyamino, or other nucleophilic groups.
  • Derivatizable groups can be joined to a polypeptide chain via one or more linkers.
  • Ligands e.g., therapeutic moieties, detectable labels, half-life extending polymers, etc.
  • This coupling chemistry can include, for example, amide, urea, thiourea, oxime, aminoacetylamide, etc.
  • the Fc domain has an altered type of glycosylation that enhances
  • the glycosylation of the Fc region can be modified to increase or decrease effector function (see for examples, Umana et al, 1999, Nat. Biotechnol 17: 176- 180; Davies et al., 2001, Biotechnol Bioeng 74:288-294; Shields et al, 2002, J Biol Chem 277:26733-26740; Shinkawa et al., 2003, J Biol Chem 278:3466-3473; U.S. Pat. Nos. 6,602,684; 6,946,292; 7,064, 191 ; 7,214,775;7,393,683; 7,425,446; 7,504,256; U.S. Publication. Nos.
  • the Fc domain is a hypofucosylated antibody Fc domain having reduced amounts of fucosyl residues (see for examples, U.S. Patent Application Publication No.2005/0226867).
  • these antibodies with increased effector function, specifically ADCC as generated in host cells (e.g., CHO cells, Lemna minor) engineered to produce highly defucosylated antibody with over 100-fold higher ADCC compared to antibody produced by the parental cells (e.g., Mori et al., 2004, Biotechnol Bioeng 88:901-908; Cox et al., 2006, Nat Biotechnol., 24: 1591-7).
  • the Fc domain has increased bisecting GlcNAc structures (e.g., Umana et al, 1999, Nat. Biotechnol 17: 176-180; US2009/0010921).
  • mutant Fc domain comprises the amino acids of SEQ ID NO:
  • mutant Fc domain comprises the amino acids of SEQ ID NO:
  • bispecific anti-HER2 antibodies comprising a first and a second polypeptide chain associated with each other, wherein the first polypeptide chain is selected from:
  • TZs is an scFv that binds the same epitope recognized by the trastuzumab antibody
  • L 1 ; L 2 , L 3 , and L 4 are peptide linkers
  • Fcx is an Fc domain
  • B VH and B CH are the VH and CHI regions, respectively, of an antibody capable of binding to an HER2 epitope distinct from the epitope recognized by the trastuzumab antibody.
  • the distinct epitope comprises one or more amino acids within
  • the epitope recognized by the trastuzumab antibody comprises one or more amino acid residues in SEQ ID NO: 53.
  • the second polypeptide chain comprises [ B VL]-[CL] wherein
  • B VL is the VL region of an antibody capable of binding to an HER2 epitope distinct from the epitope recognized by the trastuzumab antibody, and CL is an IgG light chain constant region.
  • CL is selected from the group consisting of a human kappa constant region and a human lambda constant region.
  • B VL comprises the amino acids of SEQ ID NO: 16.
  • B VL comprises the amino acids of SEQ ID NO:44.
  • B VL comprises:
  • VL-CDR1 variable light chain CDR-1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VL-CDR2 variable light chain CDR-2
  • VL-CDR3 variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions.
  • CL comprises the amino acids of SEQ ID NO:27A.
  • CL comprises the amino acids of SEQ ID NO:27B.
  • [TZ S ] comprises:
  • VH-CDR1 comprising the amino acids of SEQ ID NO:54;
  • VH-CDR2 comprising the amino acids of SEQ ID NO:55;
  • VH-CDR3 comprising the amino acids of SEQ ID NO:56;
  • VL-CDR1 comprising the amino acids of SEQ ID NO:57;
  • VL-CDR3 comprising the amino acids of SEQ ID NO:59.
  • [TZ S ] is a disulfide stabilized scFv.
  • [TZ S ] comprises (i) a VH comprising or consisting of the amino acids of SEQ ID NO: 17, or a variant thereof, and (ii) a VL comprising or consisting of the amino acids of SEQ ID NO: 18, or a variant thereof, covalently linked by a peptide linker.
  • Numerous linkers (for example, peptide linkers) suitable for linking the VH and VL moieties of an scFv are known in the art.
  • the linker is a peptide linker comprising or consisting of the amino acids of SEQ ID NO: 19.
  • [TZs] comprises or consists of the amino acids of SEQ ID NO:28.
  • a hinge polypeptide links the [ B CH] and [Fcx].
  • the hinge polypeptide comprises or consists of the amino acids of SEQ ID NO: 26.
  • the [Fcx] comprises at least one amino acid substitution introducing a derivatizable group.
  • the [Fcx] comprises one to three amino acid substitution introducing a derivatizable group.
  • the [Fcx] comprises more than three amino acid substitutions introducing a derivatizable.
  • all the derivatizable groups are identical.
  • at least one derivatizable group is different from the rest.
  • all the derivatizable groups are different.
  • the derivatizable group is a sulfhydryl group (e.g., the sulfhydryl group of a cysteine).
  • the derivatizable group is protected.
  • the derivatizable group is introduced at position 239, 248, 254,
  • the derivatizable group is a sulfhydryl group in at least one cysteine amino acid substitution comprising S239C, 248C, 254C, 258C, 273C, 279C, 282C, 284C, 286C, 287C, 289C, 297C, 298C, 312C, 324C, 326C, 330C, 335C, 337C, 339C, 350C, 355C, 356C, 359C, 360C, 361C, 375C, 383C, 384C, 389C, 398C, 400C, 413C, 415C, 418C, 422C, 435C, 440C, 441C, S442C, 443C and 446C, a cysteine amino acid insertion between positions 239 and 240, or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
  • the amino acid or amino acid substitution introducing a derivatizable sulfhydryl group is S239C and/or S442C. In some aspects, the amino acid or amino acid substitution introducing a derivatizable sulfhydryl group is a cysteine amino acid insertion between positions 239 and 240 and/or S442C.
  • [Fcx] comprises the amino acids of any one of SEQ ID NOs: 23,
  • [Fcx] comprises the amino acids of any one of SEQ ID NOs: 23,
  • [Li], [L 2 ], [L 3 ], and [L 4 ] comprise the amino acids of linker sequences independently selected from the group consisting of SEQ ID NOs: 19, 20, 21, and 22. In some aspects, all the linkers are different. In some aspects, at least two of the linkers are identical. One skilled in the art would understand that the linkers can be peptide, non-peptide, or combination of peptide and non-peptide linkers.
  • [L comprises or consists of the amino acids of SEQ ID NO:20;
  • [L 2 ] comprises or consists of the amino acids of SEQ ID NO:20;
  • [iii) [L 3 ] comprises or consists of the amino acids of SEQ ID NO:21;
  • [L 4 ] comprises or consists of the amino acids of SEQ ID NO:22.
  • [ B VH] comprises:
  • VH-CDR1 variable heavy chain CDR-1 (VH-CDR1) identical to SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VH-CDR2 variable heavy chain CDR-2
  • VH-CDR3 variable heavy chain CDR-3 (VH-CDR3) identical to SEQ ID NO: 3 or identical to SEQ ID NO: 3 except for up to 1, 2, 3, or 4 amino acid substitutions.
  • [ B VH] comprises or consists of the amino acids of SEQ ID NO: 1
  • [ B VL] comprises:
  • VL-CDR1 variable light chain CDR-1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VL-CDR2 variable light chain CDR-2
  • VL-CDR3 variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions.
  • [ B VL] comprises or consists of the amino acids of SEQ
  • [ B CH] comprises or consists of the amino acids of SEQ ID NO: 29.
  • the instant disclosure provides bispecific anti-HER2 antibodies comprising a first polypeptide chain and a second polypeptide chain, wherein (i) the first polypeptide chain comprises or consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 30, 31 A, 32A, 32C, 33A, 33C, 34, 34A, 35A, 36A, 36C, 37A, 37C, 38, 38A, 39A, 40A, 40C, 41A and 41C, and (ii) the second polypeptide chain comprises or consists of the sequence of SEQ ID NO:42A or 42B, wherein the bispecific anti-HER2 antibodies are conjugated to a therapeutic moiety.
  • the instant disclosure provides bispecific anti-HER2 antibodies comprising a first polypeptide chain and a second polypeptide chain, wherein (i) the first polypeptide chain comprises or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 30, 3 IB, 32B, 33B, 34B, 35B, 36B, 37B, 38B, 39B, 40B, and 41B, and (ii) the second polypeptide chain comprises or consists of the sequence of SEQ ID NO:42A or 42B, wherein bispecific anti-HER2 antibodies have enhanced ADCC activity.
  • ADCs Antibody-Drug Conjugates
  • the instant disclosure also provides antibody-drug conjugates (ADCs) comprising at least one of the anti-HER2 binding molecules disclosed herein (e.g., antibodies which bind the same epitope as or are derived from the 39S antibody or HER2-binding fragments thereof, or the bispecific anti-HER2 antibodies disclosed herein) conjugated to least one therapeutic moiety.
  • ADCs antibody-drug conjugates
  • the ADC comprises a bispecific anti-HER2 antibody disclosed herein conjugated to at least one therapeutic moiety (e.g., a cytotoxin), wherein said bispecific anti-HER2 antibody comprises (i) a first immunoglobulin antigen-binding domain and (ii) a second immunoglobulin antigen- binding domain, wherein the first immunoglobulin antigen-binding domain comprises a heavy chain (HC) variable region (VH) and a light chain (LC) variable region (VL) comprising:
  • VH-CDR1 variable heavy chain CDR- 1 sequence identical to SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VH-CDR2 variable heavy chain CDR-2
  • VH-CDR3 variable heavy chain CDR-3
  • VL-CDR1 variable light chain CDR- 1 sequence identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VL-CDR2 variable light chain CDR-2
  • VL-CDR3 variable light chain CDR-3
  • the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment
  • the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
  • the first immunoglobulin antigen-binding domain of the ADC comprises at least one heterologous variable domain framework region (FW) different relative to the FW regions of an immunoglobulin antigen-binding domain comprising a VH comprising the amino acids of SEQ ID NO:43, and a VL comprising the amino acids of SEQ ID NO:44;
  • FW heterologous variable domain framework region
  • the ADC further comprises at least one optional spacer which can be intercalated between the side chain of an amino acid in a polypeptide chain of the anti-HER2 binding molecule (for example, an amino in the heavy chain of an anti-HER2 bispecific antibody disclosed herein) and the therapeutic moiety.
  • the at least one spacer is a peptidic spacer.
  • the at least one spacer is a non- peptidic spacer.
  • the spacer is unstable, such an acid labile spacer (e.g. , a hydrazine).
  • the spacer is an enzyme cleavable peptide, e.g., a cleavable dipeptide.
  • the spacer is uncleavable (hydrolytically stable), for example, a thioether spacer or a hindered disulfide spacer.
  • the intercalated between the side chain of an amino acid in a polypeptide chain of the anti-HER2 binding molecule (for example, an amino in the heavy chain of an anti-HER2 bispecific antibody disclosed herein) and the additional therapeutic moiety is MCC (N-succinimidyl- 4(maleimidomethyl) cyclohexane)).
  • Hydrolytically stable spacers are substantially stable in water and do not react with water at useful pH values, including but not limited to, under physiological conditions for an extended period of time. Hydrolytically unstable or degradable spacers are degradable in water or in aqueous solutions, including for example, blood.
  • Enzymatically unstable or degradable spacers can be degraded by one or more enzymes.
  • PEG and related polymers can include degradable spacers in the polymer backbone or in the linker group between the polymer backbone and one or more of the terminal functional groups of the polymer molecule.
  • Such degradable spacers include, but are not limited to, ester linkages formed by the reaction of PEG carboxylic acids or activated PEG carboxylic acids with alcohol groups on a biologically active agent, wherein such ester groups generally hydrolyze under physiological conditions to release the biologically active agent.
  • hydrolytically degradable spacers include but are not limited to carbonate linkages; imine linkages resulting from reaction of an amine and an aldehyde; phosphate ester linkages formed by reacting an alcohol with a phosphate group; hydrazone linkages which are a reaction product of a hydrazide and an aldehyde; acetal linkages that are the reaction product of an aldehyde and an alcohol; orthoester linkages that are the reaction product of a formate and an alcohol; peptide linkages formed by an amine group, including but not limited to, at an end of a polymer such as PEG, and a carboxyl group of a peptide; and oligonucleotide linkages formed by a phosphoramidite group, including but not limited to, at the end of a polymer, and a 5' hydroxyl group of an oligonucleotide.
  • the ADC comprises two, three, four, five, six, seven, eight, nine or ten therapeutic moieties. In some specific aspects, the ADC comprises two, three, or four therapeutic moieties. In some aspects, all therapeutic moieties are the same. In some aspects, at least one therapeutic moiety is different from the rest. In some aspects, all therapeutic moieties are different. In some aspects, all the spacers (e.g., peptidic and/or non-peptidic spacers) are the same. In some aspects, at least one spacer is different from the rest. In still other aspects, all the spacers are different.
  • each therapeutic moiety is chemically conjugated to the side chain of an amino acid at a specific position in the Fc region of the anti-HER2 binding molecule (e.g., a bispecific anti-HER2 antibody disclosed herein).
  • the specific positions in the Fc region are selected from the group consisting of 239, 248, 254, 258, 273, 279, 282, 284, 286, 287, 289, 297, 298, 312, 324, 326, 330, 335, 337, 339, 350, 355, 356, 359, 360, 361, 375, 383, 384, 389, 398, 400, 413, 415, 418, 422, 435, 440, 441, 442, 443, 446, an insertion between positions 239 and 240, and combinations thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
  • the specific positions in the Fc region are 239, 442, or both, wherein the amino acid position numbering is according to the EU index as set forth in Kabat. In some aspects, the specific positions in the Fc region consist of 442 and an amino acid insertion between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
  • the amino acid side chain where the therapeutic moiety is conjugated is a sulfhydryl side chain, for example, the sulfhydryl group of a cysteine amino acid.
  • at least one therapeutic moiety is chemically conjugated to the side chain of an amino acid located at a position outside of the Fc region of the anti- HER2 binding molecule (e.g., a bispecific anti-HER2 antibody disclosed herein).
  • all the therapeutic moieties are chemically conjugated to the side chain of an amino acid located at a position outside of the Fc region of the anti-HER2 binding molecule (e.g., a bispecific anti-HER2 antibody disclosed herein).
  • at least one therapeutic moiety is genetically incorporated into the polypeptide chain of the anti-HER2 binding molecule (e.g., a bispecific anti-HER2 antibody disclosed herein) using recombinant techniques known in the art.
  • the therapeutic moiety comprises a cytotoxin, a radioisotope, a radioisotope, an immunomodulator, a cytokine, a lymphokine, a chemokine, a growth factor, a tumor necrosis factor, a hormone, a hormone antagonist, an enzyme, an oligonucleotide, a DNA, an RNA, an siRNA, an RNAi, a microRNA, a photoactive therapeutic agent, an anti-angiogenic agent, a pro-apoptotic agent, a peptide, a lipid, a carbohydrate, a chelating agentor combinations thereof.
  • the cytotoxin is an auristatin, a tubulysin, a maytansinoid or a pyrrolobenzodiazepine (PBD).
  • the cytotoxin is tubulysin 1508.
  • the ADC comprises a bispecific anti-HER2 antibody disclosed herein, wherein said antibody comprises:
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO: 32A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid at position 239, wherein the amino acid position numbering is according to the EU index as set forth in Kabat; (ii) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:33A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to cysteine amino acids respectively located at positions 239 and 442 wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:36A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid at position 239, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • a therapeutic moiety e.g., a tubulysin 1508 molecule
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO: 37 A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to cysteine amino acids respectively located at positions 239 and 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • two therapeutic moieties e.g., two tubulysin 1508 molecules
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:40A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid at position 239, wherein the amino acid position numbering is according to the EU index as set forth in Kabat; or,
  • a therapeutic moiety e.g., a tubulysin 1508 molecule
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:41A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to cysteine amino acids respectively located at positions 239 and 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
  • the ADC comprises a bispecific anti-HER2 antibody disclosed herein, wherein said antibody comprises:
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO: 62 and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • a therapeutic moiety e.g., a tubulysin 1508 molecule
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO: 33C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • two therapeutic moieties e.g., two tubulysin 1508 molecules
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:36C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • a therapeutic moiety e.g., a tubulysin 1508 molecule
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:37C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin MEDI 1508 molecules) covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • two therapeutic moieties e.g., two tubulysin MEDI 1508 molecules
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:40C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat; or,
  • a therapeutic moiety e.g., a tubulysin 1508 molecule
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:41C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
  • two therapeutic moieties e.g., two tubulysin 1508 molecules
  • ADC molecules disclosed herein comprise at least one of the anti-HER2 binding molecules disclosed herein (e.g., antibodies which bind the same epitope as or are derived from the 39S antibody or HER2-binding fragments thereof, or the bispecific anti-HER2 antibodies disclosed herein) which has been derivatized or linked (e.g., chemically or recombinantly) to another molecule (e.g., a peptide, small drug molecule, detectable molecule, etc.).
  • anti-HER2 binding molecules disclosed herein e.g., antibodies which bind the same epitope as or are derived from the 39S antibody or HER2-binding fragments thereof, or the bispecific anti-HER2 antibodies disclosed herein
  • another molecule e.g., a peptide, small drug molecule, detectable molecule, etc.
  • anti-HER2 antibodies or portions thereof are derivatized such that their HER2 binding is not affected adversely by the derivatization or labeling.
  • an anti-HER2 binding molecule disclosed herein or HER2-binding portion thereof can be functionally linked (by chemical coupling, genetic fusion, noncovalent association, or otherwise) to one or more other molecular entities, such as a cytotoxic agent, a pharmaceutical agent, a detection agent, and/or a protein or peptide that can mediate association of the anti-HER2 binding molecule with another molecule (such as a streptavidin core region or a polyhistidine tag).
  • One type of derivatized molecule can be produced by crosslinking two or more molecular entities, e.g., an anti-HER2 binding molecule disclosed herein and a therapeutic moiety (e.g., a cytotoxin such as tubulysin 1508).
  • Suitable crosslinkers include those that are heterobifunctional, i.e., having two distinctly reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimidc ester); or homobifunctional (e.g. , disuccinimidyl suberate).
  • Such crosslinkers are available, for example, from Pierce Chemical Company, Rockford, II.
  • Additional bifunctional coupling agents include N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), succinimidyl-4-(N-maleimidomethyl) cyclohexane- l-carboxylate, iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as tolyene 2,6- diisocyanate), and bis-active fluorine compounds (such as l,5-difluoro-2,4- dinitrobenzene).
  • SPDP
  • detectable labels can be attached by at least one spacer arm. Spacer arms can be of various lengths to reduce potential steric hindrance.
  • An anti-HER2 binding molecule can also be labeled with a radiolabeled amino acid.
  • the radiolabel can be used for both diagnostic and therapeutic purposes.
  • the radiolabel can be used to detect HER2-expressing cells by X-ray or other diagnostic techniques such as positron emission tomography (PET).
  • PET positron emission tomography
  • the radiolabel can be used therapeutically as a toxin for HER2-expressing cells, such as those which cause unwanted immune response.
  • labels for polypeptides include, but are not limited to, the following radioisotopes or radionuclides: 3H, 14 C, 15 N, 35 S, 90 Y, 99 Tc, l u In, 125 I and 131 I.
  • the anti-HER2 binding molecule can be labeled with a paramagnetic, radioactive, or fluorogenic ion that is detectable upon imaging.
  • the paramagnetic ion is chromium (III), manganese (II), iron (III), iron (II), cobalt (II), nickel (II), copper (II), neodymium (III), samarium (III), ytterbium (III), gadolinium (III), vanadium (II), terbium (III), dysprosium (III), holmium (III) or erbium (III).
  • the radioactive ion is iodine-123, technetium-99, indium-I l l, rhenium-188, rhenium-186, copper-67, iodine-131, yttrium- 90, iodine-125, astatine-211 , and gallium-67.
  • the anti-HER2 binding molecule is labeled with an X-ray imaging agent such as lanthanum (III), gold (III), lead (II), and bismuth (III).
  • An anti-HER2 binding molecule can also be derivatized with a chemical group, for example a polymer such as polyethylene glycol (PEG), a methyl group, an ethyl group, or a carbohydrate group.
  • PEG polyethylene glycol
  • a methyl group e.g., a methyl group
  • ethyl group e.g., a carbohydrate group.
  • cytotoxic agent as used herein is defined broadly and refers to a substance that inhibits or prevents the function of cells and/or causes destruction of cells (cell death), and/or exerts anti-neoplastic/anti-proliferative effects.
  • cytotoxic agent prevents directly or indirectly the development, maturation, or spread of neoplastic tumor cells.
  • the term includes also such agents that cause a cytostatic effect only and not a mere cytotoxic effect.
  • chemotherapeutic agents as specified below, as well as other HER2 antagonists, anti-angiogenic agents, tyrosine kinase inhibitors, protein kinase A inhibitors, members of the cytokine family, radioactive isotopes, and toxins such as enzymatically active toxins of bacterial, fungal, plant or animal origin.
  • chemotherapeutic agent is a subset of the term “cytotoxic agent” comprising natural or synthetic chemical compounds.
  • examples of chemotherapeutic or agents include alkylating agents, for example, nitrogen mustards, ethyleneimine compounds, alkyl sulphonates and other compounds with an alkylating action such as nitrosoureas, cisplatin and dacarbazine; antimetabolites, for example, folic acid, purine or pyrimidine antagonists; mitotic inhibitors, for example, Vinca alkaloids and derivatives of podophyllotoxin; cytotoxic antibiotics and camptothecin derivatives.
  • chemotherapeutic agents are amifostine (ETHYOL®), cisplatin, dacarbazine (DTIC), dactinomycin, mechlorethamine (nitrogen mustard), streptozocin, cyclophosphamide, carrnustine (BCNU), lomustine (CCNU), doxorubicin (AD IAMYCIN®), doxorubicin lipo (DOXIL®), gemcitabine (GEMZAR®), daunorubicin, daunorubicin lipo (DAUNOXOME®), procarbazine, mitomycin, cytarabine, etoposide, methotrexate, 5-fluorouracil (5-FU), vinblastine, vincristine, bleomycin, paclitaxel (TAXOL®), docetaxel (TAXOTERE®), aldesleukin, asparaginase, busulfan, carboplatin, cladribine, camptothecin,
  • the ADC comprises an anti-HER2 binding molecule disclosed herein (e.g., the 39S antibody or a derivative thereof, or one of the bispecific anti-HER2 antibodies disclosed herein) conjugated to one or more tubulysin molecules (see structure of tubulysin A and tubulysin 1508 below).
  • an anti-HER2 binding molecule disclosed herein e.g., the 39S antibody or a derivative thereof, or one of the bispecific anti-HER2 antibodies disclosed herein
  • tubulysin molecules see structure of tubulysin A and tubulysin 1508 below.
  • Tubulysin 1508 (compound T32)
  • Tubulysins are members of a class of natural products isolated from myxobacterial species (Sasse et al, J. Antibiot. 53:879-885 (2000)). As cytoskeleton interacting agents, tubulysins are mitotic poisons that inhibit tubulin polymerization and lead to cell cycle arrest and apoptosis (Steinmetz et al., Chem. Int. Ed. 43:4888-4892 (2004); Khalil et al, ChemBioChem. 7:678-683 (2006); Kaur et al, Biochem. J. 396: 235-242 (2006)).
  • Tubulysins are extremely potent cytotoxic molecules, exceeding the cell growth inhibition of any clinically relevant traditional chemo therapeutic, e.g., epothilones, paclitaxel, and vinblastine. Furthermore, they are potent against multidrug resistant cell lines (Domling et al, Mol. Diversity 9: 141-147 (2005)). These compounds show high cytotoxicity tested against a panel of cancer cell lines with IC 50 values in the low picomolar range; thus, they are of interest as anticancer therapeutics. See, e.g., WO2012019123, which is herein incorporated by reference in its entirety. Tubulysin conjugates are disclosed, e.g., in U.S. Pat. No. 7,776,814.
  • tubulysin molecule or derivative thereof is a prodrug.
  • the ADC comprises an anti-HER2 binding molecule disclosed herein (e.g., the 39S antibody or a derivative thereof, or one of the bispecific anti-HER2 antibodies disclosed herein) conjugated to one or more maytansinoid molecules.
  • an anti-HER2 binding molecule disclosed herein e.g., the 39S antibody or a derivative thereof, or one of the bispecific anti-HER2 antibodies disclosed herein conjugated to one or more maytansinoid molecules.
  • Maytansinoids are mitotic inhibitors which act by inhibiting tubulin polymerization. Maytansine was first isolated from the east African shrub Maytenus serrata (U.S. Pat. No. 3,896,111). Subsequently, it was discovered that certain microbes also produce maytansinoids, such as maytansinol and C-3 maytansinol esters (U.S. Pat. No. 4,151,042). Synthetic maytansinol and derivatives and analogues thereof are disclosed, for example, in U.S. Pat. Nos.
  • Maytansinoid drug moieties are attractive drug moieties in antibody drug conjugates because they are: (i) relatively accessible to prepare by fermentation or chemical modification, derivatization of fermentation products, (ii) amenable to derivatization with functional groups suitable for conjugation through the non-disulfide linkers to antibodies, (iii) stable in plasma, and (iv) effective against a variety of tumor cell lines.
  • Immunoconjugates containing maytansinoids, methods of making same, and their therapeutic use are disclosed, for example, in U.S. Pat. Nos. 5,208,020, 5,416,064 and European Patent EP0425235B1; Liu et al, Proc. Natl. Acad. Sci. USA 93:8618-8623 (1996) (described immunoconjugates comprising a maytansinoid designated DM1); and Chari et al, Cancer Research 52: 127-131 (1992).
  • T-DM1 Trastuzumab emtansine (ado-trastuzumab emtansine, T-DM1, trade name
  • KADCYLA® is an antibody-drug conjugate consisting of the monoclonal antibody trastuzumab (HE CEPTIN®) conjugated to the maytansinoid mertansine (DM1).
  • HE CEPTIN® monoclonal antibody trastuzumab
  • DM1 maytansinoid mertansine
  • Antibody-maytansinoid conjugates are prepared by chemically linking an antibody to a maytansinoid molecule without significantly diminishing the biological activity of either the antibody or the maytansinoid molecule. See, e.g., U.S. Pat. No. 5,208,020.
  • An average of 3-4 maytansinoid molecules conjugated per antibody molecule has shown efficacy in enhancing cytotoxicity of target cells without negatively affecting the function or solubility of the antibody, although even one molecule of toxin/antibody would be expected to enhance cytotoxicity over the use of naked antibody.
  • Maytansinoids are well known in the art and can be synthesized by known techniques or isolated from natural sources. Suitable maytansinoids are disclosed, for example, in U.S. Pat. No. 5,208,020.
  • the maytansinoid molecule, variant, or derivative thereof is a prodrug.
  • the ADC comprises an anti-HER2 binding molecule disclosed herein ⁇ e.g., the 39S antibody or a derivative thereof, or one of the bispecific anti-HER2 antibodies disclosed herein) conjugated to dolastatins or dolostatin peptidic analogs and derivatives, the auristatins (U.S. Pat. Nos. 5,635,483; 5,780,588). Dolastatins and auristatins have been shown to interfere with microtubule dynamics, GTP hydrolysis, and nuclear and cellular division (Woyke et al., Antimicrob. Agents and Chemother. 45:3580-3584 (2001)) and have anticancer activity (U.S. Pat. No.
  • the dolastatin or auristatin drug moiety can be attached to the antibody through the N (amino) terminus or the C (carboxyl) terminus of the peptidic drug moiety (See, e.g., WO2002088172).
  • the auristatine or dolastatine molecule, variant, or derivative thereof is a prodrug.
  • the ADC comprises an anti-HER2 binding molecule disclosed herein (e.g., the 39S antibody or a derivative thereof, or one of the bispecific anti-HER2 antibodies disclosed herein) conjugated to one or more calicheamicin molecules.
  • calicheamicins are capable of producing double- stranded DNA breaks at sub-picomolar concentrations.
  • the calicheamicins are a class of enediyne antibiotics derived from the bacterium Micromonospora echinospora, with calicheamicin ⁇ being the most notable.
  • Other calicheamicins are piBr, ylBr, a2I, a3I, ⁇ , ⁇ , and All.
  • Structural analogues of calicheamicin which can be used include, but are not limited to, ⁇ , ⁇ 2 ⁇ , ⁇ x3I, N-acetyl- ⁇ , PSAG and ⁇ 11 (Hinman et al, Cancer Research 53:3336-3342 (1993), Lode et al., Cancer Research 58:2925-2928 (1998) and the aforementioned U.S. patents to American Cyanamid).
  • the calicheamicin molecule, variant, or derivative thereof is a prodrug.
  • the ADC comprises an anti-HER2 binding molecule disclosed herein (e.g., the 39S antibody or a derivative thereof, or one of the bispecific anti-HER2 antibodies disclosed herein) conjugated to one or more duocarmycin molecules.
  • an anti-HER2 binding molecule disclosed herein e.g., the 39S antibody or a derivative thereof, or one of the bispecific anti-HER2 antibodies disclosed herein
  • Duocarmycins are members of a series of related natural products first isolated from
  • Natural duocarmycins include duocarmycin A, duocarmycin Bl, duocarmycin
  • duocarmycin CI duocarmycin C2
  • duocarmycin D duocarmycin SA
  • CC-1065 duocarmycin CI
  • Synthetic analogs include adozelesin, bizelesin, and carzelesin (U-80244).
  • the duocarmycin molecule, variant, or derivative thereof is a prodrug.
  • the drug is a pyrrolobenzodiazepine (PBD).
  • PBDs are relatively small molecules and some have the ability to recognize and covalently bind to specific sequences in the minor groove of DNA and thus exhibit antibiotic/antitumor activity.
  • PBDs and derivatives thereof are known in the art, for example, PBD dimers (e.g., SJG-136 or SG2000), C2-unsaturated PBD dimers, pyrrolobenzodiazepine dimers bearing C2 aryl substitutions (e.g., SG2285), PBD dimer pro-drug that is activated by hydrolysis (e.g., SG2285), and polypyrrole-PBD (e.g., SG2274).
  • PBDs are further described WO 2000/012507, WO 2007/039752, WO 2005/110423, WO 2005/085251, and WO 2005/040170, and U.S. Pat. No. 7,612,062, each of which is incorporated by reference herein in its entirety.
  • the ADC comprises an anti-HER2 binding molecule disclosed herein (e.g., the 39S antibody or a derivative thereof, or one of the bispecific anti-HER2 antibodies disclosed herein) conjugated to other antitumor agents, for example, BCNU, anthracyclines (e.g., daunomycin or adriamycin), taxenes (e.g., paclitaxel), streptozoicin, Vinca alkaloids (e.g., vincristine), 5-fluorouracil, the family of agents known collectively as LL-E33288 complex (see U.S. Pat. Nos. 5,053,394, and 5,770,710), esperamicins (see U.S.
  • the ADC can also comprise an anti-HER2 binding molecule disclosed herein (e.g., the 39S antibody or a derivative thereof, or one of the bispecific anti-HER2 antibodies disclosed herein) conjugated to enzymatically active toxins and fragments thereof which can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Saponaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin and the tricothecenes. See, for example, W01
  • the present disclosure provides anti-HER2 binding molecules that bind to the same epitope(s) as do the 39S antibody (e.g., antibodies derived from the 39S antibody or antigen-binding fragments thereof, bispecific anti-HER2 antibodies, or ADCs).
  • the 39S antibody e.g., antibodies derived from the 39S antibody or antigen-binding fragments thereof, bispecific anti-HER2 antibodies, or ADCs.
  • anti-HER2 binding molecules that bind to the same epitope as the 39S antibody can be identified based on their ability to cross-compete (e.g., to competitively inhibit the binding of, in a statistically significant manner) with the 39S antibody in standard HER2 binding assays. Accordingly, in one aspect, the instant disclosure provides anti-HER2 binding molecules (e.g., antibodies derived from the 39S antibody or antigen-binding fragments thereof, bispecific anti-HER2 antibodies, or ADCs) that compete for binding to HER2 with the 39S antibody antigen-binding fragments thereof.
  • anti-HER2 binding molecules e.g., antibodies derived from the 39S antibody or antigen-binding fragments thereof, bispecific anti-HER2 antibodies, or ADCs
  • test antibody to inhibit the binding of, e.g., the 39S antibody or binding molecules derived from the 39S antibody (e.g., bispecific antibodies or ADCs) demonstrates that the test antibody can compete with the 39S antibody for binding to HER2; such anti-HER2 binding molecule can, according to non-limiting theory, bind to the same or a related (e.g., a structurally similar or spatially proximal) epitope on HER2 as the 39S antibody or antigen-binding fragment thereof with which it competes.
  • a related e.g., a structurally similar or spatially proximal
  • the anti-HER2 molecule that binds to the same epitope on HER2 as the 39S antibody or binding molecules derived from the 39S antibody is a human monoclonal antibody or an antigen-binding fragment thereof, a bispecific anti-HER2 antibody (e.g., a bispecific antibody comprising two HER2 binding regions, at least one of which recognizes the same epitope as the 39S antibody), or an ADC (e.g., an ADC comprising at least one antigen-binding moiety recognizing the same epitope as the 39S; or an ADC comprising a bispecific antibody which comprises two HER2 binding regions, at least one of which recognizes the same epitope as the 39S antibody).
  • a bispecific anti-HER2 antibody e.g., a bispecific antibody comprising two HER2 binding regions, at least one of which recognizes the same epitope as the 39S antibody
  • an ADC e.g., an ADC comprising at least one antigen-binding moiety recognizing the
  • anti-HER2binding molecules e.g., bispecific anti-HER2 antibodies, or ADCs
  • ADCs anti-HER2binding molecules comprising a HER2-binding domain binding the same epitope as or derived from the 1.39.1 or 39S antibodies, wherein such anti-HER2-binding molecules induce internalization upon binding to the HER2 target.
  • anti-HER2 binding molecules e.g., bispecific anti-HER2 antibodies, or ADCs
  • anti-HER2-binding molecules comprising a HER2-binding domain binding the same epitope as or derived from the 1.39.1 or 39S antibodies, wherein such anti-HER2-binding molecules promote effective lysosomal trafficking following internalization.
  • anti- HER2 binding molecules e.g., bispecific anti-HER2 antibodies, or ADCs
  • ADCs anti-HER2 binding molecules comprising a HER2-binding domain binding the same epitope as or derived from the 1.39.1 or 39S antibodies, wherein such and-HER2-binding molecules induce HER2 target internalization and/or degradation.
  • an anti-HER2 binding molecule disclosed herein can reduce, block, or suppress HER2 phosphorylation. In other aspects, an anti-HER2 binding molecule disclosed herein can reduce, block, or suppress ligand-induced AKT phosphorylation. In some aspects, the anti-HER2 binding molecule can reduce, block, or suppress ligand-induced AKT phosphorylation in low HER2-expressing cancer cells.
  • an anti-HER2 binding molecule e.g. , an anti-HER2 antibody or antigen-binding fragment thereof disclosed in the instant application can reduce, disrupt, or suppress ligand-induced HER2-HER3 dimerization.
  • an ADC comprising an anti-HER2 binding molecule disclosed herein can inhibit cancer stem cell (CSC) sphere formation and/or proliferation.
  • CSC cancer stem cell
  • an anti-HER2 binding molecule disclosed herein exhibits a cytotoxic effect on CSCs.
  • an ADC comprising an anti-HER2 binding molecule disclosed herein can inhibit tumor growth and/or induce tumor regression in tumors expressing low levels of HER2 (e.g.. +1 to +2 via HercepTest).
  • an ADC comprising an anti-HER2 binding molecule disclosed herein can inhibit tumor growth and/or induce tumor regression in tumors resistant to T-DM1.
  • an HER2 binding molecule e.g., an anti-HER2 antibody or antigen-binding fragment thereof lacks ADCC activity.
  • an anti-HER2 binding molecule e.g., an anti-HER2 antibody or antigen-binding fragment thereof can reduce or suppress HER2 phosphorylation, AKT phosphorylation, and/or tumor colony formation via a ligand-independent mechanism of action.
  • Anti-HER2 binding molecules of the present disclosure can be prepared according to methods known in the art.
  • anti-HER2 binding molecules binding to the same epitope as the 39S antibody disclosed herein can be generated using hybridoma methods, such as those described by Kohler & Milstein (1975) Nature 256:495.
  • a mouse, hamster, or other appropriate host animal is immunized as described above to elicit the production by lymphocytes of antibodies that will specifically bind to an immunizing antigen.
  • Lymphocytes can also be immunized in vitro. Following immunization, the lymphocytes are isolated and fused with a suitable myeloma cell line using, for example, polyethylene glycol, to form hybridoma cells that can then be selected away from unfused lymphocytes and myeloma cells.
  • Hybridomas that produce monoclonal antibodies directed specifically against a chosen antigen as determined by immunoprecipitation, immunoblotting, or by an in vitro binding assay (e.g.
  • Radioimmunoassay RIA
  • enzyme-linked immunosorbent assay ELISA
  • RIA enzyme-linked immunosorbent assay
  • the monoclonal antibodies can then be purified from the culture medium or ascites fluid as described for polyclonal antibodies above.
  • Anti-HER2 binding molecules of the present disclosure for example, antibodies or antigen-binding fragments thereof which bind the same epitope as or are derived from the 1.39.1 or 39S antibodies, bispecific antibodies and ADCs comprising the same
  • the polynucleotides encoding a monoclonal antibody are isolated from mature B -cells or hybridoma cell, such as by RT-PCR using oligonucleotide primers that specifically amplify the genes encoding the heavy and light chains of the antibody, and their sequence is determined using conventional procedures.
  • the isolated polynucleotides encoding the heavy and light chains are then cloned into suitable expression vectors, which when transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, monoclonal antibodies are generated by the host cells.
  • recombinant anti-HER2 monoclonal antibodies or molecules comprising antigen-binding fragments thereof of the desired species can be isolated from phage display libraries expressing CDRs of the desired species as described (McCafferty et ah, Nature 348:552-554 (1990); Clarkson et al, Nature 352:624-628 (1991); and Marks et al, J. Mol. Biol. 222:581-597 (1991)).
  • the polynucleotide(s) encoding an anti-HER2 binding molecule of the present disclosure can further be modified in a number of different manners using recombinant DNA technology to generate alternative anti-HER2 binding molecules.
  • the constant domains of the light and heavy chains of, for example, a mouse monoclonal antibody can be substituted (1) for those regions of, for example, a human antibody to generate a chimeric antibody or (2) for a non-immunoglobulin polypeptide to generate a fusion antibody.
  • the constant regions are truncated or removed to generate the desired antibody fragment of a monoclonal antibody.
  • Site-directed or high-density mutagenesis of the variable region can be used to optimize specificity, affinity, etc. of a monoclonal antibody.
  • the anti-HER2 binding molecule of the present disclosure is a human antibody or antigen-binding fragment thereof.
  • Human antibodies can be directly prepared using various techniques known in the art. Immortalized human B lymphocytes immunized in vitro or isolated from an immunized individual that produce an antibody directed against a target antigen can be generated (See, e.g., Cole et al, Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boemer et al., J. Immunol. 147:86-95 (1991); and U.S. Pat. No. 5,750,373). One or more cDNAs encoding the antibody in the immortalized B lymphocyte can then be prepared and inserted into an expression vector and/or a heterologous host cell for expression of a non-naturally- occurring recombinant version of the antibody.
  • the anti-HER2 human antibody or antigen-binding fragment thereof can be selected from a phage library, where that phage library expresses human antibodies or fragments thereof as fusion proteins with heterologous phage proteins, as described, for example, in Vaughan et al, Nat. Biotech. 14:309-314 (1996); Sheets et al, Proc. Natl. Acad. Sci. 95:6157-6162 (1998); Hoogenboom and Winter, J. Mol. Biol. 227:381 (1991), and Marks et al, J. Mol. Biol. 222:581 (1991)). Techniques for the generation and use of antibody phage libraries are also described in U.S. Pat. Nos.
  • BioTechnology 10:779-783 (1992), incorporated by reference in its entirety) are known in the art and can be employed to generate high affinity human antibodies or antigen- binding fragments thereof.
  • an anti-HER2 binding molecule of the present disclosure can be a humanized antibody.
  • Methods for engineering, humanizing or resurfacing non-human or human antibodies can also be used and are well known in the art.
  • a humanized, resurfaced or similarly engineered antibody can have one or more amino acid residues from a source that is non-human, e.g., but not limited to, mouse, rat, rabbit, non-human primate or other mammal. These non-human amino acid residues are replaced by residues that are often referred to as "import" residues, which are typically taken from an "import" variable, constant or other domain of a known human sequence.
  • Such imported sequences can be used to reduce immunogenicity or reduce, enhance or modify binding, affinity, on- rate, off-rate, avidity, specificity, half-life, or any other suitable characteristic, as known in the art.
  • the CDR residues are directly and most substantially involved in influencing HER2 binding. Accordingly, part or all of the non-human or human CDR sequences are maintained while the non-human sequences of the variable and constant regions can be replaced with human or other amino acids.
  • human CDRs are inserted into non-human antibody scaffolds to make an antibody with reduced immunogenicity in an animal model system, e.g., a "murinized" antibody.
  • Anti-HER2 binding molecules e.g., antibodies
  • humanized (or human) or engineered anti-HER2 antibodies and resurfaced antibodies can be optionally prepared by a process of analysis of the parental sequences and various conceptual humanized and engineered products using three-dimensional models of the parental, engineered, and humanized sequences. Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art.
  • an anti-HER2 antibody fragment is provided.
  • Various techniques are known for the production of antibody fragments. Traditionally, these fragments are derived via proteolytic digestion of intact antibodies (for example Morimoto et al, J. Biochem. Biophy. Methods 24: 107-117 (1993); Brennan et al, Science, 229:81 (1985)).
  • anti-HER2 antibody fragments are produced recombinantly. Fab, Fv, and scFv antibody fragments can all be expressed in and secreted from E. coli or other host cells, thus allowing the production of large amounts of these fragments.
  • Such anti-HER2 antibody fragments can also be isolated from the antibody phage libraries discussed above.
  • the anti-HER2 antibody fragments can also be linear antibodies as described in U.S. Pat. No. 5,641,870. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner.
  • Techniques can be adapted for the production of single-chain antibodies specific to the same HER2 epitope as the 39S antibody (see, e.g., U.S. Pat. No. 4,946,778).
  • methods can be adapted for the construction of Fab expression libraries (see, e.g., Huse et al, Science 246: 1275-1281 (1989)) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for HER2, or derivatives, fragments, analogs or homologs thereof.
  • Antibody fragments can be produced by techniques in the art including, but not limited to: (a) a F(ab')2 fragment produced by pepsin digestion of an antibody molecule; (b) a Fab fragment generated by reducing the disulfide bridges of an F(ab')2 fragment, (c) a Fab fragment generated by the treatment of the antibody molecule with papain and a reducing agent, and (d) Fv fragments.
  • an anti-HER2 antibody or antigen-binding fragment thereof can be modified in order to increase its serum half-life. This can be achieved, for example, by incorporation of a salvage receptor binding epitope into the antibody or antibody fragment by mutation of the appropriate region in the antibody or antibody fragment or by incorporating the epitope into a peptide tag that is then fused to the antibody or antibody fragment at either end or in the middle ⁇ e.g., by DNA or peptide synthesis), or by YTE mutation.
  • Other methods to increase the serum half-life of an antibody or antigen-binding fragment thereof, e.g., conjugation to a heterologous molecule such as PEG are well known in the art.
  • Heteroconjugate anti-HER2 binding molecules e.g., bispecific antibodies which bind the same epitope as or are derived from the 39S antibody disclosed herein or ADCs
  • bispecific antibodies or ADCs can be prepared using recombinant biology technology as well as in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents.
  • bispecific antibodies or ADCs can be chemically constructed using a disulfide exchange reaction or by forming a thioether bond. Suitable reagents for this purpose are known in the art, and include iminothiolate and methyl-4- mercaptobutyrimidate.
  • the anti-HER2 binding molecules can be engineered to fuse the CH3 domain directly to the hinge region of the respective modified antibodies or fragments thereof.
  • a peptide spacer can be inserted between the hinge region and the modified CH2 and/or CH3 domains.
  • compatible constructs can be expressed wherein the CH2 domain has been deleted and the remaining CH3 domain (modified or unmodified) is joined to the hinge region with a 5-20 amino acid spacer.
  • Such a spacer can be added, for instance, to ensure that the regulatory elements of the constant domain remain free and accessible or that the hinge region remains flexible.
  • amino acid spacers can, in some cases, prove to be immunogenic and elicit an unwanted immune response against the construct. Accordingly, in certain aspects, any spacer added to the construct will be relatively non-immunogenic, or even omitted altogether, so as to maintain the desired biochemical qualities of the modified antibodies.
  • the anti-HER2 binding molecule can be provided by the partial deletion or substitution of a few or even a single amino acid.
  • the mutation of a single amino acid in selected areas of the CH2 domain can be enough to substantially reduce Fc binding and thereby increase tumor localization.
  • the constant regions of the disclosed anti-HER2 binding molecule can be modified through the mutation or substitution of one or more amino acids that enhances the profile of the resulting construct. In this respect it is possible to disrupt the activity provided by a conserved binding site (e.g. , Fc binding) while substantially maintaining the configuration and immunogenic profile of the modified antibody or antigen-binding fragment thereof.
  • Certain aspects can comprise the addition of one or more amino acids to the constant region to enhance desirable characteristics such as decreasing or increasing effector function or provide for more cytotoxin or carbohydrate attachment.
  • specific sequences derived from selected constant region domains can be inserted or replicated.
  • the present disclosure provides polynucleotides comprising nucleic acid sequences that encode an anti-HER2 binding molecule disclosed herein that specifically binds HER2.
  • the instant disclosure provides a polynucleotide comprising a nucleic acid sequence that encodes an anti-HER2 binding molecule such as an antibody or a fragment thereof (e.g., a molecule which binds the same epitope as or is derived from the 39S antibody).
  • the polynucleotides of the instant disclosure can be in the form of RNA or in the form of DNA.
  • DNA includes cDNA, genomic DNA, and synthetic DNA; and can be double- stranded or single- stranded, and if single stranded can be the coding strand or non-coding (anti-sense) strand.
  • the DNA is a cDNA that is used to produce a non-naturally-occurring recombinant antibody.
  • the polynucleotides are isolated. In certain aspects, the polynucleotides are substantially pure. In certain aspects the polynucleotides comprise the coding sequence for the mature polypeptide fused in the same reading frame to a polynucleotide (either natural or heterologous) which aids, for example, in expression and secretion of a polypeptide from a host cell (e.g. , a leader sequence which functions as a secretory sequence for controlling transport of a polypeptide from the cell).
  • the polypeptide having a leader sequence is a preprotein and can have the leader sequence cleaved by the host cell to form the mature form of the polypeptide.
  • the polynucleotides can also encode for an anti-HER2 binding molecule proprotein which is the mature protein plus additional 5' amino acid residues. In certain aspects, the polynucleotides are altered to optimize codon usage for a certain host cell.
  • the polynucleotides comprise the coding sequence for the mature anti-HER2 binding molecule, e.g. , an anti-HER2 antibody or an antigen-binding fragment thereof fused in the same reading frame to a heterologous marker sequence that allows, for example, for purification of the encoded polypeptide.
  • the marker sequence can be a hexa-histidine (His6) tag supplied, for example, by a pQE-9 vector to provide for purification of the mature polypeptide fused to the marker in the case of a bacterial host.
  • the marker sequence can be a hemagglutinin (HA) tag derived, for example, from the influenza hemagglutinin protein, when a mammalian host (e.g., COS-7 cells) is used.
  • the present disclosure further relates to variants of the described polynucleotides encoding, for example, HER2-binding fragments, analogs, and derivatives of the anti- HER2 binding molecules of the present disclosure.
  • the polynucleotide variants can contain alterations in the coding regions, non- coding regions, or both. In some aspects the polynucleotide variants contain alterations which produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded polypeptide. In some aspects, nucleotide variants are produced by silent substitutions due to the degeneracy of the genetic code. Polynucleotide variants can be produced for a variety of reasons, e.g., to optimize codon expression for a particular host (change codons in the human mRNA to those preferred by a bacterial host such as E. coli). Vectors and cells comprising the polynucleotides described herein are also provided.
  • a DNA sequence encoding an anti-HER2 binding molecule e.g., an anti-HER2 antibody or an antigen-binding fragment thereof can be constructed by chemical synthesis, for example, using an oligonucleotide synthesizer.
  • Such oligonucleotides can be designed based on the amino acid sequence of the desired polypeptide and selecting those codons that are favored in the host cell in which the recombinant polypeptide of interest will be produced. Standard methods can be applied to synthesize an isolated polynucleotide sequence encoding an isolated polypeptide of interest. For example, a complete amino acid sequence can be used to construct a back- translated gene.
  • a DNA oligomer containing a nucleotide sequence coding for the particular isolated polypeptide can be synthesized. For example, several small oligonucleotides coding for portions of the desired polypeptide can be synthesized and then ligated. The individual oligonucleotides typically contain 5' or 3' overhangs for complementary assembly.
  • the polynucleotide sequences encoding a particular isolated polypeptide of interest will be inserted into an expression vector and operatively linked to an expression control sequence appropriate for expression of the protein in a desired host. Proper assembly can be confirmed, for example, by nucleotide sequencing, restriction mapping, and expression of a biologically active polypeptide in a suitable host. As is well known in the art, in order to obtain high expression levels of a transfected gene in a host, the gene must be operatively linked to transcriptional and translational expression control sequences that are functional in the chosen expression host.
  • recombinant expression vectors are used to amplify and express
  • a transcriptional unit generally comprises an assembly of (1) a genetic element or elements having a regulatory role in gene expression, for example, transcriptional promoters or enhancers, (2) a structural or coding sequence which is transcribed into mRNA and translated into protein, and (3) appropriate transcription and translation initiation and termination sequences, as described in detail below.
  • Such regulatory elements can include an operator sequence to control transcription.
  • DNA regions are operatively linked when they are functionally related to each other.
  • DNA for a signal peptide secretory leader
  • DNA for a polypeptide is operatively linked to DNA for a polypeptide if it is expressed as a precursor which participates in the secretion of the polypeptide
  • a promoter is operatively linked to a coding sequence if it controls the transcription of the sequence
  • a ribosome binding site is operatively linked to a coding sequence if it is positioned so as to permit translation.
  • Structural elements intended for use in yeast expression systems include a leader sequence enabling extracellular secretion of translated protein by a host cell.
  • recombinant protein is expressed without a leader or transport sequence, it can include an N-terminal methionine residue. This residue can optionally be subsequently cleaved from the expressed recombinant protein to provide a final product.
  • Useful expression vectors for eukaryotic hosts include, for example, vectors comprising expression control sequences from SV40, bovine papilloma virus, adenovirus and cytomegalovirus.
  • Useful expression vectors for bacterial hosts include known bacterial plasmids, such as plasmids from E. coli, including pCR 1, pBR322, pMB9 and their derivatives, wider host range plasmids, such as Ml 3 and filamentous single- stranded DNA phages.
  • Suitable host cells for expression of anti-HER2 binding molecules e.g., anti-HER2 binding molecules
  • HER2 antibodies or antigen-binding fragments thereof include prokaryotes, yeast, insect or higher eukaryotic cells under the control of appropriate promoters.
  • Prokaryotes include gram negative or gram positive organisms, for example E. coli or bacilli.
  • Higher eukaryotic cells include established cell lines of mammalian origin as described below. Cell-free translation systems could also be employed.
  • Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are described by Pouwels et al. (Cloning Vectors: A Laboratory Manual, Elsevier, N.Y., 1985), the relevant disclosure of which is hereby incorporated by reference.
  • Suitable mammalian host cell lines include HEK-293 and HEK-293T, the COS-7 lines of monkey kidney cells, described by Gluzman (Cell 23: 175, 1981), and other cell lines including, for example, L cells, C127, 3T3, Chinese hamster ovary (CHO), NSO, HeLa, and BHK cell lines.
  • Mammalian expression vectors can comprise nontranscribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5' or 3' flanking nontranscribed sequences, and 5' or 3' nontranslated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
  • nontranscribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5' or 3' flanking nontranscribed sequences, and 5' or 3' nontranslated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
  • Anti-HER2 binding molecules e.g. , anti-HER2 antibodies or antigen-binding fragments thereof, produced by a transformed host can be purified according to any suitable method.
  • standard methods include, for example, chromatography (e.g., ion exchange, affinity and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for protein purification.
  • Affinity tags such as hexahistidine, maltose binding domain, influenza coat sequence, glutathione- S- transferase, etc., can be attached to the protein to allow easy purification by passage over an appropriate affinity column.
  • Isolated proteins can also be physically characterized using, for example, proteolysis, nuclear magnetic resonance or x-ray crystallography.
  • supernatants from systems which secrete recombinant protein into culture media can be first concentrated using a commercially available protein concentration filter, for example, an AMICON® or Millipore PELLICON® ultrafiltration unit. Following the concentration step, the concentrate can be applied to a suitable purification matrix.
  • a suitable purification matrix for example, an anion exchange resin can be employed, for example, a matrix or substrate having pendant diethylaminoethyl (DEAE) groups.
  • the matrices can be acrylamide, agarose, dextran, cellulose or other types commonly employed in protein purification.
  • a cation exchange step can be employed.
  • Suitable cation exchangers include various insoluble matrices comprising sulfopropyl or carboxymethyl groups.
  • one or more reversed-phase high performance liquid chromatography (RP-HPLC) steps employing hydrophobic RP-HPLC media, e.g. , silica gel having pendant methyl or other aliphatic groups, can be employed to further purify an HER2-binding molecule.
  • RP-HPLC reversed-phase high performance liquid chromatography
  • a recombinant anti-HER2 binding molecule e.g. , an anti-HER2 antibody or antigen-binding fragment thereof, produced in bacterial culture can be isolated, for example, by initial extraction from cell pellets, followed by one or more concentration, salting-out, aqueous ion exchange or size exclusion chromatography steps. High performance liquid chromatography (HPLC) can be employed for final purification steps.
  • Microbial cells employed in expression of a recombinant protein can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents.
  • Methods known in the art for purifying antibodies and other proteins also include, for example, those described in U.S. Pat. Publ. Nos. US20080312425, US20080177048, and US20090187005, each of which is hereby incorporated by reference in its entirety.
  • the present disclosure also provides methods directed to the use of anti-HER2 binding molecules, e.g. , antibodies, including antigen-binding fragments, variants, and derivatives thereof, to treat patients having a disease associated with HER2 expression or HER2-expressing cells.
  • anti-HER2 binding molecules e.g. , antibodies, including antigen-binding fragments, variants, and derivatives thereof.
  • HER2-expressing cell is meant a cell expressing the HER2 protein.
  • Methods for detecting and/or quantitating HER2 expression in cells are well known in the art and include, but are not limited to, PCR techniques, immunohistochemistry (e.g., HE CEPTESTTM), flow cytometry, Western blot, ELISA, and the like.
  • the methods disclosed herein are applied to treatment and diagnostic method where the cancer cells are expressing HER2 at low levels.
  • anti-HER2 antibodies e.g., the 39S antibody, variants, derivatives, and HER2 -binding fragments; bispecific anti-HER2 molecules of the instant disclosure; and ADC molecules of the instant disclosure
  • the anti-HER2 binding molecules are human or humanized anti-
  • HER2 binding molecules that mediate human ADCC; or comprise known anti-HER2 antibodies that mediate ADCC; or comprise anti-HER2 binding molecules that are engineered such that they mediate ADCC.
  • the anti-HER2 binding molecules are human or humanized anti-
  • HER2 binding molecules that do not mediate human ADCC; or comprise known anti- HER2 antibodies that do not mediate ADCC; or comprise anti-HER2 binding molecules that are engineered such that they do not mediate ADCC.
  • treatment includes the application or administration of an anti-
  • HER2 binding molecule e.g., an antibody or antigen binding fragment, variant, or derivative thereof of the current disclosure to a subject or patient, or application or administration of the anti-HER2 binding molecule to an isolated tissue or cell line from a subject or patient, where the subject or patient has a disease, a symptom of a disease, or a predisposition toward a disease.
  • treatment is also intended to include the application or administration of a pharmaceutical composition comprising the anti- HER2 binding molecule, e.g., an antibody or antigen binding fragment, variant, or derivative thereof of the current disclosure to a subject or patient, or application or administration of a pharmaceutical composition comprising the anti-HER2 binding molecule to an isolated tissue or cell line from a subject or patient, who has a disease, a symptom of a disease, or a predisposition toward a disease.
  • a pharmaceutical composition comprising the anti- HER2 binding molecule, e.g., an antibody or antigen binding fragment, variant, or derivative thereof of the current disclosure to a subject or patient, or application or administration of a pharmaceutical composition comprising the anti-HER2 binding molecule to an isolated tissue or cell line from a subject or patient, who has a disease, a symptom of a disease, or a predisposition toward a disease.
  • the anti-HER2 binding molecules e.g., antibodies or antigen-binding fragments, variants, or derivatives thereof of the present disclosure are useful for the treatment of various cancers.
  • the instant disclosure relates to anti-HER2 binding molecules, e.g., antibodies or antigen-binding fragments, variants, or derivatives thereof for use as a medicament, in particular for use in the treatment or prophylaxis of cancer.
  • cancer include, but are not limited to breast cancer, colon cancer, lung cancer, gastric cancer, head and neck squamous cells cancer, melanoma, pancreatic cancer, or prostate cancer.
  • the cancer expresses low levels of HER2 as determined, for example, via HE CEPTESTTM.
  • At least one anti-HER2 binding molecule e.g., an antibody or antigen binding fragment, variant, or derivative thereof as defined elsewhere herein is used to promote a positive therapeutic response with respect to cancer.
  • the term "positive therapeutic response" with respect to cancer treatment refers to an improvement in the disease in association with the activity of these anti-HER2 binding molecules, e.g., antibodies or antigen-binding fragments, variants, or derivatives thereof, and/or an improvement in the symptoms associated with the disease.
  • an improvement in the disease can be characterized as a complete response.
  • the term "complete response” refers to an absence of clinically detectable disease with normalization of any previously test results.
  • an improvement in the disease can be categorized as being a partial response.
  • a "positive therapeutic response” encompasses a reduction or inhibition of the progression and/or duration of cancer, the reduction or amelioration of the severity of cancer, and/or the amelioration of one or more symptoms thereof resulting from the administration of an anti-HER2 binding molecule of the instant disclosure.
  • the size of the cancer (e.g., in volume) is maintained and does not increase or increases by less than 10%, preferably less than 5%, preferably less than 4%, preferably less than 2%, and
  • Clinical response can be assessed using screening techniques such as PET, magnetic resonance imaging (MRI) scan, x-radiographic imaging, computed tomographic (CT) scan, flow cytometry or fluorescence-activated cell sorter (FACS) analysis, histology, gross pathology, and blood chemistry, including but not limited to changes detectable by ELISA, RIA, chromatography, and the like.
  • MRI magnetic resonance imaging
  • CT computed tomographic
  • FACS fluorescence-activated cell sorter
  • the anti-HER2 binding molecules e.g. , antibodies or antigen-binding fragments, variants, or derivatives thereof of the instant disclosure can be used in combination with any known therapies for cancer, including any agent or combination of agents that are known to be useful, or which have been used or are currently in use, for treatment of cancer, e.g. , colon cancer, lung cancer, gastric cancer, head and neck squamous cells cancer, and breast cancer.
  • the second agent or combination of agents of the pharmaceutical combination formulation or dosing regimen preferably has complementary activities to anti-HER2 binding molecule(s) of the instant disclosure such that they do not adversely affect each other.
  • Anticancer agents include drugs used to treat malignancies, such as cancerous growths. Drug therapy can be used alone, or in combination with other treatments such as surgery or radiation therapy. Several classes of drugs can be used in cancer treatment, depending on the nature of the organ involved. For example, breast cancers are commonly stimulated by estrogens, and can be treated with drugs which inactive the sex hormones. Similarly, prostate cancer can be treated with drugs that inactivate androgens, the male sex hormone.
  • Anti-cancer agents for use in certain methods of the present disclosure include, among others, antibodies (e.g. , antibodies which bind IGF- IR, antibodies which bind EGFR, antibodies which bind HER2 or HER3), small molecules targeting IGFIR, small molecules targeting EGFR, small molecules targeting HER2, antimetabolites, alkylating agents, topoisomerase inhibitors, microtubule targeting agents, kinase inhibitors, protein synthesis inhibitors, immunotherapeutic agents, hormonal therapies, glucocorticoids, aromatase inhibitors, mTOR inhibitors, chemotherapeutic agents, protein kinase B inhibitors, phosphatidylinositol 3-kinase (PI3K) inhibitors, cyclin dependent kinase (CDK) inhibitors, RLr9, CD289, enzyme inhibitors, anti-TRAIL, MEK inhibitors, etc.
  • antibodies e.g. , antibodies which bind IGF- IR, antibodies which bind EGFR
  • the anti-HER2 binding molecules disclosed herein can be administered in combination with other antibodies or antibody fragments targeting epidermal growth factor receptor (EGFR), e.g. Erbitux® (cetuximab) or panitumumab (VECTIBIX®).
  • EGFR epidermal growth factor receptor
  • Erbitux® cetuximab
  • VECTIBIX® panitumumab
  • the anti-HER2 binding molecules disclosed herein can be administered in combination with kinase inhibitors, e.g., tyrosine kinase inhibitors. In some other specific aspects, the anti-HER2 binding molecules disclosed herein can be administered in combination with inhibitors of the tyrosine kinase activity associated with EGFR and/or HER2/neu, e.g., lapatinib. In some aspects, the anti-HER2 binding molecules of the instant disclosure can be administered in combination with antimitotic agents. In some specific aspects, the anti-HER2 binding molecules of the instant disclosure can be administered in combination with agents that stabilize the mitotic spindle microtubule assembly, e.g., paclitaxel or docetaxel.
  • kinase inhibitors e.g., tyrosine kinase inhibitors.
  • the anti-HER2 binding molecules disclosed herein can be administered in combination with inhibitors of the tyrosine kinase activity associated with EGFR and/or
  • the methods of the instant disclosure encompass co-administration, using separate formulations or a single pharmaceutical formulation, and consecutive administration in either order.
  • the anti-HER2 binding molecules described herein are administered in combination with other drugs, wherein the antibody or antigen-binding fragment, variant, or derivative thereof and the therapeutic agent(s) can be administered sequentially, in either order, or simultaneously (i.e., concurrently or within the same time frame).
  • the combination therapy can provide "synergy” and prove “synergistic", i.e., the effect achieved when the active ingredients used together is greater than the sum of the effects that results from using the compounds separately.
  • a synergistic effect can be attained when the active ingredients are: (1) co-formulated and administered or delivered simultaneously in a combined, unit dosage formulation; (2) delivered by alternation or in parallel as separate formulations; or (3) by some other regimen.
  • a synergistic effect can be attained when the compounds are administered or delivered sequentially, e.g., by different injections in separate syringes.
  • an effective dosage of each active ingredient is administered sequentially, i.e., serially
  • effective dosages of two or more active ingredients are administered together.
  • the anti-HER2 binding molecule e.g., an anti-HER2 antibody or antigen binding fragment thereof of the instant disclosure, can be administered in a synergistic combination with a growth factor receptor (EGFR) inhibitor.
  • EGFR growth factor receptor
  • the EGFR inhibitor is an antibody.
  • the EGFR inhibitor antibody is E BITUX® (cetuximab) or VECTIBIX® (panitumumab).
  • the anti-HER2 binding molecules of the instant disclosure can be administered in a synergistic combination with inhibitors of the tyrosine kinase activity associated with EGFR and/or HER2/neu, e.g., lapatinib.
  • the anti-HER2 binding molecules of the instant disclosure can be administered in a synergistic combination with an antimitotic agent.
  • the antimitotic agent stabilizes the mitotic spindle microtubule assembly.
  • the antimitotic agent is paclitaxel or docetaxel.
  • a further aspect is the use of anti-HER2 binding molecules of the instant disclosure, e.g., antibodies or antigen-binding fragments, variants, or derivatives thereof, for diagnostic monitoring of protein levels in tissue as part of a clinical testing procedure, e.g., to determine the efficacy of a given treatment regimen.
  • detection can be facilitated by coupling the antibody to a detectable substance.
  • detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials.
  • suitable enzymes include horseradish peroxidase, alkaline phosphatase, ⁇ -galactosidase, or acetylcholinesterase;
  • suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin;
  • suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin;
  • an example of a luminescent material includes luminol;
  • examples of bioluminescent materials include luciferase, luciferin, and aequorin;
  • suitable radioactive material include 125 I, 131 I, 35 S, or 3 H.
  • a further aspect is the use of anti-HER2 binding molecules of the instant disclosure, e.g., antibodies or antigen-binding fragments, variants, or derivatives thereof, to treat a cancer patient resistant to a HER2-targeting therapeutic agent, for example an antibody targeting an epitope within domain IV of HER2 such as trastuzumab.
  • the therapeutic agent comprises a moiety targeting the same epitope as trastuzumab, and a cytotoxic moiety.
  • such cytotoxic moiety is a maytansinoid.
  • the maytansinoid is DM-1.
  • the methods of treatment disclosed herein comprise the administration of an anti-HER2 binding molecule which is an anti-HER2 antibody comprising a heavy chain (HC) variable region (VH) and a light chain (LC) variable region (VL) comprising:
  • VH-CDR1 variable heavy chain CDR-1 (VH-CDR1) identical to SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VH-CDR2 variable heavy chain CDR-2 (VH-CDR2) identical to SEQ ID NO: 2 or identical to SEQ ID NO: 2 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VH-CDR3 variable heavy chain CDR-3 (VH-CDR3) identical to SEQ ID NO: 3 or identical to SEQ ID NO: 3 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VL-CDR1 variable light chain CDR-1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VL-CDR2 variable light chain CDR-2 (VL-CDR2) identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VL-CDR3 variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions.
  • the methods of treatment disclosed herein comprise the administration of an anti-HER2 binding molecule which is a bispecific anti-HER2 antibody comprising a first immunoglobulin antigen-binding domain and a second immunoglobulin antigen-binding domain, wherein (i) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 antibody binding sites, (ii) the first immunoglobulin antigen-binding domain binds to a first HER2 antibody binding site which comprises an epitope within domain II of HER2, and (iii) the first HER2 antibody binding site is distinct from the antibody binding site of pertuzumab.
  • an anti-HER2 binding molecule which is a bispecific anti-HER2 antibody comprising a first immunoglobulin antigen-binding domain and a second immunoglobulin antigen-binding domain, wherein (i) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 antibody binding sites, (ii) the first immunoglob
  • the methods of treatment disclosed herein comprise the administration of an anti-HER2 binding molecule which is a bispecific anti-HER2 antibody comprising a first immunoglobulin antigen-binding domain and a second immunoglobulin antigen-binding domain, wherein the first immunoglobulin antigen- binding domain comprises a heavy chain (HC) variable region (VH) and a light chain (LC) variable region (VL) comprising:
  • VH-CDR1 variable heavy chain CDR-1 (VH-CDR1) identical to SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VH-CDR2 variable heavy chain CDR-2 (VH-CDR2) identical to SEQ ID NO: 2 or identical to SEQ ID NO: 2 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VH-CDR3 variable heavy chain CDR-3 (VH-CDR3) identical to SEQ ID NO: 3 or identical to SEQ ID NO: 3 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VL-CDR1 variable light chain CDR-1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VL-CDR2 variable light chain CDR-2 (VL-CDR2) identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VL-CDR3 variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions.
  • HER2 binding molecule comprises at least one heterologous variable domain framework region (FW) different relative to the FW regions of an immunoglobulin antigen-binding domain comprising a VH comprising the amino acids SEQ ID NO:43 and a VL comprising the amino acids of SEQ ID NO:44.
  • FW heterologous variable domain framework region
  • the first immunoglobulin antigen -binding domain comprises:
  • VL-FW1 variable light chain framework 1
  • VL-FW2 comprising the amino acids of SEQ ID NO: 12;
  • VL-FW3 comprising the amino acids of SEQ ID NO: 13;
  • VL-FW4 comprising the amino acids of SEQ ID NO: 14; or (vi) any combination thereof.
  • HER2 binding molecule comprises a VH and a VL, wherein the VH comprises the amino acids of SEQ ID NO: 15 or 43; and wherein the first and second immunoglobulin antigen- binding domains specifically bind to distinct HER2 epitopes.
  • the first immunoglobulin antigen-binding domain of such anti-HER2 binding molecule a VH and a VL, wherein the VL comprises the amino acids of SEQ ID NO: 16 or 44; and wherein the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
  • the first immunoglobulin antigen-binding domain of such anti-HER2 binding molecule comprises a VH and a VL, wherein the VH comprises the amino acids of SEQ ID NO: 15; and wherein the VL comprises the amino acids of SEQ ID NO: 16.
  • the second immunoglobulin antigen-binding domain of such anti-HER2 binding molecule (a) specifically binds to the same HER2 epitope as the trastuzumab antibody; and/or (b) competitively inhibits HER2 binding by the trastuzumab antibody; and/or (c) comprises at least one, at least two, at least three, at least four, at least five, or at least six complementarity determining regions (CDRs) comprising the amino acids of any one of SEQ ID NOs: 54 to 59.
  • CDRs complementarity determining regions
  • the second immunoglobulin antigen-binding domain of such anti-HER2 binding molecule is an scFv comprising (i) a VH-CDR1 comprising the amino acids of SEQ ID NO:54; (ii) a VH-CDR2 comprising the amino acids of SEQ ID NO:55; (iii) a VH-CDR3 comprising the amino acids of SEQ ID NO:56; (iv) a VL-CDR1 comprising the amino acids of SEQ ID NO:57; (v) a VL-CDR2 comprising the amino acids of SEQ ID NO:58; and (vi) a VL- CDR3 comprising the amino acids of SEQ ID NO:59.
  • the methods of treatment disclosed herein comprise the administration of an anti-HER2 binding molecule which is an ADC comprising a bispecific anti-HER2 antibody, wherein said antibody comprises:
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO: 32A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid at position 239, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • a therapeutic moiety e.g., a tubulysin 1508 molecule
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:33A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to cysteine amino acids respectively located at positions 239 and 442 wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • two therapeutic moieties e.g., two tubulysin 1508 molecules
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:36A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid at position 239, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • a therapeutic moiety e.g., a tubulysin 1508 molecule
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO: 37 A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to cysteine amino acids respectively located at positions 239 and 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • two therapeutic moieties e.g., two tubulysin 1508 molecules
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:40A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid at position 239, wherein the amino acid position numbering is according to the EU index as set forth in Kabat; or,
  • a therapeutic moiety e.g., a tubulysin 1508 molecule
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:41A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to cysteine amino acids respectively located at positions 239 and 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
  • two therapeutic moieties e.g., two tubulysin 1508 molecules
  • the methods of treatment disclosed herein comprise the administration of an anti-HER2 binding molecule which is an ADC comprising a bispecific anti-HER2 antibody, wherein said antibody comprises:
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:32C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • a therapeutic moiety e.g., a tubulysin 1508 molecule
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:3C3 and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442 wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • two therapeutic moieties e.g., two tubulysin 1508 molecules
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:36C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • a therapeutic moiety e.g., a tubulysin 1508 molecule
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:37C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat; (v) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:40C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO: 67 and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
  • two therapeutic moieties e.g., two tubulysin 1508 molecules
  • anti-HER2 binding molecules e.g., antibodies, or antigen-binding fragments, variants, or derivatives thereof (e.g., an ADC such as Bs2-4T)
  • the route of administration of the anti-HER2 binding molecule can be, e.g., oral, parenteral, by inhalation or topical.
  • parenteral as used herein includes, e.g., intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, rectal, or vaginal administration.
  • anti-HER2 binding molecules e.g., antibodies, or antigen-binding fragments, variants, or derivatives thereof (e.g., an ADC such as Bs2-4T)
  • ADC such as Bs2-4T
  • anti-HER2 binding molecules of the instant disclosure e.g., antibodies, or antigen-binding fragments, variants, or derivatives thereof (e.g., an ADC such as Bs2-4T)
  • ADC antigen-binding fragments, variants, or derivatives thereof
  • the pharmaceutical compositions can comprise pharmaceutically acceptable carriers, including, e.g. , water, ion exchangers, proteins, buffer substances, and salts. Preservatives and other additives can also be present.
  • the carrier can be a solvent or dispersion medium. Suitable formulations for use in the therapeutic methods disclosed herein are described in Remington's Pharmaceutical Sciences (Mack Publishing Co.) 16th ed. (1980).
  • sterile injectable solutions can be prepared by incorporating an active compound (e.g., an anti-HER2 antibody, or antigen-binding fragment, variant, or derivative thereof, e.g., an ADC such as Bs2-4T, by itself or in combination with other active agents) in the required amount in an appropriate solvent followed by filtered sterilization.
  • an active compound e.g., an anti-HER2 antibody, or antigen-binding fragment, variant, or derivative thereof, e.g., an ADC such as Bs2-4T, by itself or in combination with other active agents
  • the preparations can be packaged and sold in the form of a kit.
  • Such articles of manufacture can have labels or package inserts indicating that the associated compositions are useful for treating a subject suffering from, or predisposed to a disease or disorder.
  • Parenteral formulations can be a single bolus dose, an infusion or a loading bolus dose followed with a maintenance dose. These compositions can be administered at specific fixed or variable intervals, e.g., once a day, or on an "as needed" basis.
  • composition can be administered as a single dose, multiple doses or over an established period of time in an infusion. Dosage regimens also can be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response).
  • compositions of the present disclosure for treatment of HER2-expressing cell-mediated diseases such as certain types of cancers including e.g. , colon cancer, lung cancer, gastric cancer, head and neck squamous cells cancer, melanoma, pancreatic cancer, prostate cancer, and breast cancer, vary depending upon many different factors, including means of administration, target site, physiological state of the patient, whether the patient is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic.
  • the cancer expresses low levels of HER2 as determined, for example, using HE CEPTESTTM.
  • the patient is a human, but non-human mammals including transgenic mammals can also be treated.
  • Treatment dosages can be titrated using routine methods known to those of skill in the art to optimize safety and efficacy.
  • the amount of at least one anti-HER2 binding molecule, e.g. , antibody or binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T) to be administered can be readily determined by one of ordinary skill in the art without undue experimentation. Factors influencing the mode of administration and the respective amount of at least one anti-HER2 binding molecule, e.g.
  • antibody, antigen-binding fragment, variant or derivative thereof include, but are not limited to, the severity of the disease, the history of the disease, and the age, height, weight, health, and physical condition of the individual undergoing therapy.
  • the amount of anti-HER2 binding molecule, e.g. , antibody, or fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T) to be administered will be dependent upon the mode of administration and whether the subject will undergo a single dose or multiple doses of this agent.
  • the present disclosure also provides for the use of an anti-HER2 binding molecule, e.g. , an antibody or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T), in the manufacture of a medicament for treating a type of cancer, including, e.g. , breast cancer, colon cancer, lung cancer, gastric cancer, head and neck squamous cells cancer, melanoma, pancreatic cancer, and prostate cancer.
  • the cancer expresses low levels of HER2 as determined, for example, using HE CEPTESTTM.
  • the disclosure also provides for the use of an anti-HER2 binding molecule, e.g. , antibody of the instant disclosure, or antigen-binding fragment, variant, or derivative thereof, in the manufacture of a medicament for treating a subject for treating a type of cancer.
  • the cancer expresses low levels of HER2 as determined, for example, using HERCEPTESTTM.
  • the medicament is used in a subject that has been pretreated with at least one other therapy.
  • pretreated or “pretreatment” is intended the subject has received one or more other therapies (e.g. , been treated with at least one other anti-cancer therapy) prior to receiving the medicament comprising the anti-HER2 binding molecule, e.g. , antibody or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T). It is not necessary that the subject was a responder to pretreatment with the prior therapy or therapies.
  • therapies e.g. , been treated with at least one other anti-cancer therapy
  • the medicament comprising the anti-HER2 binding molecule, e.g. , antibody or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T). It is not necessary that the subject was a responder to pretreatment with the prior therapy or therapies.
  • the subject that receives the medicament comprising the anti-HER2 binding molecule e.g., an antibody or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T) could have responded, responded poorly, or could have failed to respond to pretreatment with the prior therapy, or to one or more of the prior therapies where pretreatment comprised multiple therapies.
  • an antibody or antigen-binding fragment, variant, or derivative thereof e.g., an ADC such as Bs2-4T
  • the present disclosure provides methods to treat patients that are poor responders or non- responders to other therapies (e.g., treatment with an antibody or an ADC such as T- DM1) comprising administering an anti-HER2 binding molecule disclosed herein, e.g., an antibody or binding fragment, a variant, or a derivative thereof (e.g., an ADC such as Bs2-4T).
  • therapies e.g., treatment with an antibody or an ADC such as T-DM1
  • methods to prevent resistance to cancer therapies e.g., resistance to treatment with an antibody or an ADC such as T-DM1 comprising administering an anti-HER2 binding molecule disclosed herein, e.g., an antibody or binding fragment, a variant, or a derivative thereof (e.g., an ADC such as Bs2-4T).
  • a person skilled in the art can determine whether a person showed no response after the treatment with the HER2 inhibitor.
  • a non- response to an inhibitor may be reflected in an increased suffering from cancer, such as an increased growth of a cancer/tumor and/or increase in the size of a tumor, the (increase in) the formation of metastases or a increase in the number or size of metastases.
  • a non-response may also be the development of a tumor or metastases, for example after resection of a tumor, in the shortening of time to disease progression, or in the increase in the size of (a) tumor(s) and/or (a) metastases, for example in neoadjuvant therapy.
  • a patient group can be identified that does not respond to treatment with HER2 inhibitors, like pertuzumab, trastuzumab, or T-DM1.
  • Such group of patients then could be treated with the anti-HER2 binding molecules disclosed herein, e.g., antibody of the disclosure, or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T).
  • non-responder can refer to an individual/patient/subject that is less likely to respond to a treatment using a HER2 inhibitor (e.g., pertuzumab, trastuzumab, or T- DM1).
  • HER2 inhibitor e.g., pertuzumab, trastuzumab, or T- DM1.
  • Less likely to respond refers to a decreased likeliness that a pathological complete response will occur in a patient treated with a HER2 inhibitor.
  • a patient can be initially a good responder, and resistance to HER2 inhibitors can develop during treatment with such HER2 inhibitors (e.g., pertuzumab, trastuzumab, or T-DM1), leading to poor or no-response to the treatment.
  • HER2 inhibitors e.g., pertuzumab, trastuzumab, or T-DM1
  • good responder refers to an individual whose tumor does not demonstrate growth, metastases, increase in number or size of metastases, etc. during or after treatment using a HER2 inhibitor (like pertuzumab, trastuzumab, or T- DM1), for example based on serial imaging studies, an individual that does not experience tumor growth, metastases, increase in number or size of metastases, etc. over a period of time (e.g., about 1 year following initial diagnosis), and/or an individual that experiences a certain life span (e.g., about 2 years or more following initial diagnosis).
  • HER2 inhibitor like pertuzumab, trastuzumab, or T- DM1
  • pool responder refers to an individual whose tumor grows or metastasizes during or shortly therafter standard therapy, for example using a HER2 inhibitor (like pertuzumab, trastuzumab, or T-DM1), or who experiences adverse clinical effects attributable to the tumor.
  • HER2 inhibitor like pertuzumab, trastuzumab, or T-DM1
  • the subject could be treated with the anti-HER2 binding molecules disclosed herein, e.g., antibody of the disclosure, or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T).
  • the anti-HER2 binding molecules disclosed herein e.g., antibody of the disclosure, or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T).
  • the instant disclosure also provides for the co-administration of an anti-HER2 binding molecule, e.g., antibody of the disclosure, or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T), and at least one other therapy.
  • the anti-HER2 binding molecule and the at least one other therapy can be co-administered together in a single composition or can be co-administered together at the same time or overlapping times in separate compositions.
  • an anti-HER2 binding molecule e.g., antibody of the disclosure, or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T)
  • an ADC such as Bs2-4T
  • the instant disclosure also provides for the use of an anti-HER2 binding molecule, e.g., antibody of the disclosure, or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T), in the manufacture of a medicament for treating a subject for treating cancer, wherein the anti-HER2 binding molecule is administered before a subject has been treated with at least one other therapy.
  • an anti-HER2 binding molecule e.g., antibody of the disclosure, or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T)
  • the present disclosure further provides diagnostic methods useful for during diagnosis of HER2-expressing cell-mediated diseases such as certain types of cancer including, e.g., colon cancer, lung cancer, gastric cancer, head and neck squamous cells cancer, melanoma, pancreatic cancer, prostate cancer, and breast cancer, which involves measuring the expression level of HER2 protein or transcript in tissue or other cells or body fluid from an individual and comparing the measured expression level with a standard HER2 expression level in normal tissue or body fluid, whereby an increase in the expression level compared to the standard is indicative of a disorder.
  • cancer e.g., colon cancer, lung cancer, gastric cancer, head and neck squamous cells cancer, melanoma, pancreatic cancer, prostate cancer, and breast cancer
  • the anti-HER2 binding molecules of the instant disclosure and antigen-binding fragments, variants, and derivatives thereof, can be used to assay HER2 protein levels in a biological sample using classical immunohistological methods known to those of skill in the art (e.g., see Jalkanen, et al., J. Cell. Biol. 707 :976-985 (1985); Jalkanen et al., J. Cell Biol. 105:3087-3096 (1987)).
  • Other antibody-based methods useful for detecting HER2 protein expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA), immunoprecipitation, or Western blotting. Suitable assays are described in more detail elsewhere herein.
  • HER2 polypeptide expression level in a first biological sample is intended qualitatively or quantitatively measuring or estimating the level of HER2 polypeptide in a first biological sample either directly (e.g., by determining or estimating absolute protein level) or relatively (e.g., by comparing to the disease associated polypeptide level in a second biological sample).
  • HER2 polypeptide expression level in the first biological sample can be measured or estimated and compared to a standard HER2 polypeptide level, the standard being taken from a second biological sample obtained from an individual not having the disorder or being determined by averaging levels from a population of individuals not having the disorder.
  • the standard HER2 polypeptide level is known, it can be used repeatedly as a standard for comparison.
  • biological sample any biological sample obtained from an individual, cell line, tissue culture, or other source of cells potentially expressing HER2. Methods for obtaining tissue biopsies and body fluids from mammals are well known in the art.
  • kits that comprise an anti-HER2 binding molecule disclosed herein, e.g., an anti-HER2 antibody or antigen binding fragment thereof, that can be used to perform the methods described herein.
  • a kit comprises at least one purified anti-HER2 binding molecule or an antigen-binding fragment thereof in one or more containers.
  • the kits contain all of the components necessary and/or sufficient to perform a detection assay, including all controls, directions for performing assays, and any necessary software for analysis and presentation of results.
  • the disclosed anti- HER2 binding molecules disclosed herein e.g., an anti-HER2 antibody or antigen binding fragment thereof, can be readily incorporated into one of the established kit formats which are well known in the art.
  • Anti-HER2 binding molecules e.g., antibodies or antigen-binding fragments thereof, variants, or derivatives thereof of the molecules of the instant disclosure can be assayed for immuno specific binding by any method known in the art.
  • the immunoassays that can be used include but are not limited to competitive and non-competitive assay systems using techniques such as Western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay), "sandwich” immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, protein A immunoassays, to name but a few.
  • Anti-HER2 binding molecules disclosed herein e.g., bispecific anti-HER2 antibodies or antigen-binding fragments thereof, variants, or derivatives thereof of the molecules of the instant disclosure, can be employed histologically, as in immunofluorescence, immunoelectron microscopy or non-immunological assays, for in situ detection of HER2 receptors or conserved variants or peptide fragments thereof.
  • In situ detection can be accomplished by removing a histological specimen from a patient, and applying thereto a labeled HER2-binding molecule, e.g., a bispecific anti-HER2 antibody or antigen-binding fragment thereof, variant, or derivative thereof, preferably applied by overlaying the labeled HER2-binding molecule (e.g., an antibody or fragment) onto a biological sample.
  • a labeled HER2-binding molecule e.g., a bispecific anti-HER2 antibody or antigen-binding fragment thereof, variant, or derivative thereof.
  • binding activity of a given lot of anti-HER2 binding molecule e.g., a bispecific anti-HER2 antibody or antigen-binding fragment thereof, variant, or derivative thereof, can be determined according to well-known methods. Those skilled in the art will be able to determine operative and optimal assay conditions for each determination by employing routine experimentation.
  • an anti-HER2 binding molecule of the instant disclosure e.g., a bispecific anti-HER2 antibody or antigen-binding fragment thereof, variant, or an altered/mutant derivative thereof, are known in the art and/or are commercially available.
  • Equipment and software designed for such kinetic analyses are commercially available (e.g., BIAcore, BIAevaluation software, GE Healthcare; KinExa Software, Sapidyne Instruments).
  • Embodiments are designated according to an "EnXrn” schema, where E means
  • n is the embodiment ordinal number
  • X is optional and can be A or B, where A denotes embodiments specifically related to ADC constructs, and B denotes embodiments specifically related to construct with enhanced ADCC; and m is an optional sub-ordinal number indicating additional embodiments within a class (e.g., Al, Bl, etc.).
  • a bispecific anti-HER2 antibody comprising a first immunoglobulin antigen- binding domain and a second immunoglobulin antigen-binding domain, wherein (i) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 antibody binding sites, (ii) the first immunoglobulin antigen-binding domain binds to a first HER2 antibody binding site which comprises an epitope within domain II of HER2, and (iii) the first HER2 antibody binding site is distinct from the antibody binding site of pertuzumab.
  • E2 The bispecific anti-HER2 antibody of El wherein the second immunoglobulin antigen-binding domain binds to a second HER2 antibody binding site which comprises an epitope within domain IV of HER2.
  • E3 The bispecific anti-HER2 antibody of E2 wherein the second HER2 antibody binding site is identical to the HER2 antibody binding site of trastuzumab.
  • E4 The bispecific anti-HER2 antibody of E2 wherein the second HER2 antibody binding site partially overlaps with the HER2 antibody binding site of trastuzumab.
  • E5. The bispecific anti-HER2 antibody of E2 wherein the second HER2 antibody binding site is distinct from the HER antibody binding site of trastuzumab.
  • E6. A bispecific HER2 antibody comprising a first immunoglobulin antigen- binding domain and a second immunoglobulin antigen-binding domain, wherein the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes; and wherein the first immunoglobulin antigen-binding domain binds HER2 to one or more amino acid residues in SEQ ID NO: 52.
  • E7 The bispecific antibody according to E6, wherein the second immunoglobulin antigen-binding domain binds HER2 at an epitope within domain IV.
  • E8 The bispecific antibody according to E6, wherein the second immunoglobulin antigen binding domain binds HER2 to one or more amino acid residues in SEQ ID NO: 53.
  • E9 The bispecific antibody according to E1-E8, wherein the first immunoglobulin antigen-binding domain comprises a heavy chain (HC) variable region (VH) and a light chain (LC) variable region (VL) comprising:
  • VH-CDR1 variable heavy chain CDR-1 (VH-CDR1) identical to SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VH-CDR2 variable heavy chain CDR-2 (VH-CDR2) identical to SEQ ID NO: 2 or identical to SEQ ID NO: 2 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VH-CDR3 variable heavy chain CDR-3 (VH-CDR3) identical to SEQ ID NO: 3 or identical to SEQ ID NO: 3 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VL-CDR1 variable light chain CDR-1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VL-CDR2 variable light chain CDR-2 (VL-CDR2) identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VL-CDR3 variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions.
  • the bispecific antibody according to E9, wherein the first immunoglobulin antigen-binding domain comprises at least one heterologous variable domain framework region (FW) different relative to the FW regions of an immunoglobulin antigen-binding domain comprising a VH comprising the amino acids SEQ ID NO:43 and a VL comprising the amino acids of SEQ ID NO:44.
  • FW heterologous variable domain framework region
  • El l The bispecific anti-HER2 antibody according to E10, wherein the first immunoglobulin antigen-binding domain comprises:
  • VL-FW1 variable light chain framework 1
  • VL-FW2 comprising the amino acids of SEQ ID NO: 12;
  • VL-FW3 comprising the amino acids of SEQ ID NO: 13;
  • VL-FW4 comprising the amino acids of SEQ ID NO: 14;
  • a bispecific anti-HER2 antibody comprising a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein the first immunoglobulin antigen-binding domain comprises a VH and a VL,
  • VH comprises the amino acids of SEQ ID NO: 15 or 43;
  • first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
  • a bispecific anti-HER2 antibody comprising a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein the first immunoglobulin antigen-binding domain comprises a VH and a VL,
  • VL comprises the amino acids of SEQ ID NO: 16 or 44;
  • first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
  • E14 The bispecific anti-HER2 antibody of E12 or E13,
  • VH comprises the amino acids of SEQ ID NO: 15;
  • VL comprises the amino acids of SEQ ID NO: 16.
  • E15 The bispecific anti-HER2 antibody according to any one of El to El 4, wherein the first immunoglobulin antigen-binding domain comprises an scFv antibody fragment.
  • E16 The bispecific anti-HER2 antibody according to any one of El to E15, wherein the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment.
  • E17 The bispecific anti-HER2 antibody according to thereof of any one of El to El 6, wherein the first immunoglobulin antigen binding domain comprises or consists of:
  • VH further comprising a heavy chain constant region or a fragment thereof and a VL comprising a light chain constant region (LC) or a fragment thereof;
  • E18 The bispecific anti-HER2 antibody according to E17, wherein the heavy chain constant region or fragment thereof is an IgG constant region.
  • E19 The bispecific HER2 antibody according to E18, wherein the IgG constant region or fragment thereof is an IgGl constant region.
  • E20 The bispecific HER2 antibody according to any one of E17 to E19, wherein the LC constant region is a kappa constant region.
  • E21 The bispecific HER2 antibody according to any one of E17 to El 9, wherein the LC constant region is a lambda constant region.
  • E22 The bispecific anti-HER2 antibody according to any one of El to E21, wherein the first immunoglobulin antigen-binding domain is a monoclonal antibody.
  • E23 The bispecific anti-HER2 antibody according to any one of El to E22, wherein the first immunoglobulin antigen-binding domain is a humanized antibody.
  • E24 The bispecific anti-HER2 antibody according to any one of El to E22, wherein the first immunoglobulin antigen-binding domain is a human antibody.
  • E25 The bispecific anti-HER2 antibody according to any one of El to E22, wherein the first immunoglobulin antigen-binding domain is a chimeric antibody.
  • E26 The bispecific anti-HER2 antibody according to any one of El to E25, wherein the first immunoglobulin antigen-binding domain is an affinity optimized antibody.
  • E27 The bispecific anti-HER2 antibody according to any one of El to E26, wherein the first immunoglobulin antigen-binding domain does not compete with trastuzumab or pertuzumab for epitope binding.
  • E28 The bispecific anti-HER2 antibody according to any one of El to E27, wherein the first and second immunoglobulin antigen binding domains specifically bind to distinct non- overlapping HER2 epitopes.
  • E29 The bispecific anti-HER2 antibody according to any one of El to E28, wherein:
  • the second immunoglobulin antigen-binding domain specifically binds to the same HER2 epitope as the trastuzumab antibody
  • the second immunoglobulin antigen-binding domain competitively inhibits HER2 binding by the trastuzumab antibody
  • the second immunoglobulin antigen-binding domain comprises at least one, at least two, at least three, at least four, at least five, or at least six complementarity determining regions (CDRs) comprising the amino acids of any one of SEQ ID NOs: 54 to 59.
  • CDRs complementarity determining regions
  • E30 The bispecific anti-HER2 antibody according to E29, wherein the second immunoglobulin antigen-binding domain is anscFv comprising:
  • VH-CDR1 comprising the amino acids of SEQ ID NO:54;
  • VH-CDR2 comprising the amino acids of SEQ ID NO:55;
  • VH-CDR3 comprising the amino acids of SEQ ID NO:56;
  • VL-CDR1 comprising the amino acids of SEQ ID NO:57;
  • VL-CDR3 comprising the amino acids of SEQ ID NO:59.
  • E31 The bispecific anti-HER2 antibody according to E30, wherein the scFv is a disulfide stabilized scFv.
  • E32 The bispecific anti-HER2 antibody according to E30 or E31, wherein said scFv comprises a VH comprising the amino acids of SEQ ID NO: 17, and a VL comprising the amino acid of SEQ ID NO: 18.
  • E33 The bispecific ansti-HER2 antibody according to E32, wherein the VH and VL of the scFv are covalently linked via a peptide linker.
  • E34 The bispecific anti-HER2 antibody according to E33, wherein the peptide linker comprises the amino acids of SEQ ID NO: 19.
  • E35 The bispecific anti-HER2 antibody according to any one of E29 to E34, wherein the second immunoglobulin antigen-binding domain is covalently linked to the carboxy-terminus of the HC of the first immunoglobulin antigen-binding domain.
  • E36 The bispecific anti-HER2 antibody according to E35, comprising a linker interposed between the second immunoglobulin antigen binding domain and the carboxy- terminus of the HC of the first immunoglobulin antigen-binding domain.
  • E37 The bispecific anti-HER2 antibody according to any one of E29 to E34, wherein the second immunoglobulin antigen-binding domain is covalently linked to the amino-terminus of the HC of the first immunoglobulin antigen-binding domain.
  • E38 The bispecific anti-HER2 antibody according to E37, comprising a linker interposed between the second immunoglobulin antigen-binding domain and the amino- terminus of the HC of the first immunoglobulin antigen-binding domain.
  • E39 The bispecific anti-HER2 antibody according to E29 to E34, wherein the second immunoglobulin antigen binding domain is covalently intercalated in the polypeptide chain of the HC of the first immunoglobulin antigen-binding domain.
  • E40 The bispecific anti-HER2 antibody according to E39, wherein the second immunoglobulin antigen binding domain is covalently intercalated between the CHI region and CH2 region of the HC of the first immunoglobulin antigen-binding domain.
  • E41 The bispecific anti-HER2 antibody according to E40, comprising:
  • E42 The bispecific anti-HER2 antibody according to E41, wherein the first linker and the second linker are identical.
  • E43 The bispecific anti-HER2 antibody according to E41, wherein the first linker and the second linker are different.
  • E44 The bispecific anti-HER2 antibody according to any one of E36, E38, and
  • linkers comprise a peptide linker
  • E45 The bispecific anti-HER2 antibody according to E44, wherein the peptide linker comprises at least two, at least three, at least four, at least five, at least 10, at least
  • E46 The bispecific anti-HER2 antibody according to any one of E44 or E45, wherein the peptide linker comprises a peptide having the formula Ser x [(Gly) y -Ser 4 ] z where x is from 0 to 1, y is from 1 to 4, and z is from 1 to 10.
  • E47 The bispecific anti-HER2 antibody according to E46, wherein the peptide linker comprises SEQ ID NO: 19-22.
  • E48 The bispecific anti-HER2 antibody according to any one of El to E47, wherein the heavy chain comprises a constant region comprising an Fc domain.
  • E49 The bispecific anti-HER2 antibody according to E48, wherein the Fc domain comprises a CH2 region and a CH3 region.
  • E50 The bispecific anti-HER2 antibody according to E48, wherein the Fc domain is an IgGl Fc domain.
  • E51 The bispecific anti-HER2 antibody according to E50, wherein the IgGl Fc domain is a native IgGl Fc domain.
  • E52 The bispecific anti-HER2 antibody according to E51, wherein the native
  • IgGl Fc domain comprises the amino acids of SEQ ID NO: 23.
  • E53 The bispecific anti-HER2 antibody according to E48, wherein the Fc domain is a mutant IgGl Fc domain.
  • E54A The bispecific anti-HER2 antibody according to E53, wherein the mutant
  • IgGl Fc domain comprises at least one mutation capable of reducing the ADCC activity of the bispecific antibody.
  • E54B The bispecific anti-HER2 antibody according to E53, wherein the mutant
  • IgGl Fc domain comprises at least one mutation capable of enhancing the ADCC activity of the bispecific antibody.
  • E55A The bispecific anti-HER2 antibody according to E54A, wherein at least one mutation capable of reducing the ADCC activity of the bispecific antibody is an amino acid substitution.
  • E55B The bispecific anti-HER2 antibody according to E54B, wherein at least one mutation capable of enhancing the ADCC activity of the bispecific antibody is an amino acid substitution.
  • E56A The bispecific anti-HER2 antibody according to E55A, comprising at least one amino acid substitution comprising L234F, S239A, S239C, a cysteine amino acid insertion between positions 239 and 240 or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
  • E56B The bispecific anti-HER2 antibody according to E55B, comprising at least one amino acid substitution comprising, S239A, S239D, A330L, I332E, E333A, K334A, or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
  • E57A The bispecific anti-HER2 antibody according to E55A or E56A, wherein said mutant IgGl Fc domain comprises at least one amino acid substitution introducing a derivatizable group.
  • E57B The bispecific anti-HER2 antibody according to any one of E48 to E53,
  • E58A The bispecific anti-HER2 antibody according to E57A, wherein said mutant IgGl Fc domain comprises one to three amino acid substitution introducing a derivatizable group.
  • E58B The bispecific anti-HER2 antibody according to E57B, wherein the Fc domain is a hypofucosylated antibody having reduced amounts of fucosyl residues.
  • E59A The bispecific anti-HER2 antibody according to E57A or E58A, wherein the derivatizable group in a sulfhydryl group.
  • E59B The bispecific anti-HER2 antibody according to E57B or E58B, wherein the Fc domain has increased bisecting GlcNAc structures.
  • E60 The bispecific anti-HER2 antibody according to E59A, wherein the at least one amino acid substitution comprises S239C, 248C, 254C, 258C , 273C, 279C, 282C, 284C, 286C, 287C, 289C, 297C, 298C, 312C, 324C, 326C, 330C, 335C, 337C, 339C, 350C, 355C, 356C, 359C, 360C, 361C, 375C, 383C, 384C, 389C, 398C, 400C, 413C, 415C, 418C, 422C, 435C, 440C, 441C, S442C, 443C, a cysteine amino acid insertion between positions 239 and 240, and 446C, or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
  • E61A The bispecific anti-HER2 antibody according to any one E54A, E55A,
  • mutant Fc domain comprises the amino acids of SEQ ID NO: 24A, SEQ ID NO: 24C, SEQ ID NO: 25A or SEQ ID NO:25C.
  • E61B The bispecific anti-HER2 antibody according to any one E54B, E55B,
  • mutant Fc domain comprises the amino acids of SEQ ID NO: 24B or SEQ ID NO:25B.
  • a bispecific anti-HER2 antibody comprising a first and a second polypeptide chain associated with each other, wherein the first polypeptide chain is selected from:
  • TZs is an scFv that binds the same epitope as trastuzumab
  • L 1 ; L 2 , L 3 , and L 4 are peptide linkers
  • Fc x is an Fc domain
  • B VH and B CH are the VH and CHI regions, respectively, of an antibody capable of binding to an HER2 epitope distinct from the epitope recognized by the trastuzumab antibody.
  • E63 The bispecific anti-HER2 antibody according to E62, wherein the distinct epitope comprises one or more amino acids within SEQ ID NO: 52.
  • E64 The bispecific anti-HER2 antibody according to E62 or E63, wherein the second chain comprises [ B VL]-[CL] wherein BVL is the VL region of an antibody capable of binding to an HER2 epitope distinct from the epitope recognized by the trastuzumab antibody, and CL is a IgG light chain constant region.
  • E65 The bispecific anti-HER2 antibody according to E64, wherein CL is selected from the group consisting of a human kappa constant region and a human lambda constant region.
  • E66 The bispecific anti-HER2 antibody according to E64 or E65, wherein B VL comprises:
  • VL-CDR1 variable light chain CDR- 1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1 , 2, 3, or 4 amino acid substitutions;
  • VL-CDR2 variable light chain CDR-2 (VL-CDR2) identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1 , 2, 3, or 4 amino acid substitutions;
  • VL-CDR3 variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1 , 2, 3, or 4 amino acid substitutions.
  • E67 The bispecific anti-HER2 antibody according to E64, E65 or E66, wherein
  • B VL comprises the amino acids of SEQ ID NO: 16 or 44.
  • E68 The bispecific anti-HER2 antibody according to E65, wherein CL comprises the amino acids of SEQ ID NO:27A or SEQ ID NO: 27B.
  • E69 The bispecific anti-HER2 antibody according to any one of E62 to E68, wherein [TZs] comprises:
  • VH-CDR1 comprising the amino acids of SEQ ID NO:54;
  • VH-CDR2 comprising the amino acids of SEQ ID NO:55;
  • VH-CDR3 comprising the amino acids of SEQ ID NO:56;
  • VL-CDR1 comprising the amino acids of SEQ ID NO:57;
  • VL-CDR3 comprising the amino acids of SEQ ID NO:59.
  • E70 The bispecific anti-HER2 antibody according to any one of E62 to E69, wherein [TZs] is a disulfide stabilized scFv.
  • E71 The bispecific anti-HER2 antibody according to any one of E62 to E70, wherein [TZ S ] comprises a VH comprising the amino acids of SEQ ID NO: 17 and a VL comprising the amino acids of SEQ ID NO: 18, covalently linked by a peptide linker.
  • E72 The bispecific anti-HER2 antibody according to E71 , wherein the peptide linker comprises the amino acids of SEQ ID NO: 19.
  • E73 The bispecific anti-HER2 antibody according to any one of E69 to E72, wherein [TZs] comprises of the amino acids of SEQ ID NO:28.
  • E74 The bispecific anti-HER2 antibody according to any one of E62 to E73, wherein a hinge polypeptide links the [ B CH] and [FcX] .
  • E75 The bispecific anti-HER2 antibody according to E74, wherein the hinge polypeptide comprises or consists of the amino acids of SEQ ID NO: 26.
  • E76A The bispecific anti-HER2 antibody according to any one of E62 to E75, wherein the [Fcx] comprises at least one amino acid substitution introducing a derivatizable group.
  • E76B The bispecific anti-HER2 antibody according to any one of E62 to E75, wherein [Fcx] comprises at least one mutation capable of enhancing the ADCC activity of the bispecific antibody.
  • E77A The bispecific anti-HER2 antibody according to E76A, wherein the [Fcx] comprises one to three amino acid substitution introducing a derivatizable group.
  • E77B The bispecific anti-HER2 antibody according to E76B, wherein at least one mutation capable of enhancing the ADCC activity of the bispecific antibody is an amino acid substitution.
  • E78A The bispecific anti-HER2 antibody according to E76A or E77A, wherein the derivatizable group in a sulfhydryl group.
  • E78B The bispecific anti-HER2 antibody according to E77B, comprising at least one amino acid substitution comprising, S239A, S239D, A330L, I332E, E333A, K334A, or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
  • E78B The bispecific anti-HER2 antibody according to any one of E62 to E75,
  • Fc domain has an altered type of glycosylation that enhances ADCC activity.
  • E78B2 The bispecific anti-HER2 antibody according to E78B1, wherein the Fc domain is a hypofucosylated antibody having reduced amounts of fucosyl residues.
  • E78B3 The bispecific anti-HER2 antibody according to E78B1 or E78B2, wherein the Fc domain has increased bisecting GlcNAc structures.
  • E79 The bispecific anti-HER2 antibody according to E78A, wherein the at least one amino acid substitution comprises S239C, 248C, 254C, 258C, 273C, 279C, 282C, 284C, 286C, 287C, 289C, 297C, 298C, 312C, 324C, 326C, 330C, 335C, 337C, 339C, 350C, 355C, 356C, 359C, 360C, 361C, 375C, 383C, 384C, 389C, 398C, 400C, 413C, 415C, 418C, 422C, 435C, 440C, 441C, S442C, 443C, 446C, a cysteine amino acid insertion between positions 239 and 240, or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
  • E80A The bispecific anti-HER2 antibody according to any one of E62 to E75,
  • E80B The bispecific anti-HER2 antibody according to any one of E62 to E75,
  • [Fcx] comprises the amino acids of any one of SEQ ID NOS: 23, 24B, and 25B.
  • E81 The bispecific anti-HER2 antibody according to any one of E62 to E79, wherein [Li], [L 2 ], [L 3 ], and [L 4 ] comprise amino acids independently selected from the group consisting of SEQ ID NOs: 19, 20, 21, and 22.
  • E82 The bispecific anti-HER2 antibody according to any one of E62 to E79, wherein:
  • [Li] comprises the amino acids of SEQ ID NO: 19;
  • (iii) [L 3 ] comprises the amino acids of SEQ ID NO:21;
  • E83 The bispecific anti-HER2 antibody according to any one of E62 to E82, wherein [BVH] comprises:
  • VH-CDR1 variable heavy chain CDR-1 (VH-CDR1) identical to SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions;
  • VH-CDR2 variable heavy chain CDR-2
  • VH-CDR3 variable heavy chain CDR-3 (VH-CDR3) identical to SEQ ID NO: 3 or identical to SEQ ID NO: 3 except for up to 1, 2, 3, or 4 amino acid substitutions
  • E84 The bispecific anti-HER2 antibody according to any one of E62 to E82, wherein [BVH] comprises SEQ ID NO: 15 or 43.
  • VL variable light chain CDR-1
  • VL-CDR1 identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions
  • VL-CDR2 variable light chain CDR-2
  • VL-CDR3 variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions.
  • E87 The bispecific anti-HER2 antibody according to any one of E64 to E85, wherein [BVL] comprises the amino acids of SEQ ID NO: 16 or 44.
  • E88A The bispecific HER2 antibody according to claim any one of E62 to E87, wherein first polypeptide chain comprises the amino acids of any one of SEQ ID NOs: 30, 31 A, 32A, 32C, 33A, 33C, 34, 35A, 36A, 36C, 37A, 37C, 38, 38A, 39A, 40A, 40C, 41A or 41C, and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A or 42B, wherein the bispecific HER2 antibody is conjugated to a therapeutic moiety.
  • E88B The bispecific HER2 antibody according to claim any one of E62 to E87, wherein first polypeptide chain comprises the amino acids of any one of SEQ ID NOs: 30, 31B, 32B, 33B, 34, 35B, 36B, 37B, 38, 38B, 39B, 40B, or 41B, and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A or 42B, wherein the bispecific HER2 antibody has enhanced ADCC activity.
  • E89 The bispecific HER2 antibody according to any one of El to E88B, wherein the bispecific HER2 antibody induces internalization upon binding to the HER2 target.
  • HER2 antibody promotes effective lysosomal trafficking following internalization.
  • E91 The bispecific HER2 antibody according to any one of El to E88B, wherein the bispecific HER2 antibody induces HER2 target degradation.
  • E92 The bispecific HER2 antibody according to any one of El to E88B, wherein the bispecific HER2 antibody blocks ligand- induced AKT phosphorylation in low HER2-expressing cancer cells.
  • E93 The bispecific HER2 antibody according to any one of El to E88B, wherein the bispecific HER2 antibody disrupts ligand-induced HER2:HER3 dimerization.
  • An anti-HER2 binding molecule comprising an immunoglobulin heavy chain (VH) and an immunoglobulin light chain (VL), wherein the binding molecule comprises:
  • VH-CDR1 comprising the amino acids of SEQ ID NO: 1;
  • VH-CDR2 comprising the amino acids of SEQ ID NO: 2;
  • VH-CDR3 comprising the amino acids of SEQ ID NO: 3;
  • VL-CDR1 comprising the amino acids of SEQ ID NO: 4;
  • VL-CDR2 comprising the amino acids of SEQ ID NO: 5;
  • VL-CDR3 comprising the amino acids of SEQ ID NO: 6.
  • An anti-HER2 binding molecule comprising an immunoglobulin heavy chain (VH) and an immunoglobulin light chain (VL), wherein the VH comprises the amino acids of SEQ ID NO: 15.
  • E96 An anti-HER2 binding molecule comprising a VH and a VL, wherein the
  • VL comprises the amino acids of SEQ ID NO: 16.
  • E97 The binding molecule of E94 or E95 or E96, wherein the VH comprises the amino acids of SEQ ID NO: 15 and the VL comprises the amino acids of SEQ ID NO:
  • E98 The binding molecule of any one of E94 to E97 comprising an antibody, or antigen-binding fragment thereof.
  • ADC antibody-drug conjugate
  • E100A The ADC according to E99A, further comprising at least one optional spacer.
  • E101A The ADC according to E100A, where at least one spacer is a peptidic spacer.
  • E102A The ADC according to E100A, wherein at least one spacer is a nonpeptidic spacer.
  • E103A The ADC according to any one of E99A to E102A, comprising two, three, or four therapeutic moieties.
  • E104A The ADC according to any one of E99A to E103A, where all therapeutic moieties are the same.
  • E105A The ADC according to any one of E99A to E104A, wherein each therapeutic moiety is chemically conjugated to the side chain of an amino acid at a specific position in the Fc region of the bispecific antibody.
  • E106A The ADC according to El 05 A, where the specific positions are selected from the group consisting of 239, 248, 254, 258, 273, 279, 282, 284, 286, 287, 289, 297, 298, 312, 324, 326, 330, 335, 337, 339, 350, 355, 356, 359, 360, 361, 375, 383, 384, 389, 398, 400, 413, 415, 418, 422, 435, 440, 441, 442, 443, 446, an insertion between positions 239 and 240, and combinations thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
  • E107A The ADC according to E105A or 106A, wherein the specific positions are
  • amino acid position numbering is according to the EU index as set forth in Kabat.
  • E108A The ADC according to E105A or 106A, wherein the specific positions are
  • amino acid position numbering is according to the EU index as set forth in Kabat.
  • E109A The ADC according to El 05 A to El 08 A, wherein the amino acid side chain is a sulfhydryl side chain.
  • E110A An ADC comprising the bispecific HER2 antibody according to any one of El to E98, wherein said antibody comprises:
  • a first polypeptide chain comprising the amino acids of SEQ ID NO:37A and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties covalently linked to cysteine amino acids respectively located at positions 239 and 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • a first polypeptide chain comprising the amino acids of SEQ ID NO:41A and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties covalently linked to cysteine amino acids respectively located at positions 239 and 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
  • An ADC comprising the bispecific HER2 antibody according to any one of claims 1 to 113, wherein said antibody comprises:
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:32C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:33C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:36C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:37C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:40C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat; or,
  • a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:41C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat. [00529] E112A.
  • the therapeutic moiety comprises a cytotoxin, a radioisotope, a radioisotope, an immunomodulator, a cytokine, a lymphokine, a chemokine, a growth factor, a tumor necrosis factor, a hormone, a hormone antagonist, an enzyme, an oligonucleotide, a DNA, an RNA, an siRNA, an RNAi, a microRNA, a photoactive therapeutic agent, an anti-angiogenic agent, a pro-apoptotic agent, a peptide, a lipid, a carbohydrate, a chelating agent, or combinations thereof.
  • E113A The ADC according to E112A, wherein the cytotoxin is a tubulysin, an auri statin, a rnaytansinoid or a pyrrolobenzodiazepine (PBD).
  • the cytotoxin is a tubulysin, an auri statin, a rnaytansinoid or a pyrrolobenzodiazepine (PBD).
  • El 14 An isolated nucleic acid molecule or a set of nucleic acid molecules encoding a bispecific HER2 antibody according to any one of El to E93 or an anti-HER2 binding molecule according to any one of E94 to E98, or a complement thereof.
  • El 15. A vector or a set of vectors comprising the nucleic acid molecule or set of the nucleic acid molecules of El 14, or a complement thereof.
  • El 16 A host cell comprising an isolated nucleic acid molecule or a set of nucleic acid molecules according to El 14, or the vector or set of vectors according to El 15.
  • El 18. A method for producing a bispecific HER2 antibody according to any one of El to E93 or an anti-HER2 binding molecule according to any one of E94 to E98 comprising culturing the host cell according to any one of El 16 or El 17 and recovering the antibody from the culture medium.
  • El 19 A pharmaceutical composition comprising a bispecific HER2 antibody according to any one of El to E93, an anti-HER2 binding molecule according to any one of E94 to E98, or an ADC according to any one of E99A to E113A1, and a pharmaceutically acceptable carrier.
  • E120 A method of treating a HER2-expressing cancer comprising administering a bispecific HER2 antibody according to any one of El to E93, an anti-HER2 binding molecule according to any one of E94 to E98, an ADC according to any one of E99A to El 13A1 or the composition according to El 19 to a subject in need thereof.
  • E121 The method according to E120, wherein the cancer is a low HER2- expressing cancer.
  • E122 The method according to any one of E120 or E121, further comprising administering at least one additional therapeutic agent.
  • E123 The method according to E122, wherein the at least one additional therapeutic agent is a radionuclide or a chemotherapeutic agent.
  • E124 A method to target a therapeutic moiety to cells expressing HER2 comprising administering the therapeutic moiety fused or conjugated to a bispecific HER2 antibody according to any one of El to E93, an anti-HER2 binding molecule according to any one of E94 to E98, or an ADC according to any one of E99A to E113A1.
  • El 25 A method to increase the activity of a therapeutic moiety comprising conjugating the moiety to a bispecific HER2 antibody according to any one of El to E93, an anti-HER2 binding molecule according to any one of E94 to E98, or an ADC according to any one of E99A to El 13A1.
  • El 26 A method to improve the pharmacokinetic properties of a therapeutic moiety comprising conjugating the moiety to a bispecific HER2 antibody according to any one of El to E93, an anti-HER2 binding molecule according to any one of E94 to E98, or an ADC according to any one of E99A to El 13A1.
  • E127 The method according to any of E122 to E126, wherein the therapeutic moiety is a cytotoxin, a radioisotope, an immunomodulator, a cytokine, a lymphokine, a chemokine, a growth factor, a tumor necrosis factor, a hormone, a hormone antagonist, an enzyme, an oligonucleotide, a DNA, an RNA, an siRNA, an RNAi, a microRNA, a photoactive therapeutic agent, an anti-angiogenic agent, a pro-apoptotic agent, a peptide, a lipid, a carbohydrate, or a chelating agent.
  • the therapeutic moiety is a cytotoxin, a radioisotope, an immunomodulator, a cytokine, a lymphokine, a chemokine, a growth factor, a tumor necrosis factor, a hormone, a hormone antagonist, an enzyme, an oligonucleotide, a
  • cytotoxin is a tubulysin, an auri statin, a maytansinoid or a pyrrolobenzodiazepine (PBD).
  • E129 The ADC according to E113A or the method according to E128, wherein the cytoxin is tubulysin 1508 having the following structure:
  • E130 A method to treat resistance to a HER2-targeting therapeutic agent comprising administering a bispecific HER2 antibody according to any one of El to E93, an anti-HER2 binding molecule according to any one of E94 to E98, or an ADC according to any one of E99A to El 13A to a patient in need thereof.
  • GTKVEIK X in SEQ ID NO: 18 is Q or C
  • NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN Fc portion can include EU residues KALPAPIEKTI SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS 226 to its carboxyl-terminus.
  • TSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSGGG GSGGGGSGGGGSEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVR positions correspond to sites of QAPGKGLEWVS S I SS SS SYIYYADSVKGRFT I SRDNAKNSLYLQMNSLRA known allelic variation.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Cell Biology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Oncology (AREA)
  • Epidemiology (AREA)
  • Toxicology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

The present invention relates to anti-HER2 binding molecules (e.g., antibodies and antigen binding fragments thereof), derived HER2-binding molecules (e.g., bispecific anti-HER2 antibodies), and antibody-drug conjugates (ADC) that bind the extracellular domain of the HER2 receptor. Also provided are pharmaceutical formulation comprising the disclosed compositions and method for the treating diseases associated with HER2-mediated signal transduction.

Description

BISPECIFIC HER2 ANTIBODIES
[0001] This application claims benefit of U.S. Provisional Patent Application No.
61/978,516, filed April 11, 2014 and U.S. Provisional Patent Application No. 62/107,050, filed January 23, 2015, the disclosures of which are incorporated by reference herein in their entirety.
BACKGROUND
[0002] The present invention provides compositions that specifically bind to HER2 and methods for the use of such compositions for the treatment of cancer.
[0003] The HER family of receptor tyrosine kinases are important mediators of cell growth, differentiation and survival. The receptor family includes four distinct members including epidermal growth factor receptor (EGFR, ErbBl, or HERl), HER2 (ErbB2 or pl85neu), HER3 (ErbB3) and HER4 (ErbB4 or tyro2).
[0004] HER2 was originally identified as the product of the transforming gene from neuroblastomas of chemically treated rats. Amplification of the human homolog has observed in breast and ovarian cancers and correlates with a poor prognosis. Overexpression of HER2 (frequently but not uniformly due to gene amplification) has also been observed in other carcinomas including carcinomas of the stomach, endometrium, salivary gland, lung, kidney, colon, thyroid, pancreas and bladder. HER2 can also be overexpressed in prostate cancer.
[0005] The HER receptors are generally found in various combinations in cells and heterodimerization is thought to increase the diversity of cellular responses to a variety of HER ligands (Earp et al. Breast Cancer Research and Treatment 35: 115-132 (1995)). While EGF and TGFa do not bind HER2, EGF stimulates EGFR and HER2 to form a heterodimer, which activates EGFR and results in transphosphorylation of HER2 in the heterodimer. Dimerization and/or transphosphorylation appear to activate the HER2 tyrosine kinase. See Earp et al, supra. Likewise, when HER3 is co-expressed with HER2, an active signaling complex is formed and antibodies directed against HER2 are capable of disrupting this complex (Sliwkowski et al, J. Biol. Chem., 269: 14661-14665 (1994)).
[0006] Numerous antibodies targeting HER2 have been described in the art (see, e.g.,Hudziak et al, Mol. Cell. Biol. 9: 1165-1172 (1989); U.S. Pat. No. 5,677,171; Fendly et al. Cancer Research 50: 1550-1558 (1990); Kotts et al. In vitro 26(3):59A (1990); Sarup et al. Growth Regulation 1 :72-82 (1991); Shepard et al. J. Clin. Immunol. 11 : 117- 127 (1991); Kumar et al. Mol. Cell. Biol. 1 :979-986 (1991); Lewis et al. Cancer Immunol. Immunother. 37:255-263 (1993); Pietras et al. Oncogene 9: 1829-1838 (1994); Vitetta et al. Cancer Research 54:5301-5309 (1994); Sliwkowski et al. J. Biol. Chem. 269(20): 14661-14665 (1994); Scott et al. J. Biol. Chem. 266: 14300-5 (1991); D'souza et al. Proc. Natl. Acad. Sci. 91 :7202-7206 (1994); Lewis et al. Cancer Research 56: 1457- 1465 (1996); and Schaefer et al. Oncogene 15: 1385-1394 (1997).
[0007] Other HER2 antibodies with various properties have been described in Tagliabue et al. Int. J. Cancer 47:933-937 (1991); McKenzie et al. Oncogene 4:543-548 (1989); Maier et al. Cancer Res. 51 :5361-5369 (1991); Bacus et al. Molecular Carcinogenesis 3:350-362 (1990); Stancovski et al. PNAS (USA) 88:8691-8695 (1991); Bacus et al. Cancer Research 52:2580-2589 (1992); Xu et al. Int. J. Cancer 53:401-408 (1993); WO94/00136; Kasprzyk et al. Cancer Research 52:2771-2776 (1992); Hancock et al. Cancer Res. 51 :4575-4580 (1991); Shawver et al. Cancer Res. 54: 1367-1373 (1994); Arteaga et al. Cancer Res. 54:3758-3765 (1994); Harwerth et al. J. Biol. Chem. 267: 15160-15167 (1992); U.S. Pat. No. 5,783, 186; and Klapper et al. Oncogene 14:2099- 2109 (1997).
[0008] Trastuzumab (HE CEPTIN®; see U.S. Pat. No. 5,821,337), a recombinant humanized version of the murine HER2 antibody 4D5, is clinically active in patients with HER2-overexpressing metastatic breast cancers that have received extensive prior anticancer therapy (Baselga et al, J. Clin. Oncol. 14:737-744 (1996)). To target the HER signaling pathway, Pertuzumab (PERJETA™; see Patent Publication WO2001/00245) was developed as a humanized version of the murine antibody 2C4 that inhibits the dimerization of HER2 with other HER receptors, thereby inhibiting ligand-driven phosphorylation and activation, and downstream activation of the RAS and AKT pathways. Ado-trastuzumab emtansine (T-DM1 ; KADCYLA®) is an antibody drug conjugate of trastuzumab linked to the cytotoxic agent mertansine approved for use in patients with HER2-overexpressing metastatic breast cancers resistant to trastuzumab.
[0009] Although, the therapeutic efficacy of trastuzumab in breast carcinoma is well demonstrated, it is strictly limited and only approved for 30% of breast cancer patients whose tumor overexpress HER2. 70% of the breast cancer patients do not or insufficiently respond to trastuzumab because their individual tumor do not overexpress or do not sufficiently express HER2. In other cancers and/or individual cancers, HER2 is overexpressed in a significant percentage of cases ranging from 43 to 69%, However, as a rule, the levels of HER2 expression are in principle low in the majority of tumors. Furthermore, the-overexpression of HER2 receptors is often caused by encoding gene amplification (Hynes et al., Nat Rev Cancer 5:341 (2005)). Thus, the present day consensus is that anti-HER2 monoclonal antibody therapy is inefficient in tumors with low HER2 expression or missing overexpression. Furthermore, resistance to these anti- HER2 antibodies is a significant problem.
[0010] Given the lack of an effective anti-HER2 therapy in specific cancers expressing low levels of HER2 and resistance to the current therapies, there is a need for improved antibodies capable of effectively binding to cancer cells expressing a wider range of levels of HER2 and inhibiting their growth via, for example, (i) Antibody-Dependent Cell-Mediated Cytotoxicity (ADCC) and/or (ii) cytotoxic action due to payloads conjugated to the antibodies as Antibody Drug Conjugates (ADC) and/or (iii) inhibiting receptor mediating signaling (e.g. by inhibiting receptor dimerization and/or mediating receptor internalization).
[0011] Thus, it is an object of the present disclosure to provide improved immunotherapeutic agents that effectively inhibit HER2-mediated cell signaling that can be used for the treatment of HER2-expressing cancers, including cancers where HER2 is not expressed at high levels.
BRIEF SUMMARY
[0012] The present disclosure provides an anti-HER2 binding molecule comprising an immunoglobulin heavy chain (VH) and an immunoglobulin light chain (VL), wherein the VH comprises the amino acid sequence of SEQ ID NO: 15. Also provided is an anti- HER2 binding molecule comprising a VH and a VL, wherein the VL comprises the amino acid sequence of SEQ ID NO: 16. In some aspects, the VH comprises the amino acid sequence of SEQ ID NO: 15 and the VL comprises the amino acid sequence of SEQ ID NO: 16. In some aspects, the anti-HER2 binding molecule comprises an antibody, or antigen-binding fragment thereof.
[0013] The present disclosure also provides a bispecific anti-HER2 antibody comprising a first immunoglobulin antigen-binding domain and a second immunoglobulin antigen- binding domain, wherein (i) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 antibody binding sites, (ii) the first immunoglobulin antigen-binding domain binds to a first HER2 antibody binding site which comprises an epitope within domain II of HER2, and (iii) the first HER2 antibody binding site is distinct from the antibody binding site of pertuzumab. In some aspects, the second immunoglobulin antigen-binding domain binds to a second HER2 antibody binding site which comprises an epitope within domain IV of HER2. In some aspects, the second HER2 antibody binding site is identical the HER2 antibody binding site of trastuzumab. In some aspects, the second HER2 antibody binding site partially overlaps with the HER2 antibody binding site of trastuzumab. In other aspects, the second HER2 antibody binding site is distinct from the HER antibody binding site of trastuzumab.
[0014] The present disclosure also provides a bispecific anti-HER2 antibody comprising a first immunoglobulin antigen-binding domain and a second immunoglobulin antigen- binding domain, wherein the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes; and wherein the first immunoglobulin antigen-binding domain binds HER2 at an epitope comprising one or more amino acid residues in SEQ ID NO: 52.
[0015] In some aspects, the first immunoglobulin antigen-binding domain binds HER2 at an epitope comprising one or more amino acid residues in SEQ ID NO: 52 and the second immunoglobulin antigen-binding domain specifically binds HER2 at an epitope within domain IV. In some aspects, the second immunoglobulin antigen-binding domain binds HER2 at an epitope comprising one or more amino acid residues in SEQ ID NO: 53.
[0016] In some aspects, the first immunoglobulin antigen-binding domain comprises a heavy chain variable region (VH) and a light chain variable region (VL) comprising: (i) a variable heavy chain CDR-1 (VH-CDR1) sequence identical to SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions; (ii) a variable heavy chain CDR-2 (VH-CDR2) sequence identical to SEQ ID NO: 2 or identical to SEQ ID NO: 2 except for up to 1, 2, 3, or 4 amino acid substitutions;
(iii) a variable heavy chain CDR-3 (VH-CDR3) sequence identical to SEQ ID NO: 3 or identical to SEQ ID NO: 3 except for up to 1, 2, 3, or 4 amino acid substitutions;
(iv) a variable light chain CDR-1 (VL-CDR1) sequence identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions;
(v) a variable light chain CDR-2 (VL-CDR2) sequence identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1, 2, 3, or 4 amino acid substitutions; and,
(vi) a variable light chain CDR-3 (VL-CDR3) sequence identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions.
[0017] In certain aspects, the first immunoglobulin antigen-binding domain comprises at least one heterologous variable domain framework region (FW) relative to the immunoglobulin antigen-binding domain comprising a VH comprising the amino acid sequence SEQ ID NO:43 and a VL comprising the amino acid sequence of SEQ ID NO:44.
[0018] In certain aspects, the first immunoglobulin antigen-binding domain comprises an scFv antibody fragment.
[0019] In certain aspects, the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment.
[0020] In some aspects, the at least one heterologous FW region of the bispecific anti-
HER2 antibody comprises a first immunoglobulin antigen-binding domain further comprising (i) a variable light chain framework 1 (VL-FW1) amino acid sequence comprising SEQ ID NO: 11; (ii) a VH-FW2 amino acid sequence comprising SEQ ID NO: 12; (iii) a VH-FW3 amino acid sequence comprising SEQ ID NO: 13; (iv) a VH-FW4 amino acid sequence at comprising SEQ ID NO: 14; or (vi) any combination thereof.
[0021] In some aspects, the bispecific anti-HER2 antibody comprises a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein the first immunoglobulin antigen-binding domain comprises a VH and a VL, wherein the VH amino acid sequence comprises SEQ ID NO: 15; wherein the first or the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment, and wherein the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
[0022] In some aspects, the bispecific anti-HER2 antibody comprises a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein the first immunoglobulin antigen-binding domain comprises a VH and a VL, wherein the VL amino acid sequence comprises SEQ ID NO: 16; wherein the first or the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment, and wherein the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
[0023] In some aspects, the bispecific anti-HER2 antibody comprises a VH and a VL, wherein the VH amino acid sequence comprises SEQ ID NO: 15; and wherein the VL amino acid sequence comprises SEQ ID NO: 16, wherein the first or the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment, and wherein the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
[0024] In some aspects, the bispecific anti-HER2 antibody disclosed herein comprises a first immunoglobulin antigen binding domain comprising or consisting of (a) a VH further comprising a heavy chain constant region or a fragment thereof and a VL comprising a light chain constant region or a fragment thereof; (b) a single chain Fv ("scFv"); (c) a diabody; (d) a minibody; (e) an F(ab')2; or (f) F(ab). In same aspects, the heavy chain constant region or fragment thereof is an IgG constant region. In some aspects, the IgG constant region or fragment thereof is an IgGl constant region. In some aspects, the LC constant region is a kappa constant region.
[0025] In some aspects, the LC constant region is a lambda constant region. In some aspects, the first immunoglobulin antigen-binding domain is a monoclonal antibody. In some aspects, the first immunoglobulin antigen-binding domain is a humanized antibody. In some aspects, the first immunoglobulin antigen-binding domain is a human antibody. In some aspects, the first immunoglobulin antigen-binding domain is a chimeric antibody. In some aspects, the first immunoglobulin antigen-binding domain is an affinity optimized antibody. In some aspects, the first immunoglobulin antigen-binding domain does not compete with trastuzumab or pertuzumab for epitope binding. In some aspects, the first and second immunoglobulin antigen binding domains specifically bind to distinct non-overlapping HER2 epitopes.
[0026] In some aspects, the bispecific anti-HER2 antibody comprises a first and a second immunoglobulin antigen-binding domain, wherein (a) the second immunoglobulin antigen-binding domain specifically binds to the same epitope in domain IV of HER2 as the trastuzumab antibody; (b) the second immunoglobulin antigen-binding domain competitively inhibits HER2 binding by the trastuzumab antibody; and/or (c) the second immunoglobulin antigen-binding domain comprises at least one, at least two, at least three, at least four, at least five, or at least six complementarity determining regions (CDRs) having amino acids selected from the group consisting of SEQ ID NOs: 54 to 59.
[0027] In some aspects, the second immunoglobulin antigen-binding domain comprises an scFv comprising: (i) a VH-CDR1 comprising the amino acids of SEQ ID NO:54; (ii) a VH-CDR2 comprising the amino acids of SEQ ID NO:55; (iii) a VH-CDR3 comprising the amino acids of SEQ ID NO:56; (iv) a VL-CDR1 comprising the amino acids of SEQ ID NO:57; (v) a VL-CDR2 comprising the amino acids of SEQ ID NO:58; and (vi) a VL- CDR3 comprising the amino acids of SEQ ID NO:59. In some aspects, the scFv is a disulfide stabilized scFv. In some aspects, the scFv comprises a VH comprising the amino acids of SEQ ID NO: 17, and a VL comprising the amino acids of SEQ ID NO: 18 .
[0028] In some aspects, the VH and VL of the scFv are covalently linked via a peptide linker. In some aspects, the peptide linker comprises the amino acid sequence of SEQ ID NO: 19.
[0029] In some aspects, the second immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody is covalently linked to the carboxy-terminus of the HC of the first immunoglobulin antigen-binding domain. In some aspects, the bispecific anti- HER2 antibody comprises a linker interposed between the second immunoglobulin antigen binding domain and the carboxy-terminus of the HC of the first immunoglobulin antigen-binding domain. In other aspects, the second immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody is covalently linked to the amino-terminus of the HC of the first immunoglobulin antigen-binding domain. In some aspects, the bispecific anti-HER2 antibody comprises a linker interposed between the second immunoglobulin antigen-binding domain and the amino-terminus of the HC of the first immunoglobulin antigen-binding domain.
[0030] In some aspects, the second immunoglobulin antigen binding domain of the bispecific anti-HER2 antibody is covalently intercalated in the polypeptide chain of the HC of the first immunoglobulin antigen-binding domain. In some aspects, the second immunoglobulin antigen binding domain is covalently intercalated between the CHI region and CH2 region of the HC of the first immunoglobulin antigen-binding domain. In some aspects, the bispecific anti-HER2 antibody comprises a linker interposed between the CHI region of the HC of the first immunoglobulin antigen binding domain and the second immunoglobulin antigen binding domain, and a second linker interposed between the second immunoglobulin antigen binding domain and the CH2 region of the HC of the of the first immunoglobulin antigen-binding domain.
[0031] In some aspects, the first linker and the second linker are identical. In other aspects, the first linker and the second linker are different. In some aspects, one or more of the linkers comprise a peptide linker. In some aspects, the peptide linker comprises at least one, at least two, at least three, at least four, at least five, at least 10, at least 20, or at least 30 amino acids. In other aspects, the peptide linker comprises a peptide having the formula Serx[(Gly)y-Ser4]z where x is from 0 to 1, y is from 1 to 4, and z is from 1 to 10. In some aspects, the peptide linker comprises SEQ ID NOS: 19, 20, 21, or 22.
[0032] In some aspects, the bispecific anti-HER2 antibody comprises a heavy chain which can include an Fc domain comprising a CH2 and a CH3 region. In some aspects, the Fc domain is an IgGl Fc domain. In other aspects, the IgGl Fc domain is a native IgGl Fc domain. In some aspects, the native IgGl Fc domain comprises the amino acid sequence of SEQ ID NO: 23.
[0033] In some aspects, the Fc domain is a mutant IgGl Fc domain. In other aspects, the mutant IgGl Fc domain comprises at least one mutation capable of reducing the ADCC activity of the bispecific antibody. In some aspects, at least one mutation capable of reducing the ADCC activity of the bispecific antibody is an amino acid substitution. In some aspects, at least one amino acid substitution comprises L234F, S239A, S239C, or any combination thereof. [0034] In some aspects, the mutant IgGl Fc domain comprises at least one amino acid substitution introducing a derivatizable group. In some aspects, the derivatizable group in a sulfhydryl group. In some aspects, the at least one amino acid substitution comprises S239C, 248C, 254C, 273C, 279C, 282C, 284C, 286C, 287C, 289C, 297C, 298C, 312C, 324C, 326C, 330C, 335C, 337C, 339C, 350C, 355C, 356C, 359C, 360C, 361C, 375C, 383C, 384C, 389C, 398C, 400C, 413C, 415C, 418C, 422C, 440C, 441C, S442C, 443C and 446C, or any combination thereof. In some aspects, the mutant Fc domain comprises the amino acids of SEQ ID NO: 24 or SEQ ID NO:25.
[0035] Also provided is a bispecific anti-HER2 antibody comprising a first and a second polypeptide chain associated with each other, wherein the first polypeptide chain comprises a sequence selected from:
(1) [TZSHL!HBVHHBCHHFCX]
(2) [BVH]-[BCH]-[FCX]-[L2]-[TZS]
(3) [BVH]-[BCH]-[L3]-[TZS]-[L4]-[FCX]
wherein
TZs is an scFv that binds the same epitope as trastuzumab;
L1; L2, L3, and L4 are peptide linkers;
Fcx is an Fc domain;
BVH and BCH are the VH and CHI regions, respectively, of an antibody capable of binding to an HER2 epitope distinct from the epitope recognized by the trastuzumab antibody. In certain aspects the distinct epitope comprises one or more amino acid residues in SEQ ID NO: 52.
[0036] In some aspects a hinge polypeptide links [BCH] and [Fcx]. In a specific aspect the hinge polypeptide comprises or alternatively consists of the amino acids of SEQ ID NO: 26.
[0037] In some aspects, the second chain of the bispecific anti-HER2 antibody comprises the sequence [BVL]-[CL] wherein BVL is the VL region of an antibody capable of binding to an HER2 epitope distinct from the epitope recognized by the trastuzumab antibody, and CL is an IgG light chain constant region. In some aspects, CL is selected from the group consisting of a human kappa constant region and a human lambda constant region. In some aspects the BVL comprises (i) a variable light chain CDR-1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions; (ii) a variable light chain CDR-2 (VL-CDR2) identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1, 2, 3, or 4 amino acid substitutions; and, (iii) a variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions. In some aspects, BVL comprises the amino acids of SEQ ID NO: 16 or SEQ ID NO:44.
[0038] In other aspects, CL is a kappa light chain comprising the amino acid sequence of
SEQ ID NO:27A.
[0039] In other aspects, CL is a lambda light chain comprising the amino acid sequence of SEQ ID NO:27B.
[0040] In some aspects, [TZS] comprises (i) a VH-CDR1 comprising the amino acids of
SEQ ID NO:54; (ii) a VH-CDR2 comprising the amino acids of SEQ ID NO:55; (iii) a VH-CDR3 comprising the amino acids of SEQ ID NO:56; (iv) a VL-CDR1 comprising the amino acids of SEQ ID NO:57; (v) a VL-CDR2 comprising the amino acids of SEQ ID NO:58; and (vi) a VL-CDR3 comprising the amino acids of SEQ ID NO:59. In some aspects, [TZs] is a disulfide stabilized scFv. In some aspects, [TZs] comprises a VH comprising the amino acid sequence of SEQ ID NO: 17 and a VL comprising the amino acid sequence of SEQ ID NO: 18, covalently linked by a peptide linker. In some aspects, the peptide linker comprises the amino acid sequence of SEQ ID NO: 19. In some aspects, [TZs] comprises of the amino acid sequence of SEQ ID NO:28.
[0041] In some aspects, the amino acid sequence of [Fcx] is selected from the group consisting of SEQ ID NOs: 23, 24A, 24B, 24C, 25A, 25B and 25C. In some aspects, the amino acids of [L , [L2], [L3], and [L4] is independently selected from the group consisting of SEQ ID NOs: 19, 20, 21, and 22. In other aspects (i) [Li] comprises the amino acids of SEQ ID NO:20; (ii) [L2] comprises the amino acids of SEQ ID NO:20; (iii) [L3] comprises the amino acids of SEQ ID NO:21; and, (iv) [L4] comprises the amino acids of SEQ ID NO:22.
[0042] In some aspects, [BVH] comprises (i) a variable heavy chain CDR-1 (VH-CDR1) identical to SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions; (ii) a variable heavy chain CDR-2 (VH-CDR2) identical to SEQ ID NO: 2 or identical to SEQ ID NO: 2 except for up to 1, 2, 3, or 4 amino acid substitutions; and (iii) a variable heavy chain CDR-3 (VH-CDR3) identical to SEQ ID NO: 3 or identical to SEQ ID NO: 3 except for up to 1, 2, 3, or 4 amino acid substitutions. In some aspects, [BVH] comprises SEQ ID NO: 15 or SEQ ID NO:43. In other aspects, [BCH] comprises the amino acid sequence of SEQ ID NO: 29.
[0043] In some aspects, [BVL] comprises (i) a variable light chain CDR-1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions; (ii) a variable light chain CDR-2 (VL-CDR2) identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1, 2, 3, or 4 amino acid substitutions; and (iii) a variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions. In other aspects, [BVL] comprises the amino acids of SEQ ID NO: 16.
[0044] In some aspects, the first polypeptide chain of the bispecific anti-HER2 antibody comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 30, 31 A, 3 IB, 32A, 32B, 32C 33A, 33B, 33C, 34, 35A, 35B, 36A, 36B, 36C 37A, 37B, 37C 38, 39A, 39B, 40A, 40B, 40C, 41A, 41B and 41C, and the second polypeptide chain of the bispecific anti-HER2 antibody comprises the amino acids of SEQ ID NO:42A or 42B.
[0045] In some aspects, the second immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody induces internalization upon binding to the HER2 target. In some aspects, the second immunoglobulin antigen-binding domain of the bispecific HER2 antibody promotes effective lysosomal trafficking following internalization. In some aspects, the second immunoglobulin antigen-binding domain of the bispecific HER2 antibody induces HER2 target degradation. In some aspects, the second immunoglobulin antigen-binding domain of the bispecific HER2 antibody blocks ligand- induced AKT phosphorylation in low HER2-expressing cancer cells. In some aspects, the first immunoglobulin antigen-binding domain of the bispecific HER2 antibody disrupts ligand-induced HER2:HER3 dimerization.
[0046] The present disclosure also provides an ADC comprising an anti-HER2 binding molecule disclosed herein, or an anti-HER2 bispecific antibody disclosed herein, further comprising at least one therapeutic moiety. In some aspects, the ADC further comprises at least one optional spacer. In some aspects, the at least one spacer is a peptidic spacer. In some aspects, the at least one spacer is a nonpeptidic spacer.
[0047] Conventional conjugation strategies for ADCs rely on randomly conjugating the payload (e.g., therapeutic moiety) to the antibody through lysines or cysteines. Accordingly, in some aspects the ADC is randomly conjugated to a therapeutic moiety. In particular aspects, site-specific conjugation of therapeutic moieties to antibodies using reactive amino acid residues at specific positions yields homogeneous ADC preparations with uniform stoichiometry. In some aspects, the ADC comprises two, three, or four or more therapeutic moieties. In some aspects, all therapeutic moieties are the same. In some aspects, each therapeutic moiety is chemically conjugated to the side chain of an amino acid at a specific Kabat position in the Fc region of the bispecific antibody. In some aspects, the specific Kabat positions are 239, 442, or both. In some aspects, the specific positions are Kabat position442, an amino acid insertion between Kabat positions 239 and 240, or both. In some aspects, the amino acid side chain is a sulfhydryl side chain. In some aspects, the therapeutic moiety comprises a cytotoxin, a radioisotope, an auristatin, a maytansinoid or a pyrrolobenzodiazepine (PBD), or combinations thereof. In certain aspects, the cytotoxin is tubulysin. In certain aspects, the tubulysin is Compound T32 (also referred to herein as "tubulysin 1508" or simply "1508").
[0048] The present disclosure also provides an ADC comprising a bispecific anti-HER2 antibody, wherein said antibody comprises:
(i) a first polypeptide chain comprising the amino acids of SEQ ID NO: 32 and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a tubulysin molecule covalently linked to a cysteine amino acid at Kabat position 239.
(ii) a first polypeptide chain comprising the amino acids of SEQ ID NO:33 and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two tubulysin molecules covalently linked to cysteine amino acids respectively located at Kabat positions 239 and 442.
(iii) a first polypeptide chain comprising the amino acids of SEQ ID NO:40 and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a tubulysin molecule covalently linked to a cysteine amino acid at Kabat position 239.
(iv) a first polypeptide chain comprising the amino acids of SEQ ID NO:41 and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two tubulysin molecules covalently linked to cysteine amino acids respectively located at Kabat positions 239 and 442.
[0049] The instant disclosure also provides an isolated nucleic acid molecule or a set of nucleic acid molecules encoding an anti-HER2 binding molecule (e.g., a bispecific anti- HER2 antibody disclosed herein), or a complement thereof. Also provided is a vector or a set of vectors comprising such nucleic acid molecule or set of the nucleic acid molecules, or a complement thereof. Also provided is a host cell comprising the isolated nucleic acid molecule or a set of nucleic acid molecules, or the vector or set of vectors. Also provided is a host cell expressing an anti-HER2 binding molecule or bispecific anti-HER2 antibody disclosed herein. Also provided is a method for producing an anti-HER2 binding molecule or bispecific anti-HER2 antibody comprising culturing the host cell and recovering the antibody from the culture medium.
[0050] The instant disclosure also provides a pharmaceutical composition comprising an anti-HER2 binding molecule or anti-HER2 bispecific antibody, and a pharmaceutically acceptable carrier. Also provided is a method of treating a HER2-expressing cancer comprising administering an anti-HER2 binding molecule disclosed herein, an anti-HER2 bispecific antibody disclosed herein, an ADC disclosed herein, or a pharmaceutical composition disclosed herein to a subject in need thereof. In some aspects, the cancer is a low HER2-expressing cancer. In some aspects, the method further comprises administering at least one additional therapeutic agent. In some aspects, the at least one additional therapeutic agent is a radionuclide or a chemotherapeutic agent. Also provided is a method to target a therapeutic or prophylactic agent to the surface of cells expressing HER2 comprising conjugating the agent to an anti-HER2 binding molecule disclosed herein, or an anti-HER2 bispecific antibody disclosed herein. Also provided is a method to increase the activity of a therapeutic moiety comprising conjugating the agent to an anti-HER2 binding molecule disclosed herein, or an anti-HER2 bispecific antibody disclosed herein. Also provided is a method to improve the pharmacokinetic properties of a therapeutic or prophylactic agent comprising conjugating the agent to an anti-HER2 binding molecule disclosed herein, or an anti-HER2 bispecific antibody disclosed herein. In some aspects, the therapeutic moiety is a cytotoxin. In some aspects, the cytotoxin is tubulysin. In some aspects, the tubulysin is Compound T32, also referred to herein as "tubulysin 1508" or simply "1508". Also provided is a method to treat resistance to a HER2-targeting therapeutic agent comprising administering a bispecific HER2 antibody disclosed herein, an anti-HER2 binding molecule disclosed herein, or an ADC disclosed herein to a patient in need thereof. In some aspects, the patient is resistant to a HER2- targeting therapeutic agent comprising trastuzumab and/or the maytansinoid DM1.
BRIEF DESCRIPTION OF THE DRAWINGS/FIGURES
[0051] FIG. 1 shows a sequence alignment corresponding to the amino acid sequences of the VL and VH regions of the lead optimized 39S antibody (LO) and the parent AZ 1.39.1 antibody (WT). The location of CDR1, CDR2, and CDR3 is indicated. Amino acid residues which differ with respect to the parent antibody are highlighted. Replaced framework regions in VL region are also highlighted.
[0052] FIG. 2. shows that changing the light chain frameworks to germline IGKV2D resulted in a doubling of expression.
[0053] FIG. 3. Shows a ribbon representation of the structure of the extracellular domain of HER2. The binding sites of the 39S, pertuzumab and the domain IV scFv are indicated with arrows. The binding site of 39S includes amino acids within domain II that are distinct from those of pertuzumab.
[0054] FIG. 4 shows FACS competition assays using DL-680-labeled 39S (2 iglm\) and varying concentrations of unlabeled monoclonal antibodies (R347 control, trastuzumab, pertuzumab, AZ 1.39.1, and 39S).
[0055] FIG. 5 shows ligand-dependent proliferation assays using different antibody combinations and the cell line MCF-7, demonstrating that 39S synergistically inhibits the growth of the assayed cell lines when administered in combination with trastuzumab and/or pertuzumab. For each experiment, the antibody samples plotted are: R347 control, trastuzumab, pertuzumab plus trastuzumab, 39S, 39S plus trastuzumab, and 39S plus pertuzumab. [0056] FIG. 6 shows ligand-dependent proliferation assays using different antibody combinations and the cell line NCI-N87 demonstrating that 39S synergistically inhibits the growth of the assayed cell lines when administered in combination with trastuzumab and/or pertuzumab. For each experiment, the antibody samples plotted are: R347 control, trastuzumab, pertuzumab plus trastuzumab, 39S, 39S plus trastuzumab, and 39S plus pertuzumab.
[0057] FIG. 7 depicts bispecific constructs in which an HER2-binding moiety (a cysteine- stabilized scFv that binds within domain IV) has been genetically fused to different locations within the structure of the 39S antibody. The scFv was fused to the carboxy-terminus of each one of the heavy chains of the 39S antibody (referred to as "Bs3Ab-39SH") (FIG. 7B), fused to the amino-terminus of each one of the heavy chains of the 39S antibody (referred to as "Bs2Ab-39SH") (FIG. 7A), or intercalated between the CHI and CH2 regions of each one of the heavy chains of the 39S antibody (referred to as "Bs4Ab-39SH") (FIG. 7C).
[0058] FIG. 8A shows the sequences of the heavy chains of Bs2 antibodies, indicating the amino acids at Kabat locations 234, 239, 239-ins, 330, 332 and 442 in wild-type heavy chains and heavy chains which may be optimized for ADCC activity or for the production of ADCs that have reduced ADCC activity and/or site specific conjugation.
[0059] FIG. 8B shows the sequences of the heavy chains of Bs3 antibodies, indicating the amino acids at Kabat locations 234, 239, 239-ins, 330, 332 and 442 in wild-type heavy chains and heavy chains which may be optimized for ADCC activity or for the production of ADCs that have reduced ADCC activity and/or site specific conjugation.
[0060] FIG. 8C shows the sequences of the heavy chains of Bs4 antibodies, indicating the amino acids at Kabat locations 234, 239, 239-ins, 330, 332 and 442 in wild-type heavy chains and heavy chains which may be optimized for ADCC activity or for the production of ADCs that have reduced ADCC activity and/or site specific conjugation.
[0061] FIG. 9A shows ligand-dependent proliferation assays using different bispecific antibody constructs and MDA-MB-361 cells demonstrating that Bs2Ab-39SH, Bs3Ab- 39SH and Bs4Ab-39SH have similar potency in MDA-MB-361 and MCF-7 cells (FIG. 9A and 9B, respectively), which is also comparable to the activity of parental antibody combination (39S plus trastuzumab). For each experiment, the antibody samples plotted are: R347 control, Bs2Ab-39SH, Bs3Ab-39SH, Bs4Ab-39SH, and 39S plus trastuzumab.
[0062] FIG. 9B shows ligand-dependent proliferation assays using different bispecific antibody constructs and MCF-7 cells demonstrating that Bs2Ab-39SH, Bs3Ab-39SH and Bs4Ab-39SH have similar potency in MDA-MB-361 and MCF-7 cells (FIG. 9A and 9B, respectively), which is also comparable to the activity of parental antibody combination (39S plus trastuzumab). For each experiment, the antibody samples plotted are: R347 control, Bs2Ab-39SH, Bs3Ab-39SH, Bs4Ab-39SH, and 39S plus trastuzumab.
[0063] FIG. 10 shows immunoprecipitation (IP) of HER2 from T47D cells followed by
Western (WB) detection of HER2 and HER3 to measure the disruption of HER2:HER3 dimerization induced by heregulin (HRGl), in the presence or absence of anti-HER2 antibodies. T47D cells were incubated under control conditions (with no antibody and with no HRGl; with no antibody but with HRGl; or, with control antibody R347 and with HRGl), and after incubation with HRGl plus (i) trastuzumab, (ii) pertuzumab, (iii) 39S antibody, or (iv) the Bs2Ab-39SH bispecific construct.
[0064] FIG. 11 shows the representative HPLC size-exclusion chromatography profiles showing the size separation of immune complexes derived from antibody: HER2 molar ratio of 1: 1. Bs2Ab-39SH can cross-link many HER2 molecules to form complexes as large as 1716 kDa in size, while trastuzumab can only bind to two HER2 molecules in maximal to form a 320 kDa complex.
[0065] FIG. 12 presents FACS -based receptor internalization assays showing that the three formats of HER2 bispecific antibodies presented in FIG. 6 internalized rapidly in the cell line BT-474. Plotted on the graph are: R347 control, trastuzumab, 39S, trastuzumab plus 39S, Bs2Ab-39SH, Bs3Ab-39SH, and BsAb-39SH. Similar results were seen in MCF-7 , T47D , RT-112 , MDA-MB-361, and NCI-N87 cell lines (data not shown)..
[0066] FIG. 13 shows the kinetics of Bs2Ab-39SH internalization by BT-474 cells.
Microscopy images were taken at 0, 30, 60, 120, and 360 minutes after addition of the Bs2Ab-39SH construct, trastuzumab or the R347 control. The cytoplasm of the BT-474 cells was stained with CELLTRACKER™ Green (Life Technologies Corp.), and the antibodies were labeled with ALEXA FLUOR® 647 (Life Technologies Corp.). [0067] FIG. 14 is a Western immunoblot showing the degree of degradation of HER2, or lack thereof, 2 hours, 6 hours, and 24 hours after incubation of BT-474 cells with antibody samples. GAPDH was used as control. The tested antibody samples were: (lane 1) R347 control antibody, (lane 2) trastuzumab, (lane 3) pertuzumab, (lane 4) trastuzumab and pertuzumab, (lane 5) 39S, (lane 6) trastuzumab and 39S, (lane 7) pertuzumab and 39S, (lane 8) trastuzumab, pertuzumab and 39S, (lane 9) Bs2Ab-39SH, (lane 10) Bs2Ab-39SH_aFuc (homogenously afucosylated Bs2Ab-39SH), (lane 11) Bs3Ab-39SH, (lane 12) Bs3Ab-39SH_aFuc (homogenously afucosylated Bs3Ab- 39SH_aFuc), (lane 13) Bs4Ab-39SH, and (lane 14) Bs4Ab-39SH_aFuc (homogenously afucosylated Bs4Ab-39SH).
[0068] FIG. 15 is a detailed cartoon representations of exemplary ADCs derived from the Bs2Ab-39SH (panel A), the Bs3Ab-39SH (panel B) and the Bs4Ab-39SH (panel C) anti-HER2 constructs. Two potential engineered cytotoxic agent conjugation sites in the CH2 and CH3 domains of the ADC constructs are indicated by circles. Where the desired drug-to-antibody ratio (DAR) is 2 to 1 either site 1 or site 2 may be used. Where a DAR of 4 is desirable both sites 1 and 2 are utilized. Alternative and/or additional sites may be engineered. The bispecific anti-HER2 ADCs are abbreviated herein as "Bs2Ab-2T", "Bs3Ab-2T" and "Bs4Ab-2T" (or simply as "Bs2-2T", "Bs3-2T" and "Bs4-2T") for the ADCs having a DAR of ~2 and as "Bs2Ab-4T", "Bs3Ab-4T" and "Bs4Ab-4T" (or simply as "Bs2-4T", "Bs3-4T" and "Bs4-4T") for the ADCs having a DAR of ~4. The bispecific constructs lacking any cytotoxic agent are referred by the designations provided in Figure 7 and may be identified as "unarmed." As provided herein (see, e.g., Figure 8) the engineered conjugate sites may be selected to reduce or ablate ADCC functions. Alternatively or additionally Fc portion of the antibody may further comprise additional mutations which reduce or ablate ADCC activity. Alternatively, an ADC may be generated using a classic conjugation method such as conjugating to antibodies through the often-numerous lysine residues or native cysteine residues of an antibody, generating a heterogeneous antibody-drug conjugate mixture.
[0069] FIG. 16A presents immunofluorescence images of SKOV-3 cells treated with 1 μg/ml of the antibody indicated under each image, showing the disruption of the intracellular microtubule network or lack thereof. Microtubule staining is shown. The following samples were tested: media control without any antibody (image i), R347 control antibody (image ii), trastuzumab (image iii), Bs2Ab-39SH (image iv), R347-DM1 (R347 control antibody conjugated to the cytotoxic agent maytansinoid DM1) (image v), R347-4T (R347 control antibody conjugated to 4 molecules of the cytotoxic agent tubulysin) (image vi), T-DMl (trastuzumab conjugated to maytansinoid DM1) (image vii), and Bs2-4T (Bs2Ab-39SH conjugated to 4 molecules of the cytotoxic agent tubulysin) (image viii).
[0070] FIG. 16B presents immunofluorescence images of JIMT-1 cells treated with 1 μg/ml of the antibody indicated under each image, showing the disruption of the intracellular microtubule network or lack thereof. Microtubule staining is shown. The following samples were tested: media control without any antibody (image i), R347 control antibody (image ii), trastuzumab (image iii), Bs2Ab-39SH (image iv), R347-DM1 (R347 control antibody conjugated to the cytotoxic agent maytansinoid DM1) (image v), R347-4T (R347 control antibody conjugated to 4 molecules of the cytotoxic agent tubulysin) (image vi), T-DMl (trastuzumab conjugated to maytansinoid DM1) (image vii), and Bs2-4T (Bs2Ab-39SH conjugated to 4 molecules of the cytotoxic agent tubulysin) (image viii).
[0071] FIG. 16C presents immunofluorescence images of RT-112 cells treated with 1 μg/ml of the antibody indicated under each image, showing the disruption of the intracellular microtubule network or lack thereof. Microtubule staining is shown. The following samples were tested: media control without any antibody (image i), R347 control antibody (image ii), trastuzumab (image iii), Bs2Ab-39SH (image iv), R347-DM1 (R347 control antibody conjugated to the cytotoxic agent maytansinoid DM1) (image v), R347-4T (R347 control antibody conjugated to 4 molecules of the cytotoxic agent tubulysin) (image vi), T-DMl (trastuzumab conjugated to maytansinoid DM1) (image vii), and Bs2-4T (Bs2Ab-39SH conjugated to 4 molecules of the cytotoxic agent tubulysin) (image viii).
[0072] FIG. 17A shows the cytotoxic activity of the Bs2Ab format with a DAR of 2 or 4 relative to the T-DMl, non conjugated (unarmed) Bs2Ab-39SH and trastuzumab on the SKBR-3 human breast cancer cell line. Also shown are the curves for R347 (R347 control antibody), R347 conjugated with 2 or 4 tubulysins (R347-2T and R3474T respectively) R347 conjugated to DM1. Both Bs2-2T and Bs2-4T are more potent than T- DM1.
[0073] FIG. 17B shows the cytotoxic activity the Bs4Ab format with a DAR of 2 or 4
(Panel B) relative to the T-DM1, non conjugated (unarmed) Bs4Ab-39SH and trastuzumab on the SKBR-3 human breast cancer cell line. Also shown are the curves for R347 (R347 control antibody), R347 conjugated with 2 or 4 tubulysins (R347-2T and R3474T respectively) R347 conjugated to DM1. Both Bs4-2T and Bs4-4T are more potent than T-DM1.
[0074] FIG. 18A shows the cytotoxic activity of the Bs2Ab format with a DAR of 2 or 4 relative to the T-DM1, non conjugated (unarmed) Bs2Ab-39SH and trastuzumab on the JIMT-1 human breast cancer cell line. Also shown are the curves for R347 (R347 control antibody), R347 conjugated with 2 or 4 tubulysins (R347-2T and R3474T respectively) R347 conjugated to DM1. Both Bs2-2T and Bs2-4T are very potent in killing JIMT-1 cells, while T-DM1 shows no activity.
[0075] FIG. 18B shows the cytotoxic activity of the Bs4Ab format with a DAR of 2 or 4
(Panel B) relative to the T-DM1, non conjugated (unarmed) Bs4Ab-39SH and trastuzumab on the JIMT-1 human breast cancer cell line. Also shown are the curves for R347 (R347 control antibody), R347 conjugated with 2 or 4 tubulysins (R347-2T and R3474T respectively) R347 conjugated to DM1. Both Bs4-2T and Bs4-4T are very potent in killing JJJVIT-l cells, while T-DM1 shows no activity.
[0076] FIG. 19A shows the cytotoxic activity of the Bs2Ab format with a DAR of 2 or 4 relative to the T-DM1, non conjugated (unarmed) Bs2Ab-39SH and trastuzumab on the ZR-75-1 human breast cancer cell line. Also shown are the curves for R347 (R347 control antibody), R347 conjugated with 2 or 4 tubulysins (R347-2T and R3474T respectively) R347 conjugated to DM1. Bs2-4T is the most active in killing ZR-75-1 cells, while Bs2-2T has a lower level of activity and T-DM1 shows no or limited cytotoxic activity.
[0077] FIG. 19B shows the cytotoxic activity of the Bs4Ab format with a DAR of 2 or 4
(Panel B) relative to the T-DM1, non conjugated (unarmed) Bs4Ab-39SH and trastuzumab on the ZR-75-1 human breast cancer cell line. Also shown are the curves for R347 (R347 control antibody), R347 conjugated with 2 or 4 tubulysins (R347-2T and R3474T respectively) R347 conjugated to DM1. Bs4-4T is the most active in killing ZR- 75-1 cells, while Bs4-2T has a lower level of activity and T-DMl shows no or limited cytotoxic activity.
[0078] FIG. 20 shows the cytotoxic activity of the Bs2Ab format with a DAR of 2 or 4
(Panel A) relative to the T-DMl, non conjugated (unarmed) Bs2Ab-39SH and trastuzumab on the MDA-MB-468 human breast cancer cell line. Also shown are the curves for R347 (R347 control antibody), R347 conjugated with 2 or 4 tubulysins (R347- 2T and R3474T respectively) R347 conjugated to DM1. Data indicate that neither Bs2- 2T nor Bs2-4T is active in MDA-MB-468 cells, indicating that the cytotoxic activity of Bs2-2T and Bs2-4T is target (HER2)-dependent. Similar results were observed with Bs4- 2T and Bs4-4T (data not shown)
[0079] FIG. 21A shows the activity of anti-HER2 ADC activity in the MDA-MB-361 tumor model. Shown are the tumor growth curves corresponding to mice treated with (1) vehicle control, (2) R347-4T (R347 control antibody conjugated to 4 tubulysin molecules) at 3 mg/kg, (3) T-DMl (trastuzumab-DMl ADC) at 3 mg/kg, (4) Bs2 ADMix (Bs2Ab-39SH-(FCC) construct mixed with tubulysin) at 3 mg/kg, and (5) Bs2-4T (Bs2Ab-39SH-(FCC) construct conjugated to 4 tubulysins) at 0.3, 1 and 3 mg/kg. Concentrations are indicated between parenthesis.
[0080] FIG. 21B shows the activity of anti-HER2 ADC activity in the MDA-MB-361 tumor model. Shown are the tumor growth curves corresponding to mice treated with (1) vehicle control, (2) R347-4T (R347 control antibody conjugated to 4 tubulysin molecules) at 3 mg/kg, (3) T-DMl (trastuzumab-DMl ADC) at 3 mg/kg, (4) Bs4 ADMix (Bs4Ab-39SH-(FCC) construct mixed with tubulysin) at 3 mg/kg, and (5) Bs4-4T (Bs4Ab-39SH-(FCC) conjugated to 4 tubulysins) at 0.3, 1 and 3 mg/kg. Concentrations are indicated between parenthesis.
[0081] FIG. 22 shows the activity of anti-HER2 ADC in the ST996 triple-negative (ER-
/PR-/HER2-1+) PDX tumor model. Shown are the tumor growth curves corresponding to mice treated with (1) vehicle control (CTRL), (2) isotype R347-2T CTRL (R347 control antibody conjugated to 2 tubulysin molecules), (3) isotype R347-4T CTRL (R347 control antibody conjugated to 4 tubulysin molecules), (4) T-DMl (trastuzumab-DMl ADC), (5) ADMix (construct mixed with tubulysin), (6) Bs2-2T, i.e., Bs2Ab-39SH-(FCC) construct conjugated to 2 tubulysins, or (7) Bs2-4T, i.e., Bs2Ab-39SH-(FCC) construct conjugated to 4 tubulysins. Concentrations are indicated between parenthesis. Time of dosing is also indicated by arrows. Tumor growth curves in response to the various treatments are presented as the mean tumor volume (mm ) ± SEM.
[0082] FIG. 23 shows the activity of anti-HER2 ADC activity in the ST225 (HER2-3+)
BrCa PDX tumor model. Shown are the tumor growth curves corresponding to mice treated with (1) vehicle control, (2) R347-4T (R347 control antibody conjugated to 4 tubulysin molecules), (3) T-DM1 (trastuzumab-DMl ADC), (4) BS2 ADMix (Bs2Ab- 39SH-(FCC) construct mixed with tubulysin), and (5) Bs2-4T (Bs2Ab-39SH-(FCC) construct conjugated to 4 tubulysins. Concentrations are indicated between parenthesis.
[0083] FIG. 24 shows the activity of anti-HER2 ADC activity in the T-DM-1 non- responder JIMT-1 (HER2-3+) BrCa CBX tumor model. Shown are the tumor growth curves corresponding to mice treated with (1) vehicle control, (2) R347-4T (R347 control antibody conjugated to 4 tubulysin molecules), (3) T-DM1 (trastuzumab-DMl ADC), (4) BS2 ADMix (Bs2Ab-39SH-(FCC) construct mixed with tubulysin), and (5) Bs2-4T (Bs2Ab-39SH-(FCC) construct conjugated to 4 tubulysins. Concentrations are indicated between parenthesis.
[0084] FIG. 25 shows the activity of anti-HER2 ADC activity in the ST455B triple- negative (ER-/PR-/HER2-1+) BrCa PDX tumor model. Shown are the tumor growth curves corresponding to mice treated with (1) vehicle control (CTRL), (2) isotype CTRL (R347 control antibody conjugated to 4 tubulysin molecules), (3) T-DM1 (trastuzumab- DMl ADC), (4) BS2 ADMix (Bs2Ab-39SH-(FCC) construct mixed with tubulysin), and (5) Bs2-4T (Bs2Ab-39SH-(FCC) construct conjugated to 4 tubulysins. Concentrations are indicated between parenthesis.
[0085] FIG. 26A shows the cytotoxic activity Bs2-4T and T-DM1 on a parental NCI-
N87 cell line (left panel) and an NCI-N87 cell line with acquired resistance to T-DM1 (right panel). Bs2-4T has more potent activity in the parent cell line and is still active in killing the T-DM1 resistant cells.
[0086] FIG. 26B shows the activity of anti-HER2 ADC in the T-DM1 resistant NCI-N87 tumor model. Shown are the tumor growth curves corresponding to untreated mice and mice treated with (1) ADMix (construct mixed with tubulysin), (2) T-DM1 (trastuzumab- DM1 ADC), (3) T-DMl (trastuzumab-DMl ADC) plus pertuzumab, or (4) Bs2-4T, i.e., Bs2Ab-39SH-(FCC) construct conjugated to 4 tubulysins. Concentrations are indicated between parenthesis. Tumor growth curves in response to the various treatments are presented as the mean tumor volume (mm ) ± SEM (n=7). *P < 0.001 by Student's t test as compared to the untreated control group.
[0087] FIG. 27 shows the activity of anti-HER2 ADC after pretreatment with trastuzumab. Shown are the tumor growth curves corresponding to mice treated with (1) vehice CTRL (control), (2) trastuzumab followed by Bs2-4T, (3) vehicle followed by Bs2-4T, (4) trastuzumab followed by Bs2-4T, or (5) vehicle followed by Bs2-4T. Concentrations and dosage regimens are indicated between parentheses. Tumor growth curves in response to the various treatments are presented as the mean tumor volume (mm3) +/- SEM (n=10).
[0088] FIG. 28A shows a schematic for an assay to evaluate the bystander effect of the
Bispecific ADCs.
[0089] FIG. 28B shows FACS analysis results of cells treated with (i) media alone; (ii)
R347-T4 control; (iii) T-DMl; (iv) Bs2Ab-39SH admix; and (v) Bs2-4T. The reduction in cell numbers in both quadrants indicates that Bs2-4T can kill both HER2-expressing and HER2-null cells in a co-culture, suggesting Bs2-4T has bystander effect. In contrast, T-DMl cannot kill HER2-null cells in a co-culture, suggesting it does not have bystander effect.
[0090] FIG. 29 shows the activity of Bs2-4T on cancer stem cell (CSC) sphere formation
(left panel) relative to T-DMl and R347-4T (R347 control antibody conjugated to 4 tubulysin molecules); and on CSC in xenograph tumors (right panel) relative to R34-4T (R234 control antibody conjugated to 4 tubulysin molecules).
[0091] FIG. 30A shows ligand-dependent proliferation assays using the cell line MDA-
MB-361 (human ductal breast epithelial adenocarcinoma derived from brain metastasis), which showed that all of the ADCC enhanced afucosylated bispecific antibodies retain in vitro anti-proliferative activity. In each experiment, the antibody samples used were: R347 control, 39S plus trastuzumab, Bs2Ab-39SH_aFuc, Bs3Ab-39SH_aFuc, and Bs4Ab-39SH_aFuc. [0092] FIG. 30B shows ligand-dependent proliferation assays using the cell line MCF-7
(human invasive breast ductal adenocarcinoma), which showed that all of the ADCC enhanced afucosylated bispecific antibodies retain in vitro anti-proliferative activity. In each experiment, the antibody samples used were: R347 control, 39S plus trastuzumab, Bs2Ab-39SH_aFuc, Bs3Ab-39SH_aFuc, and Bs4Ab-39SH_aFuc.
[0093] FIG. 31A shows ADCC cytotoxicity assays using the MDA-MB-361 cells as the target and engineered NK effector cells (stably expressing CD 16), which showed that each of the afucosylated bispecific antibodies has more potent ADCC activity as compared to the same construct having fucosylated glycoforms. The antibody samples used were: (1) R347 control, (2) trastuzumab, (3) trastuzumab_aFuc, (4) Bs2Ab-39SH, and (5) Bs2Ab-39SH_aFuc,
[0094] FIG. 31B shows ADCC cytotoxicity assays using the MDA-MB-361 cells as the target and engineered NK effector cells (stably expressing CD 16), which showed that each of the afucosylated bispecific antibodies has more potent ADCC activity as compared to the same construct having fucosylated glycoforms. The antibody samples used were: (1) R347 control, (2) trastuzumab, (3) trastuzumab_aFuc, (4) Bs3Ab-39SH, and (5) Bs3Ab-39SH_aFuc.
[0095] FIG. 31C shows ADCC cytotoxicity assays using the MDA-MB-361 cells as the target and engineered NK effector cells (stably expressing CD 16), which showed that each of the afucosylated bispecific antibodies has more potent ADCC activity as compared to the same construct having fucosylated glycoforms. The antibody samples used were: (1) R347 control, (2) trastuzumab, (3) trastuzumab_aFuc, (4) Bs4Ab-39SH, and (5) Bs4Ab-39SH_aFuc.
[0096] FIG. 32 shows the structure of the tubulysin 1508 payload. The double bond of the maleimide group at the far right readily reacts with the thiol group found on cysteine to form a stable carbon-sulfur bond.
[0097] FIG. 33 shows an exemplary site-specific antibody drug conjugation process, using the Bs2Ab-FCC construct as the derivatizable platform. The process comprises the steps of (a) uncapping the size chains of the derivatizable amino acids (e.g., cysteines), (b) oxidizing, (c) conjugating a payload (e.g., a cytotoxic agent such as tubulysin), and (d) polishing by removing conjugation reagents and non-reacted payload. DETAILED DESCRIPTION OF THE INVENTION
[0098] The present disclosure provides optimized anti-HER2 antibodies, and bispecific antibodies derived from such optimized anti-HER2 antibodies. Related polynucleotides, vectors, cells, and pharmaceutical compositions comprising such optimized anti-HER2 antibodies or bispecific anti-HER2 antibodies are also provided. Also provided are methods of making such optimized anti-HER2 antibodies or bispecific antibodies. In addition, the disclosure provides are methods of using the optimized anti-HER2 antibodies or bispecific anti-HER2 antibodies, for example, methods of treating cancer in a subject in need thereof.
[0099] The present disclosure also provides antibody-drug conjugates (ADC) derived from optimized anti-HER2 antibodies and bispecific antibodies derived from such optimized anti-HER2 antibodies. Also provided are methods of making ADC derived from such optimized antibodies and bispecific antibodies. Also provided are methods of using the ADC derived from optimized anti-HER2 antibodies and bispecific antibodies, for example, methods of treating cancer in a subject in need thereof. Also provided are methods to treat patients with cancers resistant to chemotherapy (e.g., tumors in T-DM1 non-responder or poor-responder patients); to treat patients that are relapsed, refractory, on non-eligible to be treated with other therapies, in particular mono- specific ADC therapies (e.g. T-DM1); or to treat patients after pretreatment with other therapies (e.g. T- DM1).
[00100] In particular, the instant disclosure provides anti-HER2 binding molecules that are suitable for treating cancer expressing low levels of HER2.
[00101] In order that the present invention can be more readily understood, certain terms are first defined. Additional definitions are set forth throughout the detailed description.
I. Definitions
[00102] Before describing the present invention in detail, it is to be understood that this invention is not limited to specific compositions or process steps, as such can vary. As used in this specification and the appended claims, the singular forms "a", "an" and "the" include plural referents unless the context clearly dictates otherwise. The terms "a" (or "an"), as well as the terms "one or more," and "at least one" can be used interchangeably herein.
[00103] Furthermore, "and/or" where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other. Thus, the term and/or" as used in a phrase such as "A and/or B" herein is intended to include "A and B," "A or B," "A" (alone), and "B" (alone). Likewise, the term "and/or" as used in a phrase such as "A, B, and/or C" is intended to encompass each of the following aspects: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone).
[00104] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure is related. For example, the Concise Dictionary of Biomedicine and Molecular Biology, Juo, Pei-Show, 2nd ed., 2002, CRC Press; The Dictionary of Cell and Molecular Biology, 3rd ed., 1999, Academic Press; and the Oxford Dictionary Of Biochemistry And Molecular Biology, Revised, 2000, Oxford University Press, provide one of skill with a general dictionary of many of the terms used in this disclosure.
[00105] Units, prefixes, and symbols are denoted in their Systeme International de Unites
(SI) accepted form. Numeric ranges are inclusive of the numbers defining the range. Unless otherwise indicated, amino acid sequences are written left to right in amino to carboxy orientation. The headings provided herein are not limitations of the various aspects , which can be had by reference to the specification as a whole. Accordingly, the terms defined immediately below are more fully defined by reference to the specification in its entirety.
[00106] It is understood that wherever aspects are described herein with the language
"comprising," otherwise analogous aspects described in terms of "consisting of" and/or "consisting essentially of" are also provided.
[00107] Amino acids are referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, are referred to by their commonly accepted single-letter codes. [00108] The terms "HER2" and "HER2 receptor" are used interchangeably herein, and refer to the ErbB2 protein (also referred to as HER2/neu in the literature). As used herein, the terms are intended to include variants (e.g., splice variants), isoforms, and homologs of HER2 (both orthologs and paralogs). In some aspects, binding of an anti-HER2 binding molecule disclosed herein to HER2 inhibits the growth of cells expressing HER2 (i.e. typically tumor cells, and in particular cancer cells expressing low levels of HER2) by inhibiting formation of heteromeric complexes between HER2 and other ErbB family members, e.g. inhibiting heterodimerization with EGFR or HER3.
[00109] HER2 is a receptor tyrosine kinase and is composed of an extracellular domain
(ECD), which consists of (i) two leucine-rich domains (domain I/Ll and domain III/L2) responsible for ligand binding, and (ii) two cysteine-rich domains (domain II/CR1 and domain IV/CR2) responsible for receptor dimerization; a transmembrane domain; and an intracellular tyrosine kinase domain. Alternative splice variants of HER2 exist. Examples of alternative splice variants of HER2 include pi 00 and herstatin (two soluble forms), as well as 611-CTF, 687-CTF, 648-CTF, and A16HER2. The soluble forms of HER2 can interact of with full-length receptors (pi 85) and inhibit receptor dimerization; 687-CTF is inactive; 611-CTF and 648-CTF can activate several intracellular signal transduction pathways; and A16HER2 lacks the amino acids 634-649 in domain IV, which induce a conformational change that promotes the formation of constitutively activated HER2 homodimers. The extracellular portion of mature HER2, without the signal sequence, corresponds to positions 23-652 of canonical Isoform 1 (see Uniprot P04626; see also "Structure of the extracellular region of HER2 alone and in complex with the Herceptin Fab." Cho et al., Nature 421:756-760 (2003), incorporated herein by reference in its entirety). The pertuzumab antibody binds to an epitope within domain II of HER2. Antibodies that do not bind to the pertuzumab binding epitope within domain II include trastuzumab, which binds to an epitope within domain IV.
[00110] The terms "inhibit," "block," and "suppress" are used interchangeably herein and refer to any statistically significant decrease in biological activity, including full blocking of the activity. For example, "inhibition" can refer to a decrease of about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 100% in biological activity. Accordingly, when the terms "inhibition" or "suppression" are applied to describe, e.g., an effect on ligand-mediated HER2 phosphorylation, the term refers to the ability of an anti-HER2 antibody or a HER2-binding molecule comprising an antigen binding fragment thereof, to statistically significantly decrease the phosphorylation of HER2 induced by an EGF-like ligand, relative to the phosphorylation in an untreated (control) cell.
[00111] The cell which expresses HER2 can be a naturally occurring cell or cell line (e.g. , a cancer cell) or can be recombinantly produced by introducing a nucleic acid encoding HER2 into a host cell. In one aspect, the anti-HER2 binding molecule, e.g. , an anti-HER2 antibody or a HER2-binding molecule comprising an antigen binding fragment thereof, inhibits ligand mediated phosphorylation of HER2 by at least 10%, or at least 20%, or at least 30%, or at least 40%, or at least 50%, or at least 60%, or at least 70%, or at least 80%, or at least 905, or about 100%, as determined, for example, by Western blotting followed by probing with an anti-phosphotyrosine antibody or by ELISA.
[00112] The terms "growth suppression" or "growth inhibition" of a cell expressing
HER2, as used herein, refer to the ability of anti-HER2 binding molecule, e.g. , an anti- HER2 antibody or a HER2-binding molecule comprising an antigen-binding fragment thereof, to statistically significantly decrease proliferation of cells expressing HER2 relative to the proliferation in the absence of the anti-HER2 binding molecule. In one aspect, the proliferation of cells expressing HER2 (e.g., cancer cells) can be decreased by at least 10%, or at least 20%, or at least 30%, or at least 40%, or at least 50%, or at least 60%, or at least 70%, or at least 80%, or at least 90%, or about 100% when cells are contacted with an anti-HER2 binding molecule, e.g. , an anti-HER2 antibody or a HER2- binding molecule comprising an antigen-binding fragment thereof, relative to the proliferation measured in the absence of the anti-HER2 binding molecule (control conditions). Cell proliferation can be measured according to various methods known in the art, e.g., by counting the number of viable cells, identifying the presence of markers of growth markers, measuring the incorporation of molecules (e.g., radioactively labelled molecules such a H-thymidine), by measuring the size of a tumor (e.g, by volume or by weight), etc. In certain aspects, growth suppression refers to reduction in the number, size, or distribution of metastases.
[00113] As used throughout the instant specification, the phrase "anti-HER2 binding molecule" refers, for example, to (i) antibodies and antigen-binding fragments thereof which bind the same epitope as or are derived from the 1.39.1 antibody (see PCT Publ. No. WO 2008/019290) disclosed in the instant application, e.g., the 39S antibody and antigen-binding fragments thereof, and in general molecules comprising such antibodies and antigen-binding fragments thereof; (ii) anti-HER2 antibodies and other HER2- binding molecules which bind the same epitope as or are derived from the 39S antibody which incorporate additional antigen-binding moieties, e.g., bispecific antibodies; (iii) antibody-drug conjugates (ADC) comprising at least one of the molecules according to (i) or (ii) conjugated to a cytotoxic moiety {e.g., a small molecule anticancer agent, a radionuclide, etc.), and (iv) anti-HER2 molecules according to (i) or (ii) having enhanced ADCC. As used herein, the term "39S antibody" refers to a lead optimized monoclonal antibody derived from the 1.39.1 antibody disclosed in PCT Publ. No. WO 2008/019290, wherein said optimized antibody comprises a VH comprising the amino acids of SEQ ID NO: 15 and a VL comprising the amino acids of SEQ ID NO: 16.
[00114] As used herein, the term "tubulysin" refers both collectively and individually to the naturally occurring tubulysins, and analogs and derivatives of tubulysins. Illustrative examples of tubulysins are disclosed, for example, in WO2004005326A2, WO2012019123A1, WO2009134279A1, WO2009055562A1, WO2004005327A1, US7754885, US20100240701, US7816377, US20110021568, and US20110263650 and in the Examples provided herein. It is to be understood that such derivatives include, for example, tubulysin prodrugs or tubulysins that include one or more protection or protecting groups, one or more linking moieties.
[00115] Cellular proliferation can be assayed using art recognized techniques which measure rate of cell division, and/or the fraction of cells within a cell population undergoing cell division, and/or rate of cell loss from a cell population due to terminal differentiation or cell death {e.g., thymidine incorporation).
[00116] The terms "antibody" or "immunoglobulin," as used interchangeably herein, include whole antibodies and any antigen binding fragment or single chains thereof and combinations thereof (e.g., bispecific antibodies).
[00117] A typical antibody comprises at least two heavy (H) chains and two light (L) chains interconnected by disulfide bonds. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region (abbreviated herein as CH). The heavy chain constant region is comprised of three domains, CHI, CH2, and CH3. Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region. The light chain constant region is comprised of one domain, CL. The VH and VL regions can be further subdivided into regions of hypervariability, termed Complementarity Determining Regions (CDR), interspersed with regions that are more conserved, termed framework regions (FW). Each VH and VL is composed of three CDRs and four FWs, arranged from amino-terminus to carboxy-terminus in the following order: FW1, CDR1, FW2, CDR2, FW3, CDR3, FW4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g. , effector cells) and the first component (Clq) of the classical complement system. Exemplary antibodies of the present disclosure include typical antibodies, scFvs, and combinations thereof where, for example, an scFv is covalently linked (for example, via peptidic bonds or via a chemical linker) to the N- terminus of either the heavy chain and/or the light chain of a typical antibody, or intercalated in the heavy chain and/or the light chain of a typical antibody.
[00118] The term "antibody" means an immunoglobulin molecule that recognizes and specifically binds to a target, such as a protein, polypeptide, peptide, carbohydrate, polynucleotide, lipid, or combinations of the foregoing through at least one antigen recognition site within the variable region of the immunoglobulin molecule. As used herein, the term "antibody" encompasses intact polyclonal antibodies, intact monoclonal antibodies, antibody fragments (such as Fab, Fab', F(ab')2, and Fv fragments), single chain variable fragment (scFv), disulfide stabilized scFvs, multispecific antibodies such as bispecific antibodies generated from at least two intact antibodies and/or antigen binding fragments thereof, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antigen determination portion of an antibody, and any other modified immunoglobulin molecule comprising an antigen recognition site so long as the antibodies exhibit the desired biological activity.
[00119] An antibody can be of any the five major classes of immunoglobulins: IgA, IgD,
IgE, IgG, and IgM, or subclasses (isotypes) thereof (e.g. IgGl, IgG2, IgG3, IgG4, IgAl and IgA2), based on the identity of their heavy-chain constant domains referred to as alpha, delta, epsilon, gamma, and mu, respectively. The different classes of immunoglobulins have different and well known subunit structures and three- dimensional configurations. Antibodies can be naked or conjugated to other molecules such as toxins, radioisotopes, etc. to form ADCs.
[00120] A "blocking" antibody or an "antagonist" antibody is one which inhibits or reduces biological activity of the antigen it binds, such as HER2. In a certain aspect, blocking antibodies or antagonist antibodies substantially or completely inhibit the biological activity of the antigen. Desirably, the biological activity is reduced by 10%, 20%, 30%, 50%, 70%, 80%, 90%, 95%, or even 100%.
[00121] The terms "anti-HER2 antibody" or "anti-HER2" refers to an antibody that is capable of binding HER2 with sufficient affinity such that the antibody is useful as a therapeutic agent or diagnostic reagent in targeting HER2. The extent of binding of an anti-HER2 antibody to an unrelated, non-HER2 protein is less than about 10% of the binding of the antibody to HER2 as measured, e.g., by a radioimmunoassay (RIA), or BIACORE™ (using recombinant HER2 as the analyte and antibody as the ligand, or vice versa), or other binding assays known in the art. In certain aspects, an antibody that binds to HER2 has a dissociation constant (KD) of <1 μΜ, <100 nM, <10 nM, <1 nM, <0.1 nM, <10 pM, <1 pM, or <0.1 pM.
[00122] The terms "antigen binding fragment" refers to a portion of an intact antibody and refers to the antigenic determining variable regions of an intact antibody. It is known in the art that the antigen binding function of an antibody can be performed by fragments of a full-length antibody. Examples of antibody fragments include, but are not limited to Fab, Fab', F(ab')2, and Fv fragments, linear antibodies, single chain antibodies, and multispecific antibodies formed from antibody fragments.
[00123] A "monoclonal antibody" refers to a homogeneous antibody population involved in the highly specific recognition and binding of a single antigenic determinant, or epitope. This is in contrast to polyclonal antibodies that typically include different antibodies directed against different antigenic determinants.
[00124] The term "monoclonal antibody" encompasses both intact and full-length monoclonal antibodies as well as antibody fragments (such as Fab, Fab', F(ab')2, Fv), single chain variable fragments (scFv), fusion proteins comprising an antibody portion, and any other modified immunoglobulin molecule comprising an antigen recognition site. Furthermore, "monoclonal antibody" refers to such antibodies made in any number of ways including, but not limited to, by hybridoma, phage selection, recombinant expression, and transgenic animals (e.g., expression of a human antibody in a transgenic mouse).
[00125] The term "humanized antibody" refers to an antibody derived from a non-human
(e.g., murine) immunoglobulin, which has been engineered to contain minimal non- human (e.g., murine) sequences. Typically, humanized antibodies are human immunoglobulins in which residues from the CDRs are replaced by residues from the CDRs of a non-human species (e.g., mouse, rat, rabbit, or hamster) that have the desired specificity, affinity, and capability (Jones et al., 1986, Nature, 321:522-525; Riechmann et al, 1988, Nature, 332:323-32'/ '; Verhoeyen et al, 1988, Science, 239: 1534-1536). In some instances, the FW residues of a human immunoglobulin are replaced with the corresponding residues in an antibody from a non-human species that has the desired specificity, and/or affinity, and/or capability.
[00126] The humanized antibody can be further modified by the substitution of additional residues either in the FW regions and/or within the replaced non-human residues to refine and optimize antibody specificity, and/or affinity, and/or capability. In general, the humanized antibody will comprise substantially all of at least one, and typically two or three, variable domains containing all or substantially all of the CDR regions that correspond to the non-human immunoglobulin whereas all or substantially all of the FW regions are those of a human immunoglobulin consensus sequence. The humanized antibody can also comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin. Examples of methods used to generate humanized antibodies are described in U.S. Pat. Nos. 5,225,539 or 5,639,641.
[00127] A "variable region" of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination. The variable regions of the heavy and light chain each consist of four FW regions connected by three CDR regions. The CDRs in each chain are held together in close proximity by the FW regions and, with the CDRs from the other chain, contribute to the formation of the antigen -binding site of antibodies. There are at least two techniques for determining CDRs: (1) an approach based on cross-species sequence variability (i.e., Kabat et al. Sequences of Proteins of Immunological Interest, (5th ed., 1991, National Institutes of Health, Bethesda Md.)); and (2) an approach based on crystallographic studies of antigen-antibody complexes (Al-lazikani et al. (1997) J. Molec. Biol. 273:927-948)). In addition, combinations of these two approaches are sometimes used in the art to determine CDRs. The Kabat numbering system is generally used when referring to a residue in the variable domain (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain) (e.g,, Kabat et al. , Sequences of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)).
The phrases "amino acid position numbering as in Kabat," "Kabat position," and grammatical variants thereof refer to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al. , Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991). Using this numbering system, the actual linear amino acid sequence can contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FW or CDR of the variable domain. For example, a heavy chain variable domain can include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g., residues 82a, 82b, and 82c, etc. according to Kabat) after heavy chain FW residue 82.
TABLE 1
Loop Kabat AbM Chothia
LI L24-L34 L24-L34 L24-L34
L2 L50-L56 L50-L56 L50-L56
L3 L89-L97 L89-L97 L89-L97
HI H31-H35B H26-H35B H26-H32..34
(Kabat Numbering)
HI H31-H35 H26-H35 H26-H32
(Chothia Numbering)
H2 H50-H65 H50-H58 H52-H56
H3 H95-H102 H95-H102 H95-H102 [00129] The Kabat numbering of residues can be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard" Kabat numbered sequence. Chothia refers instead to the location of the structural loops (Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)). The end of the Chothia CDR-H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35 A nor 35B is present, the loop ends at 32; if only 35 A is present, the loop ends at 33; if both 35 A and 35B are present, the loop ends at 34). The AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software.
[00130] IMGT (ImMunoGeneTics) also provides a numbering system for the immunoglobulin variable regions, including the CDRs. See e.g., Lefranc, M.P. et al., Dev. Comp. Immunol. 27: 55-77(2003), which is herein incorporated by reference. The IMGT numbering system was based on an alignment of more than 5,000 sequences, structural data, and characterization of hypervariable loops and allows for easy comparison of the variable and CDR regions for all species. According to the IMGT numbering schema VH-CDR1 is at positions 26 to 35, VH-CDR2 is at positions 51 to 57, VH-CDR3 is at positions 93 to 102, VL-CDRl is at positions 27 to 32, VL-CDR2 is at positions 50 to 52, and VL-CDR3 is at positions 89 to 97.
[00131] For all heavy chain constant region amino acid positions discussed in the present invention, numbering is according to the EU index first described in Edelman et al., 1969, Proc. Natl. Acad. Sci. USA 63(1 ):78-85, describing the amino acid sequence of myeloma protein Eu, which is the first human lgGl sequenced. The Eu index of Edelman et al. is also set forth in Kabat et al., 1991 , Sequences of Proteins of Immunological Interest, 5th Ed., United States Public Health Service, National Institutes of Health, Bethesda. Thus, the phrases "EU index as set forth in Kabat" or "EU index of Kabat" and "position ... according to the EU index as set forth in Kabat," and grammatical variants thereof refer to the residue numbering system based on the human lgGl Eu antibody of Edelman et al. as set forth in Kabat 1991. [00132] The numbering system used for the variable domains (both heavy chain and light chain) and light chain constant region amino acid sequence is that set forth in Kabat 1991.
[00133] As used herein the Fc region includes the polypeptides comprising the constant region of an antibody excluding the first constant region immunoglobulin domain. Thus Fc refers to the last two constant region immunoglobulin domains of IgA, IgD, and IgG, and the last three constant region immunoglobulin domains of IgE and IgM, and the flexible hinge N-terminal to these domains. For IgA and IgM Fc can include the J chain. For IgG, Fc comprises immunoglobulin domains Cgamma2 and Cgamma3 (Cy2 and Cy3) and the hinge between Cgammal (Cyl) and Cgamma2 (Cy2).
[00134] Although the boundaries of the Fc region can vary, the human IgG heavy chain Fc region is usually defined to comprise residues C226 or P230 to its carboxyl-terminus, wherein the numbering is according to the EU index as set forth in Kabat. Fc can refer to this region in isolation, or this region in the context of an antibody, antibody fragment, or Fc fusion protein.
[00135] Polymorphisms have been observed at a number of different positions within antibody constant regions (e.g., Fc positions, including but not limited to positions 270, 272, 312, 315, 356, and 358 as numbered by the EU index as set forth in Kabat), and thus slight differences between the presented sequence and sequences in the prior art can exist. Polymorphic forms of human immunoglobulins have been well-characterized. At present, 18 Gm allotypes are known: Glm (1, 2, 3, 17) or Glm (a, x, f, z), G2m (23) or G2m (n), G3m (5, 6, 10, 11, 13, 14, 15, 16, 21, 24, 26, 27, 28) or G3m (bl, c3, b3, bO, b3, b4, s, t, gl, c5, u, v, g5) (Lefranc, et al., The human IgG subclasses: molecular analysis of structure, function and regulation. Pergamon, Oxford, pp. 43-78 (1990); Lefranc, G. et al., 1979, Hum. Genet.: 50, 199-211). It is specifically contemplated that the antibodies of the present invention may be incorporate any allotype, isoallotype, or haplotype of any immunoglobulin gene, and are not limited to the allotype, isoallotype or haplotype of the sequences provided herein.
[00136] The term "human antibody" means an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any technique known in the art (e.g., recombinant expression in cultures cells, or expression in transgenic animals). Thus, the term human antibody also encompasses an antibody having an amino acid sequence corresponding to an antibody originally produced by a human (or an engineered variant or derivative thereof) but expressed in a non-human system (e.g., produced by chemical synthesis; recombinantly expressed in microbial, mammal, or insect cells; or expressed in an animal subject). Accordingly, an antibody obtained from a human subject or from human cells (e.g., hybridoma or cell line expressing a recombinant antibody or fragment thereof) and subsequently expressed in an animal, e.g., mice, is considered a human antibody. This definition of a human antibody includes intact or full-length antibodies, fragments thereof, and/or antibodies comprising at least one human heavy and/or light chain polypeptide such as, for example, an antibody comprising murine light chain and human heavy chain polypeptides.
[00137] The term "chimeric antibodies" refers to antibodies wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more animal species. Typically, the variable region of both light and heavy chains corresponds to the variable region of antibodies derived from one species of mammals (e.g. , mouse, rat, rabbit, etc.) with the desired specificity, and/or affinity, and/or capability while the constant regions are homologous to the sequences in antibodies derived from another species (usually human) to avoid eliciting an immune response in that species.
[00138] The term "epitope" as used herein refers to an antigenic protein determinant capable of binding to an HER2 antibody or HER2 binding molecule disclosed herein. Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. The part of an antibody or binding molecule that recognizes the epitope is called a paratope. The epitopes of protein antigens are divided into two categories, conformational epitopes and linear epitopes, based on their structure and interaction with the paratope. A conformational epitope is composed of discontinuous sections of the antigen's amino acid sequence. These epitopes interact with the paratope based on the 3-D surface features and shape or tertiary structure of the antigen. By contrast, linear epitopes interact with the paratope based on their primary structure. A linear epitope is formed by a continuous sequence of amino acids from the antigen.
[00139] The term "antibody binding site" refers to a region in the antigen (e.g., HER2) comprising a continuous or discontinuous site (i.e. , an epitope) to which a complementary antibody specifically binds. Thus, the antibody binding site can contain additional areas in the antigen which are beyond the epitope and which can determine properties such as binding affinity and/or stability, or affect properties such as antigen enzymatic activity or dimerization. Accordingly, even if two antibodies bind to the same epitope within an antigen, if the antibody molecules establish distinct intermolecular contacts with amino acids outside of the epitope, such antibodies are considered to bind to distinct antibody binding sites.
[00140] "Binding affinity" generally refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g. , an antibody) and its binding partner (e.g. , an antigen). Unless indicated otherwise, as used herein, "binding affinity" refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (KD). Affinity can be measured by common methods known in the art, including those described herein. Low-affinity antibodies generally bind antigen slowly and tend to dissociate readily, whereas high- affinity antibodies generally bind antigen faster and tend to remain bound longer. A variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present disclosure.
[00141] "Potency" is normally expressed as an IC50 value, in nM unless otherwise stated.
IC50 is the median inhibitory concentration of an antigen-binding molecule. In functional assays, IC50 is the concentration that reduces a biological response by 50% of its maximum. In ligand-binding studies, IC50 is the concentration that reduces receptor binding by 50% of maximal specific binding level. IC50 can be calculated by any number of means known in the art. Improvement in potency can be determined by measuring, e.g. , against the 39S parent antibody.
[00142] The fold improvement in potency for the anti-HER2 binding molecule disclosed herein (for example, as compared to the 39S parent antibody, trastuzumab, or combinations thereof) can be at least about 2-fold, at least about 4-fold, at least about 6- fold, at least about 8-fold, at least about 10-fold, at least about 20-fold, at least about 30- fold, at least about 40-fold, at least about 50-fold, at least about 60-fold, at least about 70- fold, at least about 80-fold, at least about 90-fold, at least about 100-fold, at least about 110-fold, at least about 120-fold, at least about 130-fold, at least about 140-fold, at least about 150-fold, at least about 160-fold, at least about 170-fold, or at least about 180-fold or more.
[00143] "Antibody-dependent cell-mediated cytotoxicity" or "ADCC" refers to a form of cytotoxicity in which secreted immunoglobulins bound onto Fc receptors (FcRs) present on certain cytotoxic cells (e.g., Natural Killer (NK) cells, neutrophils, and macrophages) enable these cytotoxic effector cells to bind specifically to an antigen-bearing target cell and subsequently kill the target cell with cytotoxins. Specific high-affinity IgG antibodies directed to the surface of target cells "arm" the cytotoxic cells and are absolutely required for such killing. Lysis of the target cell is extracellular, requires direct cell-to-cell contact, and does not involve complement. It is contemplated that, in addition to antibodies, other proteins comprising Fc regions, specifically Fc fusion proteins, having the capacity to bind specifically to an antigen-bearing target cell will be able to effect cell-mediated cytotoxicity. For simplicity, the cell-mediated cytotoxicity resulting from the activity of an Fc fusion protein is also referred to herein as ADCC activity.
[00144] A polypeptide, antibody, polynucleotide, vector, cell, or composition which is
"isolated" is a polypeptide, antibody, polynucleotide, vector, cell, or composition which is in a form not found in nature. Isolated polypeptides, antibodies, polynucleotides, vectors, cells or compositions include those which have been purified to a degree that they are no longer in a form in which they are found in nature. In some aspects, an antibody, polynucleotide, vector, cell, or composition which is isolated is substantially pure.
[00145] The term "subject" refers to any animal (e.g. , a mammal), including, but not limited to humans, non-human primates, rodents, and the like, which is to be the recipient of a particular treatment. Typically, the terms "subject" and "patient" are used interchangeably herein in reference to a human subject. [00146] The term "pharmaceutical composition" refers to a preparation which is in such form as to permit the biological activity of the active ingredient (e.g., an anti-HER2 binding molecule disclosed herein) to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the composition would be administered. Such composition can be sterile.
[00147] An "effective amount" of an anti-HER2 binding molecule as disclosed herein is an amount sufficient to carry out a specifically stated purpose. An "effective amount" can be determined empirically and in a routine manner, in relation to the stated purpose.
[00148] The term "therapeutically effective amount" refers to an amount of an anti-HER2 binding molecule disclosed herein or other drug effective to "treat" a disease or disorder in a subject or mammal.
[00149] The word "label" when used herein refers to a detectable compound or composition which is conjugated directly or indirectly to an anti-HER2 binding molecule disclosed herein so as to generate a "labeled" anti-HER2 binding molecule. The label can be detectable by itself (e.g. , radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, can catalyze chemical alteration of a substrate compound or composition which is detectable.
[00150] Terms such as "derivatizable group" and "derivatizable functional group" are used interchangeably and refer to a functional group that is capable of reacting to permit the formation of a covalent bond between an anti-HER2 binding molecule disclosed herein (e.g., a HER2 antibody) and another substance. In some aspects, such substance is a therapeutic moiety (e.g., a cytotoxin), a detectable label, a polymer (e.g., PEG), etc. Exemplary derivatizable groups include thiol, hydroxyl, amino, carboxy, and amide, as well as modified forms thereof, such as activated or protected forms.
[00151] Terms such as "treating" or "treatment" or "to treat" or "alleviating" or "to alleviate" refer to both (1) therapeutic measures that cure, slow down, lessen symptoms of, and/or halt progression of a diagnosed pathologic condition or disorder and (2) prophylactic or preventative measures that prevent and/or slow the development of a targeted pathologic condition or disorder. Thus, those in need of treatment include those already with the disorder; those prone to have the disorder; and those in whom the disorder is to be prevented. In certain aspects, a subject is successfully "treated" for cancer according to the methods of the present disclosure if the patient shows, e.g., total, partial, or transient remission of a certain type of cancer.
[00152] The terms "cancer", "tumor", "cancerous", and "malignant" refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. Examples of cancers include but are not limited to, carcinoma including adenocarcinomas, lymphomas, blastomas, melanomas, sarcomas, and leukemias. More particular examples of such cancers include squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, gastrointestinal cancer, Hodgkin's and non-Hodgkin's lymphoma, pancreatic cancer, glioblastoma, glioma, cervical cancer, ovarian cancer, liver cancer such as hepatic carcinoma and hepatoma, bladder cancer, breast cancer (including hormonally mediated breast cancer, see, e.g., Innes et al. (2006) Br. J. Cancer 94: 1057- 1065), colon cancer, colorectal cancer, endometrial carcinoma, myeloma (such as multiple myeloma), salivary gland carcinoma, kidney cancer such as renal cell carcinoma and Wilms' tumors, basal cell carcinoma, melanoma, prostate cancer, vulval cancer, thyroid cancer, testicular cancer, esophageal cancer, various types of head and neck cancer and cancers of mucinous origins, such as, mucinous ovarian cancer, cholangiocarcinoma (liver) and renal papillary carcinoma. In some aspects, the term cancer as used herein specifically refers to cancer expressing HER2. In some specific aspects, the term cancer refers to cancers expression low levels of HER2.
[00153] A "low level of HER2 " as used herein, refers to a cancer cell, subject, or patient exhibiting a score of less than 2+ {e.g., 1+) when using a HERCEPTEST® (DakoCytomation California Inc., Carpenteria, CA) classification, or a cancer, cancer cell, subject or patient that has been identified as such, for example, by FISH.
[00154] To determine HER2 expression in the cancer, various diagnostic/prognostic assays are available. In one aspect, HER2 overexpression can be analyzed by IHC, e.g., by using HERCEPTEST® (Dako). Paraffin embedded tissue sections from a tumor biopsy can be subjected to the IHC assay and accorded a HER2 protein staining intensity criteria as follows/ Alternatively, or additionally, FISH assays such as the INFORM™ (sold by Ventana, Ariz.) or PATHVISION™ (Vysis, 111.) can be carried out on formalin-fixed, paraffin-embedded tumor tissue to determine the extent (if any) of HER2 overexpression in the tumor. [00155] "Low" is a term that refers to a measure that is less than normal, less than a standard such as a predetermined measure or a subgroup measure that is relatively less than another subgroup measure. For example, low HER2 means a measure of HER2 that is less than a normal HER2 measure in a particular set of samples of patients that is HER2 positive. A normal HER2 measure can be determined according to any method available to one skilled in the art. Low HER2 can also mean a measure of HER2 that is less than a predetermined measure, such as a predetermined cutoff Low HER2 can also mean a measure wherein a low HER2 subgroup is relatively lower than another subgroup. For example, without limitation, according to the present specification, two distinct patient subgroups can be created by dividing samples around a mathematically determined point, such as, without limitation, a median, thus creating a group whose measure is low (i.e., less than the median) with respect to another group whose measure is high. HER2 can be measured by any method known to one skilled in the art such as, for example, without limitation, using the eTag method or using any standard IHC method such as HE CEPTEST®. AS another example, low level of HER2 refers to a low level of HER2 homodimers, which means a measure of HER2 homodimers that is less than a normal measure of HER2 homodimers in a particular set of samples or patients that is HER2 positive. Low HER2 homodimers can also mean a measure that is less than a predetermined measure, such as a predetermined cutoff. Low HER2 homodimers can also mean a measure wherein a low HER2 homodimer subgroup is relatively less than another subgroup. HER2 homodimers can be measured by any method known in the art such as Fluorescence resonance energy transfer (FRET), Bioluminescent resonance energy transfer (BRET), proximity ligation assay (PLA), dimer- specific antibodies or eTag or any other method that is well known to one skilled in the art.
[00156] As used herein, the term "carcinomas" refers to cancers of epithelial cells, which are cells that cover the surface of the body, produce hormones, and make up glands. Examples of carcinomas are cancers of the skin, lung, colon, stomach, breast, prostate and thyroid gland.
[00157] "Polynucleotide," or "nucleic acid," as used interchangeably herein, refer to polymers of nucleotides of any length, and include DNA and RNA. The nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase. A polynucleotide can comprise modified nucleotides, such as methylated nucleotides and their analogs. The preceding description applies to all polynucleotides referred to herein, including RNA and DNA.
[00158] The term "vector" means a construct, which is capable of delivering, and in some aspects, expressing, one or more gene(s) or sequence(s) of interest in a host cell. Examples of vectors include, but are not limited to, viral vectors, naked DNA or RNA expression vectors, plasmid, cosmid or phage vectors, DNA or RNA expression vectors associated with cationic condensing agents, DNA or RNA expression vectors encapsulated in liposomes, and certain eukaryotic cells, such as producer cells.
[00159] The terms "polypeptide," "peptide," and "protein" are used interchangeably herein to refer to polymers of amino acids of any length. The polymer can be linear or branched, it can comprise modified amino acids, and it can be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids, etc.), as well as other modifications known in the art. It is understood that, because the polypeptides of the instant disclosure are based upon antibodies, in certain aspects, the polypeptides can occur as single chains or associated chains.
[00160] A "recombinant" polypeptide or protein refers to a polypeptide or protein produced via recombinant DNA technology. Recombinantly produced polypeptides and proteins expressed in engineered host cells are considered isolated for the purpose of the invention, as are native or recombinant polypeptides which have been separated, fractionated, or partially or substantially purified by any suitable technique. The polypeptides disclosed herein can be recombinantly produced using methods known in the art. Alternatively, the proteins and peptides disclosed herein can be chemically synthesized.
[00161] Unless otherwise specified, the term "substituted" as used herein in the context of modifications to the chemical structure of the cytotoxic agents, i.e. tubulysins pertains to a parent group which bears one or more substituents. The term "substituent" is used herein in the conventional sense and refers to a chemical moiety which is covalently attached to, or if appropriate, fused to, a parent group. A wide variety of substituents are well known, and methods for their formation and introduction into a variety of parent groups are also well known. Examples of chemical substituents are described in more detail below.
[00162] The phrase "optionally substituted" as used herein in the context of modifications to the chemical structure of cytotoxic agents, pertains to a parent group which may be unsubstituted or which may be substituted.
[00163] The terms "substituted," "amino acid substitution" and the like as used herein in the context of polypeptides refers to replacing an amino acid residue present in a parent polypeptide with another amino acid residue. An amino acid can be substituted in a parent polypeptide, for example, via chemical peptide synthesis or through recombinant methods known in the art. Accordingly, references to a "substitution at position X" or "substitution at position X" refer to the substitution of an amino acid present at position X with an alternative amino acid residue. In some aspects, substitution patterns can described according to the schema AXY, wherein A is the single letter code corresponding to the amino acid naturally present at position X, and Y is the substituting amino acid residue. Accordingly, L234F would refer to the substitution of the leucine amino acid (L) at position 234 with a phenylalanine (F). In other aspects, substitution patterns can described according to the schema XY, wherein Y is the single letter code corresponding to the amino acid residue substituting the amino acid naturally present at position X. Accordingly, 239C would refer to the substitution of the native amino acid at position 239 with a cysteine (C).
[00164] A "conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, if an amino acid in a polypeptide is replaced with another amino acid from the same side chain family, the substitution is considered to be conservative. In another aspect, a string of amino acids can be conservatively replaced with a structurally similar string that differs in order and/or composition of side chain family members.
[00165] Non-conservative amino acid substitutions include those in which (i) a residue having an electropositive side chain (e.g., Arg, His or Lys) is substituted for, or by, an electronegative residue (e.g., Glu or Asp), (ii) a hydrophilic residue (e.g., Ser or Thr) is substituted for, or by, a hydrophobic residue (e.g., Ala, Leu, He, Phe or Val), (iii) a cysteine or proline is substituted for, or by, any other residue, or (iv) a residue having a bulky hydrophobic or aromatic side chain (e.g., Val, His, He or Trp) is substituted for, or by, one having a smaller side chain (e.g., Ala, Ser) or no side chain (e.g., Gly).
[00166] Other amino acid substitutions can be readily identified by workers of ordinary skill. For example, for the amino acid alanine, a substitution can be taken from any one of D-alanine, glycine, beta-alanine, L-cysteine and D-cysteine. For lysine, a replacement can be any one of D-lysine, arginine, D-arginine, homo-arginine, methionine, D- methionine, ornithine, or D- ornithine. Generally, substitutions in functionally important regions that can be expected to induce changes in the properties of isolated polypeptides are those in which (i) a polar residue, e.g., serine or threonine, is substituted for (or by) a hydrophobic residue, e.g., leucine, isoleucine, phenylalanine, or alanine; (ii) a cysteine residue is substituted for (or by) any other residue; (iii) a residue having an electropositive side chain, e.g., lysine, arginine or histidine, is substituted for (or by) a residue having an electronegative side chain, e.g., glutamic acid or aspartic acid; or (iv) a residue having a bulky side chain, e.g., phenylalanine, is substituted for (or by) one not having such a side chain, e.g., glycine. The likelihood that one of the foregoing non- conservative substitutions may alter functional properties of the protein is also correlated to the position of the substitution with respect to functionally important regions of the protein: some non-conservative substitutions may accordingly have little or no effect on biological properties.
[00167] The term "amino acid insertion" refers to introducing a new amino acid residue between two amino acid residues present in the parent sequence. An amino acid can be inserted in a parent sequence, for example, via chemical peptide synthesis or through recombinant methods known in the art. Accordingly as used herein, the phrases "insertion between positions X and Y" or "insertion between Kabat positions X and Y," wherein X and Y correspond to amino acid positions (e.g. , a cysteine amino acid insertion between positions 239 and 240), refers to the insertion of an amino acid between the X and Y positions, and also to the insertion in a nucleic acid sequence of a codon encoding an amino acid between the codons encoding the amino acids at positions X and Y. Insertion patterns can be described according to the schema AXins, wherein A is the single letter code corresponding to the amino acid being inserted, and X is the position preceding the insertion. Accordingly, C239ins would refer to the insertion of a cysteine amino acid (C) after position 239 (i.e., an insertion between position 239 and 240).
[00168] The term "percent sequence identity" between two polypeptide or polynucleotide sequences refers to the number of identical matched positions shared by the sequences over a comparison window, taking into account additions or deletions (i.e., gaps) that must be introduced for optimal alignment of the two sequences. A matched position is any position where an identical nucleotide or amino acid is presented in both the target and reference sequence. Gaps presented in the target sequence are not counted since gaps are not nucleotides or amino acids. Likewise, gaps presented in the reference sequence are not counted since target sequence nucleotides or amino acids are counted, not nucleotides or amino acids from the reference sequence.
[00169] The percentage of sequence identity is calculated by determining the number of positions at which the identical amino-acid residue or nucleic acid base occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity. The comparison of sequences and determination of percent sequence identity between two sequences can be accomplished using readily available software both for online use and for download. Suitable software programs are available from various sources, and for alignment of both protein and nucleotide sequences. One suitable program to determine percent sequence identity is bl2seq, part of the BLAST suite of program available from the U.S. government's National Center for Biotechnology Information BLAST web site (blast.ncbi.nlm.nih.gov). B12seq performs a comparison between two sequences using either the BLASTN or BLASTP algorithm. BLASTN is used to compare nucleic acid sequences, while BLASTP is used to compare amino acid sequences. Other suitable programs are, e.g., Needle, Stretcher, Water, or Matcher, part of the EMBOSS suite of bioinformatics programs and also available from the European Bioinformatics Institute (EBI) at www.ebi.ac.uk/Tools/psa.
[00170] Different regions within a single polynucleotide or polypeptide target sequence that aligns with a polynucleotide or polypeptide reference sequence can each have their own percent sequence identity. It is noted that the percent sequence identity value is rounded to the nearest tenth. For example, 80.11, 80.12, 80.13, and 80.14 are rounded down to 80.1, while 80.15, 80.16, 80.17, 80.18, and 80.19 are rounded up to 80.2. It also is noted that the length value will always be an integer.
[00171] In certain aspects, the percentage identity "X" of a first amino acid sequence to a second sequence amino acid is calculated as 100 x (Y/Z), where Y is the number of amino acid residues scored as identical matches in the alignment of the first and second sequences (as aligned by visual inspection or a particular sequence alignment program) and Z is the total number of residues in the second sequence. If the length of a first sequence is longer than the second sequence, the percent identity of the first sequence to the second sequence will be higher than the percent identity of the second sequence to the first sequence.
[00172] One skilled in the art will appreciate that the generation of a sequence alignment for the calculation of a percent sequence identity is not limited to binary sequence- sequence comparisons exclusively driven by primary sequence data. Sequence alignments can be derived from multiple sequence alignments. One suitable program to generate multiple sequence alignments is ClustalW2, available from www.clustal.org. Another suitable program is MUSCLE, available from www.drive5.com muscle/. ClustalW2 and MUSCLE are alternatively available, e.g., from the EBI.
[00173] It will also be appreciated that sequence alignments can be generated by integrating sequence data with data from heterogeneous sources such as structural data (e.g., cry stallo graphic protein structures), functional data (e.g., location of mutations), or phylogenetic data. A suitable program that integrates heterogeneous data to generate a multiple sequence alignment is T-Coffee, available at www.tcoffee.org, and alternatively available, e.g., from the EBI. It will also be appreciated that the final alignment used to calculate percent sequence identity can be curated either automatically or manually.
II. Anti-HER2-binding Molecules
[00174] The present disclosure provides anti-HER2 binding molecules, e.g., anti-HER2 antibodies or molecules comprising HER2-binding fragments thereof, that specifically bind HER2.
[00175] The full-length amino acid (aa) and nucleotide (nt) sequences for HER2 are known in the art (see, e.g., UniProt Acc. No. P04626 for human HER2). See, e.g., Yamamoto et al, Nature 319:230-234 (1986); Coussens et al, Science 230: 1132-1139 (1985); Tal et al, Mol. Cell. Biol. 7:2597-2601 (1987); Semba et al, Proc. Natl. Acad. Sci. U.S.A. 82:6497-6501 (1985); King et al, Science 229:974-976 (1985); Sarkar et al, DNA Cell Biol. 12:611-615 (1993); Giri et al, Mol. Cell. Biol. 25: 11005-11018 (2005); Anido et al, EMBO J. 25:3234-3244 (2006); Birrane et al, J. Biol. Chem. 278: 1399- 1402 (2003); Ivancic et al, J. Biomol. NMR 27:205-219 (2003); Cho et al, Nature 421:756-760 (2003); Franklin et al, Cancer Cell 5:317-328 (2004); Bostrom et al, Science 323: 1610-1614 (2009); Eigenbrot et al, Proc. Natl. Acad. Sci. U.S.A. 107: 15039-15044 (2010); Stephens et al, Nature 431:525-526 (2004); Greenman et al, Nature 446: 153-158 (2007); all of which are herein incorporated by reference in their entireties.
[00176] In certain aspects, the anti-HER2 binding molecules are antibodies or antigen- binding fragments thereof. In some aspects, the anti-HER2 binding molecules, e.g., anti- HER2 antibodies or molecules comprising HER2 -binding fragments thereof, comprise a Fab, a Fab', a F(ab')2, a Fd, a single chain Fv, scFv, disulfide stabilized scFv, a disulfide linked Fv, a V-NAR domain, an IgNar, an intrabody, an IgGACH2, a minibody, a F(ab')3; a tetrabody, a triabody, a diabody, a single-domain antibody, DVD-Ig, Fcab, mAb , a (scFv)2, or a scFv-Fc. In some aspects, the antibody is of the IgG type, for example of the IgGl type.
[00177] In some aspects, the anti-HER2 binding molecules are monospecific. In other aspects, the anti-HER2 binding molecules are bispecific, trispecific, tetraspecific, etc. In other aspects, the anti-HER2 binding molecules are multispecific. In some aspects, the anti-HER2 binding molecules are monovalent, bivalent, trivalent, tetravalent, etc. In yet other aspects, the anti-HER2 binding molecules are multivalent. In specific aspects, the anti-HER2 binding molecules are bivalent, e.g., an antibody comprising two HER2 specific antigen binding sites. In specific aspects, the anti-HER2 binding molecules are bispecific, i.e. , the molecule can specifically bind to two different antigens (e.g. , two different epitopes on the same or different molecules). In some specific aspects, the anti- HER2 binding molecules are bivalent and tetravalent, e.g. , an antibody comprising four antigen-binding sites that are capable of binding to two different antigens (e.g., two different epitopes on the same or different molecules).
[00178] In certain aspects, the anti-HER2 binding molecules comprise antibodies or antigen-binding fragments thereof have a binding site that is substantially the same as the binding site of the 1.39.1 antibody (see PCT Publ. No. WO 2008/019290, which is herein incorporated by reference in its entirety). In a specific aspect, the anti-HER2 binding molecules comprise antibodies or antigen-binding fragments thereof bind one or more amino acid residues of SEQ ID NO: 52. In certain aspects, the anti-HER2 binding molecules comprise antibodies or antigen-binding fragments thereof have a binding site that overlaps the binding site of the 1.39.1 antibody.
[00179] In certain aspects, the anti-HER2 binding molecules comprise antibodies or antigen-binding fragments thereof comprising a VH and/or a VL that have been modified compared to the VH (SEQ ID NO:43) and/or the VL (SEQ ID NO:44) of the parent 1.39.1 antibody (see PCT Publ. No. WO 2008/019290). The modifications introduced in the parent antibody can include mutations (e.g., point mutations or replacement of an entire subsequence) in the CDR regions and/or in the FW regions of the VH and VL as compared to the parent 1.39.1 antibody.
[00180] In some aspects, the VH-CDR1 (SEQ ID NO:45) of the parent 1.39.1 antibody has been replaced with a VH-CDR1 comprising the amino acids of SEQ ID NO: 1. In some aspects, VH-CDR1 (SEQ ID NO:45) of the parent 1.39.1 antibody has been replaced with a VH-CDR1 consisting of the amino acids of SEQ ID NO: 1.
[00181] In other aspects, VH-CDR3 (SEQ ID NO:46) of the parent 1.39.1 antibody has been replaced with a VH-CDR3 comprising the amino acids of SEQ ID NO: 3. In other aspects, VH-CDR3 (SEQ ID NO:46) of the parent 1.39.1 antibody has been replaced with a VH-CDR3 consisting of the amino acids of SEQ ID NO: 3.
[00182] In some aspects, VH-CDR1 (SEQ ID NO:45) and VH-CDR3 (SEQ ID NO:46) of the parent 1.39.1 antibody have been replaced with a VH-CDR1 and a VH-CDR3 comprising or consisting of the amino acids of SEQ ID NO: 1 and the amino acids of SEQ ID NO:3, respectively.
[00183] In some aspects, the VL-CDRl (SEQ ID NO:47) of the parent 1.39.1 antibody has been replaced with a VL-CDRl comprising the amino acids of SEQ ID NO:4. In some aspects, VL-CDRl (SEQ ID NO:3) of the parent 1.39.1 antibody has been replaced with a VH-CDR1 consisting of the amino acids of SEQ ID NO: 4.
[00184] In some aspects, the VL FWl region (SEQ ID NO:48) of the parent 1.39.1 antibody has been replaced with a VL FWl comprising the amino acids of SEQ ID NO: 11. In some aspects, the VL FWl region (SEQ ID NO:48) of the parent 1.39.1 antibody has been replaced with a FWl consisting of the amino acids of SEQ ID NO: 11.
[00185] In other aspects, the VL FW2 region (SEQ ID NO:49) of the parent 1.39.1 antibody has been replaced with a FW2 comprising the amino acids of SEQ ID NO: 12. In other aspects, the VL FW2 region (SEQ ID NO:49) of the parent 1.39.1 antibody has been replaced with a FW2 consisting of the amino acids of SEQ ID NO: 12.
[00186] In other aspects, the VL FW3 region (SEQ ID NO:50) of the parent 1.39.1 antibody has been replaced with a FW3 comprising the amino acids of SEQ ID NO: 13. In other aspects, the VL FW3 region (SEQ ID NO:50) of the parent 1.39.1 antibody has been replaced with a VL FW2 consisting of the amino acids of SEQ ID NO: 13.
[00187] In some aspects, the VL FWl region (SEQ ID NO:48) and/or the FW2 region
(SEQ ID NO:49) and/or the FW3 region (SEQ ID NO:50) of the parent 1.39.1 antibody have been replaced with a FWl and/or a FW2 and/or a FW3 independently comprising or consisting of the amino acids of SEQ ID NOS: 11, 12, or 13, respectively.
[00188] In some aspects the present disclosure provides an anti-HER2 binding molecule comprising an immunoglobulin heavy chain variable region (VH) and an immunoglobulin light chain variable region (VL), wherein the VH comprises the amino acids of SEQ ID NO: 15. In some aspects, the present disclosure provides an anti-HER2 binding molecule comprising a VH and a VL, wherein the VL comprises the amino acids of SEQ ID NO: 16. In some aspects, the VH comprises the amino acids of SEQ ID NO: 15 and the VL comprises the amino acids of SEQ ID NO: 16. In some aspect, an anti-HER2 binding molecule disclosed herein comprises an antibody, or a HER2-binding fragment thereof.
[00189] In certain aspects, an anti-HER2 binding molecule of the instant disclosure comprises an immunoglobulin heavy chain (VH) and an immunoglobulin light chain (VL), wherein the binding molecule comprises:
(i) VH-CDR1 comprising the amino acids of SEQ ID NO: 1;
(ii) VH-CDR2 comprising the amino acids of SEQ ID NO: 2;
(iii) VH-CDR3 comprising the amino acids of SEQ ID NO: 3;
(iv) VL-CDR1 comprising the amino acids of SEQ ID NO: 4;
(v) VL-CDR2 comprising the amino acids of SEQ ID NO: 5; and,
(vi) VL-CDR3 comprising the amino acids of SEQ ID NO: 6.
[00190] In certain aspects, an anti-HER2 binding molecule of the instant disclosure (e.g., an anti-HER2 antibody or HER2-binding fragment thereof, or a bispecific anti-HER2 antibody) comprises an antibody VL and an antibody VH, wherein the VL comprises an amino acid sequence at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% identical to a reference VL comprising or consisting of the amino acids of SEQ ID NO: 16.
[00191] In other aspects, an anti-HER2 binding molecule of the instant disclosure (e.g., an anti-HER2 antibody or HER2-binding fragment thereof, or a bispecific anti-HER2 antibody) comprises an antibody VL and an antibody VH, wherein the VH comprises an amino acid sequence at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% identical to a reference VH comprising or consisting of the amino acids of SEQ ID NO: 15.
[00192] In other aspects, an anti-HER2 binding molecule of the instant disclosure (e.g., an anti-HER2 antibody or HER2-binding fragment thereof, or a bispecific anti-HER2 antibody) comprises a VL comprising a sequence at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% identical to a reference VL comprising or consisting of the amino acids of SEQ ID NO: 16, and further comprises a VH comprising a sequence at least about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% identical to a reference VH comprising or consisting of the amino acids of SEQ ID NO: 15.
[00193] In some aspects, the anti-HER2 binding molecule of the instant disclosure (e.g., an anti-HER2 antibody or HER2-binding fragment thereof, or a bispecific anti-HER2 antibody) comprises a heavy chain constant region or fragment thereof. In some specific aspects, the heavy chain constant region is an IgG constant region. The IgG constant region can comprise a light chain constant region selected from the group consisting of a kappa constant region and a lambda constant region.
[00194] In certain aspects, an anti-HER2 binding molecule of the instant disclosure (e.g., an anti-HER2 antibody or HER2-binding fragment thereof, or a bispecific anti-HER2 antibody) can bind HER2 with substantially the same or better affinity as the 1.39.1 parent antibody. Thus, in one aspect, an anti-HER2 binding molecule of the instant disclosure (e.g., an anti-HER2 antibody or HER2-binding fragment thereof, or a bispecific anti-HER2 antibody) specifically binds HER2 and antigenic fragments thereof with a dissociation constant or k<j (k0ff/kon) of less than 10~6 M, or of less than 10~7 M, or of less than 10"8 M, or of less than 10"9 M, or of less than 10"10 M, or of less than 10"11 M, or of less than 10"12 M, or of less than 10"13 M.
[00195] In another aspect, an anti-HER2 binding molecule of the instant disclosure (e.g., an anti-HER2 antibody or HER2-binding fragment thereof, or a bispecific anti-HER2 antibody) binds to HER2 and/or antigenic fragments thereof with a kQff of less than
—3 1 —3 1
1x10 s , or less than 2x10 s . In other aspects, an anti-HER2 binding molecule of the instant disclosure (e.g., an anti-HER2 antibody or HER2-binding fragment thereof, or a bispecific anti-HER2 antibody) binds to HER2 and antigenic fragments thereof with a k0 of less than 10~3 s"1, less than 5xl0~3 s"1, less than lO-4 s"1, less than 5xl0~4 s"1, less than 10"5 s"1, less than 5xl0"5 s"1, less than 10"6 s"1, less than 5xl0"6 s"1, less than less than 5xl0"7 s"1, less than 10"8 s"1, less than 5xl0"8 s"1, less than 10"9 s"1, less than 5xl0"9 s-1, or less than 10~10 s-1.
[00196] In another aspect, an anti-HER2 binding molecule of the instant disclosure (e.g., an anti-HER2 antibody or HER2-binding fragment thereof, or a bispecific anti-HER2 antibody) binds to HER2 and/or antigenic fragments thereof with an association rate constant or kon rate of at least 105 M"1 s"1, at least 5xl05 M"1 s"1, at least 106 M"1 s"1, at least 5xl06 M"1 s"1, at least 107 M"1 s"1, at least 5xl07 M"1 s"1, or at least 108 M"1 s"1, or at least 109 M"1 s"1.
[00197] In other aspects, the VH and/or VL amino acid sequences can be 85%, 90%, 95%,
96%, 97%, 98% or 99% similar to the sequences set forth above, and comprise 1, 2, 3, 4, 5 or more conservative substitutions. An anti-HER2 binding molecule disclosed herein having VH and VL regions having high (i.e. , 80% or greater) similarity to the VH region of SEQ ID NOs: 16 and/or VL region of SEQ ID NOs: 15, respectively, can be obtained by mutagenesis (e.g., site-directed or PCR-mediated mutagenesis) of their respective encoding nucleic acid molecules, followed by testing of the altered antibody for retained function using the functional assays described herein.
[00198] The affinity and/or avidity of an anti-HER2 binding molecule disclosed herein for an antigen can be determined experimentally using any suitable method well known in the art, e.g. , flow cytometry, enzyme-linked immunosorbent assay (ELISA), or radioimmunoassay (RIA), or kinetics (e.g. , BIACORE™ analysis). Direct binding assays as well as competitive binding assay formats can also be readily employed. See, for example, Berzofsky et ah , "Antibody- Antigen Interactions," In Fundamental Immunology, Paul, W. E., Ed., Raven Press: New York, N.Y. (1984); Kuby, Immunology, W. H. Freeman and Company: New York, N.Y. (1992); and methods described herein.
[00199] The measured affinity of the interaction of a particular anti-HER2 binding molecule disclosed herein with a HER2 antigen can vary if measured under different conditions (e.g. , salt concentration, pH, temperature). Thus, measurements of affinity and other antigen-binding parameters (e.g. , KD or Kd, kon, kQff) are made with standardized solutions of anti-HER2 binding molecule and antigen, and a standardized buffer, as known in the art and such as the buffer described herein.
[00200] It also known in the art that affinities measured using BIACORE™ analysis can vary depending on which one of the reactants is bound to the chip. In this respect, affinity can be measured using a format in which the targeting anti-HER2 binding molecule is immobilized onto the chip (referred to as an "IgG down" format) or using a format in which the target protein (e.g. , HER2) is immobilized onto the chip (referred to as, e.g. , a "HER2 down" format). III. Bispecific Anti-HER2 Binding Molecules
[00201] The present disclosure also provides bispecific anti-HER2 antibodies comprising a first immunoglobulin antigen-binding domain and a second immunoglobulin antigen- binding domain, wherein:
(i) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 antibody binding sites;
(ii) the first immunoglobulin antigen-binding domain binds to a first HER2 antibody binding site which comprises an epitope within domain II of HER2; and,
(iii) the first HER2 antibody binding site is distinct from the antibody binding site of pertuzumab.
[00202] In some aspects, the first immunoglobulin antigen-binding domain binds to a
HER2 antibody binding site which comprises an epitope within domain II of HER2. In some aspects, the first HER2 antibody binding site is identical the HER2 antibody binding site of the 1.39.1 or 39S antibodies. In some aspects, the first HER2 antibody binding site partially overlaps with the HER2 antibody binding site of the 1.39.1 or 39S antibodies. In other aspects, the first HER2 antibody binding site is distinct from the HER antibody binding site of the 1.39.1 or 39S antibodies.
[00203] In some aspects, the second immunoglobulin antigen-binding domain binds to a second HER2 antibody binding site which comprises an epitope within domain IV of HER2. In some aspects, the second HER2 antibody binding site is identical the HER2 antibody binding site of trastuzumab. In some aspects, the second HER2 antibody binding site partially overlaps with the HER2 antibody binding site of trastuzumab. In other aspects, the second HER2 antibody binding site is distinct from the HER antibody binding site of trastuzumab.
[00204] In some aspects, the bispecific anti-HER2 antibody comprises a comprising a first immunoglobulin antigen-binding domain and a second immunoglobulin antigen-binding domain, wherein (i) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 antibody binding sites, (ii) the first immunoglobulin antigen-binding domain binds to a first HER2 antibody binding site which comprises an epitope within domain II of HER2 and is distinct from the antibody binding site of pertuzumab, and (iii) the second immunoglobulin antigen-binding domain competes with HERCEPTIN® for binding to domain IV of HER2.
[00205] The present disclosure also provides bispecific anti-HER2 molecules which bind the same epitope as or are derived from the anti-HER2 binding molecules disclosed above (i.e., lead optimized antibodies derived from the 1.39.1 parent antibody, for example, the 39S antibody). In some aspects, such bispecific anti-HER2 molecules are bispecific anti-HER2 antibodies and molecules derived from such bispecific antibodies. In some aspects, such molecules derived from the bispecific anti-HER2 molecules described herein are antibody-drug conjugates (ADC). In certain aspects, the ADCs provided herein have reduced ADCC activity. In some aspects, such molecules derived from the bispecific anti-HER2 molecules described herein have enhanced ADCC activity.
[00206] The present disclosure also provides a bispecific HER antibody comprising a first immunoglobulin and a second immunoglobulin antigen-binding domain wherein (i) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes; and (ii) wherein the first immunoglobulin antigen-binding domain binds HER2 to one or more amino acid residues in SEQ ID NO: 52. In some aspects, the second immunoglobulin antigen-binding domain binds HER2 at an epitope within domain IV. In other aspects, the second immunoglobulin antigen-binding domain binds HER2 to one or more amino acid residues in SEQ ID NO: 53.
[00207] Accordingly, in one aspect, the instant disclosure provides bispecific anti-HER2 antibodies comprising a first immunoglobulin antigen-binding domain and a second immunoglobulin antigen-binding domain, wherein the first immunoglobulin antigen- binding domain comprises a heavy chain (HC) variable region (VH), and a light chain (LC) variable region (VL) comprising:
(i) a variable heavy chain CDR-1 (VH-CDR1) sequence identical to SEQ ID NO:
1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions;
(ii) a variable heavy chain CDR-2 (VH-CDR2) sequence identical to SEQ ID NO:
2 or identical to SEQ ID NO: 2 except for up to 1, 2, 3, or 4 amino acid substitutions;
(iii) a variable heavy chain CDR-3 (VH-CDR3) sequence identical to SEQ ID NO: 3 or identical to SEQ ID NO: 3 except for up to 1, 2, 3, or 4 amino acid substitutions; (iv) a variable light chain CDR-1 (VL-CDR1) sequence identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions;
(v) a variable light chain CDR-2 (VL-CDR2) sequence identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1, 2, 3, or 4 amino acid substitutions; and,
(vi) a variable light chain CDR-3 (VL-CDR3) sequence identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions; wherein the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment; and, wherein the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
[00208] In some aspects, the first immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody comprises at least one heterologous variable domain framework region (FW) different relative to the FW regions of an immunoglobulin antigen-binding domain comprising a VH comprising the amino acids of SEQ ID NO:43 and a VL comprising the amino acids of SEQ ID NO:44;
[00209] In some aspects, the first immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody comprises (i) a variable light chain framework 1 (VL- FWl) comprising the amino acids of SEQ ID NO: 11; (ii) a variable light chain framework 2 (VL-FW2) comprising the amino acids of SEQ ID NO: 12; (iii) a VL- variable light chain framework 3 (VL-FW3) comprising the amino acids of SEQ ID NO: 13; (iv) a variable light chain framework 4 (VL-FW4) comprising the amino acids of SEQ ID NO: 14; or (v) any combination thereof.
[00210] In some aspects, the first immunoglobulin antigen-binding domain of the bispecific HER2 antibody comprises (i) a VL-FWl consisting of the amino acids of SEQ ID NO: 11; (ii) a VL-FW2 consisting of the amino acids of SEQ ID NO: 12; (iii) a VL- FW3 consisting of the amino acids of SEQ ID NO: 13; (iv) a VL-FW4 consisting of the amino acids of SEQ ID NO: 14; or (v) any combination thereof.
[00211] In other aspects, the bispecific anti-HER2 antibody disclosed herein comprises a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen- binding domain, wherein:
(i) the first immunoglobulin antigen-binding domain comprises a VH and a VL, wherein the VH comprises the amino acids of SEQ ID NO: 15 or SEQ ID NO:43; (ii) the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment; and,
(iii) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
[00212] In other aspects, the bispecific anti-HER2 antibody comprises a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein:
(i) the first immunoglobulin antigen-binding domain comprises a VH and a VL, wherein the VH consists of the amino acids of SEQ ID NO: 15 or SEQ ID NO:43;
(ii) the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment; and,
(iii) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
[00213] In some aspects, the bispecific anti-HER2 antibody comprises a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein:
(i) the first immunoglobulin antigen-binding domain comprises a VH and a VL, wherein the VL comprises the amino acids of SEQ ID NO: 16 or SEQ ID NO:44;
(ii) the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment; and,
(iii) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
[00214] In some aspects, the bispecific anti-HER2 antibody comprises a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein:
(i) the first immunoglobulin antigen-binding domain comprises a VH and a VL, wherein the VL consists of the amino acids of SEQ ID NO: 16 or SEQ ID NO:44;
(ii) the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment; and,
(iii) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes. [00215] In some aspects, the bispecific anti-HER2 antibody comprises a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein:
(i) the first immunoglobulin antigen-binding domain comprises a VH and a VL, wherein the VL comprises the amino acids of SEQ ID NO: 16 or SEQ ID NO:44, and the VH comprises the amino acids of SEQ ID NO: 15 or SEQ ID NO:45;
(ii) the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment; and,
(iii) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
[00216] In some aspects, the bispecific anti-HER2 antibody comprises a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein:
(i) the first immunoglobulin antigen-binding domain comprises a VH and a VL, wherein the VL consists of the amino acids of SEQ ID NO: 16 or SEQ ID NO:44, and the VH consists of the amino acids of SEQ ID NO: 15 or SEQ ID NO: 43;
(ii) the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment; and,
(iii) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
[00217] In some aspects, the first immunoglobulin antigen binding domain of the bispecific anti-HER2 antibody comprises or consists of:
(a) a VH further comprising a heavy chain constant region or a fragment thereof, and a VL comprising a light chain constant region (LC) or a fragment thereof;
(b) a single chain Fv ("scFv");
(c) a diabody;
(d) a minibody;
(e) an F(ab')2; or
(f) an F(ab).
[00218] In some aspects, the heavy chain constant region or fragment thereof of the bispecific anti-HER2 antibody is an IgG constant region. In some aspects, the IgG constant region or fragment thereof is an IgGl, IgG2, IgG3, or IgG4 constant region. In specific aspects, the IgG constant region is an IgGl constant region. In some aspects, the first immunoglobulin antigen binding domain of the bispecific anti-HER2 antibody comprises a VL comprising a light chain constant region (LC), wherein the LC constant region is a kappa constant region. In some aspects, the first immunoglobulin antigen binding domain of the bispecific anti-HER2 antibody comprises a VL comprising a light chain constant region (LC), wherein the LC constant region is a lambda constant region.
[00219] In some aspects, the first immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody is, for example, a monoclonal antibody, a humanized antibody, a chimeric antibody, or an affinity optimized antibody. In some aspects, the first immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody is, for example, a human antibody. In some aspects, the human antibody is expressed in a transgenic mouse (see, for example, Bruggemann, "Human antibody expression in transgenic mice, " Arch. Immunol. Therap. Exper. 49: 203-208, 2001, which is herein incorporated by reference in its entirety).
[00220] In some aspects, the first immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody does not compete with trastuzumab or pertuzumab for epitope binding. In some aspects, the first and second immunoglobulin antigen binding domains of the bispecific anti-HER2 antibody specifically bind to distinct HER2 epitopes. In some aspects, the distinct HER2 epitopes are non-overlapping.
[00221] In some aspects, the second immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody (i) specifically binds to the same HER2 epitope as the trastuzumab antibody; and/or (ii) competitively inhibits HER2 binding by the trastuzumab antibody; and/or (iii) comprises at least one, at least two, at least three, at least four, at least five, or at least six complementarity determining regions (CDRs) of comprising the amino acids of any one of SEQ ID NOs: 54 to 59.
[00222] In some aspects, the second immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody comprises an scFv. In some specific aspects, the second immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody comprises a disulfide stabilized scFv (ds-scFv). In some aspects, the disulfide stabilized scFv specifically binds to the same HER2 epitope as the trastuzumab antibody. [00223] A stabilizing disulfide can be engineered between the VH and VL regions of an scFv by introducing cysteine substitutions at positions selected such that the cysteine residues can form a disulfide bond. In particular, such a disulfide can be introduced in the framework regions such that the VL and VH regions are linked by a disulfide bond. The position of representing but not limiting residues in the VH and VL regions meeting these criteria are provided in TABLE 2.
TABLE 2: VH-VL pairs*
φ Numbering in TABLE 2 is according to the Kabat index as set forth in Kabat. It will be understood that the wild type amino acid residue at these positions will vary. Regardless of the wild type amino acid residue each position of a given pair will be substituted with a Cysteine.
[00224] The scFv disclosed herein are obtainable from or produced by any suitable source, whether natural or not, or it may be a recombinant scFv, a synthetic scFv, a semisynthetic scFv, a derivatized scFv, a fermentation optimized scFv, a fusion protein or equivalents, mutants and derivatives thereof as long as it retains the required binding specificity of the scFv's of the present disclosure. These include a scFv with binding specificity which has amino acid substitutions or has sugars or other molecules attached to amino acid functional groups. The term "derivative" or "derivatized" as used herein with respect to an scFv includes chemical modification of an scFv. Illustrative of such modifications would be replacement of hydrogen by an alkyl, acyl, or amino group.
[00225] In some aspects, the second immunoglobulin antigen-binding domain is an scFv comprising:
(i) a VH-CDR1 comprising the amino acids of SEQ ID NO:54;
(ii) a VH-CDR2 comprising the amino acids of SEQ ID NO:55;
(iii) a VH-CDR3 comprising the amino acids of SEQ ID NO:56; (iv) a VL-CDR1 comprising the amino acids of SEQ ID NO:57;
(v) a VL-CDR2 comprising the amino acids of SEQ ID NO:58; and,
(vi) a VL-CDR3 comprising the amino acids of SEQ ID NO:59.
[00226] In some aspects, the second immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody consists of a scFv that specifically binds to the same HER2 epitope as the trastuzumab antibody and comprises VH and VL derived from the VH and VL of the trastuzumab antibody (e.g., the native VH and/or VL present in the trastuzumab antibody, or VH and/or VL mutants with stabilizing mutations, e.g., the pairs of mutations shown in TABLE 2). See Goldenger, Clin. Ther. 21:309-18 (1999). Accordingly, in some aspects, the scFv that binds the same epitope as trastuzumab comprises a VH comprising the amino acids of SEQ ID NO: 17, and a VL comprising the amino acids of SEQ ID NO: 18. In some aspects, the scFv that binds the same epitope as trastuzumab comprises a VH consisting of the amino acids SEQ ID NO: 17, and a VL consisting of the amino acids of SEQ ID NO: 18. In some specific aspects, the VH and VL of the scFv that binds the same epitope as trastuzumab are covalently linked via a peptide linker. In some aspects, the peptide linker comprises the amino acids of SEQ ID NO: 19. In some aspects, the peptide linker consists of the amino acids of SEQ ID NO: 19.
[00227] As discussed above, a person skilled in the art will appreciate that scFv's that bind the same epitope as trastuzumab include sequences derived from trastuzumab, comprising for example mutant sequences wherein at least one amino acid has been deleted or substituted with respect to a parent sequence in the trastuzumab antibody, as long as the resulting molecule is capable of specifically binding to the same HER2 epitope as the trastuzumab antibody, e.g., mutations designed to introduce at least one stabilizing disulfide between the VH and VL of the scFv.
[00228] In some aspects, the second immunoglobulin antigen-binding domain of the bispecific anti-HER2 antibody is covalently linked to the carboxy-terminus of the HC of the first immunoglobulin antigen-binding domain. In some aspects, the bispecific anti- HER2 antibody comprises at least one linker interposed between the second immunoglobulin antigen binding domain and the carboxy-terminus of the HC of the first immunoglobulin antigen-binding domain. In some specific aspects, one linker is interposed between the second immunoglobulin antigen binding domain and the carboxy- terminus of the HC of the first immunoglobulin antigen-binding domain.
[00229] In some aspects, the second immunoglobulin antigen-binding domain is covalently linked to the amino-terminus of the HC of the first immunoglobulin antigen- binding domain. In some aspects, the bispecific anti-HER2 antibody comprises at least one linker interposed between the second immunoglobulin antigen-binding domain and the amino-terminus of the HC of the first immunoglobulin antigen-binding domain. In specific aspects, one linker is interposed between the second immunoglobulin antigen- binding domain and the amino-terminus of the HC of the first immunoglobulin antigen- binding domain.
[00230] In some aspects, the second immunoglobulin antigen binding domain of the bispecific anti-HER2 antibody is covalently intercalated in the sequence of the HC of the first immunoglobulin antigen-binding domain. In some aspects, the second immunoglobulin antigen binding domain of the bispecific anti-HER2 antibody is covalently intercalated between the CHI region and CH2 region of the HC of the first immunoglobulin antigen-binding domain. In some aspects, one or more linkers connect the second immunoglobulin antigen binding domain of the bispecific anti-HER2 antibody to the CHI region and/or the CH2 region of the HC of the first immunoglobulin antigen- binding domain.
[00231] In some specific aspects, the bispecific anti-HER2 antibody comprises (i) a linker interposed between the CHI region of the HC of the first immunoglobulin antigen binding domain and the second immunoglobulin antigen binding domain; and (ii) a second linker interposed between the second immunoglobulin antigen binding domain and the CH2 region of the HC of the of the first immunoglobulin antigen-binding domain. In some aspects, the first linker and the second linker are identical. In some aspects, the first linker and the second linker are different. In some aspects, one or more of the linkers comprise a peptide linker. In some aspects, the peptide linker comprises at least one, at least two, at least three, at least four, at least five, at least 10, at least 15, at least 20, at least 25, or at least 30 amino acids. In some aspects, the peptide linker comprises more than 20 amino acids. In some aspects, the peptide linker comprises a peptide having the formula Serx[(Gly)y-Ser4]z where x is from 0 to 1, y is from 1 to 4, and z is from 1 to 10. In some aspects, the peptide linker comprises a sequence selected from SEQ ID NOS: 19, 20, 21 or 22.
[00232] In some aspects, the bispecific anti-HER2 antibody comprises a heavy chain comprising a constant region comprising an Fc domain. In some aspects, the Fc domain comprises a CH2 region, and/or a CH3 region, and/or fragments thereof. In some specific aspects, the Fc domain comprises a CH2 region and a CH3 region. In some aspects, the Fc domain consists of a CH2 region and a CH region. In some aspects, the Fc domain is an IgG Fc domain, from example, an Fc domain from an IgGl, IgG2, IgG3, or IgG4. In some aspects, the IgG Fc domain is a human or humanized IgG Fc domain. In some aspects, the Fc domain is an IgGl Fc domain.
[00233] In some aspects, the IgG Fc domain, for example an IgGl Fc domain, is a native
(wild type) domain. In some aspects, the native IgGl Fc domain comprises the amino acids of SEQ ID NO: 23. In other aspects, the native IgGl Fc domain consists of the amino acids of SEQ ID NO: 23. In other aspects, the Fc domain is a mutant IgG domain, for example, a mutant IgGl, IgG2, IgG3, or IgG4 domain. In some specific aspects, the mutant Fc domain is a mutant IgGl Fc domain.
[00234] In some aspects, the mutant IgG domain, for example, a human or humanized
IgGl Fc domain, comprises at least one mutation capable of reducing the ADCC activity of the bispecific anti-HER2 antibody. In certain aspects, at least one mutation capable of reducing the ADCC activity of the anti-HER2 bispecific antibody is an amino acid substitution. In some aspects, the bispecific anti-HER2 antibody with reduced ADCC activity comprises at least one amino acid substitution selected from L234F, S239C, S239A, a cysteine amino acid insertion between positions 239 and 240, or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat. Numerous mutations capable of reducing the ADCC activity of an antibody are known in the art. For example, see the mutations described in WO2012175751, WO2011149999, WO2011066501, WO2000042072, WO2011120134, which are herein incorporated by reference in their entireties. Antibodies with reduced ADCC effector function also include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Pat. No. 6,737,056), wherein the amino acid position numbering is according to the EU index as set forth in Kabat. Such Fc mutants also include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including Fc mutant with substitution of residues 265 and 297 to alanine (U.S. Pat. No. 7,332,581, wherein the amino acid position numbering is according to the EU index as set forth in Kabat).
[00235] In some aspects, the mutant IgG domain, for example, a human or humanized
IgGl Fc domain, comprises at least one mutation capable of enhancing the ADCC activity of the bispecific anti-HER2 antibody. In certain aspects, at least one mutation capable of enhancing the ADCC activity of the anti-HER2 bispecific antibody is an amino acid substitution. In some aspects, the bispecific anti-HER2 antibody with enhanced ADCC activity comprises at least one amino acid substitution selected from S239A, S239D, A330L, I332E, E333A, K334A or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat. Additional mutations which enhance ADCC activity are known to one skilled in the art including but not limited to those exemplified in Tables 2, and 6-10 of US 6,737,056; the tables presented in Figure 41 of US 2006/024298; the tables presented in Figures 5, 12, and 15 of US 2006/235208; the tables presented in Figures 8, 9 and 10 of US 2006/0173170 and the tables presented in Figures 8, 9 and 10 of WO 09/058492 .
[00236] In some aspects, the mutant IgGl Fc domain can comprise at least one amino acid substitution introducing a derivatizable functional group. In some aspects, the mutant IgGl Fc domain comprises one to three amino acid substitutions introducing a derivatizable functional group. In some aspects, the derivatizable group is the sulfhydryl side chain of a cysteine amino acid. In particular aspects, the substituted amino acid or amino acids occur at accessible sites of the anti-HER2 binding molecule. By substituting those amino acid residues with cysteine, reactive thiol groups are thereby positioned at accessible sites of the anti-HER2 binding molecule and can be used to conjugate the anti- HER2 binding molecule to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein. Cysteine engineered antibodies can be generated as described, e.g., in U.S. Pat. No. 7,521,541.
[00237] In some aspects, the derivatizable group is introduced at Kabat position 239, 248,
254, 258, 273, 279, 282, 284, 286, 287, 289, 297, 298, 312, 324, 326, 330, 335, 337, 339, 350, 355, 356, 359, 360, 361, 375, 383, 384, 389, 398, 400, 413, 415, 418, 422, 435, 440, 441, 442, 443 or 446, at an amino acid inserted between positions 239 and 240, or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat. In some aspects, the amino acid or amino acid substitution introducing a derivatizable sulfhydryl group is selected from the group consisting of S239C, 248C, 254C, 258C, 273C, 279C, 282C, 284C, 286C, 287C, 289C, 297C, 298C, 312C, 324C, 326C, 330C, 335C, 337C, 339C, 350C, 355C, 356C, 359C, 360C, 361C, 375C, 383C, 384C, 389C, 398C, 400C, 413C, 415C, 418C, 422C, 435C, 440C, 441C, S442C, 443C and 446C, a cysteine amino acid insertion between positions 239 and 240, or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat. In some aspects, the amino acid or amino acid substitution introducing a derivatizable sulfhydryl group is S239C and/or S442C.
[00238] Selectively derivatizable groups are well known in the art, such as an amino group, sulfhydryl group, pendant oxyamino, or other nucleophilic groups. Derivatizable groups can be joined to a polypeptide chain via one or more linkers. Ligands (e.g., therapeutic moieties, detectable labels, half-life extending polymers, etc.) can be attached to the derivatizable groups using the appropriate attachment chemistry. This coupling chemistry can include, for example, amide, urea, thiourea, oxime, aminoacetylamide, etc.
[00239] In some aspects, the Fc domain has an altered type of glycosylation that enhances
ADCC activity. The glycosylation of the Fc region can be modified to increase or decrease effector function (see for examples, Umana et al, 1999, Nat. Biotechnol 17: 176- 180; Davies et al., 2001, Biotechnol Bioeng 74:288-294; Shields et al, 2002, J Biol Chem 277:26733-26740; Shinkawa et al., 2003, J Biol Chem 278:3466-3473; U.S. Pat. Nos. 6,602,684; 6,946,292; 7,064, 191 ; 7,214,775;7,393,683; 7,425,446; 7,504,256; U.S. Publication. Nos. 2003/0157108; 2003/0003097; 2009/0010921 ; POTELLEGENT™ technology (Biowa, Inc. Princeton, N.J.); GLYCOMAB™ glycosylation engineering technology (GLYCART biotechnology AG, Zurich, Switzerland)). In some aspects, the Fc domain is a hypofucosylated antibody Fc domain having reduced amounts of fucosyl residues (see for examples, U.S. Patent Application Publication No.2005/0226867). In one aspect, these antibodies with increased effector function, specifically ADCC, as generated in host cells (e.g., CHO cells, Lemna minor) engineered to produce highly defucosylated antibody with over 100-fold higher ADCC compared to antibody produced by the parental cells (e.g., Mori et al., 2004, Biotechnol Bioeng 88:901-908; Cox et al., 2006, Nat Biotechnol., 24: 1591-7). In some aspects, the Fc domain has increased bisecting GlcNAc structures (e.g., Umana et al, 1999, Nat. Biotechnol 17: 176-180; US2009/0010921).
[00240] In some aspects, the mutant Fc domain comprises the amino acids of SEQ ID NO:
24A, 24C, 25A or 25C.
[00241] In some aspects, the mutant Fc domain comprises the amino acids of SEQ ID NO:
24B or SEQ ID NO:25B.
[00242] Also provided in the instant disclosure are bispecific anti-HER2 antibodies comprising a first and a second polypeptide chain associated with each other, wherein the first polypeptide chain is selected from:
(1) [TZSHL!HBVHHBCHHFCX]
(2) [BVH]-[BCH]-[FCX]-[L2]-[TZS]
(3) [BVH]-[BCH]-[L3]-[TZS]-[L4]-[FCX]
wherein
TZs is an scFv that binds the same epitope recognized by the trastuzumab antibody;
L1 ; L2, L3, and L4 are peptide linkers;
Fcx is an Fc domain;
BVH and BCH are the VH and CHI regions, respectively, of an antibody capable of binding to an HER2 epitope distinct from the epitope recognized by the trastuzumab antibody.
[00243] In some aspects, the distinct epitope comprises one or more amino acids within
SEQ ID NO: 52.
[00244] In some aspects, the epitope recognized by the trastuzumab antibody comprises one or more amino acid residues in SEQ ID NO: 53.
[00245] In some aspects, the second polypeptide chain comprises [BVL]-[CL] wherein
BVL is the VL region of an antibody capable of binding to an HER2 epitope distinct from the epitope recognized by the trastuzumab antibody, and CL is an IgG light chain constant region. In some aspects, CL is selected from the group consisting of a human kappa constant region and a human lambda constant region. [00246] In some aspects, BVL comprises the amino acids of SEQ ID NO: 16. In some aspects, BVL comprises the amino acids of SEQ ID NO:44. In some aspects, BVL comprises:
(i) a variable light chain CDR-1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions;
(ii) a variable light chain CDR-2 (VL-CDR2) identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1, 2, 3, or 4 amino acid substitutions; and,
(iii) a variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions.
[00247] In some specific aspects, CL comprises the amino acids of SEQ ID NO:27A.
[00248] In some specific aspects, CL comprises the amino acids of SEQ ID NO:27B.
[00249] In some aspects, [TZS] comprises:
(i) a VH-CDR1 comprising the amino acids of SEQ ID NO:54;
(ii) a VH-CDR2 comprising the amino acids of SEQ ID NO:55;
(iii) a VH-CDR3 comprising the amino acids of SEQ ID NO:56;
(iv) a VL-CDR1 comprising the amino acids of SEQ ID NO:57;
(v) a VL-CDR2 comprising the amino acids of SEQ ID NO:58; and
(vi) a VL-CDR3 comprising the amino acids of SEQ ID NO:59.
[00250] In some aspects, [TZS] is a disulfide stabilized scFv. In some aspects, [TZS] comprises (i) a VH comprising or consisting of the amino acids of SEQ ID NO: 17, or a variant thereof, and (ii) a VL comprising or consisting of the amino acids of SEQ ID NO: 18, or a variant thereof, covalently linked by a peptide linker. Numerous linkers (for example, peptide linkers) suitable for linking the VH and VL moieties of an scFv are known in the art. In some aspects, the linker is a peptide linker comprising or consisting of the amino acids of SEQ ID NO: 19. In other aspects, [TZs] comprises or consists of the amino acids of SEQ ID NO:28.
[00251] In some aspects, a hinge polypeptide links the [BCH] and [Fcx]. In some aspects, the hinge polypeptide comprises or consists of the amino acids of SEQ ID NO: 26. In some aspects, the [Fcx] comprises at least one amino acid substitution introducing a derivatizable group. In other aspects, the [Fcx] comprises one to three amino acid substitution introducing a derivatizable group. In yet other aspects, the [Fcx] comprises more than three amino acid substitutions introducing a derivatizable. In some aspects, all the derivatizable groups are identical. In other aspects, at least one derivatizable group is different from the rest. In some aspects, all the derivatizable groups are different. In some aspects, the derivatizable group is a sulfhydryl group (e.g., the sulfhydryl group of a cysteine). In some aspects, the derivatizable group is protected.
[00252] In some aspects, the derivatizable group is introduced at position 239, 248, 254,
258, 273, 279, 282, 284, 286, 287, 289, 297, 298, 312, 324, 326, 330, 335, 337, 339, 350, 355, 356, 359, 360, 361, 375, 383, 384, 389, 398, 400, 413, 415, 418, 422, 435, 440, 441, 442, 443, or 446, or between positions 239 and 240, or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat. In some aspects, the derivatizable group is a sulfhydryl group in at least one cysteine amino acid substitution comprising S239C, 248C, 254C, 258C, 273C, 279C, 282C, 284C, 286C, 287C, 289C, 297C, 298C, 312C, 324C, 326C, 330C, 335C, 337C, 339C, 350C, 355C, 356C, 359C, 360C, 361C, 375C, 383C, 384C, 389C, 398C, 400C, 413C, 415C, 418C, 422C, 435C, 440C, 441C, S442C, 443C and 446C, a cysteine amino acid insertion between positions 239 and 240, or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat. In some aspects, the amino acid or amino acid substitution introducing a derivatizable sulfhydryl group is S239C and/or S442C. In some aspects, the amino acid or amino acid substitution introducing a derivatizable sulfhydryl group is a cysteine amino acid insertion between positions 239 and 240 and/or S442C.
[00253] In other aspects, [Fcx] comprises the amino acids of any one of SEQ ID NOs: 23,
24A, 24C, 25Aor 25C.
[00254] In other aspects, [Fcx] comprises the amino acids of any one of SEQ ID NOs: 23,
24B, or 25B.
[00255] In certain aspects, [Li], [L2], [L3], and [L4] comprise the amino acids of linker sequences independently selected from the group consisting of SEQ ID NOs: 19, 20, 21, and 22. In some aspects, all the linkers are different. In some aspects, at least two of the linkers are identical. One skilled in the art would understand that the linkers can be peptide, non-peptide, or combination of peptide and non-peptide linkers. In some specific aspects, (i) [L comprises or consists of the amino acids of SEQ ID NO:20; (ii) [L2] comprises or consists of the amino acids of SEQ ID NO:20; (iii) [L3] comprises or consists of the amino acids of SEQ ID NO:21; and, (iv) [L4] comprises or consists of the amino acids of SEQ ID NO:22.
[00256] In some aspects, [BVH] comprises:
(i) a variable heavy chain CDR-1 (VH-CDR1) identical to SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions;
(ii) a variable heavy chain CDR-2 (VH-CDR2) identical to SEQ ID NO: 2 or identical to SEQ ID NO: 2 except for up to 1, 2, 3, or 4 amino acid substitutions; and
(iii) a variable heavy chain CDR-3 (VH-CDR3) identical to SEQ ID NO: 3 or identical to SEQ ID NO: 3 except for up to 1, 2, 3, or 4 amino acid substitutions.
[00257] In some aspects, [BVH] comprises or consists of the amino acids of SEQ ID
NO: 15 or SEQ ID NO: 43.
[00258] In some aspects, [BVL] comprises:
(i) a variable light chain CDR-1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions;
(ii) a variable light chain CDR-2 (VL-CDR2) identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1, 2, 3, or 4 amino acid substitutions; and,
(iii) a variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions.
[00259] In some specific aspects, [BVL] comprises or consists of the amino acids of SEQ
ID NO: 16 or SEQ ID NO: 44. In some aspects, [BCH] comprises or consists of the amino acids of SEQ ID NO: 29.
[00260] In some specific aspects, the instant disclosure provides bispecific anti-HER2 antibodies comprising a first polypeptide chain and a second polypeptide chain, wherein (i) the first polypeptide chain comprises or consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 30, 31 A, 32A, 32C, 33A, 33C, 34, 34A, 35A, 36A, 36C, 37A, 37C, 38, 38A, 39A, 40A, 40C, 41A and 41C, and (ii) the second polypeptide chain comprises or consists of the sequence of SEQ ID NO:42A or 42B, wherein the bispecific anti-HER2 antibodies are conjugated to a therapeutic moiety.
[00261] In some specific aspects, the instant disclosure provides bispecific anti-HER2 antibodies comprising a first polypeptide chain and a second polypeptide chain, wherein (i) the first polypeptide chain comprises or consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 30, 3 IB, 32B, 33B, 34B, 35B, 36B, 37B, 38B, 39B, 40B, and 41B, and (ii) the second polypeptide chain comprises or consists of the sequence of SEQ ID NO:42A or 42B, wherein bispecific anti-HER2 antibodies have enhanced ADCC activity.
IV. Antibody-Drug Conjugates (ADCs)
The instant disclosure also provides antibody-drug conjugates (ADCs) comprising at least one of the anti-HER2 binding molecules disclosed herein (e.g., antibodies which bind the same epitope as or are derived from the 39S antibody or HER2-binding fragments thereof, or the bispecific anti-HER2 antibodies disclosed herein) conjugated to least one therapeutic moiety. Accordingly, in some aspects, the ADC comprises a bispecific anti-HER2 antibody disclosed herein conjugated to at least one therapeutic moiety (e.g., a cytotoxin), wherein said bispecific anti-HER2 antibody comprises (i) a first immunoglobulin antigen-binding domain and (ii) a second immunoglobulin antigen- binding domain, wherein the first immunoglobulin antigen-binding domain comprises a heavy chain (HC) variable region (VH) and a light chain (LC) variable region (VL) comprising:
(i) a variable heavy chain CDR- 1 (VH-CDR1) sequence identical to SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions;
(ii) a variable heavy chain CDR-2 (VH-CDR2) sequence identical to SEQ ID NO: 2 or identical to SEQ ID NO: 2 except for up to 1, 2, 3, or 4 amino acid substitutions;
(iii) a variable heavy chain CDR-3 (VH-CDR3) sequence identical to SEQ ID NO: 3 or identical to SEQ ID NO: 3 except for up to 1, 2, 3, or 4 amino acid substitutions;
(iv) a variable light chain CDR- 1 (VL-CDR1) sequence identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions;
(v) a variable light chain CDR-2 (VL-CDR2) sequence identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1, 2, 3, or 4 amino acid substitutions; and,
(vi) a variable light chain CDR-3 (VL-CDR3) sequence identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions;
wherein: (a) the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment; and,
(b) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
[00263] In some aspects, the first immunoglobulin antigen-binding domain of the ADC comprises at least one heterologous variable domain framework region (FW) different relative to the FW regions of an immunoglobulin antigen-binding domain comprising a VH comprising the amino acids of SEQ ID NO:43, and a VL comprising the amino acids of SEQ ID NO:44;
[00264] In some aspects, the ADC further comprises at least one optional spacer which can be intercalated between the side chain of an amino acid in a polypeptide chain of the anti-HER2 binding molecule (for example, an amino in the heavy chain of an anti-HER2 bispecific antibody disclosed herein) and the therapeutic moiety. In some aspects, the at least one spacer is a peptidic spacer. In other aspects, the at least one spacer is a non- peptidic spacer. In some aspects, the spacer is unstable, such an acid labile spacer (e.g. , a hydrazine). In other aspects, the spacer is an enzyme cleavable peptide, e.g., a cleavable dipeptide. In some aspects, the spacer is uncleavable (hydrolytically stable), for example, a thioether spacer or a hindered disulfide spacer. In some aspects, the intercalated between the side chain of an amino acid in a polypeptide chain of the anti-HER2 binding molecule (for example, an amino in the heavy chain of an anti-HER2 bispecific antibody disclosed herein) and the additional therapeutic moiety is MCC (N-succinimidyl- 4(maleimidomethyl) cyclohexane)).
[00265] Hydrolytically stable spacers are substantially stable in water and do not react with water at useful pH values, including but not limited to, under physiological conditions for an extended period of time. Hydrolytically unstable or degradable spacers are degradable in water or in aqueous solutions, including for example, blood.
[00266] Enzymatically unstable or degradable spacers can be degraded by one or more enzymes. By way of example only, PEG and related polymers can include degradable spacers in the polymer backbone or in the linker group between the polymer backbone and one or more of the terminal functional groups of the polymer molecule. Such degradable spacers include, but are not limited to, ester linkages formed by the reaction of PEG carboxylic acids or activated PEG carboxylic acids with alcohol groups on a biologically active agent, wherein such ester groups generally hydrolyze under physiological conditions to release the biologically active agent. Other hydrolytically degradable spacers include but are not limited to carbonate linkages; imine linkages resulting from reaction of an amine and an aldehyde; phosphate ester linkages formed by reacting an alcohol with a phosphate group; hydrazone linkages which are a reaction product of a hydrazide and an aldehyde; acetal linkages that are the reaction product of an aldehyde and an alcohol; orthoester linkages that are the reaction product of a formate and an alcohol; peptide linkages formed by an amine group, including but not limited to, at an end of a polymer such as PEG, and a carboxyl group of a peptide; and oligonucleotide linkages formed by a phosphoramidite group, including but not limited to, at the end of a polymer, and a 5' hydroxyl group of an oligonucleotide.
[00267] In some aspects, the ADC comprises two, three, four, five, six, seven, eight, nine or ten therapeutic moieties. In some specific aspects, the ADC comprises two, three, or four therapeutic moieties. In some aspects, all therapeutic moieties are the same. In some aspects, at least one therapeutic moiety is different from the rest. In some aspects, all therapeutic moieties are different. In some aspects, all the spacers (e.g., peptidic and/or non-peptidic spacers) are the same. In some aspects, at least one spacer is different from the rest. In still other aspects, all the spacers are different.
[00268] In some aspects, each therapeutic moiety is chemically conjugated to the side chain of an amino acid at a specific position in the Fc region of the anti-HER2 binding molecule (e.g., a bispecific anti-HER2 antibody disclosed herein).
[00269] In some aspects, the specific positions in the Fc region are selected from the group consisting of 239, 248, 254, 258, 273, 279, 282, 284, 286, 287, 289, 297, 298, 312, 324, 326, 330, 335, 337, 339, 350, 355, 356, 359, 360, 361, 375, 383, 384, 389, 398, 400, 413, 415, 418, 422, 435, 440, 441, 442, 443, 446, an insertion between positions 239 and 240, and combinations thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
[00270] In some aspects, the specific positions in the Fc region are 239, 442, or both, wherein the amino acid position numbering is according to the EU index as set forth in Kabat. In some aspects, the specific positions in the Fc region consist of 442 and an amino acid insertion between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
[00271] In some aspects, the amino acid side chain where the therapeutic moiety is conjugated is a sulfhydryl side chain, for example, the sulfhydryl group of a cysteine amino acid. In some aspects, at least one therapeutic moiety is chemically conjugated to the side chain of an amino acid located at a position outside of the Fc region of the anti- HER2 binding molecule (e.g., a bispecific anti-HER2 antibody disclosed herein). In some aspects, all the therapeutic moieties are chemically conjugated to the side chain of an amino acid located at a position outside of the Fc region of the anti-HER2 binding molecule (e.g., a bispecific anti-HER2 antibody disclosed herein). In some aspects, at least one therapeutic moiety is genetically incorporated into the polypeptide chain of the anti-HER2 binding molecule (e.g., a bispecific anti-HER2 antibody disclosed herein) using recombinant techniques known in the art.
[00272] In some aspects, the therapeutic moiety comprises a cytotoxin, a radioisotope, a radioisotope, an immunomodulator, a cytokine, a lymphokine, a chemokine, a growth factor, a tumor necrosis factor, a hormone, a hormone antagonist, an enzyme, an oligonucleotide, a DNA, an RNA, an siRNA, an RNAi, a microRNA, a photoactive therapeutic agent, an anti-angiogenic agent, a pro-apoptotic agent, a peptide, a lipid, a carbohydrate, a chelating agentor combinations thereof.
[00273] In some specific aspects, the cytotoxin is an auristatin, a tubulysin, a maytansinoid or a pyrrolobenzodiazepine (PBD). In another specific aspect, the cytotoxin is tubulysin 1508.
[00274] In specific aspects, the ADC comprises a bispecific anti-HER2 antibody disclosed herein, wherein said antibody comprises:
(i) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO: 32A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid at position 239, wherein the amino acid position numbering is according to the EU index as set forth in Kabat; (ii) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:33A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to cysteine amino acids respectively located at positions 239 and 442 wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(iii) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:36A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid at position 239, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(iv) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO: 37 A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to cysteine amino acids respectively located at positions 239 and 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(v) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:40A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid at position 239, wherein the amino acid position numbering is according to the EU index as set forth in Kabat; or,
(vi) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:41A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to cysteine amino acids respectively located at positions 239 and 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat. In specific aspects, the ADC comprises a bispecific anti-HER2 antibody disclosed herein, wherein said antibody comprises:
(i) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO: 62 and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(ii) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO: 33C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(iii) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:36C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(iv) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:37C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin MEDI 1508 molecules) covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(v) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:40C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat; or,
(vi) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:41C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
[00276] ADC molecules disclosed herein comprise at least one of the anti-HER2 binding molecules disclosed herein (e.g., antibodies which bind the same epitope as or are derived from the 39S antibody or HER2-binding fragments thereof, or the bispecific anti-HER2 antibodies disclosed herein) which has been derivatized or linked (e.g., chemically or recombinantly) to another molecule (e.g., a peptide, small drug molecule, detectable molecule, etc.). In general, anti-HER2 antibodies or portions thereof are derivatized such that their HER2 binding is not affected adversely by the derivatization or labeling. Accordingly, the anti-HER2 antibodies and antibody portions of the instant disclosure are intended to include both intact and modified forms of the anti-HER2 binding molecules described herein. For example, an anti-HER2 binding molecule disclosed herein or HER2-binding portion thereof can be functionally linked (by chemical coupling, genetic fusion, noncovalent association, or otherwise) to one or more other molecular entities, such as a cytotoxic agent, a pharmaceutical agent, a detection agent, and/or a protein or peptide that can mediate association of the anti-HER2 binding molecule with another molecule (such as a streptavidin core region or a polyhistidine tag).
[00277] One type of derivatized molecule can be produced by crosslinking two or more molecular entities, e.g., an anti-HER2 binding molecule disclosed herein and a therapeutic moiety (e.g., a cytotoxin such as tubulysin 1508). Suitable crosslinkers include those that are heterobifunctional, i.e., having two distinctly reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimidc ester); or homobifunctional (e.g. , disuccinimidyl suberate). Such crosslinkers are available, for example, from Pierce Chemical Company, Rockford, II. Additional bifunctional coupling agents include N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), succinimidyl-4-(N-maleimidomethyl) cyclohexane- l-carboxylate, iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as tolyene 2,6- diisocyanate), and bis-active fluorine compounds (such as l,5-difluoro-2,4- dinitrobenzene).
[00278] Another type of derivatized molecule can be produced by incorporating a detectable label. Useful detection agents include fluorescent compounds (e.g., fluorescein, fluorescein isothiocyanate, rhodamine, 5-dimethylamine-l- napthalenesulfonyl chloride, phycoerythrin, lanthanide phosphors and the like), enzymes that are useful for detection (e.g., horseradish peroxidase, β-galactosidase, luciferase, alkaline phosphatase, glucose oxidase and the like), epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags, etc.). In some aspects, detectable labels can be attached by at least one spacer arm. Spacer arms can be of various lengths to reduce potential steric hindrance.
[00279] An anti-HER2 binding molecule can also be labeled with a radiolabeled amino acid. The radiolabel can be used for both diagnostic and therapeutic purposes. For instance, the radiolabel can be used to detect HER2-expressing cells by X-ray or other diagnostic techniques such as positron emission tomography (PET).
[00280] Further, the radiolabel can be used therapeutically as a toxin for HER2-expressing cells, such as those which cause unwanted immune response. Examples of labels for polypeptides include, but are not limited to, the following radioisotopes or radionuclides: 3H, 14C, 15N, 35S, 90Y, 99Tc, l uIn, 125I and 131I. In some aspects, the anti-HER2 binding molecule can be labeled with a paramagnetic, radioactive, or fluorogenic ion that is detectable upon imaging. In some aspects, the paramagnetic ion is chromium (III), manganese (II), iron (III), iron (II), cobalt (II), nickel (II), copper (II), neodymium (III), samarium (III), ytterbium (III), gadolinium (III), vanadium (II), terbium (III), dysprosium (III), holmium (III) or erbium (III). In other aspects, the radioactive ion is iodine-123, technetium-99, indium-I l l, rhenium-188, rhenium-186, copper-67, iodine-131, yttrium- 90, iodine-125, astatine-211 , and gallium-67. In other aspects, the anti-HER2 binding molecule is labeled with an X-ray imaging agent such as lanthanum (III), gold (III), lead (II), and bismuth (III). An anti-HER2 binding molecule can also be derivatized with a chemical group, for example a polymer such as polyethylene glycol (PEG), a methyl group, an ethyl group, or a carbohydrate group. These groups are useful to improve the biological characteristics of the antibody, e.g., to increase serum half-life or to increase tissue binding.
[00281] The term "cytotoxic agent" as used herein is defined broadly and refers to a substance that inhibits or prevents the function of cells and/or causes destruction of cells (cell death), and/or exerts anti-neoplastic/anti-proliferative effects. For example, cytotoxic agent prevents directly or indirectly the development, maturation, or spread of neoplastic tumor cells. The term includes also such agents that cause a cytostatic effect only and not a mere cytotoxic effect. The term includes chemotherapeutic agents as specified below, as well as other HER2 antagonists, anti-angiogenic agents, tyrosine kinase inhibitors, protein kinase A inhibitors, members of the cytokine family, radioactive isotopes, and toxins such as enzymatically active toxins of bacterial, fungal, plant or animal origin.
[00282] The term "chemotherapeutic agent" is a subset of the term "cytotoxic agent" comprising natural or synthetic chemical compounds. Examples of chemotherapeutic or agents include alkylating agents, for example, nitrogen mustards, ethyleneimine compounds, alkyl sulphonates and other compounds with an alkylating action such as nitrosoureas, cisplatin and dacarbazine; antimetabolites, for example, folic acid, purine or pyrimidine antagonists; mitotic inhibitors, for example, Vinca alkaloids and derivatives of podophyllotoxin; cytotoxic antibiotics and camptothecin derivatives. Other chemotherapeutic agents are amifostine (ETHYOL®), cisplatin, dacarbazine (DTIC), dactinomycin, mechlorethamine (nitrogen mustard), streptozocin, cyclophosphamide, carrnustine (BCNU), lomustine (CCNU), doxorubicin (AD IAMYCIN®), doxorubicin lipo (DOXIL®), gemcitabine (GEMZAR®), daunorubicin, daunorubicin lipo (DAUNOXOME®), procarbazine, mitomycin, cytarabine, etoposide, methotrexate, 5-fluorouracil (5-FU), vinblastine, vincristine, bleomycin, paclitaxel (TAXOL®), docetaxel (TAXOTERE®), aldesleukin, asparaginase, busulfan, carboplatin, cladribine, camptothecin, CPT- 1 1 , 10- hydroxy-7-ethyl-camptothecin (SN38), gefitinib (IRESSA®), dacarbazine, floxuridine, fludarabine, hydroxyurea, ifosfamide, idarubicin, mesna, interferon alpha, interferon beta, irinotecan, mitoxantrone, topotecan, leuprolide, megestrol, melphalan, mercaptopurine, plicamycin, mitotane, pegaspargase, pentostatin, pipobroman, plicamycin, streptozocin, tamoxifen, teniposide, testolactone, thioguanine, thiotepa, uracil mustard, vinorelbine, chlorambucil aromatase inhibitors, and combinations thereof.
IV.A Tubulysins
[00283] In some aspects, the ADC comprises an anti-HER2 binding molecule disclosed herein (e.g., the 39S antibody or a derivative thereof, or one of the bispecific anti-HER2 antibodies disclosed herein) conjugated to one or more tubulysin molecules (see structure of tubulysin A and tubulysin 1508 below).
Tubulysin A
Tubulysin 1508 (compound T32) [00284] Tubulysins are members of a class of natural products isolated from myxobacterial species (Sasse et al, J. Antibiot. 53:879-885 (2000)). As cytoskeleton interacting agents, tubulysins are mitotic poisons that inhibit tubulin polymerization and lead to cell cycle arrest and apoptosis (Steinmetz et al., Chem. Int. Ed. 43:4888-4892 (2004); Khalil et al, ChemBioChem. 7:678-683 (2006); Kaur et al, Biochem. J. 396: 235-242 (2006)). Tubulysins are extremely potent cytotoxic molecules, exceeding the cell growth inhibition of any clinically relevant traditional chemo therapeutic, e.g., epothilones, paclitaxel, and vinblastine. Furthermore, they are potent against multidrug resistant cell lines (Domling et al, Mol. Diversity 9: 141-147 (2005)). These compounds show high cytotoxicity tested against a panel of cancer cell lines with IC50 values in the low picomolar range; thus, they are of interest as anticancer therapeutics. See, e.g., WO2012019123, which is herein incorporated by reference in its entirety. Tubulysin conjugates are disclosed, e.g., in U.S. Pat. No. 7,776,814.
[00285] In some aspects, the tubulysin molecule or derivative thereof is a prodrug.
IV.B Maytansine and Maytansinoids
[00286] In some aspects, the ADC comprises an anti-HER2 binding molecule disclosed herein (e.g., the 39S antibody or a derivative thereof, or one of the bispecific anti-HER2 antibodies disclosed herein) conjugated to one or more maytansinoid molecules.
[00287] Maytansinoids are mitotic inhibitors which act by inhibiting tubulin polymerization. Maytansine was first isolated from the east African shrub Maytenus serrata (U.S. Pat. No. 3,896,111). Subsequently, it was discovered that certain microbes also produce maytansinoids, such as maytansinol and C-3 maytansinol esters (U.S. Pat. No. 4,151,042). Synthetic maytansinol and derivatives and analogues thereof are disclosed, for example, in U.S. Pat. Nos. 4,137,230; 4,248,870; 4,256,746; 4,260,608; 4,265,814; 4,294,757; 4,307,016; 4,308,268; 4,308,269; 4,309,428; 4,313,946; 4,315,929; 4,317,821; 4,322,348; 4,331,598; 4,361,650; 4,364,866; 4,424,219; 4,450,254; 4,362,663; and 4,371,533.
[00288] Maytansinoid drug moieties are attractive drug moieties in antibody drug conjugates because they are: (i) relatively accessible to prepare by fermentation or chemical modification, derivatization of fermentation products, (ii) amenable to derivatization with functional groups suitable for conjugation through the non-disulfide linkers to antibodies, (iii) stable in plasma, and (iv) effective against a variety of tumor cell lines. Immunoconjugates containing maytansinoids, methods of making same, and their therapeutic use are disclosed, for example, in U.S. Pat. Nos. 5,208,020, 5,416,064 and European Patent EP0425235B1; Liu et al, Proc. Natl. Acad. Sci. USA 93:8618-8623 (1996) (described immunoconjugates comprising a maytansinoid designated DM1); and Chari et al, Cancer Research 52: 127-131 (1992).
[00289] Trastuzumab emtansine (ado-trastuzumab emtansine, T-DM1, trade name
KADCYLA®) is an antibody-drug conjugate consisting of the monoclonal antibody trastuzumab (HE CEPTIN®) conjugated to the maytansinoid mertansine (DM1). See, e.g., LoRusso et al, Clin. Cancer Res. 20:6437-47 (2011), which is herein incorporated by reference in its entirety. An engineered thio-Trastuzumab-DMl ADC has also been described in Junutual et al., Clin, Cancer Res. 16:4769-78 (2010), which is herein incorporated by reference in its entirety.
[00290] Antibody-maytansinoid conjugates are prepared by chemically linking an antibody to a maytansinoid molecule without significantly diminishing the biological activity of either the antibody or the maytansinoid molecule. See, e.g., U.S. Pat. No. 5,208,020. An average of 3-4 maytansinoid molecules conjugated per antibody molecule has shown efficacy in enhancing cytotoxicity of target cells without negatively affecting the function or solubility of the antibody, although even one molecule of toxin/antibody would be expected to enhance cytotoxicity over the use of naked antibody. Maytansinoids are well known in the art and can be synthesized by known techniques or isolated from natural sources. Suitable maytansinoids are disclosed, for example, in U.S. Pat. No. 5,208,020.
[00291] In some aspects, the maytansinoid molecule, variant, or derivative thereof is a prodrug.
IV. C Auristatins and Dolastatins
[00292] In some aspects, the ADC comprises an anti-HER2 binding molecule disclosed herein {e.g., the 39S antibody or a derivative thereof, or one of the bispecific anti-HER2 antibodies disclosed herein) conjugated to dolastatins or dolostatin peptidic analogs and derivatives, the auristatins (U.S. Pat. Nos. 5,635,483; 5,780,588). Dolastatins and auristatins have been shown to interfere with microtubule dynamics, GTP hydrolysis, and nuclear and cellular division (Woyke et al., Antimicrob. Agents and Chemother. 45:3580-3584 (2001)) and have anticancer activity (U.S. Pat. No. 5,663,149). The dolastatin or auristatin drug moiety can be attached to the antibody through the N (amino) terminus or the C (carboxyl) terminus of the peptidic drug moiety (See, e.g., WO2002088172).
[00293] In some aspects, the auristatine or dolastatine molecule, variant, or derivative thereof is a prodrug.
IV.D Calicheamicin
[00294] In some aspects, the ADC comprises an anti-HER2 binding molecule disclosed herein (e.g., the 39S antibody or a derivative thereof, or one of the bispecific anti-HER2 antibodies disclosed herein) conjugated to one or more calicheamicin molecules. Members of the calicheamicin family of antibiotics are capable of producing double- stranded DNA breaks at sub-picomolar concentrations. The calicheamicins are a class of enediyne antibiotics derived from the bacterium Micromonospora echinospora, with calicheamicin γΐ being the most notable. Other calicheamicins are piBr, ylBr, a2I, a3I, βΐΐ, γΐΐ, and All. See Lee et al, Journal of Antibiotics 42(7): 1070-87 (1989). For the preparation of conjugates of the calicheamicin family, see U.S. Pat. Nos. 5,712,374, 5,714,586, 5,739,116, 5,767,285, 5,770,701, 5,770,710, 5,773,001, 5,877,296. Structural analogues of calicheamicin which can be used include, but are not limited to, γΐΐ, α2Ι, <x3I, N-acetyl-γΙΙ, PSAG and Θ11 (Hinman et al, Cancer Research 53:3336-3342 (1993), Lode et al., Cancer Research 58:2925-2928 (1998) and the aforementioned U.S. patents to American Cyanamid).
[00295] In some aspects, the calicheamicin molecule, variant, or derivative thereof is a prodrug.
IV.E Duocarmycins
[00296] In some aspects, the ADC comprises an anti-HER2 binding molecule disclosed herein (e.g., the 39S antibody or a derivative thereof, or one of the bispecific anti-HER2 antibodies disclosed herein) conjugated to one or more duocarmycin molecules.
Duocarmycins are members of a series of related natural products first isolated from
Streptomyces bacteria and they are potent antitumor antibiotics. See Boger. (1991).
Chemtracts: Organic Chemistry 4 (5): 329-349 (1991); Tercel et al., Chem. Int. Ed. Engl.
52(21):5442-6 (2013); Boger & Douglas, Proc. Natl. Acad. Sci. USA 92(9): 3642-3649
(1995); Cacciari et al, Expert Opinion on Therapeutic Patents 10(12): 1853-71 (2000).
[00297] Natural duocarmycins include duocarmycin A, duocarmycin Bl, duocarmycin
B2, duocarmycin CI, duocarmycin C2, duocarmycin D, duocarmycin SA, and CC-1065.
Synthetic analogs include adozelesin, bizelesin, and carzelesin (U-80244).
[00298] In some aspects, the duocarmycin molecule, variant, or derivative thereof is a prodrug.
IV.F Pyrrolobenzodiazepine
[00299] In some aspects, the drug is a pyrrolobenzodiazepine (PBD). PBDs are relatively small molecules and some have the ability to recognize and covalently bind to specific sequences in the minor groove of DNA and thus exhibit antibiotic/antitumor activity. A number of PBDs and derivatives thereof are known in the art, for example, PBD dimers (e.g., SJG-136 or SG2000), C2-unsaturated PBD dimers, pyrrolobenzodiazepine dimers bearing C2 aryl substitutions (e.g., SG2285), PBD dimer pro-drug that is activated by hydrolysis (e.g., SG2285), and polypyrrole-PBD (e.g., SG2274). PBDs are further described WO 2000/012507, WO 2007/039752, WO 2005/110423, WO 2005/085251, and WO 2005/040170, and U.S. Pat. No. 7,612,062, each of which is incorporated by reference herein in its entirety.
IV.G Other Cytotoxic Agents
[00300] In some aspects, the ADC comprises an anti-HER2 binding molecule disclosed herein (e.g., the 39S antibody or a derivative thereof, or one of the bispecific anti-HER2 antibodies disclosed herein) conjugated to other antitumor agents, for example, BCNU, anthracyclines (e.g., daunomycin or adriamycin), taxenes (e.g., paclitaxel), streptozoicin, Vinca alkaloids (e.g., vincristine), 5-fluorouracil, the family of agents known collectively as LL-E33288 complex (see U.S. Pat. Nos. 5,053,394, and 5,770,710), esperamicins (see U.S. Pat. No. 5,877,296), . The ADC can also comprise an anti-HER2 binding molecule disclosed herein (e.g., the 39S antibody or a derivative thereof, or one of the bispecific anti-HER2 antibodies disclosed herein) conjugated to enzymatically active toxins and fragments thereof which can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor, curcin, crotin, Saponaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin and the tricothecenes. See, for example, W0199321232. In some aspects, the cytotoxic agent is a light activated drug.
V. Anti-HER2 Binding Molecules that Bind to the Same Epitope as the 39S Antibody
[00301] In another aspect, the present disclosure provides anti-HER2 binding molecules that bind to the same epitope(s) as do the 39S antibody (e.g., antibodies derived from the 39S antibody or antigen-binding fragments thereof, bispecific anti-HER2 antibodies, or ADCs).
[00302] Such anti-HER2 binding molecules that bind to the same epitope as the 39S antibody can be identified based on their ability to cross-compete (e.g., to competitively inhibit the binding of, in a statistically significant manner) with the 39S antibody in standard HER2 binding assays. Accordingly, in one aspect, the instant disclosure provides anti-HER2 binding molecules (e.g., antibodies derived from the 39S antibody or antigen-binding fragments thereof, bispecific anti-HER2 antibodies, or ADCs) that compete for binding to HER2 with the 39S antibody antigen-binding fragments thereof. The ability of a test antibody to inhibit the binding of, e.g., the 39S antibody or binding molecules derived from the 39S antibody (e.g., bispecific antibodies or ADCs) demonstrates that the test antibody can compete with the 39S antibody for binding to HER2; such anti-HER2 binding molecule can, according to non-limiting theory, bind to the same or a related (e.g., a structurally similar or spatially proximal) epitope on HER2 as the 39S antibody or antigen-binding fragment thereof with which it competes.
[00303] In one aspect, the anti-HER2 molecule that binds to the same epitope on HER2 as the 39S antibody or binding molecules derived from the 39S antibody is a human monoclonal antibody or an antigen-binding fragment thereof, a bispecific anti-HER2 antibody (e.g., a bispecific antibody comprising two HER2 binding regions, at least one of which recognizes the same epitope as the 39S antibody), or an ADC (e.g., an ADC comprising at least one antigen-binding moiety recognizing the same epitope as the 39S; or an ADC comprising a bispecific antibody which comprises two HER2 binding regions, at least one of which recognizes the same epitope as the 39S antibody).
VI. Mechanisms of Action of anti-HER2 Binding Molecules
[00304] The present disclosure provides anti-HER2binding molecules (e.g., bispecific anti-HER2 antibodies, or ADCs) comprising a HER2-binding domain binding the same epitope as or derived from the 1.39.1 or 39S antibodies, wherein such anti-HER2-binding molecules induce internalization upon binding to the HER2 target. Also provided are anti-HER2 binding molecules (e.g., bispecific anti-HER2 antibodies, or ADCs) comprising a HER2-binding domain binding the same epitope as or derived from the 1.39.1 or 39S antibodies, wherein such anti-HER2-binding molecules promote effective lysosomal trafficking following internalization. The present disclosure also provides anti- HER2 binding molecules (e.g., bispecific anti-HER2 antibodies, or ADCs) comprising a HER2-binding domain binding the same epitope as or derived from the 1.39.1 or 39S antibodies, wherein such and-HER2-binding molecules induce HER2 target internalization and/or degradation.
[00305] In some aspects, an anti-HER2 binding molecule disclosed herein can reduce, block, or suppress HER2 phosphorylation. In other aspects, an anti-HER2 binding molecule disclosed herein can reduce, block, or suppress ligand-induced AKT phosphorylation. In some aspects, the anti-HER2 binding molecule can reduce, block, or suppress ligand-induced AKT phosphorylation in low HER2-expressing cancer cells.
[00306] In still other aspects, an anti-HER2 binding molecule, e.g. , an anti-HER2 antibody or antigen-binding fragment thereof disclosed in the instant application can reduce, disrupt, or suppress ligand-induced HER2-HER3 dimerization.
[00307] In some aspects, an ADC comprising an anti-HER2 binding molecule disclosed herein can inhibit cancer stem cell (CSC) sphere formation and/or proliferation. In some aspects, an anti-HER2 binding molecule disclosed herein exhibits a cytotoxic effect on CSCs. In some aspects, an ADC comprising an anti-HER2 binding molecule disclosed herein can inhibit tumor growth and/or induce tumor regression in tumors expressing low levels of HER2 (e.g.. +1 to +2 via HercepTest). In certain aspects, an ADC comprising an anti-HER2 binding molecule disclosed herein can inhibit tumor growth and/or induce tumor regression in tumors resistant to T-DM1.
[00308] In some aspects, an HER2 binding molecule, e.g., an anti-HER2 antibody or antigen-binding fragment thereof lacks ADCC activity. In specific aspects, an anti-HER2 binding molecule, e.g., an anti-HER2 antibody or antigen-binding fragment thereof can reduce or suppress HER2 phosphorylation, AKT phosphorylation, and/or tumor colony formation via a ligand-independent mechanism of action.
VII. Preparation of Anti-HER2 Binding Molecules
[00309] Anti-HER2 binding molecules of the present disclosure (for example, antibodies or antigen-binding fragments thereof which bind the same epitope as or are derived from the 1.39.1 or 39S antibodies, bispecific antibodies and ADCs comprising the same) can be prepared according to methods known in the art. For example, anti-HER2 binding molecules binding to the same epitope as the 39S antibody disclosed herein can be generated using hybridoma methods, such as those described by Kohler & Milstein (1975) Nature 256:495.
[00310] Using the hybridoma method, a mouse, hamster, or other appropriate host animal, is immunized as described above to elicit the production by lymphocytes of antibodies that will specifically bind to an immunizing antigen. Lymphocytes can also be immunized in vitro. Following immunization, the lymphocytes are isolated and fused with a suitable myeloma cell line using, for example, polyethylene glycol, to form hybridoma cells that can then be selected away from unfused lymphocytes and myeloma cells. Hybridomas that produce monoclonal antibodies directed specifically against a chosen antigen as determined by immunoprecipitation, immunoblotting, or by an in vitro binding assay (e.g. radioimmunoassay (RIA); enzyme-linked immunosorbent assay (ELISA)) can then be propagated either in in vitro culture using standard methods (Goding, Monoclonal Antibodies: Principles and Practice, Academic Press, 1986) or in vivo as ascites tumors in an animal. The monoclonal antibodies can then be purified from the culture medium or ascites fluid as described for polyclonal antibodies above. [00311] Anti-HER2 binding molecules of the present disclosure (for example, antibodies or antigen-binding fragments thereof which bind the same epitope as or are derived from the 1.39.1 or 39S antibodies, bispecific antibodies and ADCs comprising the same) can also be made using recombinant DNA methods as described in U.S. Pat. No. 4,816,567. The polynucleotides encoding a monoclonal antibody are isolated from mature B -cells or hybridoma cell, such as by RT-PCR using oligonucleotide primers that specifically amplify the genes encoding the heavy and light chains of the antibody, and their sequence is determined using conventional procedures. The isolated polynucleotides encoding the heavy and light chains are then cloned into suitable expression vectors, which when transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, monoclonal antibodies are generated by the host cells. Also, recombinant anti-HER2 monoclonal antibodies or molecules comprising antigen-binding fragments thereof of the desired species can be isolated from phage display libraries expressing CDRs of the desired species as described (McCafferty et ah, Nature 348:552-554 (1990); Clarkson et al, Nature 352:624-628 (1991); and Marks et al, J. Mol. Biol. 222:581-597 (1991)).
[00312] The polynucleotide(s) encoding an anti-HER2 binding molecule of the present disclosure (for example, antibodies or antigen-binding fragments thereof which bind the same epitope as or are derived from the 39S antibody, bispecific antibodies and ADCs comprising the same) can further be modified in a number of different manners using recombinant DNA technology to generate alternative anti-HER2 binding molecules. In some aspects, the constant domains of the light and heavy chains of, for example, a mouse monoclonal antibody can be substituted (1) for those regions of, for example, a human antibody to generate a chimeric antibody or (2) for a non-immunoglobulin polypeptide to generate a fusion antibody. In some aspects, the constant regions are truncated or removed to generate the desired antibody fragment of a monoclonal antibody. Site-directed or high-density mutagenesis of the variable region can be used to optimize specificity, affinity, etc. of a monoclonal antibody.
[00313] In certain aspects, the anti-HER2 binding molecule of the present disclosure is a human antibody or antigen-binding fragment thereof. Human antibodies can be directly prepared using various techniques known in the art. Immortalized human B lymphocytes immunized in vitro or isolated from an immunized individual that produce an antibody directed against a target antigen can be generated (See, e.g., Cole et al, Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boemer et al., J. Immunol. 147:86-95 (1991); and U.S. Pat. No. 5,750,373). One or more cDNAs encoding the antibody in the immortalized B lymphocyte can then be prepared and inserted into an expression vector and/or a heterologous host cell for expression of a non-naturally- occurring recombinant version of the antibody.
[00314] Also, the anti-HER2 human antibody or antigen-binding fragment thereof can be selected from a phage library, where that phage library expresses human antibodies or fragments thereof as fusion proteins with heterologous phage proteins, as described, for example, in Vaughan et al, Nat. Biotech. 14:309-314 (1996); Sheets et al, Proc. Natl. Acad. Sci. 95:6157-6162 (1998); Hoogenboom and Winter, J. Mol. Biol. 227:381 (1991), and Marks et al, J. Mol. Biol. 222:581 (1991)). Techniques for the generation and use of antibody phage libraries are also described in U.S. Pat. Nos. 5,969,108, 6,172,197, 5,885,793, 6,521,404; 6,544,731; 6,555,313; 6,582,915; 6,593,081; 6,300,064; 6,653,068; 6,706,484; and 7,264,963, each of which is incorporated by reference in its entirety.
[00315] Affinity maturation strategies and chain shuffling strategies (Marks et al,
BioTechnology 10:779-783 (1992), incorporated by reference in its entirety) are known in the art and can be employed to generate high affinity human antibodies or antigen- binding fragments thereof.
[00316] In some aspects, an anti-HER2 binding molecule of the present disclosure can be a humanized antibody. Methods for engineering, humanizing or resurfacing non-human or human antibodies can also be used and are well known in the art. A humanized, resurfaced or similarly engineered antibody can have one or more amino acid residues from a source that is non-human, e.g., but not limited to, mouse, rat, rabbit, non-human primate or other mammal. These non-human amino acid residues are replaced by residues that are often referred to as "import" residues, which are typically taken from an "import" variable, constant or other domain of a known human sequence. Such imported sequences can be used to reduce immunogenicity or reduce, enhance or modify binding, affinity, on- rate, off-rate, avidity, specificity, half-life, or any other suitable characteristic, as known in the art. In general, the CDR residues are directly and most substantially involved in influencing HER2 binding. Accordingly, part or all of the non-human or human CDR sequences are maintained while the non-human sequences of the variable and constant regions can be replaced with human or other amino acids. In certain aspects, human CDRs are inserted into non-human antibody scaffolds to make an antibody with reduced immunogenicity in an animal model system, e.g., a "murinized" antibody.
[00317] Anti-HER2 binding molecules, e.g., antibodies, can optionally be humanized, resurfaced, or engineered with retention of high affinity for the antigen HER2 and other favorable biological properties. To achieve this goal, humanized (or human) or engineered anti-HER2 antibodies and resurfaced antibodies can be optionally prepared by a process of analysis of the parental sequences and various conceptual humanized and engineered products using three-dimensional models of the parental, engineered, and humanized sequences. Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art.
[00318] Computer programs are available which illustrate and display probable three- dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen, such as HER2. In this way, framework residues can be selected and combined from the consensus and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen(s), is achieved.
[00319] Humanization, resurfacing or engineering of the anti-HER2 binding molecules disclosed herein can be performed using any known method, such as but not limited to those described in, Jones et al, Nature 321:522 (1986); Riechmann et al, Nature 332:323 (1988); Verhoeyen et al , Science 239: 1534 (1988)), Sims et al, J. Immunol. 151: 2296 (1993); Chothia and Lesk, J. Mol. Biol. 196:901 (1987), Carter et al, Proc. Natl. Acad. Sci. U.S.A. 89:4285 (1992); Presta et al, J. Immunol. 151:2623 (1993), U.S. Pat. Nos. 5,639,641, 5,723,323; 5,976,862; 5,824,514; 5,817,483; 5,814,476; 5,763,192; 5,723,323; 5,766,886; 5,714,352; 6,204,023; 6,180,370; 5,693,762; 5,530,101; 5,585,089; 5,225,539; 4,816,567, 7,557,189; 7,538,195; and 7,342,110; WO90/14443; WO90/14424; WO90/14430; and EP229246, each of which is entirely incorporated herein by reference, including the references cited therein.
[00320] In certain aspects an anti-HER2 antibody fragment is provided. Various techniques are known for the production of antibody fragments. Traditionally, these fragments are derived via proteolytic digestion of intact antibodies (for example Morimoto et al, J. Biochem. Biophy. Methods 24: 107-117 (1993); Brennan et al, Science, 229:81 (1985)). In certain aspects, anti-HER2 antibody fragments are produced recombinantly. Fab, Fv, and scFv antibody fragments can all be expressed in and secreted from E. coli or other host cells, thus allowing the production of large amounts of these fragments. Such anti-HER2 antibody fragments can also be isolated from the antibody phage libraries discussed above. The anti-HER2 antibody fragments can also be linear antibodies as described in U.S. Pat. No. 5,641,870. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner.
[00321] Techniques can be adapted for the production of single-chain antibodies specific to the same HER2 epitope as the 39S antibody (see, e.g., U.S. Pat. No. 4,946,778). In addition, methods can be adapted for the construction of Fab expression libraries (see, e.g., Huse et al, Science 246: 1275-1281 (1989)) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for HER2, or derivatives, fragments, analogs or homologs thereof. Antibody fragments can be produced by techniques in the art including, but not limited to: (a) a F(ab')2 fragment produced by pepsin digestion of an antibody molecule; (b) a Fab fragment generated by reducing the disulfide bridges of an F(ab')2 fragment, (c) a Fab fragment generated by the treatment of the antibody molecule with papain and a reducing agent, and (d) Fv fragments.
[00322] In some aspects, especially in the case of antibody fragments, an anti-HER2 antibody or antigen-binding fragment thereof can be modified in order to increase its serum half-life. This can be achieved, for example, by incorporation of a salvage receptor binding epitope into the antibody or antibody fragment by mutation of the appropriate region in the antibody or antibody fragment or by incorporating the epitope into a peptide tag that is then fused to the antibody or antibody fragment at either end or in the middle {e.g., by DNA or peptide synthesis), or by YTE mutation. Other methods to increase the serum half-life of an antibody or antigen-binding fragment thereof, e.g., conjugation to a heterologous molecule such as PEG are well known in the art.
[00323] Heteroconjugate anti-HER2 binding molecules, e.g., bispecific antibodies which bind the same epitope as or are derived from the 39S antibody disclosed herein or ADCs, can be prepared using recombinant biology technology as well as in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents. For example, bispecific antibodies or ADCs can be chemically constructed using a disulfide exchange reaction or by forming a thioether bond. Suitable reagents for this purpose are known in the art, and include iminothiolate and methyl-4- mercaptobutyrimidate.
[00324] It will be noted that in certain aspects, the anti-HER2 binding molecules can be engineered to fuse the CH3 domain directly to the hinge region of the respective modified antibodies or fragments thereof. In other constructs, a peptide spacer can be inserted between the hinge region and the modified CH2 and/or CH3 domains. For example, compatible constructs can be expressed wherein the CH2 domain has been deleted and the remaining CH3 domain (modified or unmodified) is joined to the hinge region with a 5-20 amino acid spacer. Such a spacer can be added, for instance, to ensure that the regulatory elements of the constant domain remain free and accessible or that the hinge region remains flexible. However, it should be noted that amino acid spacers can, in some cases, prove to be immunogenic and elicit an unwanted immune response against the construct. Accordingly, in certain aspects, any spacer added to the construct will be relatively non-immunogenic, or even omitted altogether, so as to maintain the desired biochemical qualities of the modified antibodies.
[00325] Besides the deletion of whole constant region domains, it will be appreciated that the anti-HER2 binding molecule can be provided by the partial deletion or substitution of a few or even a single amino acid. For example, the mutation of a single amino acid in selected areas of the CH2 domain can be enough to substantially reduce Fc binding and thereby increase tumor localization. Moreover, as alluded to above, the constant regions of the disclosed anti-HER2 binding molecule can be modified through the mutation or substitution of one or more amino acids that enhances the profile of the resulting construct. In this respect it is possible to disrupt the activity provided by a conserved binding site (e.g. , Fc binding) while substantially maintaining the configuration and immunogenic profile of the modified antibody or antigen-binding fragment thereof. Certain aspects can comprise the addition of one or more amino acids to the constant region to enhance desirable characteristics such as decreasing or increasing effector function or provide for more cytotoxin or carbohydrate attachment. In such aspects, specific sequences derived from selected constant region domains can be inserted or replicated.
VIII. Polynucleotides Encoding HER2-Binding Molecules
[00326] In certain aspects, the present disclosure provides polynucleotides comprising nucleic acid sequences that encode an anti-HER2 binding molecule disclosed herein that specifically binds HER2. For example, the instant disclosure provides a polynucleotide comprising a nucleic acid sequence that encodes an anti-HER2 binding molecule such as an antibody or a fragment thereof (e.g., a molecule which binds the same epitope as or is derived from the 39S antibody). The polynucleotides of the instant disclosure can be in the form of RNA or in the form of DNA. DNA includes cDNA, genomic DNA, and synthetic DNA; and can be double- stranded or single- stranded, and if single stranded can be the coding strand or non-coding (anti-sense) strand. In certain aspects the DNA is a cDNA that is used to produce a non-naturally-occurring recombinant antibody.
[00327] In certain aspects, the polynucleotides are isolated. In certain aspects, the polynucleotides are substantially pure. In certain aspects the polynucleotides comprise the coding sequence for the mature polypeptide fused in the same reading frame to a polynucleotide (either natural or heterologous) which aids, for example, in expression and secretion of a polypeptide from a host cell (e.g. , a leader sequence which functions as a secretory sequence for controlling transport of a polypeptide from the cell). The polypeptide having a leader sequence is a preprotein and can have the leader sequence cleaved by the host cell to form the mature form of the polypeptide. The polynucleotides can also encode for an anti-HER2 binding molecule proprotein which is the mature protein plus additional 5' amino acid residues. In certain aspects, the polynucleotides are altered to optimize codon usage for a certain host cell.
[00328] In certain aspects the polynucleotides comprise the coding sequence for the mature anti-HER2 binding molecule, e.g. , an anti-HER2 antibody or an antigen-binding fragment thereof fused in the same reading frame to a heterologous marker sequence that allows, for example, for purification of the encoded polypeptide. For example, the marker sequence can be a hexa-histidine (His6) tag supplied, for example, by a pQE-9 vector to provide for purification of the mature polypeptide fused to the marker in the case of a bacterial host. In other aspects, the marker sequence can be a hemagglutinin (HA) tag derived, for example, from the influenza hemagglutinin protein, when a mammalian host (e.g., COS-7 cells) is used.
[00329] The present disclosure further relates to variants of the described polynucleotides encoding, for example, HER2-binding fragments, analogs, and derivatives of the anti- HER2 binding molecules of the present disclosure.
[00330] The polynucleotide variants can contain alterations in the coding regions, non- coding regions, or both. In some aspects the polynucleotide variants contain alterations which produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded polypeptide. In some aspects, nucleotide variants are produced by silent substitutions due to the degeneracy of the genetic code. Polynucleotide variants can be produced for a variety of reasons, e.g., to optimize codon expression for a particular host (change codons in the human mRNA to those preferred by a bacterial host such as E. coli). Vectors and cells comprising the polynucleotides described herein are also provided.
[00331] In some aspects a DNA sequence encoding an anti-HER2 binding molecule, e.g., an anti-HER2 antibody or an antigen-binding fragment thereof can be constructed by chemical synthesis, for example, using an oligonucleotide synthesizer. Such oligonucleotides can be designed based on the amino acid sequence of the desired polypeptide and selecting those codons that are favored in the host cell in which the recombinant polypeptide of interest will be produced. Standard methods can be applied to synthesize an isolated polynucleotide sequence encoding an isolated polypeptide of interest. For example, a complete amino acid sequence can be used to construct a back- translated gene. Further, a DNA oligomer containing a nucleotide sequence coding for the particular isolated polypeptide can be synthesized. For example, several small oligonucleotides coding for portions of the desired polypeptide can be synthesized and then ligated. The individual oligonucleotides typically contain 5' or 3' overhangs for complementary assembly.
[00332] Once assembled (by synthesis, site-directed mutagenesis or another method), the polynucleotide sequences encoding a particular isolated polypeptide of interest will be inserted into an expression vector and operatively linked to an expression control sequence appropriate for expression of the protein in a desired host. Proper assembly can be confirmed, for example, by nucleotide sequencing, restriction mapping, and expression of a biologically active polypeptide in a suitable host. As is well known in the art, in order to obtain high expression levels of a transfected gene in a host, the gene must be operatively linked to transcriptional and translational expression control sequences that are functional in the chosen expression host.
[00333] In certain aspects, recombinant expression vectors are used to amplify and express
DNA encoding anti-HER2 binding molecules. Recombinant expression vectors are replicable DNA constructs which have synthetic or cDNA-derived DNA fragments encoding, for example, a polypeptide chain of an anti-HER2 antibody or and antigen- binding fragment thereof, operatively linked to suitable transcriptional or translational regulatory elements derived from mammalian, microbial, viral or insect genes. A transcriptional unit generally comprises an assembly of (1) a genetic element or elements having a regulatory role in gene expression, for example, transcriptional promoters or enhancers, (2) a structural or coding sequence which is transcribed into mRNA and translated into protein, and (3) appropriate transcription and translation initiation and termination sequences, as described in detail below. Such regulatory elements can include an operator sequence to control transcription.
[00334] The ability to replicate in a host, usually conferred by an origin of replication, and a selection gene to facilitate recognition of transformants can additionally be incorporated. DNA regions are operatively linked when they are functionally related to each other. For example, DNA for a signal peptide (secretory leader) is operatively linked to DNA for a polypeptide if it is expressed as a precursor which participates in the secretion of the polypeptide; a promoter is operatively linked to a coding sequence if it controls the transcription of the sequence; or a ribosome binding site is operatively linked to a coding sequence if it is positioned so as to permit translation. Structural elements intended for use in yeast expression systems include a leader sequence enabling extracellular secretion of translated protein by a host cell. Alternatively, where recombinant protein is expressed without a leader or transport sequence, it can include an N-terminal methionine residue. This residue can optionally be subsequently cleaved from the expressed recombinant protein to provide a final product.
[00335] The choice of expression control sequence and expression vector will depend upon the choice of host. A wide variety of expression host/vector combinations can be employed. Useful expression vectors for eukaryotic hosts, include, for example, vectors comprising expression control sequences from SV40, bovine papilloma virus, adenovirus and cytomegalovirus. Useful expression vectors for bacterial hosts include known bacterial plasmids, such as plasmids from E. coli, including pCR 1, pBR322, pMB9 and their derivatives, wider host range plasmids, such as Ml 3 and filamentous single- stranded DNA phages.
[00336] Suitable host cells for expression of anti-HER2 binding molecules, e.g., anti-
HER2 antibodies or antigen-binding fragments thereof, include prokaryotes, yeast, insect or higher eukaryotic cells under the control of appropriate promoters. Prokaryotes include gram negative or gram positive organisms, for example E. coli or bacilli. Higher eukaryotic cells include established cell lines of mammalian origin as described below. Cell-free translation systems could also be employed. Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are described by Pouwels et al. (Cloning Vectors: A Laboratory Manual, Elsevier, N.Y., 1985), the relevant disclosure of which is hereby incorporated by reference.
[00337] Additional information regarding methods of protein production, including antibody production, can be found, e.g., in U.S. Publ. No. 2008/0187954, U.S. Patent Nos. 6,413,746 and 6,660,501, and Int'l Pat. Publ. No. WO 04009823, each of which is hereby incorporated by reference in its entirety.
[00338] Various mammalian or insect cell culture systems can also be advantageously employed to express recombinant anti-HER2 binding molecules, e.g., anti-HER2 antibodies or antigen-binding fragments thereof. Expression of recombinant proteins in mammalian cells can be performed because such proteins are generally correctly folded, appropriately modified and completely functional. Examples of suitable mammalian host cell lines include HEK-293 and HEK-293T, the COS-7 lines of monkey kidney cells, described by Gluzman (Cell 23: 175, 1981), and other cell lines including, for example, L cells, C127, 3T3, Chinese hamster ovary (CHO), NSO, HeLa, and BHK cell lines. Mammalian expression vectors can comprise nontranscribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5' or 3' flanking nontranscribed sequences, and 5' or 3' nontranslated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences. Baculovirus systems for production of heterologous proteins in insect cells are reviewed by Luckow & Summers, BioTechnology 6:47 (1988).
[00339] Anti-HER2 binding molecules, e.g. , anti-HER2 antibodies or antigen-binding fragments thereof, produced by a transformed host can be purified according to any suitable method. Such standard methods include, for example, chromatography (e.g., ion exchange, affinity and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for protein purification. Affinity tags such as hexahistidine, maltose binding domain, influenza coat sequence, glutathione- S- transferase, etc., can be attached to the protein to allow easy purification by passage over an appropriate affinity column. Isolated proteins can also be physically characterized using, for example, proteolysis, nuclear magnetic resonance or x-ray crystallography.
[00340] For example, supernatants from systems which secrete recombinant protein into culture media can be first concentrated using a commercially available protein concentration filter, for example, an AMICON® or Millipore PELLICON® ultrafiltration unit. Following the concentration step, the concentrate can be applied to a suitable purification matrix. Alternatively, an anion exchange resin can be employed, for example, a matrix or substrate having pendant diethylaminoethyl (DEAE) groups. The matrices can be acrylamide, agarose, dextran, cellulose or other types commonly employed in protein purification. Alternatively, a cation exchange step can be employed.
[00341] Suitable cation exchangers include various insoluble matrices comprising sulfopropyl or carboxymethyl groups. Finally, one or more reversed-phase high performance liquid chromatography (RP-HPLC) steps employing hydrophobic RP-HPLC media, e.g. , silica gel having pendant methyl or other aliphatic groups, can be employed to further purify an HER2-binding molecule. Some or all of the foregoing purification steps, in various combinations, can also be employed to provide a homogeneous recombinant protein.
[00342] A recombinant anti-HER2 binding molecule, e.g. , an anti-HER2 antibody or antigen-binding fragment thereof, produced in bacterial culture can be isolated, for example, by initial extraction from cell pellets, followed by one or more concentration, salting-out, aqueous ion exchange or size exclusion chromatography steps. High performance liquid chromatography (HPLC) can be employed for final purification steps. Microbial cells employed in expression of a recombinant protein can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents.
[00343] Methods known in the art for purifying antibodies and other proteins also include, for example, those described in U.S. Pat. Publ. Nos. US20080312425, US20080177048, and US20090187005, each of which is hereby incorporated by reference in its entirety.
IX. Treatment Methods Using Therapeutic Anti-HER2 Binding Molecules
[00344] The present disclosure also provides methods directed to the use of anti-HER2 binding molecules, e.g. , antibodies, including antigen-binding fragments, variants, and derivatives thereof, to treat patients having a disease associated with HER2 expression or HER2-expressing cells.
[00345] By "HER2-expressing cell" is meant a cell expressing the HER2 protein. Methods for detecting and/or quantitating HER2 expression in cells are well known in the art and include, but are not limited to, PCR techniques, immunohistochemistry (e.g., HE CEPTEST™), flow cytometry, Western blot, ELISA, and the like. In some aspects, the methods disclosed herein are applied to treatment and diagnostic method where the cancer cells are expressing HER2 at low levels.
[00346] The methods for diagnosis and treatment of various diseases and disorders with an anti-HER2 binding molecule disclosed herein, refer to anti-HER2 antibodies (e.g., the 39S antibody, variants, derivatives, and HER2 -binding fragments; bispecific anti-HER2 molecules of the instant disclosure; and ADC molecules of the instant disclosure) that retain the desired properties of the anti-HER2 binding molecules of the instant disclosure, e.g. , capable of specifically binding HER2 and neutralizing HER2 activity. [00347] In some aspects, the anti-HER2 binding molecules are human or humanized anti-
HER2 binding molecules that mediate human ADCC; or comprise known anti-HER2 antibodies that mediate ADCC; or comprise anti-HER2 binding molecules that are engineered such that they mediate ADCC.
[00348] In some aspects, the anti-HER2 binding molecules are human or humanized anti-
HER2 binding molecules that do not mediate human ADCC; or comprise known anti- HER2 antibodies that do not mediate ADCC; or comprise anti-HER2 binding molecules that are engineered such that they do not mediate ADCC.
[00349] In one aspect, treatment includes the application or administration of an anti-
HER2 binding molecule, e.g., an antibody or antigen binding fragment, variant, or derivative thereof of the current disclosure to a subject or patient, or application or administration of the anti-HER2 binding molecule to an isolated tissue or cell line from a subject or patient, where the subject or patient has a disease, a symptom of a disease, or a predisposition toward a disease. In another aspect, treatment is also intended to include the application or administration of a pharmaceutical composition comprising the anti- HER2 binding molecule, e.g., an antibody or antigen binding fragment, variant, or derivative thereof of the current disclosure to a subject or patient, or application or administration of a pharmaceutical composition comprising the anti-HER2 binding molecule to an isolated tissue or cell line from a subject or patient, who has a disease, a symptom of a disease, or a predisposition toward a disease.
[00350] The anti-HER2 binding molecules, e.g., antibodies or antigen-binding fragments, variants, or derivatives thereof of the present disclosure are useful for the treatment of various cancers. In one aspect, the instant disclosure relates to anti-HER2 binding molecules, e.g., antibodies or antigen-binding fragments, variants, or derivatives thereof for use as a medicament, in particular for use in the treatment or prophylaxis of cancer. Examples of cancer include, but are not limited to breast cancer, colon cancer, lung cancer, gastric cancer, head and neck squamous cells cancer, melanoma, pancreatic cancer, or prostate cancer. In some specific cases, the cancer expresses low levels of HER2 as determined, for example, via HE CEPTEST™.
[00351] In accordance with the methods of the present disclosure, at least one anti-HER2 binding molecule, e.g., an antibody or antigen binding fragment, variant, or derivative thereof as defined elsewhere herein is used to promote a positive therapeutic response with respect to cancer. The term "positive therapeutic response" with respect to cancer treatment refers to an improvement in the disease in association with the activity of these anti-HER2 binding molecules, e.g., antibodies or antigen-binding fragments, variants, or derivatives thereof, and/or an improvement in the symptoms associated with the disease.
[00352] For example, an improvement in the disease can be characterized as a complete response. The term "complete response" refers to an absence of clinically detectable disease with normalization of any previously test results. Alternatively, an improvement in the disease can be categorized as being a partial response. A "positive therapeutic response" encompasses a reduction or inhibition of the progression and/or duration of cancer, the reduction or amelioration of the severity of cancer, and/or the amelioration of one or more symptoms thereof resulting from the administration of an anti-HER2 binding molecule of the instant disclosure.
[00353] In specific aspects, such terms refer to one, two or three or more results following the administration of anti-HER2 binding molecules of the instant disclosure:
(1) a stabilization, reduction or elimination of the cancer cell population;
(2) a stabilization or reduction in cancer growth;
(3) an impairment in the formation of cancer;
(4) eradication, removal, or control of primary, regional and/or metastatic cancer;
(5) a reduction in mortality;
(6) an increase in disease-free, relapse-free, progression-free, and/or overall survival, duration, or rate;
(7) an increase in the response rate, the durability of response, or number of patients who respond or are in remission;
(8) a decrease in hospitalization rate,
(9) a decrease in hospitalization lengths,
(10) the size of the cancer (e.g., in volume) is maintained and does not increase or increases by less than 10%, preferably less than 5%, preferably less than 4%, preferably less than 2%, and
(11) an increase in the number of patients in remission. (12) a decrease in the number of adjuvant therapies (e.g., chemotherapy or hormonal therapy) that would otherwise be required to treat the cancer.
[00354] Clinical response can be assessed using screening techniques such as PET, magnetic resonance imaging (MRI) scan, x-radiographic imaging, computed tomographic (CT) scan, flow cytometry or fluorescence-activated cell sorter (FACS) analysis, histology, gross pathology, and blood chemistry, including but not limited to changes detectable by ELISA, RIA, chromatography, and the like. In addition to these positive therapeutic responses, the subject undergoing therapy with the anti-HER2 binding molecule, e.g. , an antibody or antigen-binding fragment, variant, or derivative thereof, can experience the beneficial effect of an improvement in the symptoms associated with the disease.
[00355] The anti-HER2 binding molecules, e.g. , antibodies or antigen-binding fragments, variants, or derivatives thereof of the instant disclosure can be used in combination with any known therapies for cancer, including any agent or combination of agents that are known to be useful, or which have been used or are currently in use, for treatment of cancer, e.g. , colon cancer, lung cancer, gastric cancer, head and neck squamous cells cancer, and breast cancer. The second agent or combination of agents of the pharmaceutical combination formulation or dosing regimen preferably has complementary activities to anti-HER2 binding molecule(s) of the instant disclosure such that they do not adversely affect each other.
[00356] Anticancer agents include drugs used to treat malignancies, such as cancerous growths. Drug therapy can be used alone, or in combination with other treatments such as surgery or radiation therapy. Several classes of drugs can be used in cancer treatment, depending on the nature of the organ involved. For example, breast cancers are commonly stimulated by estrogens, and can be treated with drugs which inactive the sex hormones. Similarly, prostate cancer can be treated with drugs that inactivate androgens, the male sex hormone.
[00357] Anti-cancer agents for use in certain methods of the present disclosure include, among others, antibodies (e.g. , antibodies which bind IGF- IR, antibodies which bind EGFR, antibodies which bind HER2 or HER3), small molecules targeting IGFIR, small molecules targeting EGFR, small molecules targeting HER2, antimetabolites, alkylating agents, topoisomerase inhibitors, microtubule targeting agents, kinase inhibitors, protein synthesis inhibitors, immunotherapeutic agents, hormonal therapies, glucocorticoids, aromatase inhibitors, mTOR inhibitors, chemotherapeutic agents, protein kinase B inhibitors, phosphatidylinositol 3-kinase (PI3K) inhibitors, cyclin dependent kinase (CDK) inhibitors, RLr9, CD289, enzyme inhibitors, anti-TRAIL, MEK inhibitors, etc.
[00358] In specific aspects, the anti-HER2 binding molecules disclosed herein, e.g., antibodies or antigen-binding fragments thereof, can be administered in combination with other antibodies or antibody fragments targeting epidermal growth factor receptor (EGFR), e.g. Erbitux® (cetuximab) or panitumumab (VECTIBIX®).
[00359] In other aspects, the anti-HER2 binding molecules disclosed herein can be administered in combination with kinase inhibitors, e.g., tyrosine kinase inhibitors. In some other specific aspects, the anti-HER2 binding molecules disclosed herein can be administered in combination with inhibitors of the tyrosine kinase activity associated with EGFR and/or HER2/neu, e.g., lapatinib. In some aspects, the anti-HER2 binding molecules of the instant disclosure can be administered in combination with antimitotic agents. In some specific aspects, the anti-HER2 binding molecules of the instant disclosure can be administered in combination with agents that stabilize the mitotic spindle microtubule assembly, e.g., paclitaxel or docetaxel.
[00360] Where the combined therapies comprise administration of an anti-HER2 binding molecule in combination with administration of another therapeutic agent, the methods of the instant disclosure encompass co-administration, using separate formulations or a single pharmaceutical formulation, and consecutive administration in either order. In some aspects, the anti-HER2 binding molecules described herein are administered in combination with other drugs, wherein the antibody or antigen-binding fragment, variant, or derivative thereof and the therapeutic agent(s) can be administered sequentially, in either order, or simultaneously (i.e., concurrently or within the same time frame).
[00361] The combination therapy can provide "synergy" and prove "synergistic", i.e., the effect achieved when the active ingredients used together is greater than the sum of the effects that results from using the compounds separately. A synergistic effect can be attained when the active ingredients are: (1) co-formulated and administered or delivered simultaneously in a combined, unit dosage formulation; (2) delivered by alternation or in parallel as separate formulations; or (3) by some other regimen. When delivered in alternation therapy, a synergistic effect can be attained when the compounds are administered or delivered sequentially, e.g., by different injections in separate syringes. In general, during alternation therapy, an effective dosage of each active ingredient is administered sequentially, i.e., serially, whereas in combination therapy, effective dosages of two or more active ingredients are administered together.
[00362] In some aspects, the anti-HER2 binding molecule, e.g., an anti-HER2 antibody or antigen binding fragment thereof of the instant disclosure, can be administered in a synergistic combination with a growth factor receptor (EGFR) inhibitor. In some aspects, the EGFR inhibitor is an antibody. In specific aspects, the EGFR inhibitor antibody is E BITUX® (cetuximab) or VECTIBIX® (panitumumab). In specific aspects, the anti-HER2 binding molecules of the instant disclosure, e.g., antibodies or antigen-binding fragments thereof, can be administered in a synergistic combination with inhibitors of the tyrosine kinase activity associated with EGFR and/or HER2/neu, e.g., lapatinib. In some aspects, the anti-HER2 binding molecules of the instant disclosure can be administered in a synergistic combination with an antimitotic agent. In some specific aspects the antimitotic agent stabilizes the mitotic spindle microtubule assembly. In some specific aspects, the antimitotic agent is paclitaxel or docetaxel.
[00363] A further aspect is the use of anti-HER2 binding molecules of the instant disclosure, e.g., antibodies or antigen-binding fragments, variants, or derivatives thereof, for diagnostic monitoring of protein levels in tissue as part of a clinical testing procedure, e.g., to determine the efficacy of a given treatment regimen. For example, detection can be facilitated by coupling the antibody to a detectable substance. Examples of detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, β-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin; and examples of suitable radioactive material include 125 I, 131 I, 35 S, or 3 H.
[00364] A further aspect is the use of anti-HER2 binding molecules of the instant disclosure, e.g., antibodies or antigen-binding fragments, variants, or derivatives thereof, to treat a cancer patient resistant to a HER2-targeting therapeutic agent, for example an antibody targeting an epitope within domain IV of HER2 such as trastuzumab. In some aspects, the therapeutic agent comprises a moiety targeting the same epitope as trastuzumab, and a cytotoxic moiety. In some aspects, such cytotoxic moiety is a maytansinoid. In some specific aspects, the maytansinoid is DM-1.
[00365] In some aspects, the methods of treatment disclosed herein comprise the administration of an anti-HER2 binding molecule which is an anti-HER2 antibody comprising a heavy chain (HC) variable region (VH) and a light chain (LC) variable region (VL) comprising:
(i) a variable heavy chain CDR-1 (VH-CDR1) identical to SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions;
(ii) a variable heavy chain CDR-2 (VH-CDR2) identical to SEQ ID NO: 2 or identical to SEQ ID NO: 2 except for up to 1, 2, 3, or 4 amino acid substitutions;
(iii) a variable heavy chain CDR-3 (VH-CDR3) identical to SEQ ID NO: 3 or identical to SEQ ID NO: 3 except for up to 1, 2, 3, or 4 amino acid substitutions;
(iv) a variable light chain CDR-1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions;
(v) a variable light chain CDR-2 (VL-CDR2) identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1, 2, 3, or 4 amino acid substitutions; and,
(vi) a variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions.
[00366] In some aspects, the methods of treatment disclosed herein comprise the administration of an anti-HER2 binding molecule which is a bispecific anti-HER2 antibody comprising a first immunoglobulin antigen-binding domain and a second immunoglobulin antigen-binding domain, wherein (i) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 antibody binding sites, (ii) the first immunoglobulin antigen-binding domain binds to a first HER2 antibody binding site which comprises an epitope within domain II of HER2, and (iii) the first HER2 antibody binding site is distinct from the antibody binding site of pertuzumab.
[00367] In some aspects, the methods of treatment disclosed herein comprise the administration of an anti-HER2 binding molecule which is a bispecific anti-HER2 antibody comprising a first immunoglobulin antigen-binding domain and a second immunoglobulin antigen-binding domain, wherein the first immunoglobulin antigen- binding domain comprises a heavy chain (HC) variable region (VH) and a light chain (LC) variable region (VL) comprising:
(i) a variable heavy chain CDR-1 (VH-CDR1) identical to SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions;
(ii) a variable heavy chain CDR-2 (VH-CDR2) identical to SEQ ID NO: 2 or identical to SEQ ID NO: 2 except for up to 1, 2, 3, or 4 amino acid substitutions;
(iii) a variable heavy chain CDR-3 (VH-CDR3) identical to SEQ ID NO: 3 or identical to SEQ ID NO: 3 except for up to 1, 2, 3, or 4 amino acid substitutions;
(iv) a variable light chain CDR-1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions;
(v) a variable light chain CDR-2 (VL-CDR2) identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1, 2, 3, or 4 amino acid substitutions; and,
(vi) a variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions.
[00368] In some aspects, the first immunoglobulin antigen-binding domain of such anti-
HER2 binding molecule comprises at least one heterologous variable domain framework region (FW) different relative to the FW regions of an immunoglobulin antigen-binding domain comprising a VH comprising the amino acids SEQ ID NO:43 and a VL comprising the amino acids of SEQ ID NO:44. In some aspects, the first immunoglobulin antigen -binding domain comprises:
(i) a variable light chain framework 1 (VL-FW1) comprising the amino acids of SEQ ID NO: l l;
(ii) a VL-FW2 comprising the amino acids of SEQ ID NO: 12;
(iii) a VL-FW3 comprising the amino acids of SEQ ID NO: 13;
(iv) a VL-FW4 comprising the amino acids of SEQ ID NO: 14; or (vi) any combination thereof.
[00369] In some aspects, the first immunoglobulin antigen-binding domain of such anti-
HER2 binding molecule comprises a VH and a VL, wherein the VH comprises the amino acids of SEQ ID NO: 15 or 43; and wherein the first and second immunoglobulin antigen- binding domains specifically bind to distinct HER2 epitopes. In some aspects, the first immunoglobulin antigen-binding domain of such anti-HER2 binding molecule a VH and a VL, wherein the VL comprises the amino acids of SEQ ID NO: 16 or 44; and wherein the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes. In some aspects, the first immunoglobulin antigen-binding domain of such anti-HER2 binding molecule comprises a VH and a VL, wherein the VH comprises the amino acids of SEQ ID NO: 15; and wherein the VL comprises the amino acids of SEQ ID NO: 16.
[00370] In some aspects, the second immunoglobulin antigen-binding domain of such anti-HER2 binding molecule (a) specifically binds to the same HER2 epitope as the trastuzumab antibody; and/or (b) competitively inhibits HER2 binding by the trastuzumab antibody; and/or (c) comprises at least one, at least two, at least three, at least four, at least five, or at least six complementarity determining regions (CDRs) comprising the amino acids of any one of SEQ ID NOs: 54 to 59. In some aspects, the second immunoglobulin antigen-binding domain of such anti-HER2 binding molecule is an scFv comprising (i) a VH-CDR1 comprising the amino acids of SEQ ID NO:54; (ii) a VH-CDR2 comprising the amino acids of SEQ ID NO:55; (iii) a VH-CDR3 comprising the amino acids of SEQ ID NO:56; (iv) a VL-CDR1 comprising the amino acids of SEQ ID NO:57; (v) a VL-CDR2 comprising the amino acids of SEQ ID NO:58; and (vi) a VL- CDR3 comprising the amino acids of SEQ ID NO:59.
[00371] In other aspects, the methods of treatment disclosed herein comprise the administration of an anti-HER2 binding molecule which is an ADC comprising a bispecific anti-HER2 antibody, wherein said antibody comprises:
(i) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO: 32A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid at position 239, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(ii) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:33A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to cysteine amino acids respectively located at positions 239 and 442 wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(iii) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:36A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid at position 239, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(iv) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO: 37 A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to cysteine amino acids respectively located at positions 239 and 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(v) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:40A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid at position 239, wherein the amino acid position numbering is according to the EU index as set forth in Kabat; or,
(vi) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:41A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to cysteine amino acids respectively located at positions 239 and 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
In other aspects, the methods of treatment disclosed herein comprise the administration of an anti-HER2 binding molecule which is an ADC comprising a bispecific anti-HER2 antibody, wherein said antibody comprises:
(i) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:32C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(ii) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:3C3 and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442 wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(iii) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:36C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(iv) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:37C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat; (v) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:40C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety (e.g., a tubulysin 1508 molecule) covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat; or,
(vi) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO: 67 and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties (e.g., two tubulysin 1508 molecules) covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
X. Pharmaceutical Compositions and Administration Methods
[00373] Methods of preparing and administering anti-HER2 binding molecules, e.g., antibodies, or antigen-binding fragments, variants, or derivatives thereof (e.g., an ADC such as Bs2-4T), to a subject in need thereof are well known to or are readily determined by those skilled in the art. The route of administration of the anti-HER2 binding molecule, e.g., antibody, or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T), can be, e.g., oral, parenteral, by inhalation or topical. The term parenteral as used herein includes, e.g., intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, rectal, or vaginal administration. However, in other methods compatible with the teachings herein, anti-HER2 binding molecules, e.g., antibodies, or antigen-binding fragments, variants, or derivatives thereof (e.g., an ADC such as Bs2-4T), of the instant disclosure can be delivered directly to the site of the adverse cellular population thereby increasing the exposure of the diseased tissue to the therapeutic agent.
[00374] As discussed herein, anti-HER2 binding molecules of the instant disclosure, e.g., antibodies, or antigen-binding fragments, variants, or derivatives thereof (e.g., an ADC such as Bs2-4T), can be administered in a pharmaceutically effective amount for the in vivo treatment of HER2-expressing cell-mediated diseases such as certain types of cancers. The pharmaceutical compositions can comprise pharmaceutically acceptable carriers, including, e.g. , water, ion exchangers, proteins, buffer substances, and salts. Preservatives and other additives can also be present. The carrier can be a solvent or dispersion medium. Suitable formulations for use in the therapeutic methods disclosed herein are described in Remington's Pharmaceutical Sciences (Mack Publishing Co.) 16th ed. (1980).
[00375] In any case, sterile injectable solutions can be prepared by incorporating an active compound (e.g., an anti-HER2 antibody, or antigen-binding fragment, variant, or derivative thereof, e.g., an ADC such as Bs2-4T, by itself or in combination with other active agents) in the required amount in an appropriate solvent followed by filtered sterilization. Further, the preparations can be packaged and sold in the form of a kit. Such articles of manufacture can have labels or package inserts indicating that the associated compositions are useful for treating a subject suffering from, or predisposed to a disease or disorder.
[00376] Parenteral formulations can be a single bolus dose, an infusion or a loading bolus dose followed with a maintenance dose. These compositions can be administered at specific fixed or variable intervals, e.g., once a day, or on an "as needed" basis.
[00377] The composition can be administered as a single dose, multiple doses or over an established period of time in an infusion. Dosage regimens also can be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response).
[00378] Therapeutically effective doses of the compositions of the present disclosure, for treatment of HER2-expressing cell-mediated diseases such as certain types of cancers including e.g. , colon cancer, lung cancer, gastric cancer, head and neck squamous cells cancer, melanoma, pancreatic cancer, prostate cancer, and breast cancer, vary depending upon many different factors, including means of administration, target site, physiological state of the patient, whether the patient is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic. In some specific aspects, the cancer expresses low levels of HER2 as determined, for example, using HE CEPTEST™. Usually, the patient is a human, but non-human mammals including transgenic mammals can also be treated. Treatment dosages can be titrated using routine methods known to those of skill in the art to optimize safety and efficacy. [00379] The amount of at least one anti-HER2 binding molecule, e.g. , antibody or binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T) to be administered can be readily determined by one of ordinary skill in the art without undue experimentation. Factors influencing the mode of administration and the respective amount of at least one anti-HER2 binding molecule, e.g. , antibody, antigen-binding fragment, variant or derivative thereof (e.g., an ADC such as Bs2-4T), include, but are not limited to, the severity of the disease, the history of the disease, and the age, height, weight, health, and physical condition of the individual undergoing therapy. Similarly, the amount of anti-HER2 binding molecule, e.g. , antibody, or fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T), to be administered will be dependent upon the mode of administration and whether the subject will undergo a single dose or multiple doses of this agent.
[00380] The present disclosure also provides for the use of an anti-HER2 binding molecule, e.g. , an antibody or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T), in the manufacture of a medicament for treating a type of cancer, including, e.g. , breast cancer, colon cancer, lung cancer, gastric cancer, head and neck squamous cells cancer, melanoma, pancreatic cancer, and prostate cancer. In some specific aspects, the cancer expresses low levels of HER2 as determined, for example, using HE CEPTEST™.
[00381] The disclosure also provides for the use of an anti-HER2 binding molecule, e.g. , antibody of the instant disclosure, or antigen-binding fragment, variant, or derivative thereof, in the manufacture of a medicament for treating a subject for treating a type of cancer. In some specific aspects, the cancer expresses low levels of HER2 as determined, for example, using HERCEPTEST™. In certain aspects, the medicament is used in a subject that has been pretreated with at least one other therapy.
[00382] By "pretreated" or "pretreatment" is intended the subject has received one or more other therapies (e.g. , been treated with at least one other anti-cancer therapy) prior to receiving the medicament comprising the anti-HER2 binding molecule, e.g. , antibody or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T). It is not necessary that the subject was a responder to pretreatment with the prior therapy or therapies. Thus, the subject that receives the medicament comprising the anti-HER2 binding molecule, e.g., an antibody or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T) could have responded, responded poorly, or could have failed to respond to pretreatment with the prior therapy, or to one or more of the prior therapies where pretreatment comprised multiple therapies. Accordingly, the present disclosure provides methods to treat patients that are poor responders or non- responders to other therapies (e.g., treatment with an antibody or an ADC such as T- DM1) comprising administering an anti-HER2 binding molecule disclosed herein, e.g., an antibody or binding fragment, a variant, or a derivative thereof (e.g., an ADC such as Bs2-4T). Also provided are methods to prevent resistance to cancer therapies (e.g., resistance to treatment with an antibody or an ADC such as T-DM1) comprising administering an anti-HER2 binding molecule disclosed herein, e.g., an antibody or binding fragment, a variant, or a derivative thereof (e.g., an ADC such as Bs2-4T).
[00383] Even if a patient has been previously treated with a HER2 inhibitor, a person skilled in the art can determine whether a person showed no response after the treatment with the HER2 inhibitor. For example, a non- response to an inhibitor may be reflected in an increased suffering from cancer, such as an increased growth of a cancer/tumor and/or increase in the size of a tumor, the (increase in) the formation of metastases or a increase in the number or size of metastases. A non-response may also be the development of a tumor or metastases, for example after resection of a tumor, in the shortening of time to disease progression, or in the increase in the size of (a) tumor(s) and/or (a) metastases, for example in neoadjuvant therapy. Based on these parameters or other parameters known in the art, a patient group can be identified that does not respond to treatment with HER2 inhibitors, like pertuzumab, trastuzumab, or T-DM1. Such group of patients then could be treated with the anti-HER2 binding molecules disclosed herein, e.g., antibody of the disclosure, or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T).
[00384] The present disclosure provides also methods to treat patients that are, for example, poor-responders or non-responders to another therapy. The term "non- responder" as used herein can refer to an individual/patient/subject that is less likely to respond to a treatment using a HER2 inhibitor (e.g., pertuzumab, trastuzumab, or T- DM1). "Less likely to respond" as used herein refers to a decreased likeliness that a pathological complete response will occur in a patient treated with a HER2 inhibitor. In some aspects, a patient can be initially a good responder, and resistance to HER2 inhibitors can develop during treatment with such HER2 inhibitors (e.g., pertuzumab, trastuzumab, or T-DM1), leading to poor or no-response to the treatment.
[00385] The term "good responder" as used herein refers to an individual whose tumor does not demonstrate growth, metastases, increase in number or size of metastases, etc. during or after treatment using a HER2 inhibitor (like pertuzumab, trastuzumab, or T- DM1), for example based on serial imaging studies, an individual that does not experience tumor growth, metastases, increase in number or size of metastases, etc. over a period of time (e.g., about 1 year following initial diagnosis), and/or an individual that experiences a certain life span (e.g., about 2 years or more following initial diagnosis).
[00386] The term "poor responder" as used herein refers to an individual whose tumor grows or metastasizes during or shortly therafter standard therapy, for example using a HER2 inhibitor (like pertuzumab, trastuzumab, or T-DM1), or who experiences adverse clinical effects attributable to the tumor.
[00387] In cases where it is assessed that the subject is a "non-responder," a "poor- responder" or is "less likely to respond" (based, for example, on the presence of certain biomarkers in the cancer cells), the subject could be treated with the anti-HER2 binding molecules disclosed herein, e.g., antibody of the disclosure, or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T).
[00388] The instant disclosure also provides for the co-administration of an anti-HER2 binding molecule, e.g., antibody of the disclosure, or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T), and at least one other therapy. The anti-HER2 binding molecule and the at least one other therapy can be co-administered together in a single composition or can be co-administered together at the same time or overlapping times in separate compositions. In some aspects, an anti-HER2 binding molecule, e.g., antibody of the disclosure, or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T), can be used as an adjuvant therapy.
[00389] The instant disclosure also provides for the use of an anti-HER2 binding molecule, e.g., antibody of the disclosure, or antigen-binding fragment, variant, or derivative thereof (e.g., an ADC such as Bs2-4T), in the manufacture of a medicament for treating a subject for treating cancer, wherein the anti-HER2 binding molecule is administered before a subject has been treated with at least one other therapy.
XL Diagnostics
[00390] The present disclosure further provides diagnostic methods useful for during diagnosis of HER2-expressing cell-mediated diseases such as certain types of cancer including, e.g., colon cancer, lung cancer, gastric cancer, head and neck squamous cells cancer, melanoma, pancreatic cancer, prostate cancer, and breast cancer, which involves measuring the expression level of HER2 protein or transcript in tissue or other cells or body fluid from an individual and comparing the measured expression level with a standard HER2 expression level in normal tissue or body fluid, whereby an increase in the expression level compared to the standard is indicative of a disorder.
[00391] The anti-HER2 binding molecules of the instant disclosure and antigen-binding fragments, variants, and derivatives thereof, can be used to assay HER2 protein levels in a biological sample using classical immunohistological methods known to those of skill in the art (e.g., see Jalkanen, et al., J. Cell. Biol. 707 :976-985 (1985); Jalkanen et al., J. Cell Biol. 105:3087-3096 (1987)). Other antibody-based methods useful for detecting HER2 protein expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA), immunoprecipitation, or Western blotting. Suitable assays are described in more detail elsewhere herein.
[00392] By "assaying the expression level of HER2 polypeptide" is intended qualitatively or quantitatively measuring or estimating the level of HER2 polypeptide in a first biological sample either directly (e.g., by determining or estimating absolute protein level) or relatively (e.g., by comparing to the disease associated polypeptide level in a second biological sample). HER2 polypeptide expression level in the first biological sample can be measured or estimated and compared to a standard HER2 polypeptide level, the standard being taken from a second biological sample obtained from an individual not having the disorder or being determined by averaging levels from a population of individuals not having the disorder. As will be appreciated in the art, once the "standard" HER2 polypeptide level is known, it can be used repeatedly as a standard for comparison.
- I l l - [00393] By "biological sample" is intended any biological sample obtained from an individual, cell line, tissue culture, or other source of cells potentially expressing HER2. Methods for obtaining tissue biopsies and body fluids from mammals are well known in the art.
XII. Kits Comprising Anti-HER2 Binding Molecules
[00394] The present disclosure also provides kits that comprise an anti-HER2 binding molecule disclosed herein, e.g., an anti-HER2 antibody or antigen binding fragment thereof, that can be used to perform the methods described herein. In certain aspects, a kit comprises at least one purified anti-HER2 binding molecule or an antigen-binding fragment thereof in one or more containers. In some aspects, the kits contain all of the components necessary and/or sufficient to perform a detection assay, including all controls, directions for performing assays, and any necessary software for analysis and presentation of results. One skilled in the art will readily recognize that the disclosed anti- HER2 binding molecules disclosed herein, e.g., an anti-HER2 antibody or antigen binding fragment thereof, can be readily incorporated into one of the established kit formats which are well known in the art.
XIII. Immunoassays
[00395] Anti-HER2 binding molecules, e.g., antibodies or antigen-binding fragments thereof, variants, or derivatives thereof of the molecules of the instant disclosure can be assayed for immuno specific binding by any method known in the art. The immunoassays that can be used include but are not limited to competitive and non-competitive assay systems using techniques such as Western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay), "sandwich" immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, protein A immunoassays, to name but a few. Such assays are routine and well known in the art (see, e.g., Ausubel et al., eds, (1994) Current Protocols in Molecular Biology (John Wiley & Sons, Inc., NY) Vol. 1, which is incorporated by reference herein in its entirety). [00396] Anti-HER2 binding molecules disclosed herein, e.g., bispecific anti-HER2 antibodies or antigen-binding fragments thereof, variants, or derivatives thereof of the molecules of the instant disclosure, can be employed histologically, as in immunofluorescence, immunoelectron microscopy or non-immunological assays, for in situ detection of HER2 receptors or conserved variants or peptide fragments thereof. In situ detection can be accomplished by removing a histological specimen from a patient, and applying thereto a labeled HER2-binding molecule, e.g., a bispecific anti-HER2 antibody or antigen-binding fragment thereof, variant, or derivative thereof, preferably applied by overlaying the labeled HER2-binding molecule (e.g., an antibody or fragment) onto a biological sample. Through the use of such a procedure, it is possible to determine not only the presence of HER2, or conserved variants or peptide fragments, but also its distribution in the examined tissue. Using the present disclosure, those of ordinary skill will readily perceive that any of a wide variety of histological methods (such as staining procedures) can be modified in order to achieve such in situ detection.
[00397] The binding activity of a given lot of anti-HER2 binding molecule, e.g., a bispecific anti-HER2 antibody or antigen-binding fragment thereof, variant, or derivative thereof, can be determined according to well-known methods. Those skilled in the art will be able to determine operative and optimal assay conditions for each determination by employing routine experimentation.
[00398] Methods and reagents suitable for determination of binding characteristics of an anti-HER2 binding molecule of the instant disclosure, e.g., a bispecific anti-HER2 antibody or antigen-binding fragment thereof, variant, or an altered/mutant derivative thereof, are known in the art and/or are commercially available. Equipment and software designed for such kinetic analyses are commercially available (e.g., BIAcore, BIAevaluation software, GE Healthcare; KinExa Software, Sapidyne Instruments).
[00399] The practice of the present invention will employ, unless otherwise indicated, conventional techniques of cell biology, cell culture, molecular biology, transgenic biology, microbiology, recombinant DNA, and immunology, which are within the skill of the art. Such techniques are explained fully in the literature. See, for example, Sambrook et ah, ed. (1989) Molecular Cloning A Laboratory Manual (2nd ed.; Cold Spring Harbor Laboratory Press); Sambrook et al., ed. (1992) Molecular Cloning: A Laboratory Manual, (Cold Springs Harbor Laboratory, NY); D. N. Glover ed., (1985) DNA Cloning, Volumes I and II; Gait, ed. (1984) Oligonucleotide Synthesis; Mullis et al. U.S. Pat. No. 4,683,195; Hames and Higgins, eds. (1984) Nucleic Acid Hybridization; Hames and Higgins, eds. (1984) Transcription And Translation; Freshney (1987) Culture Of Animal Cells (Alan R. Liss, Inc.); Immobilized Cells And Enzymes (IRL Press) (1986); Perbal (1984) A Practical Guide To Molecular Cloning; the treatise, Methods In Enzymology (Academic Press, Inc., N.Y.); Miller and Calos eds. (1987) Gene Transfer Vectors For Mammalian Cells, (Cold Spring Harbor Laboratory); Wu et al., eds., Methods In Enzymology, Vols. 154 and 155; Mayer and Walker, eds. (1987) Immunochemical Methods In Cell And Molecular Biology (Academic Press, London); Weir and Blackwell, eds., (1986) Handbook Of Experimental Immunology, Volumes I-IV; Manipulating the Mouse Embryo, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., (1986); and in Ausubel et al. (1989) Current Protocols in Molecular Biology (John Wiley and Sons, Baltimore, Md.).
[00400] General principles of antibody engineering are set forth in Borrebaeck, ed. (1995)
Antibody Engineering (2nd ed.; Oxford Univ. Press). General principles of protein engineering are set forth in Rickwood et al., eds. (1995) Protein Engineering, A Practical Approach (IRL Press at Oxford Univ. Press, Oxford, Eng.). General principles of antibodies and antibody -hapten binding are set forth in: Nisonoff (1984) Molecular Immunology (2nd ed.; Sinauer Associates, Sunderland, Mass.); and Steward (1984) Antibodies, Their Structure and Function (Chapman and Hall, New York, N.Y.). Additionally, standard methods in immunology known in the art and not specifically described are generally followed as in Current Protocols in Immunology, John Wiley & Sons, New York; Stites et al., eds. (1994) Basic and Clinical Immunology (8th ed; Appleton & Lange, Norwalk, Conn.) and Mishell and Shiigi (eds) (1980) Selected Methods in Cellular Immunology (W.H. Freeman and Co., NY).
[00401] Standard reference works setting forth general principles of immunology include
Current Protocols in Immunology, John Wiley & Sons, New York; Klein (1982) J., Immunology: The Science of Self-Nonself Discrimination (John Wiley & Sons, NY); Kennett et al., eds. (1980) Monoclonal Antibodies, Hybridoma: A New Dimension in Biological Analyses (Plenum Press, NY); Campbell (1984) "Monoclonal Antibody Technology" in Laboratory Techniques in Biochemistry and Molecular Biology, ed. Burden et al., (Elsevere, Amsterdam); Goldsby et al., eds. (2000) Kuby Immunnology (4th ed.; H. Freemand & Co.); Roitt et al. (2001) Immunology (6th ed.; London: Mosby); Abbas et al. (2005) Cellular and Molecular Immunology (5th ed.; Elsevier Health Sciences Division); Kontermann and Dubel (2001) Antibody Engineering (Springer Verlan); Sambrook and Russell (2001) Molecular Cloning: A Laboratory Manual (Cold Spring Harbor Press); Lewin (2003) Genes VIII (Prentice Hall2003); Harlow and Lane (1988) Antibodies: A Laboratory Manual (Cold Spring Harbor Press); Dieffenbach and Dveksler (2003) PCR Primer (Cold Spring Harbor Press).
XIV. Embodiments
[00402] Embodiments are designated according to an "EnXrn" schema, where E means
"embodiment"; n is the embodiment ordinal number; X is optional and can be A or B, where A denotes embodiments specifically related to ADC constructs, and B denotes embodiments specifically related to construct with enhanced ADCC; and m is an optional sub-ordinal number indicating additional embodiments within a class (e.g., Al, Bl, etc.).
[00403] El. A bispecific anti-HER2 antibody comprising a first immunoglobulin antigen- binding domain and a second immunoglobulin antigen-binding domain, wherein (i) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 antibody binding sites, (ii) the first immunoglobulin antigen-binding domain binds to a first HER2 antibody binding site which comprises an epitope within domain II of HER2, and (iii) the first HER2 antibody binding site is distinct from the antibody binding site of pertuzumab.
[00404] E2. The bispecific anti-HER2 antibody of El wherein the second immunoglobulin antigen-binding domain binds to a second HER2 antibody binding site which comprises an epitope within domain IV of HER2.
[00405] E3. The bispecific anti-HER2 antibody of E2 wherein the second HER2 antibody binding site is identical to the HER2 antibody binding site of trastuzumab.
[00406] E4. The bispecific anti-HER2 antibody of E2 wherein the second HER2 antibody binding site partially overlaps with the HER2 antibody binding site of trastuzumab.
[00407] E5. The bispecific anti-HER2 antibody of E2 wherein the second HER2 antibody binding site is distinct from the HER antibody binding site of trastuzumab. [00408] E6. A bispecific HER2 antibody comprising a first immunoglobulin antigen- binding domain and a second immunoglobulin antigen-binding domain, wherein the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes; and wherein the first immunoglobulin antigen-binding domain binds HER2 to one or more amino acid residues in SEQ ID NO: 52.
[00409] E7. The bispecific antibody according to E6, wherein the second immunoglobulin antigen-binding domain binds HER2 at an epitope within domain IV.
[00410] E8. The bispecific antibody according to E6, wherein the second immunoglobulin antigen binding domain binds HER2 to one or more amino acid residues in SEQ ID NO: 53.
[00411] E9. The bispecific antibody according to E1-E8, wherein the first immunoglobulin antigen-binding domain comprises a heavy chain (HC) variable region (VH) and a light chain (LC) variable region (VL) comprising:
(i) a variable heavy chain CDR-1 (VH-CDR1) identical to SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions;
(ii) a variable heavy chain CDR-2 (VH-CDR2) identical to SEQ ID NO: 2 or identical to SEQ ID NO: 2 except for up to 1, 2, 3, or 4 amino acid substitutions;
(iii) a variable heavy chain CDR-3 (VH-CDR3) identical to SEQ ID NO: 3 or identical to SEQ ID NO: 3 except for up to 1, 2, 3, or 4 amino acid substitutions;
(iv) a variable light chain CDR-1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions;
(v) a variable light chain CDR-2 (VL-CDR2) identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1, 2, 3, or 4 amino acid substitutions; and,
(vi) a variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions.
[00412] E10. The bispecific antibody according to E9, wherein the first immunoglobulin antigen-binding domain comprises at least one heterologous variable domain framework region (FW) different relative to the FW regions of an immunoglobulin antigen-binding domain comprising a VH comprising the amino acids SEQ ID NO:43 and a VL comprising the amino acids of SEQ ID NO:44. [00413] El l. The bispecific anti-HER2 antibody according to E10, wherein the first immunoglobulin antigen-binding domain comprises:
(i) a variable light chain framework 1 (VL-FW1) comprising the amino acids of SEQ ID NO: l l;
(ii) a VL-FW2 comprising the amino acids of SEQ ID NO: 12;
(iii) a VL-FW3 comprising the amino acids of SEQ ID NO: 13;
(iv) a VL-FW4 comprising the amino acids of SEQ ID NO: 14; or
(v) any combination thereof.
[00414] E12. A bispecific anti-HER2 antibody comprising a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein the first immunoglobulin antigen-binding domain comprises a VH and a VL,
wherein the VH comprises the amino acids of SEQ ID NO: 15 or 43;and
wherein the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
[00415] El 3. A bispecific anti-HER2 antibody comprising a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein the first immunoglobulin antigen-binding domain comprises a VH and a VL,
wherein the VL comprises the amino acids of SEQ ID NO: 16 or 44;and
wherein the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
[00416] E14. The bispecific anti-HER2 antibody of E12 or E13,
wherein the VH comprises the amino acids of SEQ ID NO: 15; and
wherein the VL comprises the amino acids of SEQ ID NO: 16.
[00417] E15. The bispecific anti-HER2 antibody according to any one of El to El 4, wherein the first immunoglobulin antigen-binding domain comprises an scFv antibody fragment.
[00418] E16. The bispecific anti-HER2 antibody according to any one of El to E15, wherein the second immunoglobulin antigen-binding domain comprises an scFv antibody fragment. [00419] E17. The bispecific anti-HER2 antibody according to thereof of any one of El to El 6, wherein the first immunoglobulin antigen binding domain comprises or consists of:
(a) a VH further comprising a heavy chain constant region or a fragment thereof and a VL comprising a light chain constant region (LC) or a fragment thereof;
(b) a single chain Fv ("scFv");
(c) a diabody;
(d) a minibody;
(e) an F(ab')2; or
(f) an F(ab).
[00420] E18. The bispecific anti-HER2 antibody according to E17, wherein the heavy chain constant region or fragment thereof is an IgG constant region.
[00421] E19. The bispecific HER2 antibody according to E18, wherein the IgG constant region or fragment thereof is an IgGl constant region.
[00422] E20. The bispecific HER2 antibody according to any one of E17 to E19, wherein the LC constant region is a kappa constant region.
[00423] E21. The bispecific HER2 antibody according to any one of E17 to El 9, wherein the LC constant region is a lambda constant region.
[00424] E22. The bispecific anti-HER2 antibody according to any one of El to E21, wherein the first immunoglobulin antigen-binding domain is a monoclonal antibody.
[00425] E23. The bispecific anti-HER2 antibody according to any one of El to E22, wherein the first immunoglobulin antigen-binding domain is a humanized antibody.
[00426] E24. The bispecific anti-HER2 antibody according to any one of El to E22, wherein the first immunoglobulin antigen-binding domain is a human antibody.
[00427] E25. The bispecific anti-HER2 antibody according to any one of El to E22, wherein the first immunoglobulin antigen-binding domain is a chimeric antibody.
[00428] E26. The bispecific anti-HER2 antibody according to any one of El to E25, wherein the first immunoglobulin antigen-binding domain is an affinity optimized antibody. [00429] E27. The bispecific anti-HER2 antibody according to any one of El to E26, wherein the first immunoglobulin antigen-binding domain does not compete with trastuzumab or pertuzumab for epitope binding.
[00430] E28. The bispecific anti-HER2 antibody according to any one of El to E27, wherein the first and second immunoglobulin antigen binding domains specifically bind to distinct non- overlapping HER2 epitopes.
[00431] E29. The bispecific anti-HER2 antibody according to any one of El to E28, wherein:
(a) the second immunoglobulin antigen-binding domain specifically binds to the same HER2 epitope as the trastuzumab antibody;
(b) the second immunoglobulin antigen-binding domain competitively inhibits HER2 binding by the trastuzumab antibody; or
(c) the second immunoglobulin antigen-binding domain comprises at least one, at least two, at least three, at least four, at least five, or at least six complementarity determining regions (CDRs) comprising the amino acids of any one of SEQ ID NOs: 54 to 59.
[00432] E30. The bispecific anti-HER2 antibody according to E29, wherein the second immunoglobulin antigen-binding domain is anscFv comprising:
(i) a VH-CDR1 comprising the amino acids of SEQ ID NO:54;
(ii) a VH-CDR2 comprising the amino acids of SEQ ID NO:55;
(iii) a VH-CDR3 comprising the amino acids of SEQ ID NO:56;
(iv) a VL-CDR1 comprising the amino acids of SEQ ID NO:57;
(v) a VL-CDR2 comprising the amino acids of SEQ ID NO:58; and
(vi) a VL-CDR3 comprising the amino acids of SEQ ID NO:59.
[00433] E31. The bispecific anti-HER2 antibody according to E30, wherein the scFv is a disulfide stabilized scFv.
[00434] E32. The bispecific anti-HER2 antibody according to E30 or E31, wherein said scFv comprises a VH comprising the amino acids of SEQ ID NO: 17, and a VL comprising the amino acid of SEQ ID NO: 18.
[00435] E33. The bispecific ansti-HER2 antibody according to E32, wherein the VH and VL of the scFv are covalently linked via a peptide linker. [00436] E34. The bispecific anti-HER2 antibody according to E33, wherein the peptide linker comprises the amino acids of SEQ ID NO: 19.
[00437] E35. The bispecific anti-HER2 antibody according to any one of E29 to E34, wherein the second immunoglobulin antigen-binding domain is covalently linked to the carboxy-terminus of the HC of the first immunoglobulin antigen-binding domain.
[00438] E36. The bispecific anti-HER2 antibody according to E35, comprising a linker interposed between the second immunoglobulin antigen binding domain and the carboxy- terminus of the HC of the first immunoglobulin antigen-binding domain.
[00439] E37. The bispecific anti-HER2 antibody according to any one of E29 to E34, wherein the second immunoglobulin antigen-binding domain is covalently linked to the amino-terminus of the HC of the first immunoglobulin antigen-binding domain.
[00440] E38. The bispecific anti-HER2 antibody according to E37, comprising a linker interposed between the second immunoglobulin antigen-binding domain and the amino- terminus of the HC of the first immunoglobulin antigen-binding domain.
[00441] E39. The bispecific anti-HER2 antibody according to E29 to E34, wherein the second immunoglobulin antigen binding domain is covalently intercalated in the polypeptide chain of the HC of the first immunoglobulin antigen-binding domain.
[00442] E40. The bispecific anti-HER2 antibody according to E39, wherein the second immunoglobulin antigen binding domain is covalently intercalated between the CHI region and CH2 region of the HC of the first immunoglobulin antigen-binding domain.
[00443] E41. The bispecific anti-HER2 antibody according to E40, comprising:
(i) a linker interposed between the CHI region of the HC of the first immunoglobulin antigen binding domain and the second immunoglobulin antigen binding domain; and
(ii) a second linker interposed between the second immunoglobulin antigen binding domain and the CH2 region of the HC of the of the first immunoglobulin antigen-binding domain.
[00444] E42. The bispecific anti-HER2 antibody according to E41, wherein the first linker and the second linker are identical.
[00445] E43. The bispecific anti-HER2 antibody according to E41, wherein the first linker and the second linker are different. [00446] E44. The bispecific anti-HER2 antibody according to any one of E36, E38, and
E41 to E43, wherein one or more of the linkers comprise a peptide linker.
[00447] E45. The bispecific anti-HER2 antibody according to E44, wherein the peptide linker comprises at least two, at least three, at least four, at least five, at least 10, at least
20, or at least 30 amino acids.
[00448] E46. The bispecific anti-HER2 antibody according to any one of E44 or E45, wherein the peptide linker comprises a peptide having the formula Serx[(Gly)y-Ser4]z where x is from 0 to 1, y is from 1 to 4, and z is from 1 to 10.
[00449] E47. The bispecific anti-HER2 antibody according to E46, wherein the peptide linker comprises SEQ ID NO: 19-22.
[00450] E48. The bispecific anti-HER2 antibody according to any one of El to E47, wherein the heavy chain comprises a constant region comprising an Fc domain.
[00451] E49. The bispecific anti-HER2 antibody according to E48, wherein the Fc domain comprises a CH2 region and a CH3 region.
[00452] E50. The bispecific anti-HER2 antibody according to E48, wherein the Fc domain is an IgGl Fc domain.
[00453] E51. The bispecific anti-HER2 antibody according to E50, wherein the IgGl Fc domain is a native IgGl Fc domain.
[00454] E52. The bispecific anti-HER2 antibody according to E51, wherein the native
IgGl Fc domain comprises the amino acids of SEQ ID NO: 23.
[00455] E53. The bispecific anti-HER2 antibody according to E48, wherein the Fc domain is a mutant IgGl Fc domain.
[00456] E54A. The bispecific anti-HER2 antibody according to E53, wherein the mutant
IgGl Fc domain comprises at least one mutation capable of reducing the ADCC activity of the bispecific antibody.
[00457] E54B. The bispecific anti-HER2 antibody according to E53, wherein the mutant
IgGl Fc domain comprises at least one mutation capable of enhancing the ADCC activity of the bispecific antibody.
[00458] E55A. The bispecific anti-HER2 antibody according to E54A, wherein at least one mutation capable of reducing the ADCC activity of the bispecific antibody is an amino acid substitution. [00459] E55B. The bispecific anti-HER2 antibody according to E54B, wherein at least one mutation capable of enhancing the ADCC activity of the bispecific antibody is an amino acid substitution.
[00460] E56A. The bispecific anti-HER2 antibody according to E55A, comprising at least one amino acid substitution comprising L234F, S239A, S239C, a cysteine amino acid insertion between positions 239 and 240 or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
[00461] E56B. The bispecific anti-HER2 antibody according to E55B, comprising at least one amino acid substitution comprising, S239A, S239D, A330L, I332E, E333A, K334A, or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
[00462] E57A. The bispecific anti-HER2 antibody according to E55A or E56A, wherein said mutant IgGl Fc domain comprises at least one amino acid substitution introducing a derivatizable group.
[00463] E57B. The bispecific anti-HER2 antibody according to any one of E48 to E53,
E54B, E55B or E56B wherein the Fc domain has an altered type of glycosylation that enhances ADCC activity.
[00464] E58A. The bispecific anti-HER2 antibody according to E57A, wherein said mutant IgGl Fc domain comprises one to three amino acid substitution introducing a derivatizable group.
[00465] E58B. The bispecific anti-HER2 antibody according to E57B, wherein the Fc domain is a hypofucosylated antibody having reduced amounts of fucosyl residues.
[00466] E59A. The bispecific anti-HER2 antibody according to E57A or E58A, wherein the derivatizable group in a sulfhydryl group.
[00467] E59B. The bispecific anti-HER2 antibody according to E57B or E58B, wherein the Fc domain has increased bisecting GlcNAc structures.
[00468] E60. The bispecific anti-HER2 antibody according to E59A, wherein the at least one amino acid substitution comprises S239C, 248C, 254C, 258C , 273C, 279C, 282C, 284C, 286C, 287C, 289C, 297C, 298C, 312C, 324C, 326C, 330C, 335C, 337C, 339C, 350C, 355C, 356C, 359C, 360C, 361C, 375C, 383C, 384C, 389C, 398C, 400C, 413C, 415C, 418C, 422C, 435C, 440C, 441C, S442C, 443C, a cysteine amino acid insertion between positions 239 and 240, and 446C, or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
[00469] E61A. The bispecific anti-HER2 antibody according to any one E54A, E55A,
E56A, E57A, E58A, E59A, or E60, wherein the mutant Fc domain comprises the amino acids of SEQ ID NO: 24A, SEQ ID NO: 24C, SEQ ID NO: 25A or SEQ ID NO:25C.
[00470] E61B. The bispecific anti-HER2 antibody according to any one E54B, E55B,
E56B, E57B, E58B, E59B, or E60, wherein the mutant Fc domain comprises the amino acids of SEQ ID NO: 24B or SEQ ID NO:25B.
[00471] E62. A bispecific anti-HER2 antibody comprising a first and a second polypeptide chain associated with each other, wherein the first polypeptide chain is selected from:
(2) [BVH]-[BCH]-[FCX]-[L2]-[TZS]
(3) [BVH]-[BCH]-[L3]-[TZS]-[L4]-[FCX]
wherein
TZs is an scFv that binds the same epitope as trastuzumab;
L1 ; L2, L3, and L4 are peptide linkers;
Fcx is an Fc domain;
BVH and BCH are the VH and CHI regions, respectively, of an antibody capable of binding to an HER2 epitope distinct from the epitope recognized by the trastuzumab antibody.
[00472] E63. The bispecific anti-HER2 antibody according to E62, wherein the distinct epitope comprises one or more amino acids within SEQ ID NO: 52.
[00473] E64. The bispecific anti-HER2 antibody according to E62 or E63, wherein the second chain comprises [BVL]-[CL] wherein BVL is the VL region of an antibody capable of binding to an HER2 epitope distinct from the epitope recognized by the trastuzumab antibody, and CL is a IgG light chain constant region.
[00474] E65. The bispecific anti-HER2 antibody according to E64, wherein CL is selected from the group consisting of a human kappa constant region and a human lambda constant region. [00475] E66. The bispecific anti-HER2 antibody according to E64 or E65, wherein BVL comprises:
(i) a variable light chain CDR- 1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1 , 2, 3, or 4 amino acid substitutions;
(ii) a variable light chain CDR-2 (VL-CDR2) identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1 , 2, 3, or 4 amino acid substitutions; and,
(iii) a variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1 , 2, 3, or 4 amino acid substitutions.
[00476] E67. The bispecific anti-HER2 antibody according to E64, E65 or E66, wherein
BVL comprises the amino acids of SEQ ID NO: 16 or 44.
[00477] E68. The bispecific anti-HER2 antibody according to E65, wherein CL comprises the amino acids of SEQ ID NO:27A or SEQ ID NO: 27B.
[00478] E69. The bispecific anti-HER2 antibody according to any one of E62 to E68, wherein [TZs] comprises:
(i) a VH-CDR1 comprising the amino acids of SEQ ID NO:54;
(ii) a VH-CDR2 comprising the amino acids of SEQ ID NO:55;
(iii) a VH-CDR3 comprising the amino acids of SEQ ID NO:56;
(iv) a VL-CDR1 comprising the amino acids of SEQ ID NO:57;
(v) a VL-CDR2 comprising the amino acids of SEQ ID NO:58; and
(vi) a VL-CDR3 comprising the amino acids of SEQ ID NO:59.
[00479] E70. The bispecific anti-HER2 antibody according to any one of E62 to E69, wherein [TZs] is a disulfide stabilized scFv.
[00480] E71. The bispecific anti-HER2 antibody according to any one of E62 to E70, wherein [TZS] comprises a VH comprising the amino acids of SEQ ID NO: 17 and a VL comprising the amino acids of SEQ ID NO: 18, covalently linked by a peptide linker.
[00481] E72. The bispecific anti-HER2 antibody according to E71 , wherein the peptide linker comprises the amino acids of SEQ ID NO: 19.
[00482] E73. The bispecific anti-HER2 antibody according to any one of E69 to E72, wherein [TZs] comprises of the amino acids of SEQ ID NO:28.
[00483] E74. The bispecific anti-HER2 antibody according to any one of E62 to E73, wherein a hinge polypeptide links the [BCH] and [FcX] . [00484] E75. The bispecific anti-HER2 antibody according to E74, wherein the hinge polypeptide comprises or consists of the amino acids of SEQ ID NO: 26.
[00485] E76A. The bispecific anti-HER2 antibody according to any one of E62 to E75, wherein the [Fcx] comprises at least one amino acid substitution introducing a derivatizable group.
[00486] E76B. The bispecific anti-HER2 antibody according to any one of E62 to E75, wherein [Fcx] comprises at least one mutation capable of enhancing the ADCC activity of the bispecific antibody.
[00487] E77A. The bispecific anti-HER2 antibody according to E76A, wherein the [Fcx] comprises one to three amino acid substitution introducing a derivatizable group.
[00488] E77B. The bispecific anti-HER2 antibody according to E76B, wherein at least one mutation capable of enhancing the ADCC activity of the bispecific antibody is an amino acid substitution.
[00489] E78A. The bispecific anti-HER2 antibody according to E76A or E77A, wherein the derivatizable group in a sulfhydryl group.
[00490] E78B. The bispecific anti-HER2 antibody according to E77B, comprising at least one amino acid substitution comprising, S239A, S239D, A330L, I332E, E333A, K334A, or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
[00491] E78B1. The bispecific anti-HER2 antibody according to any one of E62 to E75,
E76B, E77B or E78B wherein the Fc domain has an altered type of glycosylation that enhances ADCC activity.
[00492] E78B2. The bispecific anti-HER2 antibody according to E78B1, wherein the Fc domain is a hypofucosylated antibody having reduced amounts of fucosyl residues.
[00493] E78B3. The bispecific anti-HER2 antibody according to E78B1 or E78B2, wherein the Fc domain has increased bisecting GlcNAc structures.
[00494] E79. The bispecific anti-HER2 antibody according to E78A, wherein the at least one amino acid substitution comprises S239C, 248C, 254C, 258C, 273C, 279C, 282C, 284C, 286C, 287C, 289C, 297C, 298C, 312C, 324C, 326C, 330C, 335C, 337C, 339C, 350C, 355C, 356C, 359C, 360C, 361C, 375C, 383C, 384C, 389C, 398C, 400C, 413C, 415C, 418C, 422C, 435C, 440C, 441C, S442C, 443C, 446C, a cysteine amino acid insertion between positions 239 and 240, or any combination thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
[00495] E80A. The bispecific anti-HER2 antibody according to any one of E62 to E75,
E76A, E77A, E78A, or E79, wherein [Fcx] comprises the amino acids of any one of SEQ
ID NOS: 23, 24A, 24C, 25A and 25C.
[00496] E80B. The bispecific anti-HER2 antibody according to any one of E62 to E75,
E76B, E77B, E78B, E78B1, E78B2, E78B3, or E79, wherein [Fcx] comprises the amino acids of any one of SEQ ID NOS: 23, 24B, and 25B.
[00497] E81. The bispecific anti-HER2 antibody according to any one of E62 to E79, wherein [Li], [L2], [L3], and [L4] comprise amino acids independently selected from the group consisting of SEQ ID NOs: 19, 20, 21, and 22.
[00498] E82. The bispecific anti-HER2 antibody according to any one of E62 to E79, wherein:
(i) [Li] comprises the amino acids of SEQ ID NO: 19;
(ii) [L2] comprises the amino acids of SEQ ID NO:20;
(iii) [L3] comprises the amino acids of SEQ ID NO:21; and,
(iv) [L4] comprises the amino acids of SEQ ID NO:22.
[00499] E83. The bispecific anti-HER2 antibody according to any one of E62 to E82, wherein [BVH] comprises:
(i) a variable heavy chain CDR-1 (VH-CDR1) identical to SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions;
(ii) a variable heavy chain CDR-2 (VH-CDR2) identical to SEQ ID NO: 2 or identical to SEQ ID NO: 2 except for up to 1, 2, 3, or 4 amino acid substitutions; and
(iii) a variable heavy chain CDR-3 (VH-CDR3) identical to SEQ ID NO: 3 or identical to SEQ ID NO: 3 except for up to 1, 2, 3, or 4 amino acid substitutions
[00500] E84. The bispecific anti-HER2 antibody according to any one of E62 to E82, wherein [BVH] comprises SEQ ID NO: 15 or 43.
[00501] E85. The bispecific anti-HER2 antibody according to any one of E62 to E84, wherein [BCH] comprises the amino acids of SEQ ID NO: 29.
[00502] E86. The bispecific anti-HER2 antibody according to any one of E64 to E85, wherein [BVL] comprises: (i) a variable light chain CDR-1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions;
(ii) a variable light chain CDR-2 (VL-CDR2) identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1, 2, 3, or 4 amino acid substitutions; and
(iii) a variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions.
[00503] E87. The bispecific anti-HER2 antibody according to any one of E64 to E85, wherein [BVL] comprises the amino acids of SEQ ID NO: 16 or 44.
[00504] E88A. The bispecific HER2 antibody according to claim any one of E62 to E87, wherein first polypeptide chain comprises the amino acids of any one of SEQ ID NOs: 30, 31 A, 32A, 32C, 33A, 33C, 34, 35A, 36A, 36C, 37A, 37C, 38, 38A, 39A, 40A, 40C, 41A or 41C, and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A or 42B, wherein the bispecific HER2 antibody is conjugated to a therapeutic moiety.
[00505] E88B. The bispecific HER2 antibody according to claim any one of E62 to E87, wherein first polypeptide chain comprises the amino acids of any one of SEQ ID NOs: 30, 31B, 32B, 33B, 34, 35B, 36B, 37B, 38, 38B, 39B, 40B, or 41B, and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A or 42B, wherein the bispecific HER2 antibody has enhanced ADCC activity.
[00506] E89. The bispecific HER2 antibody according to any one of El to E88B, wherein the bispecific HER2 antibody induces internalization upon binding to the HER2 target.
[00507] E90. The bispecific HER2 antibody according to E89, wherein the bispecific
HER2 antibody promotes effective lysosomal trafficking following internalization.
[00508] E91. The bispecific HER2 antibody according to any one of El to E88B, wherein the bispecific HER2 antibody induces HER2 target degradation.
[00509] E92. The bispecific HER2 antibody according to any one of El to E88B, wherein the bispecific HER2 antibody blocks ligand- induced AKT phosphorylation in low HER2-expressing cancer cells. [00510] E93. The bispecific HER2 antibody according to any one of El to E88B, wherein the bispecific HER2 antibody disrupts ligand-induced HER2:HER3 dimerization.
[00511] E94. An anti-HER2 binding molecule comprising an immunoglobulin heavy chain (VH) and an immunoglobulin light chain (VL), wherein the binding molecule comprises:
(i) VH-CDR1 comprising the amino acids of SEQ ID NO: 1;
(ii) VH-CDR2 comprising the amino acids of SEQ ID NO: 2;
(iii) VH-CDR3 comprising the amino acids of SEQ ID NO: 3;
(iv) VL-CDR1 comprising the amino acids of SEQ ID NO: 4;
(v) VL-CDR2 comprising the amino acids of SEQ ID NO: 5; and,
(vi) VL-CDR3 comprising the amino acids of SEQ ID NO: 6.
[00512] E95. An anti-HER2 binding molecule comprising an immunoglobulin heavy chain (VH) and an immunoglobulin light chain (VL), wherein the VH comprises the amino acids of SEQ ID NO: 15.
[00513] E96. An anti-HER2 binding molecule comprising a VH and a VL, wherein the
VL comprises the amino acids of SEQ ID NO: 16.
[00514] E97. The binding molecule of E94 or E95 or E96, wherein the VH comprises the amino acids of SEQ ID NO: 15 and the VL comprises the amino acids of SEQ ID
NO: 16.
[00515] E98. The binding molecule of any one of E94 to E97 comprising an antibody, or antigen-binding fragment thereof.
[00516] E99A. An antibody-drug conjugate (ADC) comprising the bispecific HER2 antibody according to any one El to E93 or the anti-HER2 binding molecule according to any of E94 to E98 and at least one therapeutic moiety.
[00517] E100A. The ADC according to E99A, further comprising at least one optional spacer.
[00518] E101A. The ADC according to E100A, where at least one spacer is a peptidic spacer.
[00519] E102A. The ADC according to E100A, wherein at least one spacer is a nonpeptidic spacer. [00520] E103A. The ADC according to any one of E99A to E102A, comprising two, three, or four therapeutic moieties.
[00521] E104A. The ADC according to any one of E99A to E103A, where all therapeutic moieties are the same.
[00522] E105A. The ADC according to any one of E99A to E104A, wherein each therapeutic moiety is chemically conjugated to the side chain of an amino acid at a specific position in the Fc region of the bispecific antibody.
[00523] E106A. The ADC according to El 05 A, where the specific positions are selected from the group consisting of 239, 248, 254, 258, 273, 279, 282, 284, 286, 287, 289, 297, 298, 312, 324, 326, 330, 335, 337, 339, 350, 355, 356, 359, 360, 361, 375, 383, 384, 389, 398, 400, 413, 415, 418, 422, 435, 440, 441, 442, 443, 446, an insertion between positions 239 and 240, and combinations thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
[00524] E107A. The ADC according to E105A or 106A, wherein the specific positions are
239, 442, or both, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
[00525] E108A. The ADC according to E105A or 106A, wherein the specific positions are
442 and an amino acid insertion between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
[00526] E109A. The ADC according to El 05 A to El 08 A, wherein the amino acid side chain is a sulfhydryl side chain.
[00527] E110A. An ADC comprising the bispecific HER2 antibody according to any one of El to E98, wherein said antibody comprises:
(i) a first polypeptide chain comprising the amino acids of SEQ ID NO: 32A and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety covalently linked to a cysteine amino acid at position 239, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(ii) a first polypeptide chain comprising the amino acids of SEQ ID NO:33A and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties covalently linked to cysteine amino acids respectively located at positions 239 and 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(iii) a first polypeptide chain comprising the amino acids of SEQ ID NO:36A and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety covalently linked to a cysteine amino acid at position 239, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(iv) a first polypeptide chain comprising the amino acids of SEQ ID NO:37A and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties covalently linked to cysteine amino acids respectively located at positions 239 and 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(v) a first polypeptide chain comprising the amino acids of SEQ ID NO:40A and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety covalently linked to a cysteine amino acid at position 239, wherein the amino acid position numbering is according to the EU index as set forth in Kabat; or
(vi) a first polypeptide chain comprising the amino acids of SEQ ID NO:41A and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties covalently linked to cysteine amino acids respectively located at positions 239 and 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
El 11A1. An ADC comprising the bispecific HER2 antibody according to any one of claims 1 to 113, wherein said antibody comprises:
(i) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:32C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat; (ii) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:33C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(iii) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:36C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(iv) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:37C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(v) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:40C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat; or,
(vi) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:41C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat. [00529] E112A. The ADC according to any one of E99A to El 11 A, wherein the therapeutic moiety comprises a cytotoxin, a radioisotope, a radioisotope, an immunomodulator, a cytokine, a lymphokine, a chemokine, a growth factor, a tumor necrosis factor, a hormone, a hormone antagonist, an enzyme, an oligonucleotide, a DNA, an RNA, an siRNA, an RNAi, a microRNA, a photoactive therapeutic agent, an anti-angiogenic agent, a pro-apoptotic agent, a peptide, a lipid, a carbohydrate, a chelating agent, or combinations thereof.
[00530] E113A. The ADC according to E112A, wherein the cytotoxin is a tubulysin, an auri statin, a rnaytansinoid or a pyrrolobenzodiazepine (PBD).
[00531] El 14. An isolated nucleic acid molecule or a set of nucleic acid molecules encoding a bispecific HER2 antibody according to any one of El to E93 or an anti-HER2 binding molecule according to any one of E94 to E98, or a complement thereof.
[00532] El 15. A vector or a set of vectors comprising the nucleic acid molecule or set of the nucleic acid molecules of El 14, or a complement thereof.
[00533] El 16. A host cell comprising an isolated nucleic acid molecule or a set of nucleic acid molecules according to El 14, or the vector or set of vectors according to El 15.
[00534] El 17. A host cell expressing a bispecific HER2 antibody according to any one of
El to E93 or an anti-HER2 binding molecule according to any one of E94 to E98.
[00535] El 18. A method for producing a bispecific HER2 antibody according to any one of El to E93 or an anti-HER2 binding molecule according to any one of E94 to E98 comprising culturing the host cell according to any one of El 16 or El 17 and recovering the antibody from the culture medium.
[00536] El 19. A pharmaceutical composition comprising a bispecific HER2 antibody according to any one of El to E93, an anti-HER2 binding molecule according to any one of E94 to E98, or an ADC according to any one of E99A to E113A1, and a pharmaceutically acceptable carrier.
[00537] E120. A method of treating a HER2-expressing cancer comprising administering a bispecific HER2 antibody according to any one of El to E93, an anti-HER2 binding molecule according to any one of E94 to E98, an ADC according to any one of E99A to El 13A1 or the composition according to El 19 to a subject in need thereof. [00538] E121. The method according to E120, wherein the cancer is a low HER2- expressing cancer.
[00539] E122. The method according to any one of E120 or E121, further comprising administering at least one additional therapeutic agent.
[00540] E123. The method according to E122, wherein the at least one additional therapeutic agent is a radionuclide or a chemotherapeutic agent.
[00541] E124. A method to target a therapeutic moiety to cells expressing HER2 comprising administering the therapeutic moiety fused or conjugated to a bispecific HER2 antibody according to any one of El to E93, an anti-HER2 binding molecule according to any one of E94 to E98, or an ADC according to any one of E99A to E113A1.
[00542] El 25. A method to increase the activity of a therapeutic moiety comprising conjugating the moiety to a bispecific HER2 antibody according to any one of El to E93, an anti-HER2 binding molecule according to any one of E94 to E98, or an ADC according to any one of E99A to El 13A1.
[00543] El 26. A method to improve the pharmacokinetic properties of a therapeutic moiety comprising conjugating the moiety to a bispecific HER2 antibody according to any one of El to E93, an anti-HER2 binding molecule according to any one of E94 to E98, or an ADC according to any one of E99A to El 13A1.
[00544] E127. The method according to any of E122 to E126, wherein the therapeutic moiety is a cytotoxin, a radioisotope, an immunomodulator, a cytokine, a lymphokine, a chemokine, a growth factor, a tumor necrosis factor, a hormone, a hormone antagonist, an enzyme, an oligonucleotide, a DNA, an RNA, an siRNA, an RNAi, a microRNA, a photoactive therapeutic agent, an anti-angiogenic agent, a pro-apoptotic agent, a peptide, a lipid, a carbohydrate, or a chelating agent.
[00545] El 28. The method according to El 27, wherein the cytotoxin is a tubulysin, an auri statin, a maytansinoid or a pyrrolobenzodiazepine (PBD).
[00546] E129.The ADC according to E113A or the method according to E128, wherein the cytoxin is tubulysin 1508 having the following structure:
[00547] E130. A method to treat resistance to a HER2-targeting therapeutic agent comprising administering a bispecific HER2 antibody according to any one of El to E93, an anti-HER2 binding molecule according to any one of E94 to E98, or an ADC according to any one of E99A to El 13A to a patient in need thereof.
XV. Sequences
[00548] Table 3 below provides the sequence reference number (SEQ ID NO:),
acid sequence and comments regarding the sequences.
TABLE 3
SEQ
ID SEQUENCE Comments
NO
11 DIVMTQTPLSLSVTPGQPASISC VL-FR1 from affinity optimized
S39 antibody
12 WYLQKPGQPPQLLIY VL-FR2 from affinity optimized
S39 antibody
13 GVPDRFSGSGSGTDFTLKI SRVEAEDVGVYYC VL-FR3 from affinity optimized
S39 antibody
14 FGPGTKVDIK VL-FR4 from affinity optimized
S39 antibody
15 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS VH2 - VH from clone 39S antibody ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG DAYNYYYFDYWGQGTLVTVSS
16 DIVMTQTPLSLSVTPGQPASI SCKSSQSVFFRSNNKNILAWYLQKPGQPP VL2 - VL from clone 39S antibody QLLIYWASSRESGVPDRFSGSGSGTDFTLKI SRVEAEDVGVYYCQQYFGS PFTFGPGTKVDIK
17 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKXLEWVAR VH1 - VH of the Domain IV scFv IYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWG X in SEQ ID NO: 17 is K or C GDGFYAMDYWGQGTLVTVSS
18 DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYS VL1 - VL from of the Domain IV ASFLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFATYYCQQHYTTPPTFGX scFv
GTKVEIK X in SEQ ID NO: 18 is Q or C
19 GGGGSGGGGSGGGGSGGGGS Lx linker, x = 1-4 - scFv Linker - Located between VL and VH in scFv
20 GGGGSGGGGSGGGGS Lx linker, x = 1-4 - Used in Bs2Ab- FCC and Bs2Ab-FC constructs
21 EPKSCGKTGGGGSGGGGS Lx linker, x = 1-4 - Used in Bs4Ab- FCC and Bs4Ab-FC constructs
22 SGGGGSGGGGS Lx linker, x = 1 -4 - Hinge
23 CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKF Native IgGl Fc
NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN Fc portion can include EU residues KALPAPIEKTI SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS 226 to its carboxyl-terminus. The DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC
highlighted positions correspond to SVMHEALHNHYTQKSLSLSPGK
sites of known allelic variation.
24A CPPCPAPE|F]LGGP|C|VFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKF Fc IgGl L234F S239C ("FC"), for NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN ADC constructs. Mutations within KALPAPIEKTI SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS boxes. The highlighted positions DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC correspond to sites of known allelic SVMHEALHNHYTQKSLSLSPGK
variation.
24B CPPCPAPELLGGP|D|VFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKF Fc IgGl S239D I332E, for ADCC NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN constructs. Mutations within boxes. KALPAP|E]EKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS The highlighted positions DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC correspond to sites of known allelic SVMHEALHNHYTQKSLSLSPGK
variation.
24C CPPCPAPELLGGPS|c]VFLFPPKPKDTLMISRTPEVTCWVDVSHEDPEVK Fc IgGl C239-ins, for ADC FNWYVDGVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVS constructs. Mutations within boxes. NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP The highlighted positions SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS correspond to sites of known allelic CSVMHEALHNHYTQKSLSLSPGK
variation.
25A CPPCPAPE|F]LGGP|C|VFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKF Fc IgGl L234F S239C S442C NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN ("FCC"), for ADC constructs. KALPAPIEKTI SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS Mutations within boxes. The DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC highlighted positions correspond to SEQ
ID SEQUENCE Comments
NO
SVMHEALHNHYTQKSL|C]LSPGK sites of known allelic variation.
25B CPPCPAPELLGGP[D]VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF Fc IgGl S239D A330L I332E, for NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN ADCC constructs. Mutations within KALP|L]P|E]EKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS boxes. The highlighted positions DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC correspond to sites of known allelic SVMHEALHNHYTQKSLSLSPGK variation.
25C CPPCPAPELLGGPS|C]VFLFPPKPKDTLMISRTPEVTCWVDVSHEDPEVK Fc IgGl C239-ins S442C, for ADC FNWYVDGVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVS constructs. Mutations within boxes. NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP The highlighted positions SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS correspond to sites of known allelic CSVMHEALHNHYTQKSL|C|LSPGK
variation.
26 EPKSCDKTHT IgGl hinge present in Bs2 and Bs3
27A RTVAAPSVF IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSG CL kappa. The highlighted NSQESVTEQDSKDSTYSLS STLTLSKADYEKHKVYACEVTHQGLS SPVTK positions correspond to sites of SFNRGEC known allelic variation.
27B QPKAAPSVTLFPPSSEELQANKATLVCLiSDFYPGAVTVAWKADSSPVKA CL lambda. The highlighted GVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVA positions correspond to sites of PTEC known allelic variation.
28 EVQLVESGGGLVQPGGSLRLSCAASGFNI KDTYIHWVRQAPGKXiLEWVA Trastuzumab scFv sequence. K RIYPTNGYTRYADSVKGRFTI SADTSKNTAYLQMNSLRAEDTAVYYCSRW or C; X2 = Q or C. In disulfide- GGDGFYAMDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSDI QMTQSPS stabilized scFv Xi = X2 = C.
SLSASVGDRVT ITCRASQDVNTAVAWYQQKPGKAPKLLI YSASFLYSGVP SRFSGSRSGTDFTLT I S SLQPEDFATYYCQQHYTTPPTFGX2GTKVEI K
29 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV CHI from 39S antibody - EU HTFPAVLQS SGLYSLSSWTVPS SSLGTQTYICNVNHKPSNTKVDKRV residues 118 to 215. The highlighted positions correspond to sites of known allelic variation.
30 DIQMTQSPS SLSASVGDRVTI TCRASQDVNTAVAWYQQKPGKAPKLL IYS Heavy chain of Bs2Ab-native Fc ASFLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFATYYCQQHYTTPPTFGC construct. The underlined positions GTKVE IKGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCA indicate where certain substitutions ASGFNIKDTYI HWVRQAPGKCLEWVARIYPTNGYTRYADSVKGRFTI SAD
may be made. The highlighted TSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSGGG GSGGGGSGGGGSEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVR positions correspond to sites of QAPGKGLEWVS S I SS SS SYIYYADSVKGRFT I SRDNAKNSLYLQMNSLRA known allelic variation.
EDTAVYYCARGGDAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPS SKS TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS S WTVPSS SLGTQTYI CNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TI SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPGK
31A DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYS Heavy chain of Bs2Ab2 with L234F ASFLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFATYYCQQHYTTPPTFGC ("F"). Construct for ADC. The GTKVEIKGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCA highlighted positions correspond to ASGFNIKDTYIHWVRQAPGKCLEWVARIYPTNGYTRYADSVKGRFTI SAD
sites of known allelic variation. TSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSGGG GSGGGGSGGGGSEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVR QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRA EDTAVYYCARGGDAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKS SEQ
ID SEQUENCE Comments
NO
TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS WTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEF LGGPSVFLFPPKPKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPGK
31B DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYS Heavy chain of Bs2Ab2 with I332E.
ASFLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFATYYCQQHYTTPPTFGC Construct with enhanced ADCC. GTKVEIKGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCA The highlighted positions ASGFNIKDTYIHWVRQAPGKCLEWVARIYPTNGYTRYADSVKGRFTI SAD
correspond to sites of known allelic TSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSGGG GSGGGGSGGGGSEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVR variation.
QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRA EDTAVYYCARGGDAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKS TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS WTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPEEK TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPGK
32A DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYS Heavy chain of Bs2Ab with L234F, ASFLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFATYYCQQHYTTPPTFGC S239C ("FC"). Construct for ADC. GTKVEIKGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCA The highlighted positions ASGFNIKDTYIHWVRQAPGKCLEWVARIYPTNGYTRYADSVKGRFTI SAD
correspond to sites of known allelic TSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSGGG GSGGGGSGGGGSEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVR variation.
QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRA EDTAVYYCARGGDAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKS TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS WTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEF LGGPCVFLFPPKPKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPGK
32B DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYS Heavy chain of Bs2Ab with S239D ASFLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFATYYCQQHYTTPPTFGC and I332E. Construct with enhanced GTKVEIKGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCA ADCC. The highlighted positions ASGFNIKDTYIHWVRQAPGKCLEWVARIYPTNGYTRYADSVKGRFTI SAD
correspond to sites of known allelic TSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSGGG GSGGGGSGGGGSEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVR variation.
QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRA EDTAVYYCARGGDAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKS TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS WTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEL LGGPDVFLFPPKPKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPEEK TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPGK
32C DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYS Heavy chain of Bs2Ab with C239- ASFLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFATYYCQQHYTTPPTFGC ins ("C"). Construct for ADC. The GTKVEIKGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCA highlighted positions correspond to ASGFNIKDTYIHWVRQAPGKCLEWVARIYPTNGYTRYADSVKGRFTI SAD
sites of known allelic variation. TSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSGGG GSGGGGSGGGGSEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVR QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRA SEQ
ID SEQUENCE Comments
NO
EDTAVYYCARGGDAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKS TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS WTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEL LGGPSCVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTI SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLSLSPGK
33A DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYS Heavy chain of Bs2Ab with L234F, ASFLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFATYYCQQHYTTPPTFGC S239C and S442C ("FCC"). GTKVEIKGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCA Construct for ADC. The highlighted ASGFNIKDTYIHWVRQAPGKCLEWVARIYPTNGYTRYADSVKGRFTI SAD
positions correspond to sites of TSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSGGG GSGGGGSGGGGSEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVR known allelic variation.
QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRA EDTAVYYCARGGDAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKS TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS WTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEF LGGPCVFLFPPKPKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLCLSPGK
33B DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYS Heavy chain of Bs2Ab with S239D, ASFLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFATYYCQQHYTTPPTFGC A330L, and I332E. Construct with GTKVEIKGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCA enhanced ADCC. The highlighted ASGFNIKDTYIHWVRQAPGKCLEWVARIYPTNGYTRYADSVKGRFTI SAD
positions correspond to sites of TSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSGGG GSGGGGSGGGGSEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVR known allelic variation.
QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRA EDTAVYYCARGGDAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKS TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS WTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEL LGGPWFLFPPKPKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVDGVEV HNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPLPEEK TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPGK
33C DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYS Heavy chain of Bs2Ab with C239- ASFLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFATYYCQQHYTTPPTFGC ins and S442C ("CC"). Construct GTKVEIKGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCA for ADC. The highlighted positions ASGFNIKDTYIHWVRQAPGKCLEWVARIYPTNGYTRYADSVKGRFTI SAD
correspond to sites of known allelic TSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSGGG GSGGGGSGGGGSEVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVR variation.
QAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRA EDTAVYYCARGGDAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKS TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS WTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEL LGGPSCVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTI SKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH NHYTQKSLCLSPGK
34 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS Heavy chain of Bs3Ab native Fc.
ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG The highlighted positions DAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV correspond to sites of known allelic KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ TYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPK variation.
PKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY SEQ
ID SEQUENCE Comments
NO
NSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG KGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVA WYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFA TYYCQQHYTTPPTFGCGTKVEIKGGGGSGGGGSGGGGSGGGGSEVQLVES GGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKCLEWVARIYPTNGY TRYADSVKGRFTI SADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAM DYWGQGTLVTVSS
35A EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS Heavy chain of Bs3Ab with L234F ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG ("F"). Construct for ADC. The DAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV highlighted positions correspond to KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ TYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPE LGGPSVFLFPPK sites of known allelic variation. PKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG KGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVA WYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFA TYYCQQHYTTPPTFGCGTKVEIKGGGGSGGGGSGGGGSGGGGSEVQLVES GGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKCLEWVARIYPTNGY TRYADSVKGRFTI SADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAM DYWGQGTLVTVSS
35B EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS Heavy chain of Bs3Ab with I332E.
ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG Construct with enhanced ADCC. DAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV The highlighted positions KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ TYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPK correspond to sites of known allelic PKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY variation.
NSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPEEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG KGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVA WYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFA TYYCQQHYTTPPTFGCGTKVEIKGGGGSGGGGSGGGGSGGGGSEVQLVES GGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKCLEWVARIYPTNGY TRYADSVKGRFTI SADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAM DYWGQGTLVTVSS
36A EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS Heavy chain of Bs3Ab with L234F ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG and S239C ("FC"). Construct for DAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV ADC. The highlighted positions KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
correspond to sites of known allelic TYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPE LGGPCVFLFPPK PKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY variation.
NSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG KGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVA WYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFA TYYCQQHYTTPPTFGCGTKVEIKGGGGSGGGGSGGGGSGGGGSEVQLVES GGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKCLEWVARIYPTNGY TRYADSVKGRFTI SADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAM DYWGQGTLVTVSS
36B EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS Heavy chain of Bs3Ab with S239D ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG and I332E. Construct with enhanced DAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV ADCC. The highlighted positions KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ TYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPDVFLFPPK correspond to sites of known allelic variation. SEQ
ID SEQUENCE Comments
NO
PKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPEEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG KGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVA WYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFA TYYCQQHYTTPPTFGCGTKVEIKGGGGSGGGGSGGGGSGGGGSEVQLVES GGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKCLEWVARIYPTNGY TRYADSVKGRFTI SADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAM DYWGQGTLVTVSS
36C EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS Heavy chain of Bs3Ab with L234F ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG and C239-ins ("C"). Construct for DAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV ADC. The highlighted positions KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ TYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSCVFLFPP correspond to sites of known allelic KPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ variation.
YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GKGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDVNTAV AWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDF ATYYCQQHYTTPPTFGCGTKVEIKGGGGSGGGGSGGGGSGGGGSEVQLVE SGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKCLEWVARIYPTNG YTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYA MDYWGQGTLVTVSS
37A EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS Heavy chain of Bs3Ab with L234F ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG S239C and S442C ("FC"). DAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV Construct for ADC. The highlighted KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ TYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPE LGGPCVFLFPPK positions correspond to sites of PKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY known allelic variation.
NSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLCLSPG KGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVA WYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFA TYYCQQHYTTPPTFGCGTKVEIKGGGGSGGGGSGGGGSGGGGSEVQLVES GGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKCLEWVARIYPTNGY TRYADSVKGRFTI SADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAM DYWGQGTLVTVSS
37B EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS Heavy chain of Bs3Ab with S239D, ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG A330L, and I332E. Construct with DAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV enhanced ADCC. The highlighted KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ TYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPDVFLFPPK positions correspond to sites of PKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY known allelic variation.
NSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPLPEEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG KGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVA WYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTI SSLQPEDFA TYYCQQHYTTPPTFGCGTKVEIKGGGGSGGGGSGGGGSGGGGSEVQLVES GGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKCLEWVARIYPTNGY TRYADSVKGRFTI SADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAM DYWGQGTLVTVSS
37C EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS Heavy chain of Bs3Ab with C239- ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG ins and S442C ("CC"). Construct DAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV for ADC. The highlighted positions KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
correspond to sites of known allelic SEQ
ID SEQUENCE Comments
NO
TYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSCVFLFPP variation.
KPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLCLSP GKGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDVNTAV AWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDF ATYYCQQHYTTPPTFGCGTKVEIKGGGGSGGGGSGGGGSGGGGSEVQLVE SGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKCLEWVARIYPTNG YTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYA MDYWGQGTLVTVSS
38 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS Heavy chain of Bs4Ab-native Fc.
ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG The highlighted positions DAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV correspond to sites of known allelic KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
variation.
TYICNVNHKPSNTKVDKRVEPKSCGKTGGGGSGGGGSDIQMTQSPSSLSA SVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS GSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGCGTKVEIKGGGGSG GGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHW VRQAPGKCLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSL RAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSSGGGGSGGGGSCPPCP APELLGGPSVFLFPPKPKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK
39A EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS Heavy chain of Bs4Ab with L234F ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG ("F"). Construct for ADC. The DAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV highlighted positions correspond to KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
sites of known allelic variation. TYICNVNHKPSNTKVDKRVEPKSCGKTGGGGSGGGGSDIQMTQSPSSLSA SVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS GSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGCGTKVEIKGGGGSG GGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHW VRQAPGKCLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSL RAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSSGGGGSGGGGSCPPCP APEFLGGPSVFLFPPKPKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK
39B EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS Heavy chain Bs4Ab with I332E.
ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG Construct with enhanced ADCC. DAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV The highlighted positions KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
correspond to sites of known allelic TYICNVNHKPSNTKVDKRVEPKSCGKTGGGGSGGGGSDIQMTQSPSSLSA SVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS variation.
GSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGCGTKVEIKGGGGSG GGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHW VRQAPGKCLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSL RAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSSGGGGSGGGGSCPPCP APELLGGPSVFLFPPKPKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPA PEEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK
40A EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS Heavy chain of Bs4Ab with L234F ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG and S239C ("FC"). Construct for DAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV ADC. The highlighted positions SEQ
ID SEQUENCE Comments
NO
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ correspond to sites of known allelic TYICNVNHKPSNTKVDKRVEPKSCGKTGGGGSGGGGSDIQMTQSPSSLSA variation.
SVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS GSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGCGTKVEIKGGGGSG GGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHW VRQAPGKCLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSL RAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSSGGGGSGGGGSCPPCP APEFLGGPCVFLFPPKPKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK
40B EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS Heavy chain of Bs4Ab with S239D ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG and I332E for ADCC. Construct DAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV with enhanced ADCC. The KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
highlighted positions correspond to TYICNVNHKPSNTKVDKRVEPKSCGKTGGGGSGGGGSDIQMTQSPSSLSA SVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS sites of known allelic variation. GSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGCGTKVEIKGGGGSG GGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHW VRQAPGKCLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSL RAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSSGGGGSGGGGSCPPCP APELLGGPDVFLFPPKPKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPA PEEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK
40C EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS Heavy chain of Bs4Ab with and ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG C239-ins ("C"). Construct for ADC. DAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV The highlighted positions KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
correspond to sites of known allelic TYICNVNHKPSNTKVDKRVEPKSCGKTGGGGSGGGGSDIQMTQSPSSLSA SVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS variation.
GSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGCGTKVEIKGGGGSG GGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHW VRQAPGKCLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSL RAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSSGGGGSGGGGSCPPCP APELLGGPSCVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGK
41A EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS Heavy chain of Bs4Ab with L234F, ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG S239C and S442C ("FCC"). DAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV Construct for ADC. The highlighted KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
positions correspond to sites of TYICNVNHKPSNTKVDKRVEPKSCGKTGGGGSGGGGSDIQMTQSPSSLSA SVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS known allelic variation.
GSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGCGTKVEIKGGGGSG GGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHW VRQAPGKCLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSL RAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSSGGGGSGGGGSCPPCP APEFLGGPCVFLFPPKPKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLCLSPGK
41B EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS Heavy chain of Bs4Ab with S239D, ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG A330L, and I332E. Construct with SEQ
ID SEQUENCE Comments
NO
DAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV enhanced ADCC. The highlighted KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ positions correspond to sites of TYICNVNHKPSNTKVDKRVEPKSCGKTGGGGSGGGGSDIQMTQSPSSLSA known allelic variation.
SVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS GSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGCGTKVEIKGGGGSG GGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHW VRQAPGKCLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSL RAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSSGGGGSGGGGSCPPCP APELLGGPDVFLFPPKPKDTLMI SRTPEVTCWVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPL PEEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK
41C EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSS Heavy chain of Bs4Ab with C239- ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG ins and S442C ("CC")- Construct DAYNYYYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV for ADC. The highlighted positions KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
correspond to sites of known allelic TYICNVNHKPSNTKVDKRVEPKSCGKTGGGGSGGGGSDIQMTQSPSSLSA SVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFS variation.
GSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGCGTKVEIKGGGGSG GGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHW VRQAPGKCLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSL RAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSSGGGGSGGGGSCPPCP APELLGGPSCVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLCLSPGK
42A DIVMTQTPLSLSVTPGQPASI SCKSSQSVFFRSNNKNILAWYLQKPGQPP LC construct with kappa chain QLLIYWASSRESGVPDRFSGSGSGTDFTLKI SRVEAEDVGVYYCQQYFGS common to all the antibody PFTFGPGTKVDIKRTVAAPSVFIFPPSDEQLKSGTASWCLLNNFYPREA constructs. The highlighted KVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYAC
positions correspond to sites of EVTHQGLSSPVTKSFNRGEC
known allelic variation.
42B DIVMTQTPLSLSVTPGQPASI SCKSSQSVFFRSNNKNILAWYLQKPGQPP LC construct with lambda chain QLLIYWASSRESGVPDRFSGSGSGTDFTLKI SRVEAEDVGVYYCQQYFGS option for all the antibody PFTFGPGTKVDIKQPKAAPSVTLFPPSSEELQANKATLVCLiSDFYPGAV constructs. The highlighted TVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQ
positions correspond to sites of VTHEGSTVEKTVAPTEC
known allelic variation.
43 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSS VH from clone 1.39.1 antibody ISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGG DGYNYYYFDYWGQGTLVTVSS
44 DIVMTQSPDSLAVSLGERATITCKSSQSVFFRSNNKNCLAWYQQRPGQPP VL from clone 1.39.1 antibody NLLIYWASSRESGVPDRFSGSGSGTDFALTI SSLQTEDVAVYYCQQYFGS PFTFGPGTKVDIK
45 SYSM VH clone 1.39.1 CDR1 (sequence from non lead optimized antibody)
46 GGDGYNYYYFDY VH clone 1.39.1 CDR3 (sequence from non lead optimized antibody)
47 KSSQSVFFRSNNKNCLA VL clone 1.39.1 CDR1 (sequence from non lead optimized antibody)
48 DIVMTQSPDSLAVSLGERATITC VL clone 1.39.1 FW1 (sequence from non lead optimized antibody)
49 WYQQRPGQPPNLLIY VL clone 1.39.1 FW2 (sequence from non lead optimized antibody)
50 GVPDRFSGSGSGTDFALTI SSLQTEDVAVYYC VL clone 1.39.1 FW3 (sequence from non lead optimized antibody) SEQ
ID SEQUENCE Comments
NO
51 TQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLS Extracellular portion of mature FLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDP HER2 (positions 23-652 of LNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDI canonical Isoform 1 ; without signal FHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAG
sequence). Natural variant: W452C. GCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALV TYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEV See Uniprot P04626. See also TAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFG "Structure of the extracellular region SLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDL of HER2 alone and in complex with SVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNT the Herceptin Fab." Cho et al, HLCFVHTVPWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCARGHCWG Nature 421 :756-760 (2003), PGPTQCVNCSQFLRGQECVEECRVLQGLPREYVNARHCLPCHPECQPQNG incorporated herein by reference in SVTCFGPEADQCVACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGA its entirety.
CQPCPINCTHSCVDLDDKGCPAEQRASPLT
52 SLTRTVCAGGCARCKGP HER2 epitope of clone 1.39.1 derived antibodies.
53 LPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARCPSGVKPDLSY HER2 epitope binding region of MPIWKFPDEEGACQP trastuzumab (HERCEPTIN®).
Reported to span residues 538-603 (or residues 561-625 in HER2 with signal sequence); reported to be a conformational epitope with contacts at three loop regions.
54 DTYIH Domain IV scFv VH-CDR1
55 RIYPTNGYTRYADSVKG Domain IV scFv VH-CDR2
56 WGGDGFYAMDY Domain IV scFv VH-CDR3
57 RASQDVNTAVA Domain IV scFv VL-CDR1
58 SASFLYS Domain IV scFv VL-CDR2
59 QQHYTTPPT Domain IV scFv VL-CDR3
[00549] The following examples are offered by way of illustration and not by way of limitation.
EXAMPLES
[00550] Aspects of the present disclosure can be further defined by reference to the following non-limiting examples, which describe in detail preparation of certain antibodies of the present disclosure and methods for using antibodies of the present disclosure. It will be apparent to those skilled in the art that many modifications, both to materials and methods, can be practiced without departing from the scope of the present disclosure. [00551] A number of HER2 antibodies have been approved for use in the treatment of breast cancer patients whose tumor(s) overexpress HER2 including trastuzumab (HE CEPTIN®; see U.S . Pat. No. 5,821,337), pertuzumab (PERJETA™; Patent Publication WO2001/00245) and T-DM1 (ado-trastuzumab emtansine, KADCYLA™, an antibody- drug conjugate consisting of the monoclonal antibody trastuzumab linked to the cytotoxic agent mertansine (DM1), Niculescu-Duvaz et. al., 2010, Curr. Opin. Mol. Ther. 12:350- 60). However, these therapies are not indicated for the majority of patients, who express lower levels of HER2. Additionally, there are patients who do not respond to these therapies or who become resistant. Thus, there is an unmet medical need for superior therapeutics to address these patients.
[00552] As detailed in the specific examples provided below, highly potent bispecific antibodies were generated by combining an optimized fully human anti-HER2 antibody binding a newly described epitope within domain II of HER2 with an scFv binding a known epitope within domain IV of HER2. A number of different bispecific antibody configurations were generated and tested. The unique bispecific antibodies provided exhibit biological activities not seen with any of the mono-specific anti-HER2 antibodies tested. In many assays the bispecific antibodies also demonstrate a synergistic activity over mono-specific anti-HER2 antibodies. A number of the in vitro and in vivo activities of the bispecific antibodies provided herein are further enhanced by the addition of cytotoxic agents (e.g., tubulysin 1508) in the absence of or severely reduced binding activities to Fc gamma receptors. Additionally, it was found that the in vitro activity of the unique bispecific antibodies provided herein may also be enhanced by enhancing ADCC activity, for example by altering glycosylation (e.g., using POTELLEGENT™ technology (Biowa, Inc. Princeton, N.J.) to generated hypofucoslyated antibodies having enhanced ADCC activity). These data suggest that the bispecific antibodies may have therapeutic use, particularly as ADCs or as ADCC enhanced antibodies, for the treatment of cancers expressing a wide range of HER2 levels, including patients currently ineligible for treatment with trastuzumab, pertuzumab or T-DM1. In addition, the bispecific antibodies may have therapeutic use for the treatment of cancer patients that have failed existing anti-HER2 therapies. Example 1
1.1. Lead Optimization
[00553] AZ1.39.1 is a fully human monoclonal antibody against human HER2 that does not compete for binding with either trastuzumab or pertuzumab (Patent Publication WO 2008/019290). 39S is a lead- optimized antibody generated from AZ1.39.1 (Figure 1) as detailed below. Site directed mutagenesis was used to replace an unpaired Cys residue in the CDRl of light chain with He and a potential isomerization site (DG) in the CDR3 of heavy chain was removed by changing the DG to DA. The resulting variant demonstrated the same binding specificity and in vitro anti-proliferative activity as AZ 1.39.1 (data not shown). To generate higher affinity binders, mutagenesis was applied to the CDR residues of heavy chain and the mutants were expressed as IgG in mammalian cells and screened for their binding activity to the recombinant human HER2 extracellular domain protein by capture ELISA. Clones with significantly higher binding signal than the wild- type control were sequenced to reveal the mutation information. A combinatory library was constructed from the identified mutations and screened for binding activity to the recombinant human HER2 extracellular domain protein by capture ELISA. 39S was found to have the highest binding activity, and further sequence analysis revealed that 39S carried a single N5S mutation in the CDRl of heavy chain. The affinity of 39S to human HER2 (KD) is ~ 1.0 nM, determined by BIAcore, in contrast the reported affinity of the parent 1.39.1 antibody is ~ 2.0 nM. Thus, this single mutation resulted in a 2 fold increase in binding affinity over the parental antibody. To improve the antibody expression level the framework sequence, in particular FR1, FR2 and FR3 of the light chain, was swapped from IGKV4-1 + Jk3.01 to the IGVK2D germline sequence, resulting in an approximately 2-fold increase in IgG expression level measured after 7 days in culture (Figure 2).
1.2. Binding Specificity and Species Cross-reactivity of Lead-optimized Antibody 39S
[00554] To determine whether 39S retains the binding specificity and species cross- reactivity of its parental antibody AZ1.39.1, binding of 39S to the receptors of human ErbB family (EGFR, HER2, HER3, and HER4), the mouse Her2, and the cynomolgus monkey Her2 was examined by capture ELISA. Briefly, 96-well plates were coated with one of the following recombinant extracellular domain proteins: human EGFR, human HER2, human HER3, human HER4, mouse Her2, or cynomolgus monkey Her2. Antibody to be tested was prepared by diluting in a stepwise 1:3 serial dilution ranging from 50 nM down to 0.28 pM and then added to the wells in duplicate. After one hour of incubation, plates were washed, and goat anti-human IgG Fab HRP-conjugated secondary antibody was added to each well and the plates were incubated for 1 hour. The plates were washed and TMB substrate was added and incubated for 5-20 min to allow color development. The stop solution was added to the wells at the end of reaction and the plates were read at 450 nm. Binding signal (absorbance at 450 nm) was plotted against antibody concentration using Prism software. Results show that 39S, similar to AZ1.39.1, can bind to human HER2 and cynomolgus monkey Her2, but not to Human EGFR, HER3, HER4, or mouse Her2 (data not shown). 39S Epitope Mapping and Characterization
The domain II of human HER2 was identified as the epitope of 39S by swapping domains between human and mouse Her2 molecules. Mouse Her2 was chosen as the chimeric partner because it is not recognized by 39S, but shares 85% sequence identity with human HER2. Chimeric variants targeting each domain of HER2 were constructed (see method below) as listed in Table 4, including four knock-out (KO, loss-of-function) variants replacing domain I, II, III, or IV of human HER2 with the mouse counterpart, and one knock-in (KI, gain-of-function) variant grafting the domain II of human HER2 into mouse Her2 molecule. The chimeric variant nomenclature denotes types of variants (KO/KI) and the number of domains swapped. The binding profiles of 39S to these variants were characterized using a SPR based instrument ProteOn™ by capturing variants on sensor surfaces using anti-human and mouse Her2 polyclonal antibodies (see method below). The expression of the variants was monitored by anti-His polyclonal antibody using ProteOn™. The binding results of 39S to the loss-of-function variants have demonstrated that domain II is the epitope-containing domain. 39S did not bind to the variant of KO_II encoding for mouse domain II (Table 4), while retained binding to the variant of KO_I encoding for mouse domain I. Although the variants knocking out human domain III and IV (KO_III and KO_IV) did not express, these two domains were excluded as the epitope of 39S basing on the binding results on the gain-of-function variant KI_II. This gain-of-function variant (KI_II), encoding for mouse domain I, III and IV and human domain II, was recognized by 39S with similar binding affinity (168pM) as to human HER2 (84pM). Therefore, the domain II (amino acid 146-310) of human HER2 was identified as the epitope-containing domain of 39S by both loss-of-function and gain-of-function variants.
[00556] We further refined the epitope of 39S and identified the region of amino acid 192-
208 in domain II as the critical epitope region. A series of chimeric human/mouse variants were constructed targeting short regions of domain II possessing different amino acid sequences between human and mouse Her2 proteins, as listed in Table 4. Seven knock-out variants were generated by replacing each of the following human HER2 regions with the mouse counterparts, including amino acids 146-208, 159-162, 171-187, 192-208, 250-261, 276-285, and 295-296. In addition, one knock-in variant was constructed by grafting the region of amino acid 192-208 of human HER2 to the mouse molecule. The variant nomenclature denotes types of variants (KO/KI) and the swapped regions with amino acid numbering. All variants had detectable expression levels by anti- His polyclonal antibody (Table 4). 39S did not bind to any of the chimeric variants, in which the region of amino acid 192-208 of human HER2 was replaced by mouse residues (KO_146-208, KO_192-208). The binding of 39S was not impacted when substituting any other regions of human HER2 with mouse amino acids (KO_159-162, KO_171-187, KO_250-261, KO_276-285, and KO_295-296). Furthermore, 39S bind to the KI variant encoding human 192-208 (KI_192-208) with a KD of 72 pM, comparable to the KD (84 pM) of human HER2. Taken together, the region of amino acid 192-208 in domain II of human HER2 was identified as the functional epitope of 39S.
[00557] The variant nomenclature denotes types of variants (KO/KI) and the swapped regions with amino acid numbering. Amino acid positions were denoted basing on the numbering scheme of mature human HER2 sequences without its signal peptide. The expression levels of all variants were monitored by an anti-His polyclonal antibody. The binding profiles of 39S to these variants were characterized using a SPR based instrument ProteOn™ by capturing variants on sensor surfaces using anti-human and mouse Her2 polyclonal antibodies. By capturing Her2 proteins on sensor surfaces, the measured apparent binding affinities of 39S are expected to be higher than the monovalent binding affinity in the format of immobilizing 39S on chip surfaces.
Table 4. Binding profiles of 39S to chimeric human/mouse Her2 variants
[00558] Construction and expression of chimeric human/mouse Her2 variants were constructed as follows. Briefly, DNAs encoding chimeric human/mouse Her2 variants with a His tag were assembled and amplified by overlapping PCR using human and mouse Her2 plasmids as templates (Medlmmune). The assembled DNAs were cloned into the mammalian expression vector pEBNA (Medlmmune). HEK293F cells were then transiently transfected with the various constructs using 293fectin and standard protocols according to the manufacturer's instructions (Invitrogen).
[00559] The binding characteristics of 39S to chimeric human/mouse variants were studied using a ProteOn™ XPR36 instrument (BioRad). Standard amine coupling was used to immobilize an anti-human or mouse Her2 polyclonal antibody (R&D System) in 10 mM sodium acetate (pH 5.0) to the surface of a GLC biosensor chip at -5000 resonance units (RU) for each channel. The chimeric proteins in cell culture supernatant were injected and captured by anti-human or mouse polyclonal antibodies onto the GLC surface with a -200RU response. Anti-HER2 mAb 39S was diluted in phosphate- buffered saline (PBS) (pH 7.4) with 0.005% Tween-20 from 10 nM to 0.625nM (1:2 dilution), and injected at 100 μΕ/ι ίη for 180 sec with a 600- second dissociation time. Expression levels of chimeric variants were monitored by flowing anti-His polyclonal antibody (Medlmmune) under the same conditions as injecting 39S. The surface was regenerated twice by injecting glycine buffer (lOmM, pH 1.5) at 100 μΕ/ηιίη for 30 sec. All sensorgram data were processed with the ProteOn™ Manager 3.0.1 software.
[00560] A FACS-based binding competition assay was used to determine whether antibodies competed for binding to the same epitope as trastuzumab, and/or pertuzumab. BT-474 cells were harvested, resuspended in FACS buffer, and 2.5 x 105 cells/well were added to a 96-well U-bottom plate. Antibody to be tested (R347 IgGl isotype control, trastuzumab, pertuzumab, AZl.39.1, and 39S) was prepared by diluting in FACS buffer containing 2 μg/mL of Alexa- Fluor 647-labeled 39S antibody in a stepwise 1:4 serial dilution ranging from 500 μg/mL down to 1.9 ng/mL and then added to cells in triplicate. After 1 hour of staining on ice, cells were washed 3 times with ice-cold FACS buffer and then fixed with 2% PFA. Cells were analyzed by a BD LSR II machine with BD FACSDiva™ software. Data were analyzed with FlowJo software and presented as mean MFI ± SEM (n=3).
[00561] Figure 4 shows that 39S binds to the same epitope as its parental antibody
AZl.39.1; and 39S does not compete with trastuzumab or pertuzumab for binding. The binding sites of 39S, pertuzumab and trastuzumab are indicated by arrows on the ribbon structure of HER2 provided in Figure 3. 1.4. In Vitro Activity of 39S
[00562] A panel of human cancer cell lines expressing various levels of HER2 was selected for evaluating the anti-proliferative activity of antibodies or antibody combinations. HER2 expression level in cells was determined by HercepTest and quantitative FACS (Table 5).
TABLE 5: HER2 Expression Levels on Human Cancer Cell Lines
[00563] Proliferation Inhibition Assay: Cells were plated in serum-containing culture media at a density of 5,000 to 20,000 per well (depending on the growth kinetics of each cell line) of 96- well plates in a volume of 100 μί. A 2X concentration of each dose of antibody or antibody combination to be tested was prepared by diluting the test articles in culture medium. One hundred microliters of each test article was added to cells in triplicate such that the final dose curve ranged from 10 μg/mL down to 0.15 ng/mL in a stepwise 1 :4 serial dilution series. For ligand-dependent proliferation inhibition assay, cells were plated in serum-free media and a 4X concentration of each dose of antibody or antibody combination to be tested was prepared by diluting the test articles in serum-free medium. Fifty microliters of each test article was added to cells in triplicate and then 50 μL· of Heregulin-βΐ at a concentration of 32 ng/mL diluted in serum- free medium was added to cells to achieve the final Heregulin-βΐ concentration of 8 ng/mL and the final antibody dose curve ranged from 100 μg/mL down to 6.1 ng/mL in a stepwise 1:4 serial dilution series. The treated cells were cultured at 37 °C / 5% C02 for 4 to 7 days (depending on the growth kinetics of each particular cell line). Cell viability was determined using Cell Titer Glo from Promega according to manufacturer's instructions. Data are analyzed using the GraphPad Prism software and presented as percent growth inhibition relative to the untreated control.
[00564] Figure 5 shows that 39S has a similar activity as pertuzumab in inhibiting ligand- driven proliferation in MCF-7 cells. In combination with trastuzumab or pertuzumab, 39S shows additive or synergistic inhibition of ligand-dependent proliferation with potency comparable to trastuzumab and pertuzumab combination. Similar results were observed in other cells lines such as MDA-MB-361 and RT-112 (data not shown).
[00565] Figure 6 shows that 39S, like pertuzumab, has a limited activity in inhibiting NCI-
N87 cell proliferation in serum-containing media. However when combined with trastuzumab or pertuzumab 39S demonstrates a strong synergistic effect in inhibiting cell growth. Synergy between 39S and trastuzumab or pertuzumab is much greater than that seen with the combination of trastuzumab and pertuzumab. Similar results were observed in BT-474 cells (data not shown).
Example 2
2.1. Bispecific Antibody Construction
[00566] Cloning of Bs2Ab-39SH, Bs3Ab-39SH and Bs4Ab-39SH. Bispecific expression constructs were generated by cloning the variable domains for the anti-HER2 domain IV antibody (SEQ ID NOs: 17 and 18 where X is C) anti-HER2 antibody 39S (SEQ ID NOs: 15 and 16) into expression vectors comprising the appropriate constant regions. The anti- HER2 domain IV variable binding domain was constructed as single-chain Fv (scFv). Using the amino acid sequences of SEQ ID NOs: 17 and 18 (where X-C) above a codon optimized DNA sequence for maximum mammalian protein expression was designed and synthesized. The Bs2Ab and Bs3Ab constructs were generated using methods similar to those described in Dimasi et al., (2009) J. Mol. Biol. 393, 672-692. The Bs4Ab construct was generated using method similar to those described in Patent Publication WO2013070565A1. The final synthetic gene contains two cysteine mutations, one in the light-chain at position 100 and one on the heavy chain at position 44, respectively. These cysteines will form an interchain disulfide bond between the VL and VH domains in order to stabilize the scFv. The two VL and VH domains of the scFv were linked using 20 amino acids residues (G4S)4. The scFv in Bs2Ab was linked to the N-terminus of the heavy chain by using a 10 amino acid residue linker (G4S)2. The scFv in the Bs3Ab format was linked to the C-terminus of the antibody CH3 domain by using a 10 amino acid residue linker (G4S)2. Two linkers of sequence (G4S)2 were used for linking the scFv in the Bs4Ab backbone. Construct identity and fidelity was determined using DNA sequence.
[00567] Figure 7 provides a schematic diagram of each of the Bs2Ab-39SH, Bs3Ab-
39SH, Bs4Ab-39SH bispecific antibody formats (Panels A, B and C, respectively) generated for binding to HER2 antigen. The bispecific antibodies have two binding units, each of which binds a different epitope on the same antigen. The binding units are labeled on the figure. The molecule is bilaterally symmetric with respect to the binding units. As depicted, Bs2Ab-39SH, Bs3Ab-39SH, Bs4Ab-39SH formats refers to bispecific antibodies in which a scFv is fused to the amino terminus of the variable region (Bs2Ab- 39SH), inserted into a modified hinge region (Bs4Ab-39SH) or the carboxy-terminus of CH3 (Bs3Ab-39SH) of a heavy chain through a linker (e.g., (G4S)2). The three bispecific constructs shown are comprised of an anti-HER2 domain IV binding scFv fused to an anti-HER2 domain II human IgGl via a glycine serine linker (e.g., (G4S)2).
[00568] The amino acid sequences of the Bs2Ab-39SH, Bs3Ab-39SH and Bs4Ab-39SH constructs are provided in Figure 8 (also see SEQ ID NOs: 30, 34, and 38 native Fc region). Figure 8 A shows the bispecific antibody heavy chain amino acid sequences for Bs2Ab-39SH and possible substitution sites for enhanced ADCC and or site specific Antibody Drug Conjugation for two and four drug loading. The anti-HER2 domain IV scFv is in the VL-(G4S)4 linker- VH format and is genetically linked to the amino terminus of the anti-HER2 domain II antibody heavy chain via a (G4S)2 linker. The amino acid substitutions and or insertions depicted within can be made in the CH2 and CH3 of the antibody for enhanced ADCC and site specific conjugation. Figure 8B shows the bispecific antibody heavy chain amino acid sequences for Bs3Ab-39SH and possible substitution sites for enhanced ADCC and or site specific Antibody Drug Conjugation for two and four drug loading. The anti-HER2 domain IV scFv is in the VL-(G4S)4 linker- VH format and is genetically linked to the carboxy-terminus of the anti-HER2 domain II antibody heavy chain via a (G4S)2 linker. The amino acid substitutions and or insertions depicted within can be made in the CH2 and CH3 of the antibody for enhanced ADCC and site specific conjugation. Figure 8C shows the bispecific antibody heavy chain amino acid sequences for Bs4Ab-39SH and possible substitution sites for enhanced ADCC and or site specific Antibody Drug Conjugation for two and four drug loading. The anti- HER2 domain IV scFv is in the VL-(G4S)4 linker- VH format and is inserted into a modified hinge region of the anti-HER2 domain II antibody heavy chain via two (G4S)2 linkers. The amino acid substitutions and or insertions depicted within can be made in the CH2 and CH3 of the antibody for enhanced ADCC and site specific conjugation.
2.2. Binding Specificity and Species Cross-reactivity of Bispecific Antibody
[00569] Binding specificity and species cross-reactivity of bispecific antibodies to the recombinant extracellular domain protein of human EGFR, human HER2, human HER3, human HER4, mouse Her2, or cynomolgus monkey Her2 were determined by capture ELISA as described in Example 1. Results show that all bispecific antibodies tested, including Bs2Ab-39SH, Bs3Ab-39SH and Bs4Ab-39SH, are able to bind to human HER2 and cynomolgus monkey Her2 at similar potency and none of them shows binding to the Human EGFR, HER3, HER4, or the mouse Her2 (data not shown), suggesting the bispecific antibodies retain the binding specificity of species cross -reactivity of their parental monoclonal antibodies.
[00570] Binding kinetics of the bispecific antibodies to human HER2 and cynomolgus monkey Her2 are determined by BIAcore (data not shown). The affinity to human HER2 (KD) is 113 pM for Bs2Ab-39SH, and 236 pM for Bs4Ab-39SH. 2.3. In Vitro Activity of Bispecific Antibody
[00571] Activity of bispecific antibody in inhibiting ligand-driven cell proliferation was determined using method described in Example 1. Results show that Bs2Ab-39SH, Bs3Ab-39SH and Bs4Ab-39SH have similar potency in MDA-MB-361 cells (Figure 9A) and MCF-7 cells (Figure 9B), which is also comparable to the activity of parental antibody combination (39S plus trastuzumab). Similar results were observed in other cell lines including NCI-N87 and RT-112 (data not shown).
2.4. Disruption of HER2:HER3 Heterodimerization by Bispecific Antibody
[00572] T47D cells were harvested, washed and resuspended in serum-free media. Cells were seeded at a density of 1 x 106 cells/well in a 6- well plate and then incubated overnight at 37°C/5 C02. The next day cells were pre-treated for 1 hour with antibody to be tested (R347 IgGl isotype control, trastuzumab, pertuzumab, 39S, and Bs2Ab- 39SH) at a concentration of 500 nM. After pre-treatment, heregulin-βΐ was added at a final concentration of 8 ng/mL and cells were incubated for 5 min at 37°C/5 C02. Cells were then washed twice with ice-cold lx PBS, lysed and immune-precipitated using mouse anti-human HER2 (clone 44E7) antibody and the Pierce Classic IP Kit from Thermo Scientific according to manufacturer's instructions. Immune-precipitated protein samples were eluted in Laemmli buffer containing 2-mecaptoethanol and analyzed by Western blot using standard protocol. Rabbit anti-human HER2 (clone 29D8) antibody was used to detect HER2 and rabbit anti-human HER3 (C-17) polyclonal antibody was used to detect HER3 in the Western blot analysis.
[00573] Figure 10 shows that Bs2Ab-39SH and 39S, similar to pertuzumab, can disrupt
HER2:HER3 heterodimerization induced by ligand stimulation.
2.5. Clustering of HER2 by Bispecific Antibody
[00574] To examine whether the bispecific antibody can cross-link HER2 to form a large complex, the recombinant human HER2 extracellular domain protein was mixed with Bs2Ab-39SH or trastuzumab at various molar ratios and incubated at room temperature for 30 min. The formed immune complexes were separated by HPLC size-exclusion chromatography; the sizes of which were then analyzed by Multi-Angle Light Scattering (MALS) assay.
[00575] Figure 11 shows the representative data derived from antibody:HER2 molar ratio of 1: 1 (data at other molar ratios not shown). Results indicate that Bs2Ab-39SH can cross-link many HER2 molecules to form a protein complex as large as 1716 kDa in size, while trastuzumab can only bind to two HER2 molecules in maximal to form a 320 kDa complex. Similar results were observed with Bs4Ab-39SH (data not shown).
2.6. Enhanced Internalization and Lysosomal Trafficking by Bispecific Antibody
[00576] Antibody internalization was measured by FACS. BT-474 cells were harvested from a T150 flask, resuspended in ice-cold culture media and then added to a 96-well U- bottom plate at 1 x 106 cells/well. Cells were pelleted by centrifugation at 4°C. Media were flicked off, and cell pellets were resuspended in triplicate in 150 μΐ^ of ice-cold culture media containing 10 μg/mL antibody or antibody combination to be tested (R347 IgGl isotype control, trastuzumab, pertuzumab, AZ1.39.1, 39S, trastuzumab+39S, trastuzumab+pertuzumab, pertuzumab+39S, trastuzumab+pertuzumab+39S, Bs2Ab- 39SH, Bs3Ab-39SH, and Bs4Ab-39SH). Cells were incubated on ice for 1 hour and then washed to remove unbound antibodies. An aliquot of cells was kept on ice; the rest was incubated at 37°C/5 C02 for a different period of time (30 min, 1 hour, 2 hours, or 4 hours) and then cooled on ice immediately. Cells were washed twice with ice-cold FACS buffer and then fixed with 4% PFA for 20 min. Following fixation, cells were stained with anti-human IgG Alexa-Fluor 488 and analyzed by a BD LSR II machine and BD FACSDiva™ software. Data were analyzed with FlowJo software. Receptor-antibody complex internalization was calculated as percent mean fluorescent intensity (MFI) loss at 37°C relative to that on ice after subtracted by the background value of MFI derived from the untreated control.
[00577] Figure 12 shows that the bispecific antibody (Bs2Ab-39SH, Bs3Ab-39SH,
Bs4Ab-39SH) can induce a much faster and stronger internalization than any single mono-specific antibody or antibody combination. Pertuzumab, AZ1.39.1, trastuzumab+pertuzumab, pertuzumab+39S, and trastuzumab+pertuzumab+39S have similar or lower internalization profiles to that of 39S and are not shown in the graph. Similar results were observed in cell lines NCI-N87, MDA-MB-361 and RT-112 (data not shown).
[00578] Confocal microscopy method was used to visualize antibody internalization and lysosomal trafficking. BT-474 cells were harvested from a T-150 flask and resuspended in ice-cold culture media and then added to a 96-well U-bottom plate at 2.5 x 105 cells/well. Cells were pelleted by centrifugation at 4°C. Media were flicked off, and cell pellets were resuspended in 150 μΐ^ of ice-cold culture media in the presence of 10 μg/mL antibody to be tested, such as R347 IgGl isotype control, trastuzumab, Bs2Ab- 39SH, and Bs4Ab-39SH. Cells were incubated at 37°C/5 C02 for a different period of time (30 min, 2 hours, 4 hours, or 6 hours) and then cooled on ice immediately. Cells were washed twice with ice-cold FACS buffer and then fixed and permeabilized using BD Biosciences Cytofix/Cytoperm™ Fixation/Permeabilization Solution according to manufacturer's instructions. Cells were stained in the dark with anti-human IgG Alexa- Fluor 488, and mouse anti-human LAMP-1 (clone H4A3) followed by anti-mouse IgG Alexa- Fluor 647. After staining, cells were cytospun onto positive charge slides and coversliped with ProLong® Gold Antifade Reagent containing DAPI. Cells were then visualized by Leica SP5 Confocal Microscope and the Leica Application Suite Advanced Fluorescence software suite.
[00579] Figure 13 shows the antibody internalization and trafficking to the lysosomes.
Both Bs2Ab-39SH and Bs4Ab-39SH promote much faster internalization and stronger lysosomal trafficking than trastuzumab, which show little to no internalization (data for Bs4Ab-39SH not shown).
[00580] Western blot analysis was used to monitor lysosomal degradation of HER2. BT-
474 cells were harvested, washed and resuspended in culture media. Cells were seeded at a density of 5 x 104 cells/well in a 96-well plate and treated at 37°C/5 C02 with antibody to be tested (R347 IgGl isotype control, trastuzumab, pertuzumab, 39S, trastuzumab+pertuzumab, trastuzumab+39S, pertuzumab+39S, trastuzumab+pertuzumab+39S, Bs2Ab-39SH, Bs3Ab-39SH, and Bs4Ab-39SH) at a concentration of 500 nM for 2 hours, 6 hours, or 24 hours. At the end of treatment, cells were washed twice with ice-cold lx PBS and then lysed in M-PER Mammalian Protein Extract buffer from Thermo Scientific according to manufacturer's instructions. Protein concentration of each lysate was measured by BCA assay. Equal amount of protein in each lysate was loaded onto gel in Western blot. Rabbit anti-human HER2 (clone 29D8) antibody and rabbit anti-human GAPDH (clone D16H11) antibody were used to detect HER2 and GAPDH, respectively.
[00581] Figure 14 shows that treatment with the bispecific antibody (Bs2Ab-39SH,
Bs3Ab-39SH, or Bs4Ab-39SH) leads to the significant HER2 degradation in BT-474 cells, and mono-specific antibody or antibody combination induces no or limited HER2 degradation.
Example 3
3.1. Cloning of site-specific mutants for site-specific conjugation and for ablating Fc gamma receptor binding activities
[00582] Standard overlapping PCR methods were used to introduce the mutation L234F,
S239C and S442C, independently or in combination (L234F-S239C (FC) and L234F- S239C-S442C (FCC)) into the Fc portion of the Bs2Ab-39SH and Bs4Ab-39SH constructs. The Primers were designed to contain desired mutations and flanking primers, containing restriction sites to facilitate directional cloning, were used to amplify the Fc fragments containing the specific mutations. Modified Fc PCR products were cloned into mammalian expression vectors using defined restrictions sites. Identities of Fc mutations were confirmed by DNA sequence analysis.
[00583] Figure. 15 shows illustrations of three anti-HER2 bispecific antibodies, (Bs2Ab-
39SH, Bs3Ab-39SH, Bs4Ab-39SH) with amino acids substitutions for site specific conjugation. In addition, the L234F substitution on the CH2 of the antibody heavy chain (not depicted in the figure) is used to minimize Fc gamma receptor binding. Where 2 DAR is desired a cysteine substitution is engineered at site 1 (e.g., S239C) or site 2 (e.g., S442C), and for 4 DAR a cysteine substitution is engineered at both sites. The bispecific - drug constructs are also referred to herein as Bs2-2T/Bs2-4T, Bs3-2T/Bs34T, and Bs4- 2T/Bs4-4T.
[00584] The resulting bispecific antibodies were conjugated to the tubulysin 1508 payload essentially as described below (see Example 5). 3.2. Binding Specificity and Species Cross-reactivity of Bispecific ADC
[00585] To determine whether the conjugation of tubulysin 1508 alters antigen binding specificity and species cross-reactivity, binding activity of bispecific ADC to the recombinant extracellular domain protein of human EGFR, human HER2, human HER3, human HER4, mouse Her2, and cynomolgus monkey Her2 were confirmed by capture ELISA as described in Example 1. Results show that conjugation did not change the antigen binding specificity and species cross -reactivity of the bispecific ADC. Both Bs2- 4T and Bs4-4T can bind to human HER2 and cynomolgus monkey Her2 at the same potency as their unconjugated version; and none of them shows binding to the human EGFR, HER3, HER4, or the mouse Her2 (data not shown). Binding kinetics of the bispecific ADC to human HER2 are determined by BIAcore and results show that the affinity to human HER2 (KD) is 120 pM for Bs2-4T, and 271 pM for Bs4-4T.
3.3. Disruption of Intracellular Microtubule Network by Bispecific ADC
[00586] To examine the disruption of intracellular microtubule network by anti-HER2
ADC, three cell lines were selected: SKOV-3, JIMT- 1, and RT112, which represent the T-DM1 eligible, the T-DM1 non-responder, and the T-DM1 ineligible, respectively. On day 1, cells were harvested by trypsinization, resuspended in culture media, and then seeded in 8- well chamber slides at a density of 6 x 104 cells/well. Slides were incubated at 37°C/5 CO2 overnight. On day 2, media were aspirated to remove any unattached cells and then fresh media containing 5 nM ADC to be tested were added to the cells. Slides were incubated at 37°C/5 C02 overnight. On day 3, each chamber was washed twice with lx PBS. Cells were then fixed with 4% PFA for 20 min. At the end of fixation, the chambers were removed and slides were stained following standard immunofluorescence procedures. Briefly, cells were permeabilized using Triton X- 100 and washed with lx PBS containing Tween-20. Rabbit anti-human a- Tubulin Alexa- Fluor 488 (clone 11H10) was diluted by 1 : 100 in DAKO antibody diluent and added to the slides. After incubation at room temperature for 1 hour, slides were coversliped with ProLong® Gold Antifade Reagent containing DAPI. Stained cells were visualized by the Leica SP5 Confocal Microscope and the Leica Application Suite Advanced Fluorescence software suite. [00587] Figure 16A shows in SKOV-3, a cell line representing T-DMl eligible patients, that both T-DMl and Bs2-4T are capable of disrupting microtubule networks. Similar results were observed in SKBR-3 cells (data not shown).
[00588] Figure 16B shows in JIMT-1, a cell line representing T-DMl non-responder patients, that only Bs2-4T is able to disrupt intracellular microtubule networks.
[00589] Figure 16C shows in RT-112, a cell line representing T-DMl ineligible patients, that Bs2-4T is able to disrupt intracellular microtubule networks, while T-DMl is inactive.
3.4. In Vitro Activity of Bispecific ADC
[00590] A panel of human cancer cell lines expressing various levels of HER2 was used to evaluate the cytotoxic activity of bispecific ADC (Table 5 in Example 1). Briefly, cells were harvested, resuspended, and plated in serum-containing culture media at a density of 5,000 to 20,000 per well (depending on the growth kinetics of each cell line) of 96-well plates in a volume of 100 μΐ^. A 2X concentration of each dose of antibody or ADC to be tested was prepared by diluting the test articles in culture medium. One hundred microliters of each test article was added to cells in triplicate such that the final dose curve ranged from 5 nM down to 0.08 pM in a stepwise 1:4 serial dilution series. The treated cells were incubated at 37°C/5 C02 for 3 to 4 days, depending on the growth kinetics of each particular cell line. Cell viability was determined using Cell Titer Glo according to manufacturer's instructions. Data are analyzed by the GraphPad Prism software and presented as percent growth inhibition relative to the untreated control. EC50 values were determined using Sigmoidal non-linear regression analysis with GraphPad Prism software and were summarized in Table 6.
Table 6: In vitro potency of anti-HER2 ADC in a panel of cancer cell lines (EC50 in pM)
JIMT-1 Inactive 13.3 7.1 5.1 3.1
MDA-MB-453 344.3 19.0 13.0 10.5 8.6
RT-112 Inactive 4635 2938 36.5 23.5
MCF7-GTU Inactive Inactive Inactive 84.5 61.4
ZR-75-1 Inactive 1543 753.5 18.1 20.9
T47D Inactive Inactive Inactive Inactive Inactive
MCF-7 Inactive Inactive Inactive Inactive Inactive
MDA-MB-468 Inactive Inactive Inactive Inactive Inactive
[00591] Figure 17A shows the cytotoxic activity of Bs2-2T and Bs2-4T relative to T-DMl and various controls in SKBR-3, a human breast cancer cell line representing the T-DMl eligible patients. Data indicate that both Bs2-2T and Bs2-4T are more potent than T-DMl in SKBR-3 cells.
[00592] Figure 17B shows the cytotoxic activity of Bs4-2T and Bs4-4T relative to T-DMl and various controls in SKBR-3, a human breast cancer cell line representing the T-DMl eligible patients. Data indicate that both Bs4-2T and Bs4-4T are more potent than T-DMl in SKBR-3 cells.
[00593] Figure 18A shows the cytotoxic activity of Bs2-2T and Bs2-4T relative to T-DMl and various controls in JIMT-1, a human breast cancer cell line representing the T-DMl eligible but non-responder patients. Data indicate that both Bs2-2T and Bs2-4T are very potent in killing JIMT-1 cells, while T-DMl shows no activity.
[00594] Figure 18B shows the cytotoxic activity of Bs4-2T and Bs4-4T relative to T-DMl and various controls in JIMT-1, a human breast cancer cell line representing the T-DMl eligible but non-responder patients. Data indicate that both Bs4-2T and Bs4-4T are very potent in killing JJJVIT-l cells, while T-DMl shows no activity.
[00595] Figure 19A shows the cytotoxic activity of Bs2-2T and Bs2-4T relative to T-DMl and various controls in ZR-75-1, a human breast cancer cell line representing the T-DMl ineligible patients. Data indicate that Bs2-4T is the most active in killing ZR-75-1 cells, while Bs2-2T has a lower level of activity and T-DMl shows no or limited cytotoxic activity. [00596] Figure 19B shows the cytotoxic activity of Bs4-2T and Bs4-4T relative to T-DM1 and various controls in ZR-75-1, a human breast cancer cell line representing the T-DM1 ineligible patients. Data indicate that Bs4-4T is the most active in killing ZR-75-1 cells, while Bs4-2T has a lower level of activity and T-DM1 shows no or limited cytotoxic activity.
[00597] Figure 20 shows the cytotoxic activity of Bs2-2T and Bs2-4T relative to T-DM1 and various controls in MDA-MB-468, a human breast cancer cell line with no HER2 expression. Data indicate that neither Bs2-2T nor Bs2-4T is active in MDA-MB-468 cells, indicating that the cytotoxic activity of Bs2-2T and Bs2-4T is target (i.e. HER2)- dependent. Similar results were observed with Bs4-2T and Bs4-4T (data not shown).
3.5. In Vivo Activity of Bispecific ADC Constructs
[00598] Cell Line-Based Xenograft ( CBX) Tumor Models and Patient-Derived Xenograft
(PDX) Tumor Models: All mouse experiments were carried out in compliance with the guidelines published by the Association for Assessment and Accreditation of Laboratory Animal Care (AAALAC) and protocols approved by the Medlmmune Institutional Animal Care and Use Committee. Athymic nude mice between 4-8 weeks of age were used in the studies. In subcutaneous CBX models, animals were injected unilaterally on the right flank with tumor cells harvested from culture at a specific passage lot. In orthotopic CBX models, xenografts were established by injecting 5 x 106 cells per mouse (suspended in 50% matrigel) into the mammary fat pad on the right flank of animals. In PDX models, animals are implanted unilaterally on the flank with tumor fragments harvested from host animals each implanted from a specific passage lot. Pre-study tumor volumes were recorded for each experiment beginning approximately one week prior to its estimated start date. When tumors reach the appropriate tumor volume initiation (TVI) range (typically 150-250 mm ), animals are randomized into treatment and control groups and dosing initiated. Animals were dosed once weekly unless otherwise specified with test articles via intravenous or intraperitoneal injection. Animals were observed daily and tumor dimensions and body weights were measured and recorded twice weekly. Tumor volumes are calculated using the following formula: tumor volume= π ÷ 6 (length x width 2 ). Tumor growth curve was presented as the mean tumor volume (mm 3 ) ± SEM. [00599] Figure 21 A shows that even at lower concentrations (1 mg/kg) Bs2-4T has higher in vivo activity relative to T-DMl (3 mg/kg) and various controls (all at 3 mg/kg) in MDA-MB-361 model, a human breast cancer CBX tumor model representing the T-DMl ineligible patients. Data demonstrate that Bs2-4T induced a dose-dependent tumor growth inhibition, and at 3 mg/kg dose Bs2-4T induced complete tumor regression while T-DMl showed limited activity. At 3 mg/kg Bs4-4T also exhibited higher in vivo activity relative to T-DMl (Figure 21B).
[00600] FIG. 22 shows the in vivo activity of Bs2-2T relative to Bs2-4T and T-DMl in
ST996 model. ST996 is a primary PDX model derived from a triple-negative breast cancer patient (HER2 IHC: 1+; ER-; PR-). Data demonstrate that Bs2-2T at 3 mg/kg dose induced a robust tumor growth inhibition, although its anti-tumor potency was slightly reduced as compared to Bs2-4T. In contrast, T-DMl showed no activity in ST996 model. Similar results were observed in additional low HER2-expressing PDX models ST738, ST455B, and ST821 (data not shown).
[00601] Figure 23 shows the in vivo activity of Bs2-4T relative to T-DMl and various controls in ST225 model, a human breast cancer PDX tumor model representing T-DMl eligible patients. Data demonstrate that Bs2-4T at 3 mg/kg dose induced complete and durable tumor regression. In contrast, T-DMl only induced tumor stasis during the treatment phase and the tumor re-grew quickly after the treatment was stopped.
[00602] Figure 24 shows the in vivo activity of Bs2-4T relative to T-DMl and various controls in JIMT-1 model, a human breast cancer CBX orthotopic tumor model representing T-DMl eligible but non-responder patients. Data demonstrate that Bs2-4T at 3 mg/kg dose induced complete and durable tumor regression. In contrast, T-DMl or T- DM1 plus pertuzumab combination showed no activity.
[00603] Figure 25 shows the in vivo activity of Bs2-4T relative to T-DMl and various controls in ST455B model. ST455B is a primary PDX model derived from a triple- negative breast cancer patient (HER2 IHC: 1+, ER-, PR-). Data demonstrate that Bs2-4T at 3 mg/kg dose induced complete tumor regression while T-DMl showed no activity.To further expand the finding shown in Figure 25, we have examined Bs2-4T in another 16 PDX models derived from breast cancer patients with relatively low levels of HER2 expression (+1 to +2 via HercepTest). Other criteria were also considered in the selection of these models, including the degree of heterogeneity in HER2 expression, ER/PR status and histopathologic subclass, to maximize the diversity of tumor subtypes in the study. Table 7 summarizes the in vivo activity of Bs2-4T in these 17 different PDX breast cancer models. Bs2-4T demonstrated potent anti-tumor activity regardless of the histopathologic subclass and ER/PR status of the tumor. At the dose of 1 mg/kg, 41% of the tumor models showed tumor regression and 6% showed tumor stasis. At the dose of 3 mg/kg, 71% of the models showed tumor regression and 12% showed tumor stasis.
[00604] These studies demonstrate the superior activity of the Bispecific ADCs of the instant invention as compared to mono-specific ADC therapies (e.g. T-DM1) across a wide range of breast cancer models. In particular, the Bispecific ADCs of the instant invention have in vivo activity in cancer models with low levels of HER2 expression and in models of T-DM1 non-responder patients.
[00605] Table 7: Summary of in vivo efficacy of Bs2-4T in a panel of PDX breast cancer models representing HER2-low/T-DMl ineligible patients. At the time-point showing maximal response to the Bs2-4T treatment, if the tumor volume is decreased as compared to the tumor volume at dosing initiated (TVI), the in vivo efficacy is expressed as percent tumor volume change over the TVI. Otherwise the in vivo efficacy is expressed as percent tumor volume change relative to the vehicle control. Responsiveness to the treatment ranked as "regression" if the tumor volume decreased by >20%, "stasis" if the tumor volume changed <20%, and "progression" if the tumor volume increased by
>20%.
3.6. Activity of Bispecific ADC in Tumor Models with Acquired T-DM1 Resistance
[00606] NCI-N87 cells with acquired resistance to T-DM1 were generated through continuous treatment with gradually increased concentration of T-DM1 up to 5 μg/mL. In vitro cytotoxic activity of Bs2-4T relative to T-DM1 was examined in both parental and resistant cell lines as described in Example 3. Results shown in Figure 26 A indicate that both Bs2-4T and T-DM1 are active in the parental NCI-N87 cells although Bs2-4T is more potent than T-DM1 (left panel). In the resistant cell line, T-DM1 has lost the activity, whereas Bs2-4T is still active in killing the resistant cells (right panel). Other resistant cell lines were also generated through continuous treatment with T-DM1, including BT-474, SKOV-3, and MDA-MB-361, and similar cytotoxic activity was observed with Bs2-4T in these resistant cell lines (data not shown).
[00607] To establish an in vivo tumor model with acquired T-DM1 resistance, the T-DM1- resistant NCI-N87 cells were injected subcutaneously into the immune-deficient mice. The tumor-bearing mice were treated with 3 mg/kg of T-DM1. It appeared that the in vitro T-DM1 resistance was not fully translated into the in vivo resistance, reflected by considerable variations in tumor growth among animals. Thus, mice with large refractory tumors (-1000 mm in volume) were selected and the tumor tissue fragments were passaged to new mice until the tumors grew consistently in the presence of weekly treatment of 3 mg/kg T-DM1. After three passages, stable resistant tumors evolved and these tumors were fragmented and implanted into mice to evaluate the in vivo activity of Bs2-4T. As demonstrated in Figure 26B, tumors relapsed from the repeated T-DM1 treatment were not only resistant to T-DM1, but also unresponsive to T-DM1 and pertuzumab combination treatment. In contrast, Bs2-4T induced a robust and sustained tumor regression after treatment, suggesting its potential as an effective therapy for the T- DM1 relapsed/refractory patients.
[00608] Figure 26B shows that Bs2-4T induces tumor regression in the T-DM1 resistant
NCTN87 tumor model. Tumor growth curves, in response to weekly intravenous dosing of Bs2-4T (3 mg/kg), T-DM1 (3 mg/kg) or other control antibody/ ADC (3 mg/kg, except for pertuzumab which is 10 mg/kg) for a total of 4 doses, are shown as the mean tumor volume (mm ) ± SEM (n=7). *P < 0.001 by Student's t test as compared to the untreated control group. 3.7. In Vivo Anti-tumor Activity of Bispecific ADC is not Attenuated by Pretreatment of Trastuzumab
[00609] ST225 PDX tumor fragments were implanted unilaterally on the flank of athymic nude mice. Mice were randomized into treatment and control groups and dosing initiated when tumor volumes reached 200-250 mm . In the treatment groups, mice were either dosed with vehicle buffer or trastuzumab (3 mg/kg). Three days later, mice received weekly intravenous injection of Bs2-4T for a total 4 doses. Figure 27 shows that pretreatment of trastuzumab does not attenuate the anti-tumor activity of Bs2-4T in the ST225 PDX model, suggesting that a washout period may not be needed if Bs2-4T is used to treat patients that are relapsed/refractory to trastuzumab or T-DMl . ST225 is a primary breast cancer PDX model with HER2 overexpression. Tumor growth curves in response to various treatment are presented in Figure 27 as the mean tumor volume (mm3) ± SEM (n=10).
3.8. Bystander Effect of Bispecific ADC
[00610] NCI-N87 cells were stably transfected with green fluorescent protein (GFP) and MDA-MB-468 cells were stably transfected with red fluorescent protein (RFP). Both cell lines were harvested, washed, resuspended in culture media and then seeded in the same well of a 6-well plate as co-culture. As a control, each cell line was seeded in a different 6-well plate as single culture (Figure 28 A). To adjust to different growth kinetics, NCI-N87 cells were seeded at 5 x 105 cells/well and MDA-MB-468 cells were seeded at 2 x 105 cells/well. Cells were incubated for 2 days at 37°C/5 C02. Media were aspirated and fresh media containing 5 nM of antibody or ADC to be tested was added to cells and the plates were incubated for 4 days at 37°C/5 C02. At the end of treatment, cells in each well were collected, washed, resuspended in 100 μΐ^ of ice-cold FACS buffer and then fixed with 2% PFA. Cells were analyzed by a BD LSR II machine and BD FACSDiva™ software. Data were analyzed with FlowJo software.
[00611] Figure 28B demonstrates that Bs2-4T can kill both HER2-overexpressing and
HER2-null cells in a co-culture, suggesting that Bs2-4T has bystander effect. In contrast, T-DMl cannot kill HER2-null cells in a co-culture, suggesting that it does not have bystander effect. As controls, both Bs2-4T and T-DMl showed potent killing of NCT N87 cells in single cultures and neither Bs2-4T nor T-DM1 showed killing of MDA-MB- 468 cells in single cultures (data not shown).
3.9. Activity of Bispecific ADC against Cancer Stem Cells
[00612] Cancer Stem Cell Sphere Assay: MDA-MB-361 cells were cultured under standard tissue culture conditions in Leibovitz's L-15 medium supplemented with 20% FBS. Cells were harvested by trypsinization, washed twice with PBS, and resuspended to 30,000 cells per mL in stem cell medium (SCM: DMEM/F12 supplemented with 20 ng/mL EGF, lOng/mL bFGF, 5 mg/mL insulin, 0.4% BSA and 1% knock-out serum replacement). To form primary spheres, 1 mL of cells were plated into 24-well ultra-low attachment plates and treated with 10 pM of either R347-4T, T-DM1 or BS2-4T and incubated for 4 days at 37°C/5% C02. At the end of treatment, the primary spheres were harvested, dissociated using 0.05% trypsin and resuspended at a density of 30,000 cells/mL in SCM containing the same antibody treatment as the primary sphere culture. Cells were then plated in triplicate into 96-well ultra-low attachment plates and incubated for 4 days. Sphere cell viability was determined using Cell Titer Glo according to manufacturer's instructions. Data are presented as fold of CSC sphere formation relative to the untreated control. Figure 29 (left panel) shows that Bs2-4T inhibited CSC sphere formation by 84% and T-DM1 had no activity in inhibiting CSC sphere formation. Similar results were observed in other cancer cell lines including BT-474, JIMT-1 and T47D (data not shown).
[00613] Assessment of Cancer Stem Cells in Xenograft Tumors Treated with Bs2-4T:
Tumors from MDA-BM-361 xenograft studies evaluating the in vivo activity of Bs2-4T were excised, cut into 4 mm pieces and cryopreserved using Cryostor. Frozen tumor pieces were thawed at 37°C, washed twice in Hank's Balanced Salt Solution (HBSS) and further minced using sterile scalpel blades. To obtain single-cell suspensions, the tumor pieces were then mixed with 200 units of ultrapure collagenase III per mL of DMEM/F12 medium. The tumor suspension was incubated at 37 °C for approximately 1 hour, with mechanical disruption every 30 minutes. At the end of the incubation, cells were filtered through a 70-μιη nylon mesh and washed twice with HBSS. Following the last wash, cells were put through a 40- μιη cell strainer and counted using a Vi-Cell XR Cell Viability Analyzer. Cells were assayed for aldehyde dehydrogenase activity as a measure of CSCs using the Stemcell Technologies Aldefluor kit and following manufacturer's instructions. The cells were run on an LSRII flow cytometer and analyzed with FlowJo. Figure 29 (right panel) shows that the treatment with Bs2-4T resulted in reduction of CSC by 54% in MDA-MB-361 breast cancer xenograft model.
Example 4
4.1. Afucosylated Bispecific Antibody Production and Characterization
[00614] The bispecific antibodies were expressed using POTELLEGENT™ technology
(Biowa, Inc. Princeton, N.J.) to generated afucoslyated antibodies having enhanced ADCC activity. Table 8 shows the KD (nM) as measured by BIAcore of Bs2Ab-39SH and Bs4Ab-39SH bispecific antibodies and trastuzumab with fucosylation (_Fuc) and without fucosylation (_aFuc) binding to Fc gamma receptors (FcyRs) and Clq demonstrating that the afucosylated antibodies have enhanced binding to FcyRI, and both alleles of FcyRIIIa.
Table 8: KD (nM) Measured by BIAcore
[00615] Measurement of Equilibrium Binding Constants: Human Fc Gamma Receptors:
The binding constants (¾) for the binding of anti-HER2 bispecific antibodies to human FcyRs were measured on a ProteOn XPR36 instrument. Briefly, the bispecific antibodies were immobilized at high density on a GLC sensor chip using a standard amino coupling chemistry as outlined by the instrument manufacturer. The final surface density of IgG measured approximately 3000 RU. A reference flow cell was also prepared on this sensor chip using the identical immobilization protocol minus protein. Stock solutions of each FcyR were prepared at either 4000 nM, 16,000 nM, or 32,000 nM in instrument buffer (phosphate buffered saline [PBS]/Tween/Ethylenediaminetetraaceticacid [EDTA] buffer containing 50 mM phosphate, pH 7.4, 0.15 M NaCl, 3 mM EDTA, and 0.005% Tween- 20), and then serially diluted (1:3) in the same buffer to obtain the desired concentration series for each receptor: 1.82 nM-4,000 nM (FcyRI), 197.5 nM- 16,000 nM (FcyRIIA), 395.1 nM-16,000 nM (FcyRIIb), 21.9 nM-16,000 nM (hFcgRIIIA-158V), and 395- 32,000 mM (FCYRIIIA-158F). Each concentration of FcyR was injected over both the bispecific antibody and reference cell surfaces at a flow rate of 25 μΕ/ηιίη for 8 min, during which binding data were collected. Between injections, the surfaces were regenerated (i.e., bound FcyR was removed) with a 60-sec pulse of 5 mM HCl. Several buffer injections were also interspersed throughout the injection series. Later, one of these buffer injections along with the reference cell data was used to correct the binding data for any injection artifacts (e.g., nonspecific binding) through a technique commonly referred to as "double-referencing" (Myszka, 1999). After all binding data were collected, individual data sets were averaged for binding (Response at equilibrium [Req]) at each concentration (C), and then fit to a 1: 1 binding isotherm (Req vs. C) plot. From this, the equilibrium binding constants, KD, were derived using the vendor's evaluation software, version 3.1.0.6.
Measurement of Equilibrium Binding Constants: Human FcRn Protein: The affinity (¾) for the binding of the bispecific antibodies to human FcRn protein (huFcRn) was measured on a ProteOn XPR36 instrument. Briefly, bispecific antibodies were immobilized at high density on a GLC sensor chip using a standard amino coupling chemistry, as described above. A stock solutions of huFcRn protein was prepared at 3000 nM in instrument buffer (50 mM sodium phosphate buffer, pH 6, containing 150 mM NaCl, and 0.05% Tween-20), and then serially diluted (3: 1) to 1.37 nM in the same buffer. Each concentration of huFcRn was sequentially injected over the bispecific antibody and reference cell surfaces, connected in series, at a flow rate of 25 μΕ/ηιίη for 16 min. Binding data were collected, followed by a 60-sec injection of 50 mM sodium phosphate buffer, pH 7.4, containing 150 mM NaCl, and 0.05% Tween 20 between injections of each receptor or buffer blank to regenerate the IgG surface (i.e., remove bound huFcRn protein). Several buffer injections were also interspersed throughout the injection series. Later, one of these buffer injections was used along with the reference cell data to correct the raw data sets for injection artifacts (e.g., nonspecific binding) through "double-referencing" (Myszka, 1999). After all binding data was collected, individual data sets were averaged for binding (Req) at each concentration (C), and then fit to a 1: 1 binding isotherm (Req vs. C) plot. From this, the equilibrium binding constants, KD, were derived using the vendor's BIAevaluation software, v. 4.1. Results show that the bispecific antibodies have similar KD values which are comparable to conventional IgGl.
4.2. In Vitro Activity of Afucosylated Bispecific Antibody
[00617] Activity of afucosylated bispecific antibody in inhibiting ligand-driven cell proliferation was determined using method described in Example 1. Results show that afucosylated Bs2Ab-39SH, afucosylated Bs3Ab-39SH and afucosylated Bs4Ab-39SH have similar anti-proliferative potency in MDA-MB-361 cells (Figure 30A) and MCF-7 cells (Figure 30B), which is also comparable to the activity of parental antibody combination (39S plus trastuzumab). Similar results were observed in other cell lines including NCI-N87 and RT-112 (data not shown).
4.3. Enhanced ADCC Activity of Afucosylated Bispecific Antibody
[00618] KC1333, a human natural killer (NK) cell line expressing FcyRIIIa, was used as an effector cell and MDA-MB-361 cell line was used as a target cell in the ADCC assay to evaluate the ADCC activity of anti-HER2 antibodies. Both cell lines were harvested, washed and resuspended in assay medium. KC1333 were resuspended at a density of 1 x 106 cells/mL and MDA-MB-361 at 4 x 105 cells/mL. Fifty microliter of each cell line was added to the wells in a 96-well U-bottom plate to achieve target:effector ratio of 1:2.5. A 3X concentration of each dose of antibody was prepared by diluting the test articles in assay medium. Fifty microliter of each test article was added to cells in triplicate such that the final dose curve ranged from 10 μg/mL down to 0.15 ng/mL in a stepwise 1:4 serial dilution series. Plates were centrifuged to pellet cells in each well and then incubated overnight at 37°C/5 C02. The next day LDH in the supernatant of each well was quantified using Promega' s CytoTox 96® Non-Radioactive Cytotoxicity Assay according to manufacturer's instructions. Data are analyzed using the GraphPad Prism software and presented as percent cytotoxicity relative to the untreated control.
[00619] Figures 31A through 31C show the ADCC activity of afucosylated bispecific antibodies relative to trastuzumab and afucosylated trastuzumab in MDA-MB-361 cells. Data suggest that the ADCC activity of afucosylated antibody is higher than its fucosylated version and the rank of ADCC potency among afucosylated bispecific antibodies is Bs2Ab-39SH_aFuc > Bs4Ab-39SH_aFuc > Bs3Ab-39SH_aFuc. Similar results were observed in other cell lines including BT-474, NCI-N87, MDA-MB-453, T47D, and JIMT-1 (data not shown).
Example 5
5.1. Tubulysin 1508 Payload Synthesis
[00620] Synthesis of tubulysin 1508 cytotoxin payload as shown in Figure 32 for conjugation is detailed in the following illustrative example in which, unless stated otherwise:
(i) temperatures are given in degrees Celsius (°C); when operations were carried out at room temperature or ambient temperature, that is, in a range of 18-25 °C, unless otherwise stated;
(ii) solutions were dried over anhydrous sodium sulphate or magnesium sulphate; evaporation of organic solvent was carried out using a rotary evaporator under reduced pressure (4.5 - 30 mmHg) with a bath temperature of up to 30 °C;
(iii) chromatography means flash chromatography on silica gel; thin layer chromatography (TLC) was carried out on silica gel plates;
(iv) in general, the course of reactions was followed by TLC or liquid chromatography/mass spectroscopy (LC/MS) and reaction times are given for illustration only;
(v) final products have satisfactory proton nuclear magnetic resonance (NMR) spectra and/or mass spectra data; (vi) yields are given for illustration only and are not necessarily those which can be obtained by diligent process development; preparations were repeated if more material was required;
(vii) when given, nuclear magnetic resonance (NMR) data is in the form of delta (δ) values for major diagnostic protons, given in part per million (ppm) relative to tetramethylsilane (TMS) as an internal standard, determined at 300 or 400 MHz in d6-DMSO unless otherwise stated;
(viii) chemical symbols have their usual meanings;
(ix) solvent ratio is given in volume: volume (v/v) terms; and
(x) purification of the compounds was carried out using one or more of the following methods:
a) flash chromatography on regular silica gel;
b) flash chromatography on silica gel using Isco Combiflash® separation system: RediSep normal phase flash column, flow rate, 30-40 ml/min (ISCO MPLC); please add the ISCO reverse phase column
c) Gilson semiprep HPLC separation system: YMC pack ODS-AQ column, 100x20mm, S 5μιη 12 nm, water (0.1% trifluoroacetic acid) and acetonitrile (0.1% trifluoroacetic acid) as solvents, 20 min run;
Compound Tl
21] To a solution of (2R,4R)-4-methylpiperidine-2-carboxylic acid (2 g, 13.97 mmol) in MeOH (40 mL) and water (40.0 mL) was added paraformaldehyde (2.52 g, 27.94 mmol) and Pd/C (10%) (0.8 g, 7.52 mmol). The reaction mixture was stirred under a hydrogen atmosphere at room temperature overnight. From TLC, the reaction was not completed. Another one equivalent of paraformaldehyde (2.52 g, 27.94 mmol) was added and the reaction mixture was stirred another 24 hours. TLC indicated the reaction was completed and reaction mixture was filtered, washed the catalyst with MeOH (2 x 30 mL). The filtrate was concentrated in vacuo to give crude product as a white solid, which was washed with ether (3 x 30 mL), dried in high vacuum overnight to yield (2R,4R)- l,4-dimethylpiperidine-2-carboxylic acid (Tl) (1.870 g, 85 %) as a white solid. LC-MS: 158 (M+ 1); 1H NMR (400 MHz, DEUTERIUM OXIDE) δ ppm 0.97 (d, J=5.52 Hz, 3 H), 1.54 (br. s, 1 H), 1.71 - 1.87 (m, 3 H), 1.91 - 2.07 (m, 1 H), 2.84 (s, 3 H), 3.13 (td, J=8.41, 3.76 Hz, 1 H), 3.35 (m, 1 H), 3.65 (m, 1 H).
Compound T2 Di-tert-Butyl dicarbonate (243.0 g, 1.1 mol) was added dropwise to a suspension of (R)-3-amino-4-methyl pentanoic acid (commercially available) (133.0 g, 1.0 mol) and Na2C03 (212 g, 2.0 mol) in acetone (1 L) and water (1 L) with stirring at room temperature. The reaction mixture was stirred overnight and the organic solvent was removed under reduced pressure. The residue was diluted with water (1 L) and washed with EtOAc (500 mL x3). The aqueous phase was acidified with 2N HC1 solution to pH=3 and the resulting mixture was extracted with EtOAc (800 mL x3). The combined extracts were washed with brine (800 mL xl), dried (anhydrous Na2S04) and concentrated to give compound (T2) (224.0 g, 97% yield) as an oil, which was used in the next step without further purification.
Compound T3
Triethylamine (67 g, 0.61 mol) was added to a suspension of compound (T2) .0 g, 0.61 mol) and Ν,Ο-dimethylhydroxylamine hydrochloride (74.1 g, 0.76 mol) in CH2CI2 (1.4 L) with stirring at 0°C. The suspension was stirred for 0.5 hour and EDCI (74 g, 0.61 mol) was added in portions at 0 °C. The reaction mixture was stirred for 2 hours at 0°C and water (800 mL) was added. The organic phase was separated, washed with 5% KHS04 solution (800 mLx3), saturated NaHC03 solution (800 mLx3) and brine (800 mLxl), was dried (anhydrous Na2S04) and concentrated to dryness. The residue was purified by flash column chromatography on silica gel (EtOAc/Hexane=l:5) to afford compound (T3) (141.0 g, 84% yield) as an oil. 1H NMR (300 MHz, CDC13): δ 5.26 (m, 1H), 3.75 (m, 1H), 3.70 (s, 3H), 3.15 (s, 3H), 2.60-2.80 (m, 2H), 1.85 (m, 1H), 1.41 (s, 9H), 0.90 (d, J = 6.6 Hz, 3H), 0.88 (d, J = 6.6 Hz, 3H).
Compound T4
Iodoethane (250.0 g, 1.6 mol) was added to a solution of compound (T3) (55.0 g,
0.2 mol) in DMF (1.1 L) with stirring at 0°C. Then NaH (60% suspension, 24.0 g, 0.60 mol) was added in portions at 0°C and the reaction mixture was allowed to warm to room temperature and stirred for 12 hours. The reaction was quenched with water (2 L) carefully and EtOAc (2 L) was added. The organic phase was separated, washed with 5% KHS04 solution (800 mLx3), saturated NaHC03 solution (800 mLx3) and brine (800 mLxl), dried (anhydrous Na2S04) and concentrated to dryness. The residue was purified by flash column chromatography on silica gel (EtOAc/Hexane=l: 10) to afford compound (T4) (35.1 g, 58% yield) as an oil. 1H NMR (300 MHz, CDC13): δ 3.70 (s, 3H), 3.65 (m, 1H), 3.10-3.30 (m, 5H), 2.50-2.95 (m, 2H), 1.90-2.20 (m, 1H), 1.40-.55 (m, 9H), 1.10 (t, J = 7.2 Hz, 3H), 0.90 (d, J = 6.6 Hz, 3H), 0.88 (d, J = 6.6 Hz, 3H).
Compound T5
[00625] A solution of n-BuLi (106 ml, 2.5N in hexane, 0.17 mol) was added dropwise to a solution of 2-bromo-4-((tert-butyldimethylsilyloxy)methyl)thiazole (74 g, 0.24 mol) (prepared as described in Wipf, P et al Org. Lett. 2007, 9(8), p. 1605) in dry THF (500 mL) at -78°C under N2 with stirring over 1 hour. The suspension was stirred for further 30 min and then a solution of compound (T4) (51.0 g, 0.17 mol) in dry THF (300 mL) was added dropwise over 30 min at -78°C. The reaction mixture was stirred for 1 hour at -78°C and then allowed to warm to room temperature and stirred for 12 hours. The reaction was quenched with 20% aqueous ammonium chloride solution (1 L) and the organic solvent was removed under reduced pressure. The resulting mixture was extracted with EtOAc (800 mLx3). The combined organic phases were washed with 5% KHS04 solution (800 mLx3), saturated NaHC03 solution (800 mLx3) and brine (800 mLxl), dried (Na2S04) and concentrated to dryness. The crude material was purified by flash column chromatography on silica gel (EtOAc/Hexane=l: 10) to afford compound (T5) (58.1 g, 73% yield) as an oil. 1H NMR (300 MHz, CDC13): δ 7.53 (m, 1H), 4.90 (s, 2H), 4.04 (m, 1H), 3.35 (m, 2H), 3.15 (m, 2H), 2.00 (m, 1H), 1.40 (s, 9H), 0.80-1.20 (m, 18H), 0.14 (s, 6H).
Compound T6
[00626] LiBH4 (4.8 g, 0.22 mol) was added in portions to a solution of compound (T5)
(47.1 g, 0.1 mol) in methanol (500 mL) at room temperature over a period of 0.5 hour with stirring. The suspension was stirred for 2 hours and the solvent was removed under reduced pressure. The residue was dissolved in EtOAc (800 mL) and the resulting solution was washed with saturated NaHC03 solution (500 mLx3) and brine (500 mLxl), dried (Na2S04) and concentrated to dryness. The crude material was purified by flash column chromatography (EtOAc/Hexane=l:6) to afford compound (T6) (13.5 g, 28% yield) and its isomer (Τ6') (21.0 g, 45% yield). 1H NMR (300 MHz, CHLOROFORM-d) δ ppm -0.06 - 0.05 (m, 6 H) 0.76 - 0.89 (m, 15 H) 1.12 (t, J=6.97 Hz, 3 H) 1.39 (s, 9 H) 1.55 - 2.05 (m, 3 H) 2.86 - 3.21 (m, 2 H) 3.76 - 3.96 (m, 1 H) 4.73 (d, J=1.13 Hz, 4 H) 7.01 (s, 1 H).
Compound T7
[00627] Acetyl chloride (45.2 g, 0.58 mol) was added dropwise to a solution of compound
(T6) (34.0 g, 72 mmol) in pyridine (500 mL) at 0°C with stirring over 10 min. The reaction mixture was allowed to warm to room temperature and stirred for 12 hours. The reaction was quenched with water (200 mL) and the solvent was removed under reduced pressure. The residue was treated with CH2CI2 (800 mL) and the resulting mixture was washed with 5% KHS04 solution (800 mLx3), saturated NaHC03 solution (800 mLx3) and brine (800 mLxl), dried (Na2S04) and concentrated to dryness. The crude material was purified by flash column chromatography on silica gel (EtOAc/ Hexane=l: 10) to afford compound (T7) (25.7 g, 69% yield) as an oil. 1H NMR (300 MHz, CDC13): δ 7.15 (m, 1H), 5.95 (m, 1H), 4.84 (s, 2H), 4.04 (m, 1H), 3.10 (m, 2H), 2.35 (m, 1H), 2.15 (s, 3H), 2.00 (m, 1H), 1.70 (m, 1H), 1.45 (s, 9H), 1.25 (t, J = 7.2 Hz, 3H), 0.80-1.10 (m, 15H), 0.08 (s, 6H).
Compound T8
[00628] A solution of tetrabutylammonium fluoride (65.3 g, 0.25 mol) in THF (200 mL) was added dropwise to a solution of compound (7) (25.7 g, 50 mmol) in THF (300 mL) at 0°C with stirring. The reaction mixture was allowed to warm to room temperature and stirred for 4 hours. Water (800 mL) was added and the organic solvent was removed under reduced pressure. The residue was treated with CH2CI2 (800 mL) and the resulting mixture was washed with 5% KHSO4 solution (800 mLx3), saturated NaHC03 solution (800 mLx3) and brine (800 mLxl), dried (Na2S04) and concentrated to dryness. The crude material was purified by flash column chromatography on silica gel (EtOAc/ Hexane=l:4) to afford compound (T8) (19.5 g, 98% yield) as an oil. 1H NMR (300 MHz, CDC13): δ 8.26 (m, 1H), 5.95 (m, 1H), 4.83 (m, 2H), 4.10 (m, 1H), 3.17 (m, 2H), 2.40 (m, 1H), 2.20 (s, 3H), 2.18 (m, 1H), 1.75 (m, 1H), 1.56 (s, 9H), 1.10-1.30 (m, 3H), 0.80- 1.05 (m, 6H).
Compound T9
[00629] Dess-Martin reagent (32.7 g, 75 mmol) was added to a solution of compound (T8)
(20.0 g, 50 mmol) in dichloromethane (300 mL) and the reaction mixture was stirred at room temperature for 12 hours. The mixture was washed with sodium hydroxide solution (IN, 300 mLx3), sodium thiosulfate solution (IN, 300 mLx3), saturated NaHC03 (300 mLx3) solution and brine (300 mLxl), respectively. The organic layer was dried (Na2S04) and concentrated to dryness to give the corresponding aldehyde.
[00630] This crude aldehyde was dissolved in tert-butyl alcohol (500 mL) and a solution of sodium chlorite (80%, 36.4 g, 320 mmol) and sodium dihydrogenphosphate monohydrate (105 g, 0.77 mol) in water (300 mL) was added dropwise over 1 hour at room temperature. The reaction mixture was stirred for 3 hours and diluted with hydrochloric acid solution (0.1N, 500 mL). The resulting mixture was extracted with EtOAc (500 mLxl) and the combined organic layers were washed with 5% KHS04 solution (500 mLx3) and brine (500 mLxl), dried over Na2S04 and concentrated to dryness. The residue was purified by flash column chromatography on silica gel (CH2Cl2/MeOH=100:5) to afford compound (T9) (15.4 g, 58% yield). 1H NMR (300 MHz, CDCI3): δ 9.90 (br s, 1H), 8.27 (s, 1H), 5.96 (m, 1H), 4.07 (m, 1H), 3.15 (m, 2.35 (m, 1H), 2.20 (s, 3H), 2.18 (m, 1H), 1.75 (m, 1H), 1.45 (s, 9H), 1.20 (t, J = 7.: 3H), 0.98 (d, J = 6.6 Hz, 3H), 0.88 (d, J = 6.6 Hz, 3H).
Compound T10
[00631] To a solution of 2-((lR,3R)-l-acetoxy-3-((tert-butoxycarbonyl)(ethyl)amino)-4- methylpentyl)thiazole-4-carboxylic acid (T9) (6.5g, 15.68 mmol) in DCM (60 mL) was added TFA( 30 mL) in dropwise at 0 °C. The mixture was stirred at 0 °C for 1 hour. The solvent was evaporated in vacuo to give crude product (T10). The crude product was used to next step reaction without further purification (7.2 grams). LC-MS : 315 (M + 1).
Compound Til
[00632] To the solution of 2-((lR,3R)-l-acetoxy-3-(ethylamino)-4-methylpentyl)thiazole-
4-carboxylic acid 4, Trifluoroacetic acid salt (T10) (5g, 11.67 mmol) and sodium bicarbonate (9.80 g, 116.71 mmol) in a mixture of acetone (300 mL) and water (150 mL) was added (9H-fluoren-9-yl)methyl (2,5-dioxopyrrolidin-l-yl) carbonate (3.94 g, 11.67 mmol). The mixture was stirred at room temperature overnight. LCMS indicated the reaction was completed. The mixture was acidified to (pH 2) with hydrochloric acid and acetone was evaporated in vacuo. The product was extracted with DCM (3 x 300 mL). The combined organic extracts were washed with 0.1% HCl solution (200 mL), brine (200 mL), dried over Na SO , and evaporated in vacuo. The residue was purified by flash chromatography (silica gel, MeOH/DCM, MeOH from 0% to 5%,) to give 2-((lR,3R)-3- ((((9H-fluoren-9-yl)methoxy)carbonyl)(ethyl)amino)-l-acetoxy-4-methylpentyl)thiazole- 4-carboxylic acid (Til) (3.53 g, 54.6 %) as a white solid. LC-MS : 537.2 (M+l); 1H NMR (400 MHz, CHLOROFORM- J) δ ppm 0.84 (d, 7=6.78 Hz, 3 H), 0.92 - 1.05 (m, 5 H), 1.14 (d, 7=3.01 Hz, 1 H), 1.73 (dt, 7=10.23, 6.43 Hz, 1 H), 1.92 - 2.05 (m, 1 H), 2.12 - 2.27 (m, 4 H), 2.28 - 2.44 (m, 1 H), 2.90 - 3.33 (m, 2 H), 3.98 (t, 7=9.29 Hz, 1 H), 4.12 - 4.32 (m, 1 H), 4.47 - 4.82 (m, 2 H), 5.95 (dd, 7=10.92, 2.89 Hz, 1 H), 7.29 - 7.45 (m, 4 H), 7.55 - 7.69 (m, 2 H), 7.72 - 7.81 (m, 2 H), 8.22 - 8.29 (m, 1 H).
Compound T12
DMAP (106 g, 0.86 mol) was added to a solution of Boc-L-4-nitro-Phenylalanine
(1800 g, 0.58 mol) and Meldrum's acid (92 g, 0.64 mol) in dichloromethane (1.5 L). The resulting solution was cooled at -5°C under N2 atmosphere, followed by addition of DCC (240 g, 1.16 mol) in dichloromethane (1 L) over 1 h. The mixture was stirred overnight at 0-5°C. Then the precipitated Ν,Ν' -dicyclohexylurea was removed by filtration and the filtrate was washed with 5% aqueous HCl (1 L x 3), and brine (1 L x 1), and was dried over MgS04. After removal of MgS04 by filtration, the organic phase was concentrated to dryness. The residue was triturated with EtOAc/hexane (1: 1, 500 mL), and was dried to afford compound (T12) (130.0 g, 51% yield) as a yellow solid.
Compound T13
[00634] AcOH (400 niL) was added to a solution of compound (T12) (130.0 g, 0.298 mol) in dichloromethane (1.5 L) at -5°C under N2. Solid NaBH4 (22.7 g, 0.597 mol) was added in small portions over 2 hours (gas evolution and exothermic). After stirring for additional 3 h at -5 °C, TLC indicated the reaction was complete. The mixture was quenched with brine (1 L). The organic layer was separated, and washed sequentially with water (1 Lx2), aqueous saturated NaHC03 (1 Lx3) and brine (1 Lx3), and was dried over MgS04. The filtrate was concentrated to dryness and afford compound (T13) (70.3 g, 55 % yield) as a yellow solid. 1H NMR (300 MHz, CDC13): δ 8.18 (d, J=8.7 Hz, 2H), 7.41 (d, J=8.7 Hz, 2H), 4.58 (m, 1H), 4.29 (m, 1H), 3.85 (m,lH), 2.97 (d, J=6.6 Hz, 2H), 2.27 (m ,2H), 1.80 (s, 3H), 1.76 (s, 3H), 1.35 (s, 9H).
Compound T14
[00635] K2C03 (35 g, 0.25 mol) and Mel (36 g, 0.25 mol) were added to a solution of compound (T13) (70.3 g, 0.167 mol) in acetone (400 mL) and DMF (400 mL). The mixture was stirred overnight at room temperature. TLC showed the starting material was consumed. Water (2 L) was added and the mixture was stirred for an additional hour. The precipitated solid was collected by filtration, was washed with water, was dried to afford compound (T14) (34.5 g, 47% yield) as a pale yellow solid. 1H NMR (300 MHz, CDC13): δ 8.17 (d, J=8.7 Hz, 2H), 7.34 (d, J=8.7 Hz, 2H), 4.22 (m, 1H), 3.85 (m,lH), 2.85 (m, 2H), 2.22 (m ,2H), 1.73 (s, 3H), 1.73 (s, 3H), 1.52 (s, 3H), 1.31 (s, 9H).
Compound T15 [00636] Compound (T14) (34.5 g, 79.1 mmol) was dissolved in toluene (500 mL). The solution was heated under reflux for 40 hours. TLC indicated the reaction complete. The solvent was removed to afford compound (T15) (30g), which was used for next step without further purification.
Compound T16
[00637] K2C03 (22 g, 0.16 mol) was added to a solution of compound (T15) (30 g, 79 mmol) in MeOH (300 mL). The mixture was stirred for 3 hours at room temperature. TLC showed complete conversion. The solvent was removed, the residue was dissolved in dichloromethane (500 mL), washed with brine (500 mLx3), dried over MgS04. After removal of MgS04 by filtration, the organic phase was concentrated to dryness. The residue was further purified by silica gel chromatography (EtOAc/Hexane=l: 10) and afforded compound (T16) (23.5 g, 81 % yield for two steps) as 1: 1 diastereomeric mixture. 1H NMR (300 MHz, CDC13): δ 8.13 (d, J=8.7 Hz, 2H), 7.34 (d, J=8.7 Hz, 2H), 4.43 (m, IH), 3.85 (m,lH), 3.65 (s ,3H), 2.85 (m, 2H), 2.65 (m ,1H), 1.85 (m, IH), 1.50 (m, IH), 1.30 (s, 9H), 1.15 (t, J=6.6 Hz, 3H).
Compound T17
[00638] 50 g of compound (T16) was subjected to chiral chromatography using SFC
(supercritical fluid chromatography) on a Chiralpak ID 21x250 mm, 5 μ column using mobile phase A 90% carbon dioxide and phase B isopropanol 10% at a 60 ml/min flow rate. The separation was performed at 40 °C and detection at 270 nM. Baseline separation was achieved and two fractions were isolated. Peak B was desired compound (T17) and was obtained as a solid 27.4 g (55%).
[00639] >99: 1 diastereomeric excess on a Chiralpak IA column 4.6x250 mm, 5μ, 10% 1: 1
Methanoklsopropanol in hexane with 0.1% diethylamine modifier.
[00640] LC/MS (2 minute, Acid _CV10.olp method 367 (M + 1), 1.16 minutes.
[00641] 1H NMR (400 MHz, METHANOL-d4) δ ppm 8.16 (d, J=8.53 Hz, 2 H) 7.46 (d,
J=8.53 Hz, 2 H) 3.79 - 3.93 (m, 1 H) 3.68 (s, 3 H) 2.90 - 2.99 (m, 1H) 2.71 - 2.81 (m, 1 H) 2.47 - 2.59 (m, 1 H) 1.81 - 1.95 (m, 1 H) 1.55 - 1.66 (m, 1 H) 1.32 (s, 9 H) 1.21 - 1.25 (m, 2 H) 1.16 (d, J=7.03 Hz, 3 H).
Compound T18
[00642] A solution of (2S,4R)-methyl 4-((tert-butoxycarbonyl)amino)-2-methyl-5-(4- nitrophenyl)pentanoate (T17) (3.5g, 9.55 mmol) in 6N HC1 aqueous solution (8.0 mL, 263.30 mmol) was heated at 130 °C in microwave for 30 min. The reaction mixture was lyophilized to afford (2S,4R)-4-amino-2-methyl-5-(4-nitrophenyl)pentanoic acid (T18) as a solid. The product was used in the next step reaction without further purification. (3.2 g). LC-MS : 253 (M + 1); 1H NMR (400 MHz, DEUTERIUM OXIDE) δ ppm 1.12 (d, 7=7.28 Hz, 3 H), 1.62 - 1.76 (m, 1 H), 1.90 - 2.02 (m, 1 H), 2.56 - 2.68 (m, 1 H), 3.02 - 3.11 (m, 2 H), 3.58 - 3.69 (m, 1 H), 7.47 (d, 7=8.53 Hz, 2 H), 8.18 (d, 7=8.78 Hz, 2 H). Compound T19
[00643] To the solution of compound (T18) (0.43 g, 1.49 mmol) and sodium bicarbonate
(1.251 g, 14.89 mmol) in a mixture of acetone (30 mL) and water (15 mL) was added (9H-fluoren-9-yl)methyl 2,5-dioxopyrrolidin-l-yl carbonate (0.502 g, 1.49 mmol). The mixture was stirred at room temperature for overnight. LCMS indicated the reaction was completed. The mixture was acidified to pH 2 with hydrochloric acid and acetone was evaporated in vacuo. The product was extracted with DCM (3 X 60 mL). The combined organic extracts were washed with IN HCl solution (40 mL), brine (40 mL), dried over Na2SC" , and evaporated in vacuo. The residue was purified by silica gel flash chromatography, EtOAc from 0% to 100% in DCM, to give (2S,4R)-4-(((9H-fluoren-9- yl)methoxy)carbonylamino)-2-methyl-5-(4-nitrophenyl)pentanoic acid (0.630 g, 89 %) (T19) as a white solid. LC-MS : 475.5 (M+H); 1H NMR (400 MHz, CHLOROFORM-J) δ ppm 0.81 - 1.06 (m, 1 H), 1.08 - 1.28 (m, 2 H), 1.33 - 1.75 (m, 1 H), 1.77 - 2.11 (m, 1 H), 2.36 - 2.69 (m, 2 H), 2.76 - 3.18 (m, 1 H), 3.43 - 4.08 (m, 1 H), 4.09 - 4.19 (m, 1 H), 4.21 - 4.53 (m, 2 H), 4.54 - 4.80 (m, 1 H), 7.18 - 7.58 (m, 8 H), 7.66 - 7.82 (m, 2 H), 7.95 - 8.17 (m, 2 H), 8.67 (br. s., 1 H).
Compound T20
[00644] DIEA (0.419 mL, 2.40 mmol) was added to a solution of (2S,4R)-4-(((9H- fluoren-9-yl)methoxy)carbonylamino)-2-methyl-5-(4-nitrophenyl)pentanoic acid (0.380 g, 0.80 mmol) (T19) in DCM (4.5 mL), and the mixture was stirred at room temperature for 5 min, then 2-Chlorotrityl chloride resin (0.5 g, 0.80 mmol) was added to the mixture. The mixture was shaken at room temperature overnight, the resulting resin was washed with DMF (3 X 6 mL), MeOH (3 X 6 mL), and DCM (3 X 6 mL), then treated with DIEA (0.419 mL, 2.40 mmol) and MeOH/DCM (1: 1, 5 mL) at room temperature for 30 min. Resulting resin was filtered, washed with DMF (3 X 6 mL), MeOH (3 X 6 mL), and DCM (3 X 6 mL), dried in high vacuum overnight. Small amount of compound was cleaved from resin, and analyzed by LCMS. The resulting resin (T20) was used for next step reaction. LC-MS : 475 (M + 1)
Compound T21
To the resin (T20) (0.5 g, 0.80 mmol) was added 20% piperidine in DMF (5 mL).
The mixture was shaken at room temperature for 6 min, the resulting resin was filtered, washed with DMF (3 x 6 mL), MeOH (3 x 6 mL), DCM (3 x 6 mL), dried in vacuo. Small amount of the compound was cleaved from resin, analyzed by LCMS, which indicated the reaction was completed. The resulting resin (T21) was used for the next step reaction. LC-MS: 253 (M + H).
Compound T22
[00646] To the resin (T21) (0.5 g, 1.88 mmol) was added a solution of 2-((lR,3R)-3-
((((9H-fluoren-9-yl)methoxy)carbonyl)(ethyl)amino)-l-acetoxy-4-methylpentyl)thiazole- 4-carboxylic acid (3) (1.108 g, 2.07 mmol), HATU (1.428 g, 3.76 mmol), 2,4,6- trimethylpyridine (0.500 mL, 3.76 mmol), and DIEA (0.656 mL, 3.76 mmol) in DMF (5 mL) at room temperature. The mixture was shaken at room temperature for two hours, and the resulting resin was filtered, washed with DMF (3 x 6 mL), MeOH (3 x 6 mL), and DCM (3 x 6 mL), dried in vacuo. Small amount of the compound was cleaved from resin, analyzed by LCMS, which indicated the reaction was completed. The resulting resin (T22) was used for the next step. LC-MS: 771 (M + H).
Compound T23
[00647] To the resin (T22) (0.5 g, 0.80 mmol) was added 20% piperidine in DMF (5 mL).
The mixture was shaken at room temperature for 6 min, the resulting resin was filtered, washed with DMF (3 x 6 mL), MeOH (3 x 6 mL), DCM (3 x 6 mL), dried in vacuo. Small amount of the compound was cleaved from resin, analyzed by LCMS, which indicated the reaction was completed. The resulting resin (T23) was used in the next reaction step. LC-MS : 549 (M + 1).
Compound T24
[00648] To a solution of (2S,3S)-2-(((9H-fluoren-9-yl)methoxy)carbonylamino)-3- methylpentanoic acid (Fmoc-Isoleucine) (7 g, 19.81 mmol) and pyridine (1.602 mL, 19.81 mmol) in DCM (120 mL) was added via cannula a solution of DAST (3.11 mL, 23.77 mmol) in DCM (20 mL) over 10 min. The reaction mixture was stirred at room temperature for 1 hour, diluted with DCM (80 mL), washed with ice-cold water (2 x 200 mL), the organic layer was dried over MgS04, filtered, and evaporated in vacuo to give (9H-fluoren-9-yl)methyl (2S,3S)-l-fluoro-3-methyl-l-oxopentan-2-ylcarbamate (6.65 g, 94 %) as a white solid. An esterification test was performed to assure quantitative acid fluoride formation by dissolving Fmoc-Ile-F (5 mg) in anhydrous MeOH (0.3 mL) and DIEA (0,030 mL) and allowing to react at room temperature for 15 min. The mixture was then evaporated in vacuo and analyzed by LCMS, showed less than 1% of Fmoc-Ile-OH present.
[00649] 1H NMR (400 MHz, CHLOROFORM-d) δ ppm 0.83 - 1.12 (m, 6 H) 1.18 - 1.37
(m, 1 H) 1.42 - 1.59 (m, 1 H) 2.01 (br. s., 1 H) 4.26 (t, J=6.78 Hz, 1 H) 4.44 - 4.63 (m, 3 H) 5.20 (d, J=8.53 Hz, 1 H) 7.31 - 7.39 (m, 2 H) 7.40 - 7.47 (m, 2 H) 7.61 (d, J=7.28 Hz, 2 H) 7.80 (d, J=7.53 Hz, 2 H).
Compound T25
[00650] To the resin (T23) (0.5 g, 0.80 mmol) was added a solution of (9H-fluoren-9- yl)methyl (2S,3S)-l-fluoro-3-methyl-l-oxopentan-2-ylcarbamate (T24) (0.569 g, 1.60 mmol), DMAP (4.89 mg, 0.04 mmol), and DIEA (0.419 mL, 2.40 mmol) in DCM (5 mL) at room temperature. The mixture was shaken at room temperature for overnight, the resulting resin was filtered, washed with DMF (3 x 6 mL), MeOH (3 x 6 mL), DCM (3 x 6 mL), dried in high vacuum. Small amount of compound was cleaved from resin, and analyzed by LC/MS, LCMS indicated the reaction was completed. The resulting resin (T25) was used in the next reaction step. LC-MS : 884 (M + H).
Compound T26
[00651] To the resin (T25) (0.5 g, 0.80 mmol) was added 20% piperidine in DMF (5 mL).
The mixture was shaken at room temperature for 6 min, the resulting resin was filtered, washed with DMF (3 x 6 mL), MeOH (3 x 6 mL), DCM (3 x 6 mL), dried in vacuo. Small amount of the compound was cleaved from resin, analyzed by LCMS, which indicated the reaction was completed. The resulting resin (T26) was used in the next reaction step. LC-MS: 662 (M + 1).
Compound T27
[00652] To the resin (T26) (0.5 g, 0.80 mmol) was added a solution of (2R,4R)-1,4- dimethylpiperidine-2-carboxylic acid (1) (0.252 g, 1.60 mmol), HATU (0.608 g, 1.60 mmol), 2,4,6-trimethylpyridine (0.320 mL, 2.40 mmol), and DIEA (0.419 mL, 2.40 mmol) in DMF (5 mL). The mixture was shaken at room temperature for 2 hours, the resulting resin was filtered, washed with DMF (3 x 6 mL), MeOH (3 x 6 mL), and DCM (3 x 6 mL), dried in vacuo. Small amount of the compound was cleaved from resin, analyzed by LCMS, which indicated the reaction was completed. The resulting resin (T27) was used in the next reaction step. LC-MS: 801 (M + 1).
Compound T28
[00653] To the resin (T27) was added a solution of tin(II) chloride dehydrate (1.805 g,
8.00 mmol), and sodium acetate (0.197 g, 2.40 mmol) in DMF (5 mL). The mixture was shaken at room temperature for 4 hours, the resulting resin was filtered, washed with DMF (3 x 6 mL), MeOH (3 x 6 mL), and DCM (3 x 6 mL), and dried in vacuo. Small amount of the compound was cleaved from resin, analyzed by LCMS, which indicated the reaction was completed. The resulting resin (T28) was used for the next step. LC-MS: 771 (M + H).
Compound T29
[00654] To the resin (T28) (0.2 g, 0.32 mmol) was added a solution of (S)-2-(((9H- fluoren-9-yl)methoxy)carbonylamino)-6-(tert-butoxycarbonylamino)hexanoic acid (commercially available) (0.300 g, 0.64 mmol), HATU (0.243 g, 0.64 mmol), 2,4,6- trimethylpyridine (0.128 mL, 0.96 mmol), and DIEA (0.168 mL, 0.96 mmol) in DMF (4 mL). The mixture was shaken at room temperature for 2 hours, the resulting resin was filtered, washed with DMF (3 x 2 mL), MeOH (3 x 2 mL), and DCM (3 x 2 mL), and dried in vacuo. Small amount of the compound was cleaved from resin, analyzed by LCMS, which indicated the reaction was completed. The resulting resin (T29) was used to next step reaction. LC-MS: 1221 (M + 1).
Compound T30
To the resin (T29) (0.2 g, 0.32 mmol) was added 20% piperidine in DMF (2 mL).
The mixture was shaken at room temperature for 6 min, the resulting resin was filtered, washed with DMF (3 x 3 mL), MeOH (3 x 3 mL), DCM (3 x 3 mL), dried in vacuo. Small amount of the compound was cleaved from resin, analyzed by LCMS, which indicated the reaction was completed. The resulting resin (T30) was used to next step reaction. LC/MS : 999 (M + H).
Compound T31
[00656] To the resin (T30) (0.2 g, 0.32 mmol) was added a solution of 2,5- dioxopyrrolidin-l-yl 6-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l-yl)hexanoate (0.148 g, 0.48 mmol) in DMF (2 mL) , followed by N-METHYLMORPHOLINE (0.106 mL, 0.96 mmol) at room temperature. The mixture was shaken at room temperature for 2 hours, the resulting resin was filtered, washed with DMF (3 x 3 mL), DCM (3 x 3 mL), dried in vacuo. Small amount of the compound was cleaved from resin, analyzed by LCMS, which indicated the reaction was completed. The resulting resin (T31) was used for the next step. LC-MS: 1192 (M + 1).
Compound T32 (tubulysin 1508)
[00657] To the resin (T31) (0.2 g, 0.32 mmol) was added DCM (1 mL), and TFA (1 mL) at room temperature. The mixture was shaken at room temperature for 20 min, then filtered. The resin was washed with DCM/TFA (1: 1, 3 x 2 mL), the filtrates were evaporated in vacuo. The residue was purified by reverse phase HPLC (ACN/H2O
(contained 0.1 TFA), ACN from 5% to 75% in 14 min.) The pure fractions were lyophilized to give (2S,4R)-4-(2-((lR,3R)-l-acetoxy-3-((2S,3S)-2-((2R,4R)-l,4- dimethylpiperidine-2-carboxamido)-N-ethyl-3-methylpentanamido)-4- methylpentyl)thiazole-4-carboxamido)-5-(4-((S)-6-amino-2-(6-(2,5-dioxo-2,5-dihydro- lH-pyrrol-l-yl)hexanamido)hexanamido)phenyl)-2-methylpentanoic acid (T32) (0.095 g, 22.48 %) as a white solid. LC-MS : 1092 [M+l]; 1H NMR (400 MHz, METHANOL-d4) δ ppm 7.99 (s, 1 H), 7.34 (d , / =8.53 Hz, 2 H), 7.10 (d , 7=8.53 Hz, 2 H), 6.66 (s, 2 H), 5.64 (d, 7=10.79 Hz, 1 H), 4.50 - 4.61 (m, 1 H), 4.21 - 4.35 (m, 2 H), 3.92 (d, 7=9.29 Hz, 1 H), 3.69 (br. s., 1 H), 3.37 (t, 7=7.15 Hz, 2 H), 3.15-3.35 ( m, 4H), 3.04 (dt, 7=3.58, 1.85 Hz, 1 H), 2.84 (t, 7=7.65 Hz, 2 H), 2.76 (d, 7=7.03 Hz, 2 H), 2.62 (br. s., 2 H), 2.38 - 2.52 (m, 2 H), 2.25 (t, 7=11.54 Hz, 1 H), 2.16 (t, 7=7.40 Hz, 2 H), 2.04 - 2.11 (m, 4 H), 1.70 - 2.00 (m, 7 H) 1.42 - 1.69 (m, 11 H), 1.34 - 1.40 (m, 1 H), 1.27 (t, 7=6.78 Hz, 3 H), 1.16 - 1.24 (m, 2 H), 1.01 - 1.14 (m, 7 H), 0.90 (d, 7=6.78 Hz, 3 H), 0.94 (d, 7=6.53 Hz, 3 H), 0.84 (t, 7=7.40 Hz, 3 H), 0.79 (d, 7=6.53 Hz, 3 H).
5.2. Conjugation of Tubulysin 1508
[00658] Compound T32 (tubulysin 1508) comprises a linker and a maleimide group that is readily conjugated to a thiol residue of an antibody forming a thiol-maleimide linkage. Cytotoxins compising a maleimide group (e.g., tubulysin 1508) may be conjugated to specific cysteine residues engineered into the anti-HER2 antibodies provided herein (e.g. Bs2Ab-39SH, Bs3Ab-39SH, or Bs4Ab-39SH) of the invention. Alternatively, or optionally one may use classical conjugation methods to attach a cytotoxic agent the antibodies described. Method for conjugation to native lysine and cysteine residues are well known in the art. Representative methods for site specific (at engineered cysteine residues) and classic conjugation (at native cysteine residues) are provided below.
[00659] A representative site-specific antibody drug conjugation process is outlined in
Figure 33 and includes the steps of (a) uncapping the size chains of the derivatizable amino acids {e.g., cysteines), (b) oxidizing, (c) conjugating a payload {e.g., a cytotoxic agent such as tubulysin 1508), and (d) polishing by removing conjugation reagents and non-reacted payload. For example conjugation to an engineered cysteine may be carried out by formulating the antibody in IX PBS with 1 mM thylenediaminetetraacetic acid. Mild reduction is used generate free thiols by adding forty equivalences of Tris(2- carboxyethyl)phosphine hydrochloride per antibody is incubated at 37°C for three hours. Three successive dialysis in IX PBS with ImM Ethylenediaminetetraacetic acid are used to remove the Tris(2-carboxyethyl)phosphine hydrochloride (alternatively desalting columns may be used). The antibody interchain disulphide bonds are allowed to re-form by addition -20 equivalences of dehydroabietic acid (dhAA) and incubation -four hours at room temperature. In preparation for conjugation, dimethyl sulfoxide was add to the antibody to ten percent v/v and 8 or 12 equivalences of the tubulysis 1508 payload in Dimethyl sulfoxide is added and incubated at room temperature for ~1 hour (alternatively incubate at 4°C for -16 hours) for 2T and 4T drug loading, respectively. The reaction is quenched by adding -4 molar equivalence of N-acteyl cysteine (NAC) per payload. The free payload was removed from the conjugated antibody by Ceramic Hydroxyapatite following the manufacture recommendations. The final product may be subjected to buffer-exchange if desired. The conjugated antibodies may be analysed by non-reducing and reducing SDS-PAGE to confirm purity and conjugation to the heavy chain.
Antibody-drug conjugates with drugs randomly conjugated to native cysteine residues are prepared by partial reduction of the antibody followed by reaction with desired linker-drug. The antibody at a concentration of 5 mg/mL is partially reduced by addition of ~3 molar equivalents of DTT at pH 8.0, followed by incubation at -37 °C for ~2 h. The reduction reaction is then chilled in ice and the excess DTT removed, for example via diafiltration. The linker-drug is then added to linker-drug/thiol molar ratio of -1: 10. The conjugation reaction is carried out in the presence of -10% v/v of DMSO. After conjugation, excess free cysteine (-2 fold molar ration over linker-drug) is added to quench unreacted linker-drug to produce the cysteine-linker-drug adduct. The reaction mixture is purified (e.g, by hydrophobic interaction chromatography) and may be subjected to buffer-exchange into PBS. Drug load distribution is determined using standard methods such as hydrophobic interaction chromatography and reduced reverse phase chromatography.
Chemical Abbreviations
Ac acetyl
ACN acetonitrile
Boc di-ie/ -butyl dicarbonate
t-Bu tert-butyl
Bzl benzyl, where Bzl-OMe is methoxybenzyl and Bzl-Me is methylbenzene
Cbz or Z benzyloxy-carbonyl, where Z-Cl and Z-Br are chloro- and bromobenzyloxy carbonyl, respectively
DAST diethylamino sulfur trifluoride
DCM dichloromethane
DIAD diisopropyl azodicarboxylate DIC N,N'-diisopropylcarbodiimide
DIEA diethylisopropylamine
DMF N,N-dimethylformamide
DTT dithiothreitol
EtOAc ethyl acetate
Et20 diethylether
Fmoc 9H-fluoren-9-ylmethoxycarbonyl
HATU l-[Bis(dimethylamino)methylene]-lH-l,2,3-triazolo[4,5-b]pyridinium 3- oxid hexafluorophosphate
HC1 hydrochloric acid
LC-MS liquid chromatography- mass spectrometry
MeOH methanol
Na2C03 sodium bicarbonate
NaHC03 sodium hydrogen carbonate
PAB para-aminobenzyloxycarbonyl
RT room temperature
TEA triethylamine
TFA trifluoroacetic acid
THF tetrahydrofuran
TLC thin layer chromatography
INCORPORATION BY REFERENCE
[00661] All references cited herein, including patents, patent applications, papers, text books, and the like, and the references cited therein, to the extent that they are not already, are hereby incorporated herein by reference in their entireties for all purposes.
EQUIVALENTS
[00662] The foregoing written specification is considered to be sufficient to enable one skilled in the art to practice the embodiments. The foregoing description and Examples detail certain embodiments and describes the best mode contemplated by the inventors. It will be appreciated, however, that no matter how detailed the foregoing may appear in text, the embodiments may be practiced in many ways and the claims include any equivalents thereof.

Claims

WHAT IS CLAIMED IS:
1. A bispecific anti-HER2 antibody comprising a first immunoglobulin antigen- binding domain and a second immunoglobulin antigen-binding domain, wherein (i) the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 antibody binding sites, (ii) the first immunoglobulin antigen-binding domain binds to a first HER2 antibody binding site which comprises an epitope within domain II of HER2, and (iii) the first HER2 antibody binding site is distinct from the antibody binding site of pertuzumab.
2. The bispecific antibody according to claim 1, wherein the first immunoglobulin antigen-binding domain comprises a heavy chain (HC) variable region (VH) and a light chain (LC) variable region (VL) comprising:
(i) a variable heavy chain CDR-1 (VH-CDR1) identical to SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions;
(ii) a variable heavy chain CDR-2 (VH-CDR2) identical to SEQ ID NO: 2 or identical to SEQ ID NO: 2 except for up to 1, 2, 3, or 4 amino acid substitutions;
(iii) a variable heavy chain CDR-3 (VH-CDR3) identical to SEQ ID NO: 3 or identical to SEQ ID NO: 3 except for up to 1, 2, 3, or 4 amino acid substitutions;
(iv) a variable light chain CDR-1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions;
(v) a variable light chain CDR-2 (VL-CDR2) identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1, 2, 3, or 4 amino acid substitutions; and,
(vi) a variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions.
3. A bispecific anti-HER2 antibody comprising a first immunoglobulin antigen binding-domain and a second immunoglobulin antigen-binding domain, wherein the first immunoglobulin antigen-binding domain comprises a VH and a VL, wherein
(a) the VH comprises the amino acids of SEQ ID NO: 15 or 43;
(b) the VL comprises the amino acids of SEQ ID NO: 16 or 44;
and wherein the first and second immunoglobulin antigen-binding domains specifically bind to distinct HER2 epitopes.
4. The bispecific anti-HER2 antibody according to thereof of any one of claims 1 to 3, wherein the first immunoglobulin antigen binding domain and/or the second immunoglobulin antigen-binding domain comprises or consists of (a) a VH further comprising a heavy chain constant region or a fragment thereof and a VL comprising a light chain constant region (LC) or a fragment thereof; (b) a single chain Fv ("scFv"); (c) a diabody; (d) a minibody; (e) an F(ab')2; or (f) an F(ab).
5. The bispecific anti-HER2 antibody according to claim 4, wherein (a) the heavy chain constant region or fragment thereof is an IgG constant region; and/or (b) the LC constant region is a kappa constant region or a lambda constant region.
6. The bispecific anti-HER2 antibody according to any one of claims 1 to 5, wherein the first immunoglobulin antigen-binding domain is a monoclonal antibody, a humanized antibody, a human antibody, a chimeric antibody, or an affinity optimized antibody.
7. The bispecific anti-HER2 antibody according to any one of claims 1 to 6, wherein:
(a) the second immunoglobulin antigen-binding domain specifically binds to the same HER2 epitope as the trastuzumab antibody;
(b) the second immunoglobulin antigen-binding domain competitively inhibits HER2 binding by the trastuzumab antibody; or
(c) the second immunoglobulin antigen-binding domain comprises at least one, at least two, at least three, at least four, at least five, or at least six complementarity determining regions (CDRs) comprising the amino acids of any one of SEQ ID NOs: 54 to 59.
8. The bispecific anti-HER2 antibody according to claim 7, wherein the second immunoglobulin antigen-binding domain is an scFv comprising:
(i) a VH-CDR1 comprising the amino acids of SEQ ID NO:54;
(ii) a VH-CDR2 comprising the amino acids of SEQ ID NO:55;
(iii) a VH-CDR3 comprising the amino acids of SEQ ID NO:56;
(iv) a VL-CDR1 comprising the amino acids of SEQ ID NO:57;
(v) a VL-CDR2 comprising the amino acids of SEQ ID NO:58; and
(vi) a VL-CDR3 comprising the amino acids of SEQ ID NO:59.
9. The bispecific anti-HER2 antibody according to claim 7 or claim 8 , wherein (a) the second immunoglobulin antigen-binding domain is covalently linked to the carboxy-terminus of the HC of the first immunoglobulin antigen-binding domain;
(b) the second immunoglobulin antigen-binding domain is covalently linked to the amino-terminus of the HC of the first immunoglobulin antigen-binding domain; or,
(c) the second immunoglobulin antigen binding domain is covalently intercalated in the polypeptide chain of the HC of the first immunoglobulin antigen-binding domain.
10. The bispecific anti-HER2 antibody according to any one of claims 1 to 9, wherein the heavy chain comprises a constant region comprising an Fc domain.
11. The bispecific anti-HER2 antibody according to claim 10, wherein the Fc domain comprises at least one mutation capable of reducing or enhancing the ADCC activity of the bispecific antibody.
12. A bispecific anti-HER2 antibody comprising a first and a second polypeptide chain associated with each other, wherein the first polypeptide chain is selected from:
(1) [TZSHL!HBVHHBCHHFCJ
(2) [BVH]-[BCH]-[Fcx]-[L2]-[TZs]
(3) [BVH]-[BCH]-[L3]-[TZS]-[L4]-[FCX]
wherein
TZs is an scFv that binds the same epitope as trastuzumab;
1-4, L2, L3, and L4 are peptide linkers;
Fcx is an Fc domain;
BVH and BCH are the VH and CHI regions, respectively, of an antibody capable of binding to an HER2 epitope distinct from the epitope recognized by the trastuzumab antibody; and wherein the second chain comprises [BVL]-[CL] wherein BVL is the VL region of an antibody capable of binding to an HER2 epitope distinct from the epitope recognized by the trastuzumab antibody, and CL is a IgG light chain constant region selected from the group consisting of a human kappa constant region and a human lambda constant region.
13. The bispecific anti-HER2 antibody according to claim 12, wherein BVL comprises
(i) a variable light chain CDR-1 (VL-CDR1) identical to SEQ ID NO: 4 or identical to SEQ ID NO: 4 except for up to 1, 2, 3, or 4 amino acid substitutions; (ii) a variable light chain CDR-2 (VL-CDR2) identical to SEQ ID NO: 5 or identical to SEQ ID NO: 5 except for up to 1, 2, 3, or 4 amino acid substitutions; and,
(iii) a variable light chain CDR-3 (VL-CDR3) identical to SEQ ID NO: 6 or identical to SEQ ID NO: 6 except for up to 1, 2, 3, or 4 amino acid substitutions; wherein [TZs] comprises
(i) a VH-CDR1 comprising the amino acids of SEQ ID NO:54;
(ii) a VH-CDR2 comprising the amino acids of SEQ ID NO:55;
(iii) a VH-CDR3 comprising the amino acids of SEQ ID NO:56;
(iv) a VL-CDR1 comprising the amino acids of SEQ ID NO:57;
(v) a VL-CDR2 comprising the amino acids of SEQ ID NO:58; and
(vi) a VL-CDR3 comprising the amino acids of SEQ ID NO:59; wherein the [Fcx] comprises
(i) at least one amino acid substitution introducing a derivatizable group; and/or,
(ii) at least one mutation capable of enhancing the ADCC activity of the bispecific antibody;
and wherein [BVH] comprises
(i) a variable heavy chain CDR-1 (VH-CDR1) identical to SEQ ID NO: 1 or identical to SEQ ID NO: 1 except for up to 1, 2, 3, or 4 amino acid substitutions;
(ii) a variable heavy chain CDR-2 (VH-CDR2) identical to SEQ ID NO: 2 or identical to SEQ ID NO: 2 except for up to 1, 2, 3, or 4 amino acid substitutions; and
(iii) a variable heavy chain CDR-3 (VH-CDR3) identical to SEQ ID NO: 3 or identical to SEQ ID NO: 3 except for up to 1, 2, 3, or 4 amino acid substitutions.
14. The bispecific HER2 antibody according to any one of claims 1 to 13, wherein the bispecific HER2 antibody:
(a) induces internalization upon binding to the HER2 target;
(b) promotes effective lysosomal trafficking following internalization;
(c) induces HER2 target degradation;
(d) blocks ligand-induced AKT phosphorylation in low HER2-expressing cancer cells; (e) disrupts ligand-induced HER2:HER3 dimerization; or
(f) combinations thereof.
15. An antibody-drug conjugate (ADC) comprising the bispecific HER2 antibody according to any one of claims 1 to 14 and least one, two, three, or four therapeutic moieties, and optionally comprising at least one spacer.
16. The ADC according to claim 15, wherein each therapeutic moiety is chemically conjugated to the side chain of an amino acid at a specific position in the Fc region of the bispecific antibody.
17. The ADC according to claim 16, where the specific positions are selected from the group consisting of 239, 248, 254, 258, 273, 279, 282, 284, 286, 287, 289, 297, 298, 312, 324, 326, 330, 335, 337, 339, 350, 355, 356, 359, 360, 361, 375, 383, 384, 389, 398, 400, 413, 415, 418, 422, 435, 440, 441, 442, 443, 446, an insertion between positions 239 and 240, and combinations thereof, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
18. The ADC according to claim 17, wherein the specific positions are 239, 442, or both, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
19. An ADC comprising the bispecific HER2 antibody according to any one of claims 1 to 14, wherein said antibody comprises:
(i) a first polypeptide chain comprising the amino acids of SEQ ID NO: 32A and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety covalently linked to a cysteine amino acid at position 239, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
(ii) a first polypeptide chain comprising the amino acids of SEQ ID NO:33A and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties covalently linked to cysteine amino acids respectively located at positions 239 and 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat; a first polypeptide chain comprising the amino acids of SEQ ID NO:36A and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety covalently linked to a cysteine amino acid at position 239, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
a first polypeptide chain comprising the amino acids of SEQ ID NO:37A and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties covalently linked to cysteine amino acids respectively located at positions 239 and 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
a first polypeptide chain comprising the amino acids of SEQ ID NO:40A and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety covalently linked to a cysteine amino acid at position 239, wherein the amino acid position numbering is according to the EU index as set forth in Kabat; or,
a first polypeptide chain comprising the amino acids of SEQ ID NO:41A and a second polypeptide chain comprising the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties covalently linked to cysteine amino acids respectively located at positions 239 and 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:32A and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:33C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:36C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:37C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat;
) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:40C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises a therapeutic moiety covalently linked to a cysteine amino acid inserted between positions 239 and 240, wherein the amino acid position numbering is according to the EU index as set forth in Kabat; or,
i) a first polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:41C and a second polypeptide chain comprising or consisting of the amino acids of SEQ ID NO:42A, wherein the first polypeptide chain comprises two therapeutic moieties covalently linked to a cysteine amino inserted between positions 239 and 240 and a cysteine amino acid located at position 442, wherein the amino acid position numbering is according to the EU index as set forth in Kabat.
20. The ADC according to any one of claims 15 to 19, wherein the therapeutic moiety comprises a cytotoxin, a radioisotope, an immunomodulator, a cytokine, a lymphokine, a chemokine, a growth factor, a tumor necrosis factor, a hormone, a hormone antagonist, an enzyme, an oligonucleotide, a DNA, an RNA, an siRNA, an RNAi, a microRNA, a photoactive therapeutic agent, an anti-angiogenic agent, a pro-apoptotic agent, a peptide, a lipid, a carbohydrate, a chelating agent, or combinations thereof.
21. The ADC according to claim 20, wherein the cytotoxin is a tubulysin, an auristatin, a maytansinoid or a pyrrolobenzodiazepine (PBD).
22. A pharmaceutical composition comprising a bispecific HER2 antibody according to any one of claims 1 to 14, or an ADC according to any one of claims 15 to 21, and a pharmaceutically acceptable carrier.
23. A method of treating a HER2-expressing cancer comprising administering a bispecific HER2 antibody according to any one of claims 1 to 14, an ADC according to any one of claims 15 to 21, or the pharmaceutical composition according to claim 22 to a subject in need thereof.
24. The method according to claim 23, wherein the cancer is a low HER2-expressing cancer.
25. A method to treat resistance to a HER2-targeting therapeutic agent comprising administering a bispecific HER2 antibody according to any one of claims 1 to 14, an ADC according to any one of claims 15 to 21, or the pharmaceutical composition according to claim 22 to a subject in need thereof.
EP15777404.3A 2014-04-11 2015-04-10 Bispecific her2 antibodies Active EP3129055B1 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US201461978516P 2014-04-11 2014-04-11
US201562107050P 2015-01-23 2015-01-23
PCT/US2015/025232 WO2015157592A1 (en) 2014-04-11 2015-04-10 Bispecific her2 antibodies

Publications (3)

Publication Number Publication Date
EP3129055A1 true EP3129055A1 (en) 2017-02-15
EP3129055A4 EP3129055A4 (en) 2017-11-22
EP3129055B1 EP3129055B1 (en) 2020-07-01

Family

ID=54288419

Family Applications (1)

Application Number Title Priority Date Filing Date
EP15777404.3A Active EP3129055B1 (en) 2014-04-11 2015-04-10 Bispecific her2 antibodies

Country Status (17)

Country Link
US (1) US10160812B2 (en)
EP (1) EP3129055B1 (en)
JP (1) JP2017512765A (en)
KR (1) KR20160143808A (en)
CN (1) CN106232139A (en)
AU (1) AU2015243377A1 (en)
BR (1) BR112016022910A2 (en)
CA (1) CA2943299A1 (en)
CL (1) CL2016002547A1 (en)
ES (1) ES2819863T3 (en)
HK (1) HK1232127A1 (en)
IL (1) IL247478A0 (en)
MX (1) MX2016012830A (en)
RU (1) RU2016144176A (en)
SG (1) SG11201608192SA (en)
TW (1) TW201542594A (en)
WO (1) WO2015157592A1 (en)

Families Citing this family (50)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3733714A1 (en) * 2019-04-30 2020-11-04 Universität Zürich Her2-binding tetrameric polypeptides
UY36075A (en) * 2014-04-11 2015-10-30 Medimmune Llc TUBULISINE DERIVATIVES
LT3374398T (en) 2015-11-10 2020-09-10 Medimmune, Llc ASCT2 SPECIFIC BINDING MOLECULES AND THEIR APPLICATIONS
US10689458B2 (en) 2015-11-30 2020-06-23 Pfizer Inc. Site specific HER2 antibody drug conjugates
WO2017134547A1 (en) 2016-02-01 2017-08-10 Pfizer Inc. Tubulysin analogs and methods for their preparation
JP7676100B2 (en) 2016-02-05 2025-05-14 ジェンマブ アクティーゼルスカブ Multispecific antigen-binding molecules with improved internalization properties
CN107446045A (en) * 2016-07-22 2017-12-08 北京天广实生物技术股份有限公司 A kind of anti-HER2 antibody, its pharmaceutical composition and purposes
DK3579848T3 (en) 2017-02-08 2025-01-20 Dragonfly Therapeutics Inc MULTISPECIFIC BINDING PROTEINS FOR ACTIVATING NATURAL KILLER CELLS AND THERAPEUTIC APPLICATIONS THEREOF FOR THE TREATMENT OF CANCER
KR20240060739A (en) 2017-02-20 2024-05-08 드래곤플라이 쎄라퓨틱스, 인크. Proteins binding her2, nkg2d and cd16
SG11201907288RA (en) 2017-02-28 2019-09-27 Seattle Genetics Inc Cysteine mutated antibodies for conjugation
SG11202000499RA (en) 2017-08-01 2020-02-27 Medimmune Llc Bcma monoclonal antibody-drug conjugate
CN107789631B (en) * 2017-11-03 2021-03-16 合肥瀚科迈博生物技术有限公司 Anti-human ErbB2 double-epitope antibody-drug conjugate and application thereof
SG11202007482WA (en) 2018-02-08 2020-09-29 Dragonfly Therapeutics Inc Antibody variable domains targeting the nkg2d receptor
SG11202007579TA (en) 2018-02-08 2020-09-29 Dragonfly Therapeutics Inc Combination therapy of cancer involving multi-specific binding proteins that activate natural killer cells
SG10201801219VA (en) 2018-02-13 2019-09-27 Agency Science Tech & Res Anti-HER2 Antibodies
JP7353576B2 (en) 2018-02-20 2023-10-02 ドラゴンフライ セラピューティクス, インコーポレイテッド Multispecific binding proteins that bind to CD33, NKG2D, and CD16, and methods of use thereof
FI3765525T3 (en) 2018-03-13 2023-10-16 Zymeworks Bc Inc Anti-her2 biparatopic antibody-drug conjugates and methods of use
LT3781200T (en) * 2018-04-16 2024-08-12 F. Hoffmann-La Roche Ag ANTIBODIES OF CHELATED RADIONUCLIDES
WO2019232323A1 (en) * 2018-05-31 2019-12-05 Board Of Regents, The University Of Texas System Bi-specific antibodies and use thereof
EA202091888A1 (en) * 2018-08-08 2020-10-23 Драгонфлай Терапьютикс, Инк. VARIABLE ANTIBODY DOMAINS TARGETED ON THE NKG2D RECEPTOR
EP3833392A4 (en) 2018-08-08 2022-05-18 Dragonfly Therapeutics, Inc. MULTI-SPECIFIC BINDING PROTEINS BINDING TO BCMA, NKG2D AND CD16, AND METHODS OF USE
EP3833385A4 (en) 2018-08-08 2021-12-22 Dragonfly Therapeutics, Inc. NKG2D, CD16 AND TUMOR-ASSOCIATED ANTIGEN BINDING PROTEINS
AU2019358419A1 (en) * 2018-10-08 2021-04-15 Universität Zürich HER2-binding tetrameric polypeptides
JP7410143B2 (en) * 2018-11-01 2024-01-09 山▲東▼新▲時▼代▲薬▼▲業▼有限公司 Bispecific antibodies and their uses
MA54601A (en) * 2018-12-24 2022-03-30 Sanofi Sa NEW PSEUDOFAB-BASED MULTI-SPECIFIC BINDING PROTEINS
CN113226329A (en) * 2018-12-28 2021-08-06 国立大学法人东京大学 Fusion protein of cancer cell-recognizing antibody and streptavidin mutant
JP7727549B2 (en) * 2019-03-22 2025-08-21 セルティス・セラピューティクス・ピーティーワイ・リミテッド Anti-HER2 binding molecule
CA3253631A1 (en) 2019-05-31 2025-10-30 Zymeworks Bc Inc. Methods of using a bispecific antigen-binding construct targeting her2 for the treatment of gastroesophageal adenocarcinona (gea)
EP4058024A1 (en) 2019-11-15 2022-09-21 Seagen Inc. Methods of treating her2 positive breast cancer with tucatinib in combination with an anti-her2 antibody-drug conjugate
KR20210068264A (en) 2019-11-30 2021-06-09 김상엽 Strap-attached health gloves
IL295729A (en) * 2020-02-19 2022-10-01 Denali Therapeutics Inc Engineered anti-her2 bispecific proteins, compositions comprising same and uses thereof
CN115515643A (en) * 2020-02-28 2022-12-23 建新公司 Modified binding polypeptides for optimized drug conjugation
IL295312A (en) 2020-02-28 2022-10-01 Regeneron Pharma Bispecific antigen binding molecules that bind her2 and methods of using them
GB202004263D0 (en) 2020-03-24 2020-05-06 Autolus Ltd Antibody conjugate
CN115836088A (en) 2020-05-06 2023-03-21 蜻蜓疗法股份有限公司 Proteins that bind NKG2D, CD16, and CLEC12A
FR3112939B1 (en) * 2020-07-31 2024-01-05 Univ Montpellier Universal cell therapy product and its use
CA3193594A1 (en) 2020-09-11 2022-03-17 Medimmune Limited Therapeutic b7-h4 binding molecules
CA3190569A1 (en) 2020-10-22 2022-04-28 Christopher Daly Anti-fgfr2 antibodies and methods of use thereof
CN114539413A (en) * 2020-11-25 2022-05-27 三生国健药业(上海)股份有限公司 Multivalent bispecific antibodies that bind HER2, methods of making, and uses thereof
WO2022187539A1 (en) 2021-03-03 2022-09-09 Dragonfly Therapeutics, Inc. Methods of treating cancer using multi-specific binding proteins that bind nkg2d, cd16 and a tumor-associated antigen
US20240307551A1 (en) * 2021-07-05 2024-09-19 Jiangsu Alphamab Biopharmaceuticals Co., Ltd. Antibody-drug conjugate and application thereof
AR126873A1 (en) * 2021-08-25 2023-11-22 Denali Therapeutics Inc ANTI-HER2 ANTIBODIES AND METHODS FOR THEIR USE
WO2023038803A2 (en) * 2021-08-25 2023-03-16 Denali Therapeutics Inc. Engineered anti-her2 bispecific proteins
TW202348252A (en) 2022-02-16 2023-12-16 英商梅迪繆思有限公司 Combination therapies for treatment of cancer with therapeutic binding molecules
AU2023229884A1 (en) 2022-03-09 2024-10-10 Astrazeneca Ab BINDING MOLECULES AGAINST FRα
CN119234152A (en) 2022-03-11 2024-12-31 阿斯利康(瑞典)有限公司 Scoring method for anti-fra antibody-drug conjugate therapy
JP2026506049A (en) 2023-02-16 2026-02-20 アストラゼネカ・アクチエボラーグ Combination Therapies for the Treatment of Cancer Using Therapeutic Binding Molecules - Patent application
TW202506194A (en) 2023-04-28 2025-02-16 英商梅迪繆思有限公司 B7-h4 therapeutic binding molecules for the treatment of cancer
CN116874606B (en) * 2023-09-08 2023-11-24 益科思特(北京)医药科技发展有限公司 Bispecific antibody targeting TROP2 and CD3 as well as preparation method and application thereof
WO2026078620A1 (en) 2024-10-11 2026-04-16 Medimmune Llc Cd22 antibody and drug conjugates and uses thereof

Family Cites Families (127)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3896111A (en) 1973-02-20 1975-07-22 Research Corp Ansa macrolides
US4151042A (en) 1977-03-31 1979-04-24 Takeda Chemical Industries, Ltd. Method for producing maytansinol and its derivatives
US4137230A (en) 1977-11-14 1979-01-30 Takeda Chemical Industries, Ltd. Method for the production of maytansinoids
US4307016A (en) 1978-03-24 1981-12-22 Takeda Chemical Industries, Ltd. Demethyl maytansinoids
US4265814A (en) 1978-03-24 1981-05-05 Takeda Chemical Industries Matansinol 3-n-hexadecanoate
JPS5562090A (en) 1978-10-27 1980-05-10 Takeda Chem Ind Ltd Novel maytansinoid compound and its preparation
JPS5566585A (en) 1978-11-14 1980-05-20 Takeda Chem Ind Ltd Novel maytansinoid compound and its preparation
US4256746A (en) 1978-11-14 1981-03-17 Takeda Chemical Industries Dechloromaytansinoids, their pharmaceutical compositions and method of use
JPS55164687A (en) 1979-06-11 1980-12-22 Takeda Chem Ind Ltd Novel maytansinoid compound and its preparation
JPS55102583A (en) 1979-01-31 1980-08-05 Takeda Chem Ind Ltd 20-acyloxy-20-demethylmaytansinoid compound
JPS55162791A (en) 1979-06-05 1980-12-18 Takeda Chem Ind Ltd Antibiotic c-15003pnd and its preparation
JPS55164685A (en) 1979-06-08 1980-12-22 Takeda Chem Ind Ltd Novel maytansinoid compound and its preparation
JPS55164686A (en) 1979-06-11 1980-12-22 Takeda Chem Ind Ltd Novel maytansinoid compound and its preparation
US4309428A (en) 1979-07-30 1982-01-05 Takeda Chemical Industries, Ltd. Maytansinoids
JPS5645483A (en) 1979-09-19 1981-04-25 Takeda Chem Ind Ltd C-15003phm and its preparation
EP0028683A1 (en) 1979-09-21 1981-05-20 Takeda Chemical Industries, Ltd. Antibiotic C-15003 PHO and production thereof
JPS5645485A (en) 1979-09-21 1981-04-25 Takeda Chem Ind Ltd Production of c-15003pnd
WO1982001188A1 (en) 1980-10-08 1982-04-15 Takeda Chemical Industries Ltd 4,5-deoxymaytansinoide compounds and process for preparing same
US4450254A (en) 1980-11-03 1984-05-22 Standard Oil Company Impact improvement of high nitrile resins
US4313946A (en) 1981-01-27 1982-02-02 The United States Of America As Represented By The Secretary Of Agriculture Chemotherapeutically active maytansinoids from Trewia nudiflora
US4315929A (en) 1981-01-27 1982-02-16 The United States Of America As Represented By The Secretary Of Agriculture Method of controlling the European corn borer with trewiasine
JPS57192389A (en) 1981-05-20 1982-11-26 Takeda Chem Ind Ltd Novel maytansinoid
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US6492107B1 (en) 1986-11-20 2002-12-10 Stuart Kauffman Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique
DE3546807C2 (en) 1985-03-30 1991-03-28 Marc Genf/Geneve Ch Ballivet
US5618920A (en) 1985-11-01 1997-04-08 Xoma Corporation Modular assembly of antibody genes, antibodies prepared thereby and use
DE3600905A1 (en) 1986-01-15 1987-07-16 Ant Nachrichtentech METHOD FOR DECODING BINARY SIGNALS AND VITERBI DECODERS AND APPLICATIONS
US7838216B1 (en) 1986-03-05 2010-11-23 The United States Of America, As Represented By The Department Of Health And Human Services Human gene related to but distinct from EGF receptor gene
US5681718A (en) 1986-03-14 1997-10-28 Celltech Limited Methods for enhanced production of tissue plasminogen activator in cell culture using alkanoic acids or salts thereof
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US5770701A (en) 1987-10-30 1998-06-23 American Cyanamid Company Process for preparing targeted forms of methyltrithio antitumor agents
US5606040A (en) 1987-10-30 1997-02-25 American Cyanamid Company Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methyl-trithio group
US5053394A (en) 1988-09-21 1991-10-01 American Cyanamid Company Targeted forms of methyltrithio antitumor agents
WO1989006692A1 (en) 1988-01-12 1989-07-27 Genentech, Inc. Method of treating tumor cells by inhibiting growth factor receptor function
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
CA2016842A1 (en) 1989-05-16 1990-11-16 Richard A. Lerner Method for tapping the immunological repertoire
EP0478627A4 (en) 1989-05-16 1992-08-19 William D. Huse Co-expression of heteromeric receptors
CA2016841C (en) 1989-05-16 1999-09-21 William D. Huse A method for producing polymers having a preselected activity
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
CA2026147C (en) 1989-10-25 2006-02-07 Ravi J. Chari Cytotoxic agents comprising maytansinoids and their therapeutic use
US6172197B1 (en) 1991-07-10 2001-01-09 Medical Research Council Methods for producing members of specific binding pairs
GB9015198D0 (en) 1990-07-10 1990-08-29 Brien Caroline J O Binding substance
ES2113940T3 (en) 1990-12-03 1998-05-16 Genentech Inc ENRICHMENT METHOD FOR PROTEIN VARIANTS WITH ALTERED UNION PROPERTIES.
ATE255131T1 (en) 1991-06-14 2003-12-15 Genentech Inc HUMANIZED HEREGULIN ANTIBODIES
PT1696031E (en) 1991-12-02 2010-06-25 Medical Res Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
JP4157160B2 (en) 1991-12-13 2008-09-24 ゾーマ テクノロジー リミテッド Methods for the preparation of modified antibody variable regions
ZA932522B (en) 1992-04-10 1993-12-20 Res Dev Foundation Immunotoxins directed against c-erbB-2(HER/neu) related surface antigens
CA2120745A1 (en) 1992-06-30 1994-01-06 Philip G. Kasprzyk A combination of anti-erbb-2 monoclonal antibodies and method of using
US5639641A (en) 1992-09-09 1997-06-17 Immunogen Inc. Resurfacing of rodent antibodies
US5635483A (en) 1992-12-03 1997-06-03 Arizona Board Of Regents Acting On Behalf Of Arizona State University Tumor inhibiting tetrapeptide bearing modified phenethyl amides
US5780588A (en) 1993-01-26 1998-07-14 Arizona Board Of Regents Elucidation and synthesis of selected pentapeptides
US5773001A (en) 1994-06-03 1998-06-30 American Cyanamid Company Conjugates of methyltrithio antitumor agents and intermediates for their synthesis
GB9422383D0 (en) 1994-11-05 1995-01-04 Wellcome Found Antibodies
US5663149A (en) 1994-12-13 1997-09-02 Arizona Board Of Regents Acting On Behalf Of Arizona State University Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
US5712374A (en) 1995-06-07 1998-01-27 American Cyanamid Company Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates
US5714586A (en) 1995-06-07 1998-02-03 American Cyanamid Company Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates
DE69638269D1 (en) 1995-06-14 2010-11-18 Univ California HIGH-AFFINE HUMAN ANTIBODY AGAINST TUMORANTIGENE
US6696248B1 (en) 1995-08-18 2004-02-24 Morphosys Ag Protein/(poly)peptide libraries
ATE219517T1 (en) 1995-08-18 2002-07-15 Morphosys Ag PROTEIN/(POLY)PEPTIDE LIBRARIES
US5783186A (en) 1995-12-05 1998-07-21 Amgen Inc. Antibody-induced apoptosis
US5714352A (en) 1996-03-20 1998-02-03 Xenotech Incorporated Directed switch-mediated DNA recombination
EP0931147A1 (en) 1996-10-18 1999-07-28 Genentech, Inc. ANTI-ErbB2 ANTIBODIES
AU3657899A (en) 1998-04-20 1999-11-08 James E. Bailey Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
US7244826B1 (en) 1998-04-24 2007-07-17 The Regents Of The University Of California Internalizing ERB2 antibodies
GB9818731D0 (en) 1998-08-27 1998-10-21 Univ Portsmouth Compounds
KR100940380B1 (en) 1999-01-15 2010-02-02 제넨테크, 인크. Polypeptide Variants with Altered Effector Function
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
PT1176195E (en) 1999-04-09 2013-07-18 Kyowa Hakko Kirin Co Ltd Method for controlling the activity of immunologically functional molecule
AT500848B1 (en) 1999-06-25 2008-01-15 Genentech Inc HUMANIZED ANTI-ERBB2 ANTIBODIES
ATE482275T1 (en) 1999-07-02 2010-10-15 Morphosys Ag GENERATION OF SPECIFIC BINDING PARTNERS THAT BIND TO (POLY)PEPTIDES ENCODED BY GENOMIC DNA FRAGMENTS OR ESTS
WO2001001748A2 (en) 1999-07-02 2001-01-11 Genentech, Inc. Peptide compounds that bind her2
CA2388245C (en) 1999-10-19 2012-01-10 Kyowa Kirin Co., Ltd. The use of serum-free adapted rat cells for producing heterologous polypeptides
US7306801B2 (en) 2000-05-15 2007-12-11 Health Research, Inc. Methods of therapy for cancers characterized by overexpression of the HER2 receptor protein
US6946292B2 (en) 2000-10-06 2005-09-20 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions with increased antibody dependent cytotoxic activity
US7064191B2 (en) 2000-10-06 2006-06-20 Kyowa Hakko Kogyo Co., Ltd. Process for purifying antibody
AU2002307037B2 (en) 2001-04-02 2008-08-07 Biogen Idec Inc. Recombinant antibodies coexpressed with GnTIII
US6884869B2 (en) 2001-04-30 2005-04-26 Seattle Genetics, Inc. Pentapeptide compounds and uses related thereto
ITRM20010408A1 (en) 2001-07-10 2003-01-10 Univ Napoli Federico Ii CYTOTOXIC HUMAN MINI-ANTIBODY FOR CANCER CELLS THAT EXPRESS THE ERBB2 RECEPTOR.
KR100988949B1 (en) 2001-10-25 2010-10-20 제넨테크, 인크. Glycoprotein Composition
DE60226641D1 (en) 2001-12-03 2008-06-26 Amgen Fremont Inc ANTIBODY CATEGORIZATION BASED ON BINDING CHARACTERISTICS
US7135174B2 (en) 2002-01-07 2006-11-14 Amgen Fremont, Inc. Antibodies directed to PDGFD and uses thereof
US8188231B2 (en) 2002-09-27 2012-05-29 Xencor, Inc. Optimized FC variants
JP2005522514A (en) * 2002-04-10 2005-07-28 ジェネンテック・インコーポレーテッド Modified anti-HER2 antibody
US7538195B2 (en) 2002-06-14 2009-05-26 Immunogen Inc. Anti-IGF-I receptor antibody
WO2004005326A2 (en) 2002-07-09 2004-01-15 Morphochem Aktiengellschaft Fu Tubulysin conjugates
DK1523493T3 (en) 2002-07-09 2013-12-02 Alexander Doemling New tubulysine analogues
GB0216648D0 (en) 2002-07-18 2002-08-28 Lonza Biologics Plc Method of expressing recombinant protein in CHO cells
US20060235208A1 (en) 2002-09-27 2006-10-19 Xencor, Inc. Fc variants with optimized properties
HUE026914T2 (en) 2002-11-07 2016-08-29 Immunogen Inc Anti-cd33 antibodies and method for treatment of acute myeloid leukemia using the same
DE10254439A1 (en) 2002-11-21 2004-06-03 GESELLSCHAFT FüR BIOTECHNOLOGISCHE FORSCHUNG MBH (GBF) Tubulysins, manufacturing processes and tubulysin agents
US20050226867A1 (en) 2003-10-08 2005-10-13 Kyowa Hakko Kogyo Co., Ltd. IL-5R-specific antibody composition
ATE516288T1 (en) 2003-10-22 2011-07-15 Us Gov Health & Human Serv PYRROLOBENZODIAZEPINE DERIVATIVES, COMPOSITIONS CONTAINING SAME AND RELATED METHODS
PT1692182E (en) 2003-11-05 2010-05-13 Roche Glycart Ag Cd20 antibodies with increased fc receptor binding affinity and effector function
CA2558195C (en) 2004-03-01 2012-11-06 Spirogen Limited 11-hydroxy-5h-pyrrolo[2,1-c][1,4]benzodiazepin-5-one derivatives as key intermediates for the preparation of c2 substituted pyrrolobenzodiazepines
WO2005075514A2 (en) 2004-03-10 2005-08-18 Lonza Ltd. Method for producing antibodies
US7273608B2 (en) 2004-03-11 2007-09-25 City Of Hope Humanized anti-CEA T84.66 antibody and uses thereof
GB0410725D0 (en) 2004-05-13 2004-06-16 Spirogen Ltd Pyrrolobenzodiazepine therapeutic agents
AU2005279347A1 (en) 2004-08-30 2006-03-09 Lonza Biologics Plc. Affinity- plus ion exchange- chromatography for purifying antibodies
ES2579805T3 (en) 2004-09-23 2016-08-16 Genentech, Inc. Antibodies and conjugates engineered with cysteine
BRPI0517837A (en) 2004-11-12 2008-10-21 Xencor Inc fc variants with altered link to fcrn
US8802820B2 (en) 2004-11-12 2014-08-12 Xencor, Inc. Fc variants with altered binding to FcRn
EP1879901B1 (en) 2005-04-21 2009-12-23 Spirogen Limited Pyrrolobenzodiazepines
ATE427949T1 (en) 2005-10-05 2009-04-15 Spirogen Ltd 4-A4-(5-OXO-2,3,5,11A-TETRAHYDRO-5H-PYRROLO A2, 1-CUA1,4UBENZODIAZEPINE-8-YLOXY)-BUTYRYLAMINOU-1 - PYRROLE-2-CARBONATE ALKYL ESTER DERIVATIVES AND RELATED COMPOUND FOR THE TREATMENT OF A PROLIFERATIVE DISEASE
AU2007345745C1 (en) 2006-06-19 2013-05-23 Merck Sharp & Dohme Corp. ILT3 binding molecules and uses therefor
JP5638804B2 (en) * 2006-08-04 2014-12-10 アストラゼネカ アクチボラグ Antibodies against ErbB2
DK2099823T4 (en) 2006-12-01 2022-05-09 Seagen Inc Target binding agent variants and uses thereof
US7691980B2 (en) 2007-01-09 2010-04-06 Bio-Rad Laboratories, Inc. Enhanced capacity and purification of antibodies by mixed mode chromatography in the presence of aqueous-soluble nonionic organic polymers
US8476451B2 (en) 2007-07-20 2013-07-02 The Regents Of The University Of California Tubulysin D analogues
WO2009012958A2 (en) 2007-07-20 2009-01-29 Helmholtz-Zentrum für Infektionsforschung GmbH Tubulysin d analogues
US20090155275A1 (en) * 2007-07-31 2009-06-18 Medimmune, Llc Multispecific epitope binding proteins and uses thereof
WO2009055562A1 (en) 2007-10-25 2009-04-30 Endocyte, Inc. Tubulysins and processes for preparing
US8093364B2 (en) 2008-01-18 2012-01-10 Bio-Rad Laboratories, Inc. Enhanced purification of antibodies and antibody fragments by apatite chromatography
ES2613963T3 (en) 2008-01-18 2017-05-29 Medimmune, Llc Cysteine manipulated antibodies for site specific conjugation
CA2766405A1 (en) 2009-06-22 2011-01-13 Medimmune, Llc Engineered fc regions for site-specific conjugation
SI2506871T1 (en) 2009-11-30 2016-12-30 Janssen Biotech, Inc. ANTIBODY Fc MUTANTS WITH ABLATED EFFECTOR FUNCTIONS
JP2013528357A (en) 2010-03-29 2013-07-11 ザイムワークス,インコーポレイテッド Antibody with enhanced or suppressed effector function
RU2604811C2 (en) 2010-05-27 2016-12-10 Мерк Шарп Энд Домэ Корп. Method for preparing antibodies having improved properties
MX2013001402A (en) 2010-08-06 2013-08-29 Endocyte Inc Processes for preparing tubulysins.
WO2012088290A2 (en) * 2010-12-22 2012-06-28 Abbott Laboratories Tri-variable domain binding proteins and uses thereof
WO2012143523A1 (en) 2011-04-20 2012-10-26 Genmab A/S Bispecifc antibodies against her2
EP2537864B1 (en) 2011-06-24 2019-08-07 Laboratoire Français du Fractionnement et des Biotechnologies Fc variants with reduced effector functions
ES2749349T3 (en) 2011-11-07 2020-03-19 Medimmune Llc Multispecific and multivalent binding proteins and uses thereof
UY36075A (en) 2014-04-11 2015-10-30 Medimmune Llc TUBULISINE DERIVATIVES
SMT201900160T1 (en) 2014-04-11 2019-05-10 Medimmune Llc Conjugated compounds comprising cysteine-engineered antibodies

Also Published As

Publication number Publication date
MX2016012830A (en) 2017-01-05
EP3129055B1 (en) 2020-07-01
HK1232127A1 (en) 2018-01-05
RU2016144176A (en) 2018-05-14
WO2015157592A1 (en) 2015-10-15
SG11201608192SA (en) 2016-10-28
ES2819863T3 (en) 2021-04-19
CA2943299A1 (en) 2015-10-15
TW201542594A (en) 2015-11-16
CN106232139A (en) 2016-12-14
RU2016144176A3 (en) 2018-11-20
EP3129055A4 (en) 2017-11-22
AU2015243377A1 (en) 2016-09-15
US20170291955A1 (en) 2017-10-12
KR20160143808A (en) 2016-12-14
CL2016002547A1 (en) 2017-06-23
BR112016022910A2 (en) 2017-10-17
IL247478A0 (en) 2016-11-30
US10160812B2 (en) 2018-12-25
JP2017512765A (en) 2017-05-25

Similar Documents

Publication Publication Date Title
EP3129055B1 (en) Bispecific her2 antibodies
US20230067757A1 (en) Anti-claudin 18 antibodies and methods of use thereof
CA2862319C (en) Antibodies to integrin .alpha.v.beta.6 and use of same to treat cancer
KR102080535B1 (en) Binding molecules specific for her3 and uses thereof
KR20200055758A (en) New anti-CD19 antibody
TW202134281A (en) ANTI-αVβ6 ANTIBODIES AND ANTIBODY-DRUG CONJUGATES
WO2019175359A1 (en) De-immunised anti-erbb3 antibodies
EP3143046B1 (en) Her1 antigen binding proteins binding to the beta-hairpin of her1
EP3759137A1 (en) Csf1r binding agents
AU2024324215A1 (en) Anti-ctla-4 antibodies and related binding molecules and methods and uses thereof
HK1203207B (en) Binding molecules specific for her3 and uses thereof

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20161109

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

AX Request for extension of the european patent

Extension state: BA ME

DAV Request for validation of the european patent (deleted)
A4 Supplementary search report drawn up and despatched

Effective date: 20171025

RIC1 Information provided on ipc code assigned before grant

Ipc: C07K 16/40 20060101ALI20171018BHEP

Ipc: A61K 45/06 20060101ALI20171018BHEP

Ipc: A61K 39/395 20060101AFI20171018BHEP

REG Reference to a national code

Ref country code: HK

Ref legal event code: DE

Ref document number: 1231738

Country of ref document: HK

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS

17Q First examination report despatched

Effective date: 20180606

GRAP Despatch of communication of intention to grant a patent

Free format text: ORIGINAL CODE: EPIDOSNIGR1

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: GRANT OF PATENT IS INTENDED

RIC1 Information provided on ipc code assigned before grant

Ipc: C07K 16/32 20060101ALI20190711BHEP

Ipc: A61P 35/00 20060101AFI20190711BHEP

INTG Intention to grant announced

Effective date: 20190806

RAP1 Party data changed (applicant data changed or rights of an application transferred)

Owner name: MEDIMMUNE, LLC

RIN1 Information on inventor provided before grant (corrected)

Inventor name: COATS, STEVEN

Inventor name: DIMASI, NAZZARENO

Inventor name: GAO, CHANGSHOU

Inventor name: RAINEY, GODFREY

Inventor name: DAMSCHRODER, MELISSA

Inventor name: LI, JOHN

Inventor name: GINGIPALLI, LAKSHMAIAH

Inventor name: WANG, FENGJIANG

Inventor name: GAO, CUIHUA

Inventor name: KASTURIRANGAN, SRINATH

Inventor name: FLEMING, RYAN

Inventor name: BEZABEH, BINYAM

Inventor name: TOADER, DORIN

Inventor name: YUAN, ANDY QINGAN

GRAJ Information related to disapproval of communication of intention to grant by the applicant or resumption of examination proceedings by the epo deleted

Free format text: ORIGINAL CODE: EPIDOSDIGR1

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS

REG Reference to a national code

Ref country code: DE

Ref legal event code: R079

Ref document number: 602015055123

Country of ref document: DE

Free format text: PREVIOUS MAIN CLASS: A61K0039395000

Ipc: A61P0035000000

GRAP Despatch of communication of intention to grant a patent

Free format text: ORIGINAL CODE: EPIDOSNIGR1

INTC Intention to grant announced (deleted)
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: GRANT OF PATENT IS INTENDED

RIC1 Information provided on ipc code assigned before grant

Ipc: A61P 35/00 20060101AFI20190911BHEP

Ipc: C07K 16/32 20060101ALI20190911BHEP

INTG Intention to grant announced

Effective date: 20191010

GRAS Grant fee paid

Free format text: ORIGINAL CODE: EPIDOSNIGR3

GRAA (expected) grant

Free format text: ORIGINAL CODE: 0009210

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE PATENT HAS BEEN GRANTED

AK Designated contracting states

Kind code of ref document: B1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

AX Request for extension of the european patent

Extension state: BA ME

REG Reference to a national code

Ref country code: CH

Ref legal event code: EP

Ref country code: AT

Ref legal event code: REF

Ref document number: 1285591

Country of ref document: AT

Kind code of ref document: T

Effective date: 20200715

REG Reference to a national code

Ref country code: IE

Ref legal event code: FG4D

REG Reference to a national code

Ref country code: DE

Ref legal event code: R096

Ref document number: 602015055123

Country of ref document: DE

REG Reference to a national code

Ref country code: SE

Ref legal event code: TRGR

REG Reference to a national code

Ref country code: LT

Ref legal event code: MG4D

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: BG

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20201001

REG Reference to a national code

Ref country code: NL

Ref legal event code: MP

Effective date: 20200701

REG Reference to a national code

Ref country code: AT

Ref legal event code: MK05

Ref document number: 1285591

Country of ref document: AT

Kind code of ref document: T

Effective date: 20200701

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: PT

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20201102

Ref country code: FI

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

Ref country code: LT

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

Ref country code: NO

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20201001

Ref country code: AT

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

Ref country code: CZ

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

Ref country code: GR

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20201002

Ref country code: HR

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: RS

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

Ref country code: PL

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

Ref country code: LV

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

Ref country code: IS

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20201101

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: NL

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

REG Reference to a national code

Ref country code: DE

Ref legal event code: R097

Ref document number: 602015055123

Country of ref document: DE

REG Reference to a national code

Ref country code: ES

Ref legal event code: FG2A

Ref document number: 2819863

Country of ref document: ES

Kind code of ref document: T3

Effective date: 20210419

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: DK

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

Ref country code: EE

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

Ref country code: SM

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

Ref country code: RO

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

PLBE No opposition filed within time limit

Free format text: ORIGINAL CODE: 0009261

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: NO OPPOSITION FILED WITHIN TIME LIMIT

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: AL

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

26N No opposition filed

Effective date: 20210406

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: SK

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: SI

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: MC

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: LU

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20210410

REG Reference to a national code

Ref country code: BE

Ref legal event code: MM

Effective date: 20210430

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: LI

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20210430

Ref country code: CH

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20210430

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: IE

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20210410

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: IS

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20201101

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: BE

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20210430

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: HU

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT; INVALID AB INITIO

Effective date: 20150410

P01 Opt-out of the competence of the unified patent court (upc) registered

Effective date: 20230408

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: CY

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

REG Reference to a national code

Ref country code: HK

Ref legal event code: WD

Ref document number: 1231738

Country of ref document: HK

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: MK

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: MT

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

PGFP Annual fee paid to national office [announced via postgrant information from national office to epo]

Ref country code: DE

Payment date: 20250319

Year of fee payment: 11

PGFP Annual fee paid to national office [announced via postgrant information from national office to epo]

Ref country code: ES

Payment date: 20250502

Year of fee payment: 11

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: TR

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20200701

PGFP Annual fee paid to national office [announced via postgrant information from national office to epo]

Ref country code: SE

Payment date: 20260319

Year of fee payment: 12

PGFP Annual fee paid to national office [announced via postgrant information from national office to epo]

Ref country code: GB

Payment date: 20260319

Year of fee payment: 12

PGFP Annual fee paid to national office [announced via postgrant information from national office to epo]

Ref country code: IT

Payment date: 20260319

Year of fee payment: 12

PGFP Annual fee paid to national office [announced via postgrant information from national office to epo]

Ref country code: FR

Payment date: 20260320

Year of fee payment: 12