EP3024469A1 - Vectors for producing and secreting substance of interest by bacteria and applications thereof - Google Patents

Vectors for producing and secreting substance of interest by bacteria and applications thereof

Info

Publication number
EP3024469A1
EP3024469A1 EP14744523.3A EP14744523A EP3024469A1 EP 3024469 A1 EP3024469 A1 EP 3024469A1 EP 14744523 A EP14744523 A EP 14744523A EP 3024469 A1 EP3024469 A1 EP 3024469A1
Authority
EP
European Patent Office
Prior art keywords
sequence
protein
sequences
trail
nucleic acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP14744523.3A
Other languages
German (de)
French (fr)
Inventor
Gwenaël Jan
Hélène FALENTIN
Charles Halouze
Marie-Thérèse DIMANCHE-BOITREL
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Universite de Rennes 1
Institut National de la Recherche Agronomique INRA
Institut National de la Sante et de la Recherche Medicale INSERM
Original Assignee
Universite de Rennes 1
Institut National de la Recherche Agronomique INRA
Institut National de la Sante et de la Recherche Medicale INSERM
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Universite de Rennes 1, Institut National de la Recherche Agronomique INRA, Institut National de la Sante et de la Recherche Medicale INSERM filed Critical Universite de Rennes 1
Priority to EP14744523.3A priority Critical patent/EP3024469A1/en
Publication of EP3024469A1 publication Critical patent/EP3024469A1/en
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70575NGF/TNF-superfamily, e.g. CD70, CD95L, CD153, CD154
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/66Microorganisms or materials therefrom
    • A61K35/74Bacteria
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P21/00Preparation of peptides or proteins
    • C12P21/02Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/036Fusion polypeptide containing a localisation/targetting motif targeting to the medium outside of the cell, e.g. type III secretion
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/74Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
    • C12N15/746Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora for lactic acid bacteria (Streptococcus; Lactococcus; Lactobacillus; Pediococcus; Enterococcus; Leuconostoc; Propionibacterium; Bifidobacterium; Sporolactobacillus)

Definitions

  • the present invention relates to the field of genetic engineering applicable to various industries including the pharmaceuticals, chemicals, agri-foods, cosmetics and biotechnologies industries.
  • the invention relates to a vector useful for the production of a substance of interest by a bacterium, particularly a bacterium belonging to the order Actinomycetales, more particularly to the genus Propionibacterium, and even more particularly to the species Propionibacterium freudenreichii.
  • Said vector can be particularly useful in the pharmaceutical field, for the large-scale production of substances whose activity is of interest in industries as diverse as pharmaceuticals, chemicals, agri-foods, cosmetics but also as a biotechnology tool for the production and secretion of substance of interest in bacteria particularly belonging to the order Actinomycetales.
  • baculovirus baculovirus, Sf , Sf21, etc.
  • plant cells e.g., CHO, HEK, COS, etc.
  • mammalian cells e.g., CHO, HEK, COS, etc.
  • propionibacteria are very robust and adaptable to particular media (e.g. media containing milk, milk derivatives or molasses) that are possibly hostile to the growth and development of other living systems (e.g. due to the presence in the medium of lactic acid, salt, etc.).
  • media e.g. media containing milk, milk derivatives or molasses
  • These bacteria have also good tolerance with respect to variations, changes or disturbances of the environmental conditions likely to occur during large-scale culture operations.
  • propionibacteria can be described as "natural antifungals” since they naturally produce metabolites (for example, propionate) that inhibit the development of contaminating fungi. Furthermore, they are able to produce recombinant proteins of significant size (for example, proteins of more than 500 amino acids) and can even produce several different proteins simultaneously (for example, more than a dozen different proteins).
  • Propionibacteria are also particularly useful for applications in the pharmaceutical and dietary fields.
  • propionibacteria can be used as a tool for addressing or targeting substances to the intestine. Indeed, in mammals, including humans, propionibacteria are naturally able to target the intestine where their survival time can reach two weeks, compared to only two or three days for lactic bacteria, even though they are natural hosts of this environment.
  • propionibacteria over various other bacteria proposed so far for use in anti-tumoral therapy (e.g., in WO 01/25397 in the name of Vion Pharmaceuticals, Inc. and in WO 2009/11 1177 in the name of Mount Sinai School of Medicine of New York University) is that propionibacteria per se are efficient and specific anti-tumoral agents that can safely be used in mammals, in particular in humans. This inherent property of propionibacteria can thus be further enhanced upon using propionibacteria to deliver therapeutic agents, such as drugs, to eradicate tumor cells while at the same time preventing damage to normal cells.
  • therapeutic agents such as drugs
  • Propionibacteria do not need to be genetically attenuated or enhanced by genomic mutations as it is the case for other bacteria such as Clostridium, Salmonella, Listeria, and the like.
  • propionibacteria can be particularly useful anti-tumoral agents thanks to both their intrinsic anti-tumoral properties and their ability to efficiently, specifically and safely deliver other anti- tumoral drugs in order to kill cancer cells.
  • the Inventors have previously demonstrated that Propionibacterium freudenreichii (Falentin et al., 2010, Plos One; Genbank accession No. FN806773) has particular cytotoxic properties with respect to colon cancer cells (Jan et al., 2002; Lan et al., 2007).
  • Propionibacterium freudenreichii adheres to colonic epithelial cells and has no toxic effect on healthy cells (Lan et al., 2008).
  • the Inventors have recently developed new vectors allowing the production and secretion of various substances at a high level by a bacterium, particularly belonging to the order Actinomycetales, including the genus Propionibacterium.
  • the Inventors have shown that said signal peptides particularly in combination with promoters of genes encoding a surface layer protein of a Propionibacterium freudenreichii, allow the secretion into the extracellular medium of a substance of interest by a bacterium, in particular a propionibacterium, at a level up to 100 times greater than that obtained with other signal peptides in the same strain.
  • the invention relates to a vector comprising:
  • nucleic acid sequence encoding a signal peptide is selected from the group consisting of: - the sequence of the signal peptide of a gene encoding a surface layer protein of a Propionibacterium freudenreichii; and
  • sequences having at least 80%, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with said sequence over the entire length of said sequence;
  • sequence of said promoter is selected from the group consisting of:
  • sequences having at least 80%>, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with said sequence over the entire length of said sequence.
  • a vector can be a cloning or an expression vector.
  • the vectors according to the invention can be viral vectors such as bacteriophages, or non-viral, such as plasmid vectors.
  • a plasmid vector is a non-viral DNA molecule hosted by a cell, distinct from the natural chromosomal DNA of said host cell and capable of autonomous replication. The choice of plasmid vector and, more particularly, the origin of replication it carries thus depend on the host cell. According to the type of host cell, several copies of a plasmid vector and/or several different plasmid vectors can be hosted simultaneously.
  • a plasmid vector according to the invention can possibly be carried by (or "integrated in” or "inserted in") the chromosome of the host cell.
  • nucleic acid sequence refers to the sequence of a nucleic acid molecule, DNA and RNA, wherein the former can be genomic DNA, plasmid DNA, recombinant DNA or complementary DNA (cDNA), for example, and the latter can be messenger RNA (mRNA), ribosomal RNA (rRNA) or transfer RNA (tRNA).
  • mRNA messenger RNA
  • rRNA ribosomal RNA
  • tRNA transfer RNA
  • nucleic acid sequences of the invention refer to sequences of DNA molecules.
  • the promoter comprised in the vector according to the invention can be a promoter suitable for the expression of said substance of interest in a bacterium, particularly a priopionibacterium.
  • said promoter is a promoter for bacterial RNA polymerase, in particular for propionibacterial RNA polymerase.
  • Said promoter can be a constitutive and/or inducible promoter well known by one skilled in the art.
  • said promoter is inducible.
  • the promoter can be developmentally regulated, inducible or tissue specific, preferably inducible in the digestive tract.
  • said promoter is a promoter of propionic origin, in particular of P. freudenheimii origin, such as the promoter of protein PF963 of P. freudenreichii. More particularly, said promoter is a strong propionic promoter.
  • the sequence of said promoter is selected from the group consisting of:
  • sequences having at least 80%, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with said sequence over the entire length of said sequence.
  • promoters of genes encoding a surface layer protein of a Propionibacterium freudenreichii in combination with signal peptides of genes encoding a surface layer protein of a Propionibacterium freudenreichii allow the secretion into the extracellular medium of a substance of interest by a propionibacterium at a level up to 100 times greater than that obtained with other promoters and peptide signals in the same propionibacterium strain.
  • sequence of said promoter is selected from the group consisting of:
  • said surface layer protein is selected from the group consisting of the surface layer protein A, the surface layer protein B, the surface layer protein C, the surface layer protein D, the surface layer protein E and the surface layer protein F, in particular of the surface layer protein A.
  • sequence of said promoter is selected from the group consisting of:
  • sequences having at least 80%>, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with said sequence over the entire length of said sequence;
  • CIRM BIA 118 strain refers to the strain numbered 118 available at the International Centre for Microbial Resources dedicated to food bacteria interest ("Centre international de lives microbiennes dedie au. bacteries d'interets") located in Renncs (France).
  • the vector according to the invention can comprise at least two promoters such as defined above which, even more advantageously, will be situated preferably in a series (but not necessarily coupled to each other), in order to increase the expression level of said substance of interest ("expression booster" effect).
  • the recombinant vector according to the present invention comprises at least one nucleic acid sequence encoding a signal peptide translationally fused to at least one nucleic acid sequence encoding a substance of interest.
  • said signal peptide is a secretory signal peptide.
  • secretory signal peptide refers to any peptide allowing the secretion, in particular into the extracellular medium, of said substance of interest, by a host cell comprising the vector according to the invention, particularly by a propionibacterium.
  • said signal peptide is a propionibacterial secretory signal peptide, allowing the secretion, in particular into the extracellular medium, of said substance of interest, by a host cell comprising the vector according to the invention, particularly by a propionibacterium.
  • a signal peptide of a propionibacterium selected from dairy propionibacterium and so-called "cutaneous" propionibacterium (CPB) can be used.
  • dairy propionibacterium can be cited: Propionibacterium freudenreichii, P. jensenii, P. thoenii P. acidipropionici and P. microaerophilum.
  • the following cutaneous propionibacterium can also be cited: P.
  • a signal peptide of a propionibacterium selected from the following species can be used: Propionibacterium freudenreichii, more particularly the subspecies P. freudenreichii subsp. freudenreichii and P. freudenheimii subsp. shermanii, and Propionibacterium acnes, wherein said propionibacterium is preferentially P. freudenreichii subsp. shermanii.
  • said nucleic acid sequence encoding a signal peptide can be selected from the group consisting of:
  • sequences having at least 80%, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with one of said sequences over the entire length of said sequence.
  • Table I presents the nucleotide (NT) sequences, as well as the corresponding amino acid (AA) sequences of signal peptides, identified by the Inventors using proteomic analysis of P. freudenreichii CIRM-BIA 1 exoproteome.
  • Table II below presents amino acid sequences of signal peptide, identified by the Inventors from the genomic sequence of P. acnes, accessible from databases (strain P. acnes KPA171202; accession number: NCBI: NC 006085; 5 GenBank: AEO 17283). Table II
  • nucleic acid sequence encoding a signal peptide can be selected from the group consisting of:
  • sequences having at least 80% more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%o and even more particularly at least 99% of identity with said sequence over the entire length of said sequence.
  • Said surface layer protein can be selected from the group consisting of the surface layer protein A, the surface layer protein B, the surface layer protein C, the surface layer protein D, the surface layer protein E and the surface layer protein F of a Propionibacterium freudenreichii, in particular the surface layer protein A of a Propionibacterium freudenreichii.
  • the Inventors have shown that said signal peptides, in particular in combination with promoters of genes encoding a surface layer protein of a Propionibacterium freudenreichii, allow the secretion into the extracellular medium of a substance of interest by a propionibacterium at a level up to 100 times greater than that obtained with other signal peptides in the same propionibacterium strain.
  • said promoter and said signal peptide are the promoter and the signal peptide of the same gene encoding a surface layer protein of a Propionibacterium freudenreichii.
  • nucleic acid sequence encoding a signal peptide is selected from the group consisting of:
  • sequences having at least 80%>, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with one of said sequences over the entire length of said sequence and particularly corresponding to nucleic acid sequences encoding a signal peptide allowing the secretion, in particular into the extracellular medium, of said substance of interest by a propionibacterium.
  • the inventors have demonstrated that the signal peptide having the sequence set forth in SEQ ID NO: 59 in combination with the promoter of the gene encoding the Surface layer protein A of a Propionibacterium freudenreichii allows the secretion into the extracellular medium of a substance of interest by different strains of Propionibacterium freudenreichii at a level up to 100 times greater than that obtained with other signal peptides and promoters in the same Propionibacterium freudenreichii strain.
  • the vector according to the invention comprises the nucleic acid sequence SEQ ID NO: 69 or a sequence having at least 80%, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%o, at least 97%, at least 98%> and even more particularly at least 99% of identity with SEQ ID NO: 69 over the entire length of said sequence, trans lationally fused to said nucleic acid sequence encoding a substance of interest.
  • sequences having at least 80% of identity with the nucleic acid sequence SEQ ID NO: 69 over the entire length of said sequence comprise a promoter and a sequence encoding a signal peptide, particularly a secretory signal peptide.
  • the vector according to the invention comprises the nucleic acid sequence SEQ ID NO: 69 translationally fused to said nucleic acid sequence encoding a substance of interest.
  • the nucleic acid sequence SEQ ID NO: 69 comprises the promoter and the signal peptide of the Surface layer protein A of the Propionibacterium freudenheimii CIRM BIA 118.
  • the percentage of identity to which reference is made in the presentation of the invention are determined on the basis of global alignment of sequences to be compared, that is to say, on an alignment of sequences over their entire length, using for example the algorithm of Needlman and Wunsch 1970.
  • This sequence comparison can be done for example using the needle software by using the parameter "Gap open” equal to 10.0, the parameter “Gap Extend” equal to 0.5, and a matrix "BLOSUM 62".
  • Software such as needle is available on the website ebi.ac.uk worldwide, under the name "needle”.
  • Said nucleic acid sequence encoding a signal peptide can be translationally fused with several nucleic acid sequences encoding a substance of interest. Said nucleic acid sequence encoding a signal peptide can be operatively linked to several promoters.
  • said substance of interest can be any molecule of interest.
  • said substance of interest is of eukaryotic origin, more particularly of animal origin and even more particularly of mammalian origin.
  • said substance of interest can originate from mammals selected from the group consisting of rodents (e.g. mice, rats, rabbits, Chinese pigs, hamsters), canidae (e.g., dogs),felidae (e.g., cats), domestic livestock (e.g. cows, pigs, goats, sheeps, horses), and humans.
  • rodents e.g. mice, rats, rabbits, Chinese pigs, hamsters
  • canidae e.g., dogs
  • felidae e.g., cats
  • domestic livestock e.g. cows, pigs, goats, sheeps, horses
  • said substance of interest is a peptide or a protein chosen in the group consisting of antibodies, receptor ligands, hormones, cytokines, growth factors, cell adhesion molecules, blood clotting factors, enzymes, fragments thereof and combinations thereof, more particularly in the group consisting of cytokines, antibodies and hormones, and even more particularly from the group consisting of proapoptotic TRAIL protein and the C- terminal extracellular domain of the TRAIL protein.
  • a “fragment” of a protein or peptide is a protein or a peptide of amino acid sequence of smaller length but included in the one of said initial peptide or protein.
  • a protein "fragment” could be a peptide, for example.
  • the vector according to the present invention makes it possible to express and secrete the proapoptotic TRAIL protein (TNF- related apoptosis-inducing ligand, also called TNSF10, TL2, CD253 and Apo- 2L), a cytokine of the TNF family.
  • the sequence of the Homo sapiens TRAIL protein can be the sequence set forth in SEQ ID NO: 58 (accession number AAC50332.1).
  • said substance of interest can be the proapoptotic TRAIL protein or the C-terminal extracellular domain of the TRAIL protein, in particular the Homo sapiens proapoptotic TRAIL protein or the C- terminal extracellular domain of the Homo sapiens TRAIL protein.
  • said substance of interest is the C-terminal extracellular domain of the TRAIL protein consisting of the sequence from amino acids 1 14 to 281 of the sequence set forth in SEQ ID NO: 58.
  • TRAIL is an antineoplastic agent with strong potential because it induces the death of many tumor cells, independently of p53 and Pgpl80 (MDR, multidrug resistance). TRAIL also inhibits the growth of xenografted colon tumors in nude mice (Ashkenazi et al., 1999). Quite interestingly, TRAIL has little cytotoxic effect on most normal tissues (Ashkenazi et al., 1999), including human colon epithelium (Strater et al., 2002).
  • propionibacteria have major advantages compared to other bacteria such as salmonellas, bifidobacteria and coliform bacteria.
  • dairy propionibacteria enable local delivery because they target colon epithelial cells and have an active fermentative metabolism in the human colon (Herve et al., 2007), which enables site-specific delivery of TRAIL.
  • GRAS food-quality bacteria
  • these food-quality (GRAS: generally regarded as safe) bacteria adapt and survive in the digestive tract of animals and humans with an efficiency that, although strain-dependent, exceeds that of other probiotics (Herve et al., 2007).
  • GRAS food-quality bacteria
  • they express in the intestine enzymatic activities characteristic of their fermentative metabolism by producing an increase in SCFA concentrations (Lan et al, 2007b) and induce an increase in apoptosis in the mucosa of the colon of rats treated with 1 ,2-dimethylhydrazine (Lan et al., 2008).
  • the Inventors have further shown a synergistic action with TRAIL in vitro as illustrated in the examples below.
  • the vector according to the invention comprises:
  • nucleic acid sequence encoding a signal peptide is selected from the group consisting of:
  • sequence of said promoter is selected from the group consisting of:
  • sequences having at least 80%>, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with said sequence over the entire length of said sequence.
  • a particularly preferred vector according to the invention is the vector pCHH04: TRAIL comprising:
  • nucleic acid sequence encoding the signal peptide of the Surface layer protein A of the Propionibacterium freudenreichii CIRM BIA 118, translationally fused to
  • nucleic acid sequence encoding the sequence from amino acids 114 to 281 of the TRAIL protein sequence set forth in SEQ ID NO: 58.
  • a P. freudenreichii CIRM-BIA-118 comprising said vector pCHH04: TRAIL has been deposited on November 13, 2012 under number CNCM 1-4692 with the Collection Nationale de Cultures de Microorganismes (CNCM, Institut Pasteur, 25 rue du Dondel Roux, 75724 Paris Cedex 15, France).
  • a particularly preferred vector according to the invention is the vector comprised in the propionibacterium deposited on November 13, 2012 under number CNCM 1-4692 with the Collection Nationale de Cultures de Microorganismes (CNCM, Institut Pasteur, 25 rue du Dondel Roux, 75724 Paris Cedex 15, France).
  • the present invention further relates to a bacterium comprising at least one vector according to the invention as previously defined.
  • Said bacterium comprising a vector according to the invention can belong to the order Actinomycetales, in particular to the genus Propionibacterium, and more particularly to a species selected from the group consisting of Propionibacterium freudenreichii, Propionibacterium jensenii, Propionibacterium thoenii, Propionibacterium acidipropionicii, Propionibacterium acnes, Propionibacterium granulosum, Propionibacterium avidum, Propionibacterium propionicum and Propionibacterium microaerophilum and even more particularly the species Propionibacterium freudenreichii.
  • said bacterium comprising a vector according to the invention can be selected from the group consisting of Propionibacterium freudenreichii freudenreichii and Propionibacterium freudenreichii shermanii.
  • the propionibacterium comprising at least one vector according to the invention can be selected from the group consisting of CIRM BIA 512 strain, CIRM BIA 125 strain, CIRM BIA 118 strain, CIRM BIA 129 strain, CIRM BIA 138 and CIRM BIA 122 strain, particularly CIRM BIA 512 strain, CIRM BIA 125 strain, CIRM BIA 118 strain, CIRM BIA 129 strain and CIRM BIA 122 strain, more particularly CIRM BIA 512 strain, CIRM BIA 125 strain, CIRM BIA 118 strain and CIRM BIA 129 strain, even more particularly CIRM BIA 512 strain, CIRM BIA 125 strain, CIRM BIA 118 strain and even more particularly CIRM BIA 512 strain and CIRM BIA 1 18 strain and even more particularly CIRM BIA 118 strain.
  • the propionibacterium comprising at least one vector according to the invention is a CIRM BIA 138 strain.
  • This strain also named TL 133 strain in the article of Lan et al. (2007b) has the advantage to be particularly tolerant towards digestive stresses.
  • the vector can be carried by the chromosome of the bacterium according to the invention.
  • the vector can be integrated, for example, in the chromosome of the host cell by homologous recombination as described by Deutsch e* al. (2012).
  • One particularly preferred bacterium according to the invention is the propionibacterium deposited on November 13, 2012 under number CNCM 1-4692 with the Collection Nationale de Cultures de Microorganismes (CNCM, Institut Pasteur, 25 rue du Dondel Roux, 75724 Paris Cedex 15, France). If the substance of interest to be secreted lends itself to such a use (an anorexiant peptide, for example), the bacterium according to the invention could be used as a probiotic food or dietary supplement for mammals, in particular humans.
  • the bacterium can be integrated in the mammal's food in the form of a fermented dairy product (e.g., fermented milk, fermented whey, cheese).
  • the present invention further relates to a composition comprising at least one vector according to the invention and/or at least one bacterium according to the invention.
  • composition according to the invention can be a dietary or a pharmaceutical composition.
  • dietary compositions comprises any type of food/feed and beverages, also including clinical, nutrition and dietary supplements.
  • the dietary compositions according to the present invention may further contain protecting components (such as carbohydrates, betaines, fibers, polyois), protective hydrocolloids (such as gums, proteins, modified starches), binders, film-forming agents, encapsulating agents/materials, wail/shell materials, matrix compounds, coatings, emu isi tiers, surface active agents, solubil ising agents (oils, fats, waxes, lecithins etc.), adsorbents, carriers, fillers, co-compounds, dispersing agents, wetting agents, processing aids (solvents), flowing agents, taste-masking agents, weighting agents, jei!yfying agents, gel-forming agents, antioxidants and ant imicrobials.
  • protecting components such as carbohydrates, betaines, fibers, polyois
  • protective hydrocolloids such as gums, proteins, modified starches
  • binders film
  • Said pharmaceutical composition according to the invention can comprise an effective amount of at least one vector according to the invention and/or at least one bacterium according to the invention and at least one pharmaceutically acceptable carrier (or excipient).
  • Such therapeutically effective amount can be determined by one skilled in the art by routine tests including assessment of the effect of administration of said components (vector according to the invention and/or bacterium according to the invention) on the pathologies and/or disorders which are sought to be prevent and/or to be treated by the administration of said drug (or pharmaceutical composition).
  • such tests can be implemented by analyzing both quantitative and qualitative effect of the administration of different amounts of said aforementioned components (vector according to the invention and/or bacterium according to the invention) on a set of markers (biological and/or clinical) characteristics of said pathologies and/or of said disorders, in particular from a biological sample of a subject.
  • the present invention further relates to a vector according to the invention or a bacterium according to the invention for use as a medicament.
  • the invention further relates to a vector according to the invention or a bacterium according to the invention for use as a medicament in the prevention and/or treatment of at least one disease selected from the group consisting of allergies, hypertension (e.g., the substance of interest has a hypotensive activity), obesity (e.g., the substance of interest has an anorexiant activity), cancers, in particular colorectal cancers (e.g., the substance of interest has a proapoptotic activity) and inflammatory colon diseases, in particular Crohn's disease (wherein the substance of interest is advantageously an anti- inflammatory cytokine, for example IL-10).
  • a disease selected from the group consisting of allergies, hypertension (e.g., the substance of interest has a hypotensive activity), obesity (e.g., the substance of interest has an anorexiant activity), cancers, in particular colorectal cancers (e.g., the substance of interest has a proapoptotic activity) and inflammatory colon diseases, in
  • the invention further relates to a vector according to the invention or a bacterium according to the invention for use as a medicament in the prevention of at least one microbial infection, including a viral, bacterial, fungal or parasitic infection.
  • the substance of interest can be an antigen or an epitope.
  • said medicament can be a vaccine, which can further comprise an immune adjuvant.
  • the invention further relates to a vector according to the invention or a bacterium according to the invention, in particular a bacterium belonging to the genus Propionibacterium and more particularly to the species Propionibacterium freudenreichii for use as a medicament in the prevention and/or treatment of cancer; in particular wherein said substance of interest is an anti-tumoral agent like the proapoptotic TRAIL protein or the C-terminal extracellular domain of the TRAIL protein (in particular of sequence from amino acids 114 to 281 of the protein TRAIL sequence set forth in SEQ ID NO: 58).
  • anti-tumoral agent relates to any compound having an anti-tumoral effect.
  • the anti-tumoral agent can have a preventing or inhibiting effect on the formation or growth of tumors or tumor cells. This can be a pro-apoptotic, an anti-proliferative, a cytostatic or a cytotoxic effect.
  • the invention further relates to the use of a vector or a bacterium according to the invention for the preparation of a medicament for the prevention and/or treatment of at least one disease, in particular selected from the group consisting of allergies, hypertension (e.g., the substance of interest has a hypotensive activity), obesity (e.g., the substance of interest has an anorexiant activity), cancers, in particular colorectal cancers (e.g., the substance of interest has a proapoptotic activity) and inflammatory colon diseases, in particular Crohn's disease (wherein the substance of interest is advantageously an antiinflammatory cytokine, for example IL-10).
  • a vector or a bacterium according to the invention for the preparation of a medicament for the prevention and/or treatment of at least one disease, in particular selected from the group consisting of allergies, hypertension (e.g., the substance of interest has a hypotensive activity), obesity (e.g., the substance of interest has an anorexiant activity), cancers, in particular
  • the invention further relates to the use of a vector or a bacterium according to the invention for the preparation of a medicament in the prevention of at least one microbial infection, including a viral, bacterial, fungal or parasitic infection.
  • the substance of interest can be an antigen or an epitope.
  • said medicament can be a vaccine, which can further comprise an immune adjuvant.
  • the medicament or the composition according to the invention can be manufactured in a conventional way.
  • the medicament (pharmaceutical composition) in accordance with the invention can moreover include one or more pharmaceutically acceptable excipients or additives such as diluents, adjuvants, anti-foaming agents, stabilizers, dispersants, colorants, preservatives, etc.
  • Inert excipients or adjuvants can be used in such a way that, in the drugs according to the present invention, the only therapeutic agents will be the vector and/or the bacterium.
  • the medicament (pharmaceutical composition) according to the present invention can include one or more other therapeutically or prophylactically active agents, in addition to the vector and/or the bacterium.
  • the combination of several therapeutic agents including at least the vector and/or the bacterium, will have a better therapeutic or prophylactic action than when the vector and/or the bacterium are the only therapeutic agents present in the medicament (pharmaceutical composition).
  • This better action can be, among others:
  • the various means of the present invention are preferably administered to a mammal for the secretion of the substance of interest in the small intestine and/or the colon, preferably the colon, of said mammal.
  • mammal is defined in its usual sense. Examples of mammals include bovines; pigs; goats; sheep; horses; rodents such as mice, rabbits, rats and hamsters; felines and canines, including domestic animals such as cats and dogs. A preferred mammal in the context of the invention is a human.
  • the means of the invention can be administered by any suitable conventional route, in particular selected from the oral, subcutaneous, intramuscular, intravenous, intrarectal, enema and intratracheal routes.
  • Oral administration is preferred, wherein the drug is in the form of tablets, hard gelatin capsules (e.g., gastroprotective gelatin capsules), soft capsules, powders for direct use or for dilution (e.g., lyophilisates), syrups, gels, etc.
  • Said means can be administered in a single or repeated dose one or more times spaced over a certain interval of time.
  • the suitable administration route and dosing schedule can vary according to various parameters, such as the subject to be treated and/or the substance of interest.
  • the invention also relates to a method for therapeutic or prophylactic treatment of a subject in need thereof, comprising the step of administering to said subject a therapeutically effective amount of at least one compound selected from the group consisting of:
  • the invention also relates to a method for therapeutic or prophylactic treatment of a disease, in particular a cancer, more particularly a colorectal cancer, comprising the step of administering to a subject in need thereof a therapeutically effective amount of at least one compound selected from the group consisting of:
  • a bacterium according to the invention in particular a bacterium belonging to the genus Propionibacterium and more particularly to the species Propionibacterium freudenreichii; and a medicament (pharmaceutical composition) according to the invention;
  • said substance of interest is the proapoptotic TRAIL protein or the C-terminal extracellular domain of the TRAIL protein (in particular of sequence from amino acids 114 to 281 of the protein TRAIL sequence set forth in SEQ ID NO: 58).
  • the present invention further relates to the use of a vector and/or a bacterium according to the invention to produce and secrete, preferably into the extracellular medium, one or more substance of interest.
  • the present invention further relates to a method for producing and secreting into the extracellular medium, at least one substance of interest, by at least one bacterium according to the invention, said method comprising the steps of:
  • the method according to the invention makes it possible to produce and secrete substances of interest on a large scale, that is, on an industrial scale.
  • suitable conditions in terms of the composition of the culture medium, temperature, time, ventilation, stirring, etc.
  • suitable conditions in terms of the composition of the culture medium, temperature, time, ventilation, stirring, etc.
  • propionibacteria are known to those persons skilled in the art (see in particular documents US 20090312425 in the name of Meiji Dairies Corp. and CN 101045910 in the name of Nanjing University of Technology).
  • propionibacteria are robust, are able to grow on particular substrates such as whey or molasses and are able to adapt to non-standard culture conditions, characteristics which a large number of other bacteria do not share.
  • the invention further relates to a product comprising:
  • At least one vector according to the invention and/or at least one bacterium according to the invention and/or another active agent, in particular chosen in the group consisting of an anti-tumoral agent, an anti- inflammatory agent and an immunomodulatory agent, more particularly an anti-tumoral agent;
  • the substance of interest has a hypotensive activity
  • obesity e.g., the substance of interest has an anorexiant activity
  • cancers in particular colorectal cancers (e.g., the substance of interest has a proapoptotic activity) and inflammatory colon diseases, in particular Crohn's disease (wherein the substance of interest is advantageously an antiinflammatory cytokine, for example IL-10).
  • Said active agent can be a short-chain fatty acid (SCFA), preferably propionate or acetate.
  • SCFA short-chain fatty acid
  • the invention also relates to an isolated nucleic acid molecule of sequence selected from the group consisting of:
  • sequences having at least 80%, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with one of said sequences over the entire length of said sequence.
  • sequences having at least 80% of identity with one of the nucleic acid sequences encoding the peptides of sequences SEQ ID NO: 59 to 68 over the entire length of said sequence encode a signal peptide, particularly a secretory signal peptide.
  • sequences having at least 80% of identity with the nucleic acid sequence SEQ ID NO: 69 over the entire length of said sequence comprise a promoter and a sequence encoding a signal peptide, particularly a secretory signal peptide.
  • the invention further relates to a vector comprising at least one nucleic acid sequence selected from the group consisting of: - the nucleic acid sequences encoding the peptides of sequences SEQ ID NO: 59 to 68;
  • sequences having at least 80%, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with one of said sequences over the entire length of said sequence.
  • the invention also relates to a bacterium comprising a vector comprising at least one nucleic acid sequence selected from the group consisting of:
  • sequences having at least 80%>, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with one of said sequences over the entire length of said sequence.
  • FIG. 1 Graphs illustrating the synergy observed in vitro between TRAIL and P. freudenreichii metabolites.
  • HT29 colon cancer cells were treated with sublethal doses of TRAIL (25 ng/ml, 50 ng/ml and 100 ng/ml).
  • SCFA propionate/acetate SCFA, figure 1 A
  • P. freudenreichii supernatant FIG. IB
  • Figure 2 Identification of the protein secreted in the majority by P. freudenreichii, PF963.
  • A growth of two strains of P . freudenreichii, one auto lytic ( ⁇ ) and the other nonlytic (o).
  • B and C electrophoretic analysis (SDS-PAGE) of proteins secreted by a strain of lytic (B) and nonlytic (C) P. freudenheimii.
  • Protein PF963 was identified by mass spectrometry.
  • Figure 3 Diagram detailing the cloning strategy to obtain the pFB4:TRAIL plasmid (deposited with the CNCM on July 23, 2009 under number 1-4213).
  • A the promoter region and signal peptide of the P.
  • freudenreichii protein PF963 were amplified by PCR with introduction (PCR mutagenesis) of restriction sites Nde ⁇ and ⁇ .
  • the active extracellular portion of TRAIL (residues 1 14 to 281) was amplified by PCR with introduction of restriction sites HmdIII and Pstl .
  • B and C the two PCR products were purified and linked in order to obtain the ligation product SP-TRAIL.
  • D plasmid pK705 was opened by digestion using two enzymes Ndel and Pstl . The ligation product SP-TRAIL was introduced into the open plasmid.
  • the new plasmid pFB4 includes a promoter and a signal peptide enabling the secretion, in particular into the extracellular medium, by P. freudenreichii of a heterologous protein.
  • the arrows and the scissors represent PCR primers and restriction sites, respectively.
  • Figure 4 Map of the pFB4:TRAIL plasmid (deposited with the CNCM, Institut Pasteur, 28 rue du Dondel Roux, F-75724 Paris Cedex 15, on July 23, 2009 under number 1-4213).
  • Figure 5 Sequence of the fusion protein coded for by the pFB4:TRAIL plasmid.
  • the underlined region corresponds to the PF963 protein signal sequence and the region in bold corresponds to the TRAIL extracellular domain sequence (residues 1 14 to 281 ).
  • Figure 6 Detection by Western blot of the fusion protein coded for by the pFB4:TRAIL plasmid.
  • the samples deposited were culture supernatants of wild P. freudenreichii CIP103027 (1) or of P. freudenheimii CIP103027 carrying the pFB4:TRAIL plasmid (2 and 3).
  • a solution of Superjft/ZerTRAILTM (Alexis Biochemicals, Coger, France) was deposited as positive control (4).
  • the Western blot was developed using a commercial "PAb to TRAIL" antibody (Alexis Biochemicals).
  • Figure 7 Map of the pCHH04: TRAIL plasmid (deposited with the CNCM on November 13, 2012 under number CNCM 1-4692).
  • Figure 8 Proteomic comparative analysis of Propionibacterium freudenreichii exoproteomes.
  • Strains CIRM BIA 1 , 129, 1 18, 456, 127, 508, 516 and 512 were grown in YEL medium and the culture supernatants analyzed by SDS PAGE followed by Coomassie Blue staining.
  • the reference strain CIRM BIA 1 the first sequenced in 2010, secretes 4 proteins with equivalent efficiency, including PF963.
  • Figure 9 Western Blot detection.
  • the plasmids pFB4:TRAIL and pCHH04:TRAIL are compared within the same CIRM BIA 118 strain with respect to TRAIL secretion into the extracellular medium. Secretion of TRAIL into the extracellular medium is then compared in different strains harboring the pCHH04:TRAIL plasmid :The pCHH04:TRAIL plasmid was transformed into different strains of Propionibacterium freudenreichii and the resulting supernatants were analyzed with respect to TRAIL secretion by western blotting.
  • this bacterium induced the apoptosis of human colon adenocarcinoma cells in vitro via these SCFA which act on cancer cell mitochondria (Jan et al., 2002).
  • the mitochondrial pathway of apoptosis induction has been clearly identified in the triggering of programmed cell death of HT29 cells by dairy propionibacteria (Jan et al., 2002; Lan et al., 2007a).
  • Said SCFA cause the opening of mitochondrial permeability transition pores (PTP), the depolarization of mitochondria, the leaking of proapoptotic mitochondrial proteins and the activation of effector caspases.
  • PTP mitochondrial permeability transition pores
  • TRAIL is a cytokine capable of inducing the apoptosis of human colon cancer cells by binding to death receptors. TRAIL thus induces a different apoptotic pathway on the cellular and molecular levels and potentiates the action of other proapoptotic molecules used in cancer chemotherapy (Lacour et al., 2001; Lacour et al, 2003; Meurette et al, 2005; Meurette et al, 2006). Cell death induced by TRAIL or by SCFA is promoted by an acidic environment (Meurette et al, 2007; Lan et al, 2007a).
  • Figure 1 shows that sublethal doses of TRAIL (25 ng/ml, 50 ng/ml and lOO ng/ml) do not significantly induce cell death during the treatment period. Moreover, the smallest doses of SCFA alone induce little or no cell death, but induce massive death in the presence of TRAIL (figures 1A and IB). These results show a synergy of proapoptotic action on human colon cancer cells between SCFA metabolites produced by P. freudenreichii and TRAIL. Ill-Development of a first recombinant propionibacterium with the goal of inducing both the intrinsic and extrinsic apoptotic pathways.
  • the Inventors sought to make a bacterium, harmless to healthy cells, produce inducers of the two apoptotic pathways. These inducers are the SCFA produced by P. freudenreichii for the intrinsic pathway and TRAIL for the extrinsic pathway. Since propionibacteria have a positive tropism for the mucosa of the colon, said recombinant bacterium will not only be likely to produce TRAIL in situ in the colon, but also to carry SCFA and TRAIL toward colon epithelial cells.
  • PF963 the major protein secreted by P. freudenreichii during its growth and in the absence of lysis.
  • the experimental procedure e.g., electrophoresis, trypsino lysis, nano-LC and MS/MS
  • PF963 the major protein secreted by P. freudenreichii during its growth and in the absence of lysis.
  • the experimental procedure e.g., electrophoresis, trypsino lysis, nano-LC and MS/MS
  • the supernatant of the nonlytic strain of P. freudenreichii was analyzed by electrophoresis.
  • the gel fragment containing the major protein secreted was removed, rinsed and then subjected to "in gel" trypsin proteolysis.
  • the resulting peptides were separated by nano-LC and then analyzed with tandem mass spectrometry (MS/MS).
  • PF963 is an enzyme secreted via the machinery of the "Sec” pathway which recognizes and cleaves a signal peptide (SP).
  • SP signal peptide
  • This construction was carried out in E. coli on a cloning plasmid.
  • the fusion thus obtained was introduced into an expression vector (pK705) previously developed for the cloning and expression of propionibacterial genes in dairy propionibacteria and efficient in P . freudenreichii (Kiatpapan et al., 2000) in order to express the fusion protein.
  • the expression and the extracellular addressing of the fusion protein were then analyzed by Western blot.
  • strains were screened on the basis of aptitude for autolysis. Indeed, it is known that certain strains of said bacterium make use of a programmed cell suicide, autolysis. In this case, cytoplasmic proteins are released in the surrounding medium.
  • other strains including strain CIRM BIA 1 , do not undergo autolysis and on the contrary make use of a tolerance reaction with respect to various stresses, called the starvation- induced multi-tolerance response. In principle, these nonlytic strains thus only release actively secreted proteins and do not release proteins by accident.
  • Figure 2A shows the evolution of the bacterial population for an autolytic strain ( ⁇ ) and for a nonlytic strain (o) of Propionibacterium freudenreichii subsp. shermanii.
  • Figure 2C shows the electrophoretic analysis (SDS-PAGE) of proteins secreted by a nonlytic strain, CIRM BIA 1. This analysis reveals several secreted proteins, including protein PF963, identified in the culture supernatant of all the nonlytic strains tested. This protein was cut out of a preparative SDS-PAGE gel and subjected to digestion by trypsin.
  • SDS-PAGE electrophoretic analysis
  • ESI-MS/MS electrospray ionization tandem mass spectrometry
  • QSTAR®XL hybrid triple quadrupole time-of- flight apparatus
  • protein PF963 a secreted bacterial wall peptidase belonging to the NlpC/P60 family.
  • the complete 5 sequence of protein PF963 (SEQ ID NO 36; table I) can be deduced after determination of the complete sequence of the genome of strain CIP 103027 by the Inventors.
  • a signal peptide at the N-terminal end of PF963 indicates that this enzyme is secreted via the Sec secretion pathway.
  • the sequence of said signal peptide is SEQ ID NO 36.
  • the sequence of the pFB4:TRAIL plasmid was verified (SEQ ID NO 42).
  • the portion corresponding to the fusion protein ranges from nucleotides 8451 to 9070. This portion is translated in figure 5 (SEQ ID NO 43): the sequence corresponding to the PF963 peptide signal protein is underlined and the Val 114 - Gly 281 sequence of TRAIL appears in bold.
  • the fusion protein has a sequence of 205 amino acid residues corresponding to a mass of 23,190 Da and an isoelectric point of 9.08.
  • the elimination of the signal peptide leads to a sequence of 171 amino acid residues corresponding to a mass of 19,822 Da and an isoelectric point of 8.60.
  • the inventors have optimized the plasmid pFB4: TRAIL by changing both the promoter region and the signal peptide to obtain the pCHH04: TRAIL plasmid, allowing secretion into the extracellular medium, of a higher amount of TRAIL into the supernatant.
  • pCHH04:TRAIL The construction of pCHH04:TRAIL is described in Figure 7.
  • the pFB4:TRAIL plasmid which is a shuttle plasmid, was transformed into Escherichia coli.
  • the propionibacterial insert containing the promoter PF963 and the signal peptide PS963 were excised using the appropriate restriction endonucleases.
  • a new propionibacterial DNA fragment (set forth in SEQ ID NO: 69), containing the promoter region and the signal peptide of protein slpA of the Propionibacterium freudenreichii CIRM BIA 118 strain, was introduced in order to put the signal peptide in frame with the TRAIL coding sequence.
  • the corresponding sequence was amplified by PCR (PSlpA fwd BamHl, which has the sequence set forth in SEQ ID NO: 70 and PS SlpA-EcoRV-Rev bis, which has the sequence set forth in SEQ ID NO: 71) from Propionibacterium freudenreichii CIRM BIA 1 genomic sequence, which was previously sequenced and annotated (Falentin et al., 2010a).
  • This new plasmid, pCHH04:TRAIL was then transformed into different strains of Propionibacterium freudenreichii. The corresponding supernatants were then analyzed by western blot with respect to TRAIL secretion as above described.
  • TRAIL concentration was further quantified by Enzyme- Linked Immunosorbent Assay (ELISA) in supernatant of Propionibacterium freudenreichii transformed with pFB4:TRAIL or pCHH04:TRAIL plasmid according to the manufacturer's instructions (R&D System Europe, Lille, France). Human TRAIL standard concentration-response curves were used to quantify TRAIL levels in supernatants. TRAIL concentrations were determined using an automatic plate reader associated with genesis software (LabSystems Spectrophotometer, Cambridge, UK) and data were expressed in ng/ml.
  • TRAIL allows higher amounts of TRAIL secretion into the extracellular medium than the pFB4: TRAIL construction.
  • the sip A promoter isolated from strain CIRM BIA 118, is most probably stronger than PF963 promoter.
  • the slpA signal peptide allows efficient secretion of the TRAIL human cytokine in different Propionibacterium strains.
  • Other sip proteins were then identified from the genomic sequence of several Propionibacterium freudenreichii strains.
  • the corresponding signal peptides are presented in Table III and may also be used to allow heterologous protein expression in Bacteria, in particular belonging to the order Actinomycetales, in particular to the genus Propionibacterium, and more particularly to the species Propionibacterium freudenreichii.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Mycology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biotechnology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Public Health (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Cell Biology (AREA)
  • Immunology (AREA)
  • Toxicology (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

The present invention relates to a vector useful for the production and secretion of a substance of interest by bacteria and applications thereof.

Description

VECTORS FOR PRODUCING AND SECRETING SUBSTANCE OF
INTEREST BY BACTERIA AND APPLICATIONS THEREOF
The present invention relates to the field of genetic engineering applicable to various industries including the pharmaceuticals, chemicals, agri-foods, cosmetics and biotechnologies industries.
In particular, the invention relates to a vector useful for the production of a substance of interest by a bacterium, particularly a bacterium belonging to the order Actinomycetales, more particularly to the genus Propionibacterium, and even more particularly to the species Propionibacterium freudenreichii.
Said vector can be particularly useful in the pharmaceutical field, for the large-scale production of substances whose activity is of interest in industries as diverse as pharmaceuticals, chemicals, agri-foods, cosmetics but also as a biotechnology tool for the production and secretion of substance of interest in bacteria particularly belonging to the order Actinomycetales.
There are today a large number of methods and means for the large-scale production of substances including peptides and proteins. With traditional chemical synthesis, which is hardly suitable for large-scale production of proteins comprising several dozen amino acids, the generally preferred method is synthesis in vivo, that is, in living biological systems. Many commercial societies have made a principal business of said production, and thus propose technologies based on genetic engineering and biotechnology to provide industrial quantities of peptides and/or proteins, preferably active and purified. Depending on needs, it is now possible to use various living systems such as bacteria (e.g., Escherichia coli), yeasts (e.g., Saccharomyces cerevisiae, Pichia pastoris), insect cells
(baculovirus, Sf , Sf21, etc.), plant cells and mammalian cells (e.g., CHO, HEK, COS, etc.).
The inventors have previously demonstrated (WO 2011/141558) the efficiency of using propionibacteria as living systems for producing and secreting substances including recombinant peptides and proteins, particularly of eukaryotic origin.
Indeed, these bacteria have several advantages for the large-scale production of various substances. One of their major advantages is their ability to grow on low-value culture media (e.g. including by-products of dairy and sugar industries). In fact, propionibacteria are very robust and adaptable to particular media (e.g. media containing milk, milk derivatives or molasses) that are possibly hostile to the growth and development of other living systems (e.g. due to the presence in the medium of lactic acid, salt, etc.). These bacteria have also good tolerance with respect to variations, changes or disturbances of the environmental conditions likely to occur during large-scale culture operations. Moreover, propionibacteria can be described as "natural antifungals" since they naturally produce metabolites (for example, propionate) that inhibit the development of contaminating fungi. Furthermore, they are able to produce recombinant proteins of significant size (for example, proteins of more than 500 amino acids) and can even produce several different proteins simultaneously (for example, more than a dozen different proteins).
Propionibacteria are also particularly useful for applications in the pharmaceutical and dietary fields.
In fact, one of the other major advantages of propionibacteria is that they can be used as a tool for addressing or targeting substances to the intestine. Indeed, in mammals, including humans, propionibacteria are naturally able to target the intestine where their survival time can reach two weeks, compared to only two or three days for lactic bacteria, even though they are natural hosts of this environment.
Another major advantages of propionibacteria over various other bacteria proposed so far for use in anti-tumoral therapy (e.g., in WO 01/25397 in the name of Vion Pharmaceuticals, Inc. and in WO 2009/11 1177 in the name of Mount Sinai School of Medicine of New York University) is that propionibacteria per se are efficient and specific anti-tumoral agents that can safely be used in mammals, in particular in humans. This inherent property of propionibacteria can thus be further enhanced upon using propionibacteria to deliver therapeutic agents, such as drugs, to eradicate tumor cells while at the same time preventing damage to normal cells. Propionibacteria do not need to be genetically attenuated or enhanced by genomic mutations as it is the case for other bacteria such as Clostridium, Salmonella, Listeria, and the like. Thus, propionibacteria can be particularly useful anti-tumoral agents thanks to both their intrinsic anti-tumoral properties and their ability to efficiently, specifically and safely deliver other anti- tumoral drugs in order to kill cancer cells. Particularly, the Inventors have previously demonstrated that Propionibacterium freudenreichii (Falentin et al., 2010, Plos One; Genbank accession No. FN806773) has particular cytotoxic properties with respect to colon cancer cells (Jan et al., 2002; Lan et al., 2007). Among other notable properties, Propionibacterium freudenreichii adheres to colonic epithelial cells and has no toxic effect on healthy cells (Lan et al., 2008).
The Inventors have recently developed new vectors allowing the production and secretion of various substances at a high level by a bacterium, particularly belonging to the order Actinomycetales, including the genus Propionibacterium.
The doses of the secreted substances are so high that in case of large-scale substances production, they do not need to be purified. Thus, these vectors provide a system, which is not expensive, quick and easy to implement and thus particularly appropriate for large-scale substances production.
In fact, unexpectedly, the Inventors have demonstrated that signal peptides of genes encoding a surface layer protein of a Propionibacterium freudenreichii allow the secretion into the extracellular medium of a substance of interest at a high level by a bacterium, in particular a propionibacterium. These results are really surprising since surface layer proteins are, as indicated by their name, described as proteins anchored in the surface of Propionibacterium freudenreichii (Lortal et a/. 1993).
More surprisingly, the Inventors have shown that said signal peptides particularly in combination with promoters of genes encoding a surface layer protein of a Propionibacterium freudenreichii, allow the secretion into the extracellular medium of a substance of interest by a bacterium, in particular a propionibacterium, at a level up to 100 times greater than that obtained with other signal peptides in the same strain.
Thus, in one aspect, the invention relates to a vector comprising:
- at least one promoter operatively linked to
- at least one nucleic acid sequence encoding a signal peptide translationally fused to
- at least one nucleic acid sequence encoding a substance of interest;
wherein said nucleic acid sequence encoding a signal peptide is selected from the group consisting of: - the sequence of the signal peptide of a gene encoding a surface layer protein of a Propionibacterium freudenreichii; and
- the sequences having at least 80%, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with said sequence over the entire length of said sequence;
and/or
wherein the sequence of said promoter is selected from the group consisting of:
- the sequence of the promoter of a gene encoding a surface layer protein of a Propionibacterium freudenreichii; and
- the sequences having at least 80%>, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with said sequence over the entire length of said sequence.
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one skilled in the relevant art.
For convenience, the meaning of certain terms and phrases employed in the specification, examples and claims are provided.
A vector can be a cloning or an expression vector. The vectors according to the invention can be viral vectors such as bacteriophages, or non-viral, such as plasmid vectors. A plasmid vector is a non-viral DNA molecule hosted by a cell, distinct from the natural chromosomal DNA of said host cell and capable of autonomous replication. The choice of plasmid vector and, more particularly, the origin of replication it carries thus depend on the host cell. According to the type of host cell, several copies of a plasmid vector and/or several different plasmid vectors can be hosted simultaneously. A plasmid vector according to the invention can possibly be carried by (or "integrated in" or "inserted in") the chromosome of the host cell.
A "recombinant vector" is a vector obtained by traditional molecular biology and genetic engineering techniques, in which one or more exogenous nucleotide sequences have been inserted (or cloned). The term "nucleic acid sequence" according to the invention refers to the sequence of a nucleic acid molecule, DNA and RNA, wherein the former can be genomic DNA, plasmid DNA, recombinant DNA or complementary DNA (cDNA), for example, and the latter can be messenger RNA (mRNA), ribosomal RNA (rRNA) or transfer RNA (tRNA). Preferably, the nucleic acid sequences of the invention refer to sequences of DNA molecules.
The promoter comprised in the vector according to the invention can be a promoter suitable for the expression of said substance of interest in a bacterium, particularly a priopionibacterium.
Particularly, said promoter is a promoter for bacterial RNA polymerase, in particular for propionibacterial RNA polymerase. Said promoter can be a constitutive and/or inducible promoter well known by one skilled in the art. Preferably, said promoter is inducible. The promoter can be developmentally regulated, inducible or tissue specific, preferably inducible in the digestive tract. In particular, said promoter is a promoter of propionic origin, in particular of P. freudenreichii origin, such as the promoter of protein PF963 of P. freudenreichii. More particularly, said promoter is a strong propionic promoter. As noted by the Inventors, it could be advantageous to use a promoter ensuring "basic" constitutive expression which could be strengthened by induced expression under particular conditions like conditions of digestive stress (for example the digestive stress-inducible promoter of the BCCP transcarboxylase described in Herve et ah, 2007). In one embodiment, the sequence of said promoter is selected from the group consisting of:
- the sequence of the promoter of a gene encoding a surface layer protein of a Propionibacterium freudenreichii; and
- the sequences having at least 80%, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with said sequence over the entire length of said sequence.
In fact, as mentioned above, unexpectedly, the Inventors have shown that said promoters of genes encoding a surface layer protein of a Propionibacterium freudenreichii in combination with signal peptides of genes encoding a surface layer protein of a Propionibacterium freudenreichii allow the secretion into the extracellular medium of a substance of interest by a propionibacterium at a level up to 100 times greater than that obtained with other promoters and peptide signals in the same propionibacterium strain.
These surface layer proteins have notably been described in the article of Lortal et al. (1993).
In particular, the sequence of said promoter is selected from the group consisting of:
- the sequence of the promoter of a gene encoding a surface layer protein of a Propionibacterium freudenreichii, particularly of the Propionibacterium freudenreichii CIRM BIA 118 strain; and
- the sequences having at least 80%, more particularly at least 85%, at least
86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with said sequence over the entire length of said sequence;
wherein said surface layer protein is selected from the group consisting of the surface layer protein A, the surface layer protein B, the surface layer protein C, the surface layer protein D, the surface layer protein E and the surface layer protein F, in particular of the surface layer protein A.
In particular, the sequence of said promoter is selected from the group consisting of:
- the sequence of the promoter of a gene encoding the surface layer protein A of Propionibacterium freudenreichii CIRM BIA 118 strain; and
- the sequences having at least 80%>, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with said sequence over the entire length of said sequence;
As used herein the term "CIRM BIA 118 strain" refers to the strain numbered 118 available at the International Centre for Microbial Resources dedicated to food bacteria interest ("Centre international de ressources microbiennes dedie au. bacteries d'interet alimentaire") located in Renncs (France).
Advantageously, the vector according to the invention can comprise at least two promoters such as defined above which, even more advantageously, will be situated preferably in a series (but not necessarily coupled to each other), in order to increase the expression level of said substance of interest ("expression booster" effect).
The recombinant vector according to the present invention comprises at least one nucleic acid sequence encoding a signal peptide translationally fused to at least one nucleic acid sequence encoding a substance of interest. In particular, said signal peptide is a secretory signal peptide. The term "secretory signal peptide" refers to any peptide allowing the secretion, in particular into the extracellular medium, of said substance of interest, by a host cell comprising the vector according to the invention, particularly by a propionibacterium. In particular, said signal peptide is a propionibacterial secretory signal peptide, allowing the secretion, in particular into the extracellular medium, of said substance of interest, by a host cell comprising the vector according to the invention, particularly by a propionibacterium. Particularly, a signal peptide of a propionibacterium selected from dairy propionibacterium and so-called "cutaneous" propionibacterium (CPB) can be used. Among other examples, the following dairy propionibacterium can be cited: Propionibacterium freudenreichii, P. jensenii, P. thoenii P. acidipropionici and P. microaerophilum. The following cutaneous propionibacterium can also be cited: P. acnes, P. granulosum, P. avidum and P. propionicum. More particularly, a signal peptide of a propionibacterium selected from the following species can be used: Propionibacterium freudenreichii, more particularly the subspecies P. freudenreichii subsp. freudenreichii and P. freudenreichii subsp. shermanii, and Propionibacterium acnes, wherein said propionibacterium is preferentially P. freudenreichii subsp. shermanii.
In one embodiment, said nucleic acid sequence encoding a signal peptide can be selected from the group consisting of:
- the sequences SEQ ID NO: 1 to 18, particularly the sequence SEQ ID NO: 18;
- the nucleic acid sequences encoding the signal peptides of sequences SEQ ID NO: 45 to 57; and
the sequences having at least 80%, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with one of said sequences over the entire length of said sequence. Table I below presents the nucleotide (NT) sequences, as well as the corresponding amino acid (AA) sequences of signal peptides, identified by the Inventors using proteomic analysis of P. freudenreichii CIRM-BIA 1 exoproteome.
5
Table I
MRR TTIAALAAVLSFSPLAAQA-AP
Atgcgacgtcgcaccacgattgcagccctcgctg
PF# 279 10 28
Ctgtcttgagtttcagtcccctggccgcccaggccg
caccc
MPSHAVRETRANKLRRFLRPTVAQGVLGIAFCLVAAVGV VQI-RS
Atgcctagtcatgcggtgcgggagacgcgggcgaacaagttgcgccggttcctgcggcc
PF# 2818 c 11 29
Accgttgcccagggcgtgctcggtatcgcgttctgcctcgtggccgccgtcggcgtggtg ca
gatccgctcc
MSRIQLPRLSRIAIAAAASAALIGTSFIAPATAFA-AP
Atgtcacggattcaactcccccggctgagccggattgcgatcgcagc
PF# 2932 12 30
Agcagcttccgctgccctgatcggcaccagcttcatcgccccggcca
cggcctttgccgcgccg
MKRRTLLGTLGIMGLSVPLAACS-SK
PF# 3042 Ctagccgaccttctcggccttgctggccaggtcgtc 13 31 ggggatcgtgacccccatcagggaggcggccttctcatt
MVTGGNDMPSKRITTWPGISALSALIAGMLLAPLPVAA- DG Ttagttgttggggacgaggagggagtggagttcgatgacgtcgagggtgggtgc
PF# 3412 14 32
Ggtggcggggcgggtgatggtttcggtgccggtgtgtccttgggcggtccaggtg
atggtccaggt
MAMVMASLAMFGASRASA-AD
PF# 3427 Tcagccagttggtgccggccttggcgtcgg 15 33 cggcgtgggatacacgcggaactgggcgcc
MFI SRFRRAAAVGL AAVT ALS AT AC SGSSSSSSSSA-SS
Atgttcatttcgcgcttccgtcgtgcggctgcggtcggcctggccgc
PF# 527 16 34
Cgtcaccgcattgtccgccactgcctgtagcggttcctcgtcgtcgtc
cagctcatccgcgagctcg
MKSATRRPLTRWIVAFGVVLVLVIAGSVGLHASG-AL
Atgaagtccgcgacgcgacgcccgctgacgcgctggattgtcgccttcg
PF# 876 17 35
Gggtggtgttggtgctggtcatcgccgggtcggtggggctgcatgcctccg
gtgccctg
MNPFVKTARVAITSTLVAGSLATASLVFAPLAQA-DY
Gtgaatcccttcgtcaagacggcgcgcgtggctatcacctcgacgc
PF# 963 18 36
Tggtggcaggctcgctcgccactgccagcctcgtgtttgcaccactt
gcacaggccgattac
Table II below presents amino acid sequences of signal peptide, identified by the Inventors from the genomic sequence of P. acnes, accessible from databases (strain P. acnes KPA171202; accession number: NCBI: NC 006085; 5 GenBank: AEO 17283). Table II
Advantageously, said nucleic acid sequence encoding a signal peptide can be selected from the group consisting of:
5 - the sequence of the signal peptide of a gene encoding a surface layer protein of a Propionibacterium freudenreichii, particularly of the Propionibacterium freudenreichii CIRM BIA 118 strain;
the sequences having at least 80% more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%o and even more particularly at least 99% of identity with said sequence over the entire length of said sequence.
Said surface layer protein can be selected from the group consisting of the surface layer protein A, the surface layer protein B, the surface layer protein C, the surface layer protein D, the surface layer protein E and the surface layer protein F of a Propionibacterium freudenreichii, in particular the surface layer protein A of a Propionibacterium freudenreichii.
As above stated, the Inventors have unexpectedly demonstrated that signal peptides of genes encoding a surface layer protein of a Propionibacterium freudenreichii allow the secretion into the extracellular medium of a substance of interest by a propionibacterium. These results are really surprising since surface layer proteins are, as indicated by their name, described as proteins anchored in the surface of Propionibacterium freudenreichii (Lortal et al. 1993).
More surprisingly, the Inventors have shown that said signal peptides, in particular in combination with promoters of genes encoding a surface layer protein of a Propionibacterium freudenreichii, allow the secretion into the extracellular medium of a substance of interest by a propionibacterium at a level up to 100 times greater than that obtained with other signal peptides in the same propionibacterium strain.
In one embodiment, said promoter and said signal peptide are the promoter and the signal peptide of the same gene encoding a surface layer protein of a Propionibacterium freudenreichii.
In particular, said nucleic acid sequence encoding a signal peptide is selected from the group consisting of:
the nucleic acid sequences encoding the signal peptides of sequences SEQ ID NO: 59 to 68, in particular of sequence SEQ ID NO: 59;
the sequences having at least 80%>, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with one of said sequences over the entire length of said sequence and particularly corresponding to nucleic acid sequences encoding a signal peptide allowing the secretion, in particular into the extracellular medium, of said substance of interest by a propionibacterium. Unexpectedly, the inventors have demonstrated that the signal peptide having the sequence set forth in SEQ ID NO: 59 in combination with the promoter of the gene encoding the Surface layer protein A of a Propionibacterium freudenreichii allows the secretion into the extracellular medium of a substance of interest by different strains of Propionibacterium freudenreichii at a level up to 100 times greater than that obtained with other signal peptides and promoters in the same Propionibacterium freudenreichii strain.
Table III - Sequences of the different signal peptides corresponding to surface layer (sip) genes identified in different strains of Propionibacterium
freudenreichii
512 slpA PFCIR S-layer MATGAAAAMFVTTFAG 68
M512 protein A MAP ANA
08945
In one embodiment, the vector according to the invention comprises the nucleic acid sequence SEQ ID NO: 69 or a sequence having at least 80%, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%o, at least 97%, at least 98%> and even more particularly at least 99% of identity with SEQ ID NO: 69 over the entire length of said sequence, trans lationally fused to said nucleic acid sequence encoding a substance of interest.
Particularly, the sequences having at least 80% of identity with the nucleic acid sequence SEQ ID NO: 69 over the entire length of said sequence, comprise a promoter and a sequence encoding a signal peptide, particularly a secretory signal peptide.
In particular, the vector according to the invention comprises the nucleic acid sequence SEQ ID NO: 69 translationally fused to said nucleic acid sequence encoding a substance of interest. The nucleic acid sequence SEQ ID NO: 69 comprises the promoter and the signal peptide of the Surface layer protein A of the Propionibacterium freudenreichii CIRM BIA 118.
The percentage of identity to which reference is made in the presentation of the invention are determined on the basis of global alignment of sequences to be compared, that is to say, on an alignment of sequences over their entire length, using for example the algorithm of Needlman and Wunsch 1970. This sequence comparison can be done for example using the needle software by using the parameter "Gap open" equal to 10.0, the parameter "Gap Extend" equal to 0.5, and a matrix "BLOSUM 62". Software such as needle is available on the website ebi.ac.uk worldwide, under the name "needle".
Said nucleic acid sequence encoding a signal peptide can be translationally fused with several nucleic acid sequences encoding a substance of interest. Said nucleic acid sequence encoding a signal peptide can be operatively linked to several promoters.
In the context of the present invention, said substance of interest can be any molecule of interest. Particularly said substance of interest is of eukaryotic origin, more particularly of animal origin and even more particularly of mammalian origin. In particular, said substance of interest can originate from mammals selected from the group consisting of rodents (e.g. mice, rats, rabbits, Chinese pigs, hamsters), canidae (e.g., dogs),felidae (e.g., cats), domestic livestock (e.g. cows, pigs, goats, sheeps, horses), and humans.
In one embodiment, said substance of interest is a peptide or a protein chosen in the group consisting of antibodies, receptor ligands, hormones, cytokines, growth factors, cell adhesion molecules, blood clotting factors, enzymes, fragments thereof and combinations thereof, more particularly in the group consisting of cytokines, antibodies and hormones, and even more particularly from the group consisting of proapoptotic TRAIL protein and the C- terminal extracellular domain of the TRAIL protein.
A "fragment" of a protein or peptide is a protein or a peptide of amino acid sequence of smaller length but included in the one of said initial peptide or protein. A protein "fragment" could be a peptide, for example.
In a preferred embodiment, the vector according to the present invention makes it possible to express and secrete the proapoptotic TRAIL protein (TNF- related apoptosis-inducing ligand, also called TNSF10, TL2, CD253 and Apo- 2L), a cytokine of the TNF family. The sequence of the Homo sapiens TRAIL protein can be the sequence set forth in SEQ ID NO: 58 (accession number AAC50332.1).
Thus, in one embodiment, said substance of interest can be the proapoptotic TRAIL protein or the C-terminal extracellular domain of the TRAIL protein, in particular the Homo sapiens proapoptotic TRAIL protein or the C- terminal extracellular domain of the Homo sapiens TRAIL protein.
In particular, said substance of interest is the C-terminal extracellular domain of the TRAIL protein consisting of the sequence from amino acids 1 14 to 281 of the sequence set forth in SEQ ID NO: 58.
According to the literature, TRAIL is an antineoplastic agent with strong potential because it induces the death of many tumor cells, independently of p53 and Pgpl80 (MDR, multidrug resistance). TRAIL also inhibits the growth of xenografted colon tumors in nude mice (Ashkenazi et al., 1999). Quite interestingly, TRAIL has little cytotoxic effect on most normal tissues (Ashkenazi et al., 1999), including human colon epithelium (Strater et al., 2002).
Other teams very recently expressed the active C-terminal extracellular domain of TRAIL in bacteria such as Salmonella typhimurium (Ganai et al., 2009), Bifidobacterium longum (Hu et al., 2009) and E. coli (Zhang et al., 2010). In this work, salmonellas, bifidobacteria and coliform bacteria are proposed as systemic TRAIL delivery vectors in cancer models.
However, propionibacteria have major advantages compared to other bacteria such as salmonellas, bifidobacteria and coliform bacteria.
First, dairy propionibacteria enable local delivery because they target colon epithelial cells and have an active fermentative metabolism in the human colon (Herve et al., 2007), which enables site-specific delivery of TRAIL.
Second, dairy propionibacteria themselves have proapoptotic properties. It was recently shown in vitro that dairy propionibacteria, by the SCFA resulting from their fermentative metabolism, induce the apoptosis of two human colon adenocarcinoma cell lines (Caco2 and HT29) (Jan et al., 2002). This effect is directly related to the release of propionate by these bacteria and to their action on cancer cell mitochondria. It has also been shown that at extracellular pH (pHe) between 6 and 7.5, SCFA (propionate and acetate SCFA) induce apoptotic death whereas at pHe=5.5, they induce necrotic death in HT29 human colon cancer cells (Lan et al., 2007a). In vivo, these food-quality (GRAS: generally regarded as safe) bacteria adapt and survive in the digestive tract of animals and humans with an efficiency that, although strain-dependent, exceeds that of other probiotics (Herve et al., 2007). Moreover, they express in the intestine enzymatic activities characteristic of their fermentative metabolism by producing an increase in SCFA concentrations (Lan et al, 2007b) and induce an increase in apoptosis in the mucosa of the colon of rats treated with 1 ,2-dimethylhydrazine (Lan et al., 2008). The Inventors have further shown a synergistic action with TRAIL in vitro as illustrated in the examples below.
In one embodiment, the vector according to the invention comprises:
- at least one promoter operatively linked to
- at least one nucleic acid sequence encoding a signal peptide translationally fused to
- at least one nucleic acid sequence encoding a substance of interest;
wherein said nucleic acid sequence encoding a signal peptide is selected from the group consisting of:
- the sequence of the signal peptide of a gene encoding a surface layer protein of a Propionibacterium freudenreichii; and - the sequences having at least 80%, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with said sequence over the entire length of said sequence;
and
wherein the sequence of said promoter is selected from the group consisting of:
- the sequence of the promoter of a gene encoding a surface layer protein of a Propionibacterium freudenreichii; and
- the sequences having at least 80%>, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with said sequence over the entire length of said sequence.
A particularly preferred vector according to the invention is the vector pCHH04: TRAIL comprising:
the promoter of the Surface layer protein A of the Propionibacterium freudenreichii CIRM BIA 118, operatively linked to
a nucleic acid sequence encoding the signal peptide of the Surface layer protein A of the Propionibacterium freudenreichii CIRM BIA 118, translationally fused to
a nucleic acid sequence encoding the sequence from amino acids 114 to 281 of the TRAIL protein sequence set forth in SEQ ID NO: 58.
A P. freudenreichii CIRM-BIA-118 comprising said vector pCHH04: TRAIL has been deposited on November 13, 2012 under number CNCM 1-4692 with the Collection Nationale de Cultures de Microorganismes (CNCM, Institut Pasteur, 25 rue du Docteur Roux, 75724 Paris Cedex 15, France).
Thus, a particularly preferred vector according to the invention is the vector comprised in the propionibacterium deposited on November 13, 2012 under number CNCM 1-4692 with the Collection Nationale de Cultures de Microorganismes (CNCM, Institut Pasteur, 25 rue du Docteur Roux, 75724 Paris Cedex 15, France).
The present invention further relates to a bacterium comprising at least one vector according to the invention as previously defined. Said bacterium comprising a vector according to the invention, can belong to the order Actinomycetales, in particular to the genus Propionibacterium, and more particularly to a species selected from the group consisting of Propionibacterium freudenreichii, Propionibacterium jensenii, Propionibacterium thoenii, Propionibacterium acidipropionicii, Propionibacterium acnes, Propionibacterium granulosum, Propionibacterium avidum, Propionibacterium propionicum and Propionibacterium microaerophilum and even more particularly the species Propionibacterium freudenreichii.
In particular, said bacterium comprising a vector according to the invention can be selected from the group consisting of Propionibacterium freudenreichii freudenreichii and Propionibacterium freudenreichii shermanii.
Advantageously, the propionibacterium comprising at least one vector according to the invention can be selected from the group consisting of CIRM BIA 512 strain, CIRM BIA 125 strain, CIRM BIA 118 strain, CIRM BIA 129 strain, CIRM BIA 138 and CIRM BIA 122 strain, particularly CIRM BIA 512 strain, CIRM BIA 125 strain, CIRM BIA 118 strain, CIRM BIA 129 strain and CIRM BIA 122 strain, more particularly CIRM BIA 512 strain, CIRM BIA 125 strain, CIRM BIA 118 strain and CIRM BIA 129 strain, even more particularly CIRM BIA 512 strain, CIRM BIA 125 strain, CIRM BIA 118 strain and even more particularly CIRM BIA 512 strain and CIRM BIA 1 18 strain and even more particularly CIRM BIA 118 strain.
In one embodiment, the propionibacterium comprising at least one vector according to the invention is a CIRM BIA 138 strain. This strain also named TL 133 strain in the article of Lan et al. (2007b) has the advantage to be particularly tolerant towards digestive stresses.
Advantageously, the vector can be carried by the chromosome of the bacterium according to the invention. The vector can be integrated, for example, in the chromosome of the host cell by homologous recombination as described by Deutsch e* al. (2012).
One particularly preferred bacterium according to the invention is the propionibacterium deposited on November 13, 2012 under number CNCM 1-4692 with the Collection Nationale de Cultures de Microorganismes (CNCM, Institut Pasteur, 25 rue du Docteur Roux, 75724 Paris Cedex 15, France). If the substance of interest to be secreted lends itself to such a use (an anorexiant peptide, for example), the bacterium according to the invention could be used as a probiotic food or dietary supplement for mammals, in particular humans. Advantageously, the bacterium can be integrated in the mammal's food in the form of a fermented dairy product (e.g., fermented milk, fermented whey, cheese).
The present invention further relates to a composition comprising at least one vector according to the invention and/or at least one bacterium according to the invention.
Said composition according to the invention can be a dietary or a pharmaceutical composition.
The term "dietary compositions" comprises any type of food/feed and beverages, also including clinical, nutrition and dietary supplements. The dietary compositions according to the present invention may further contain protecting components (such as carbohydrates, betaines, fibers, polyois), protective hydrocolloids (such as gums, proteins, modified starches), binders, film-forming agents, encapsulating agents/materials, wail/shell materials, matrix compounds, coatings, emu isi tiers, surface active agents, solubil ising agents (oils, fats, waxes, lecithins etc.), adsorbents, carriers, fillers, co-compounds, dispersing agents, wetting agents, processing aids (solvents), flowing agents, taste-masking agents, weighting agents, jei!yfying agents, gel-forming agents, antioxidants and ant imicrobials.
Said pharmaceutical composition according to the invention can comprise an effective amount of at least one vector according to the invention and/or at least one bacterium according to the invention and at least one pharmaceutically acceptable carrier (or excipient).
Such therapeutically effective amount can be determined by one skilled in the art by routine tests including assessment of the effect of administration of said components (vector according to the invention and/or bacterium according to the invention) on the pathologies and/or disorders which are sought to be prevent and/or to be treated by the administration of said drug (or pharmaceutical composition).
For example, such tests can be implemented by analyzing both quantitative and qualitative effect of the administration of different amounts of said aforementioned components (vector according to the invention and/or bacterium according to the invention) on a set of markers (biological and/or clinical) characteristics of said pathologies and/or of said disorders, in particular from a biological sample of a subject.
The present invention further relates to a vector according to the invention or a bacterium according to the invention for use as a medicament.
The invention further relates to a vector according to the invention or a bacterium according to the invention for use as a medicament in the prevention and/or treatment of at least one disease selected from the group consisting of allergies, hypertension (e.g., the substance of interest has a hypotensive activity), obesity (e.g., the substance of interest has an anorexiant activity), cancers, in particular colorectal cancers (e.g., the substance of interest has a proapoptotic activity) and inflammatory colon diseases, in particular Crohn's disease (wherein the substance of interest is advantageously an anti- inflammatory cytokine, for example IL-10).
The invention further relates to a vector according to the invention or a bacterium according to the invention for use as a medicament in the prevention of at least one microbial infection, including a viral, bacterial, fungal or parasitic infection. In this case, the substance of interest can be an antigen or an epitope. Thus, said medicament can be a vaccine, which can further comprise an immune adjuvant.
The invention further relates to a vector according to the invention or a bacterium according to the invention, in particular a bacterium belonging to the genus Propionibacterium and more particularly to the species Propionibacterium freudenreichii for use as a medicament in the prevention and/or treatment of cancer; in particular wherein said substance of interest is an anti-tumoral agent like the proapoptotic TRAIL protein or the C-terminal extracellular domain of the TRAIL protein (in particular of sequence from amino acids 114 to 281 of the protein TRAIL sequence set forth in SEQ ID NO: 58).
As used herein the term "anti-tumoral agent" relates to any compound having an anti-tumoral effect. The anti-tumoral agent can have a preventing or inhibiting effect on the formation or growth of tumors or tumor cells. This can be a pro-apoptotic, an anti-proliferative, a cytostatic or a cytotoxic effect.
The invention further relates to the use of a vector or a bacterium according to the invention for the preparation of a medicament for the prevention and/or treatment of at least one disease, in particular selected from the group consisting of allergies, hypertension (e.g., the substance of interest has a hypotensive activity), obesity (e.g., the substance of interest has an anorexiant activity), cancers, in particular colorectal cancers (e.g., the substance of interest has a proapoptotic activity) and inflammatory colon diseases, in particular Crohn's disease (wherein the substance of interest is advantageously an antiinflammatory cytokine, for example IL-10).
The invention further relates to the use of a vector or a bacterium according to the invention for the preparation of a medicament in the prevention of at least one microbial infection, including a viral, bacterial, fungal or parasitic infection. In this case, the substance of interest can be an antigen or an epitope. Thus, said medicament can be a vaccine, which can further comprise an immune adjuvant.
The medicament or the composition according to the invention can be manufactured in a conventional way. The medicament (pharmaceutical composition) in accordance with the invention can moreover include one or more pharmaceutically acceptable excipients or additives such as diluents, adjuvants, anti-foaming agents, stabilizers, dispersants, colorants, preservatives, etc. Inert excipients or adjuvants can be used in such a way that, in the drugs according to the present invention, the only therapeutic agents will be the vector and/or the bacterium. Nevertheless, the medicament (pharmaceutical composition) according to the present invention can include one or more other therapeutically or prophylactically active agents, in addition to the vector and/or the bacterium. Advantageously, the combination of several therapeutic agents, including at least the vector and/or the bacterium, will have a better therapeutic or prophylactic action than when the vector and/or the bacterium are the only therapeutic agents present in the medicament (pharmaceutical composition). This better action can be, among others:
- a better dose-effect relationship;
- a therapeutic or prophylactic effect that is more stable or longer lasting over time;
- a better administration of the medicament (pharmaceutical composition);
- a synergy of action between at least two therapeutic agents present in the medicament (pharmaceutical composition). The various means of the present invention (vector, bacterium, medicament, pharmaceutical composition) as described above are preferably administered to a mammal for the secretion of the substance of interest in the small intestine and/or the colon, preferably the colon, of said mammal.
The term "mammal" is defined in its usual sense. Examples of mammals include bovines; pigs; goats; sheep; horses; rodents such as mice, rabbits, rats and hamsters; felines and canines, including domestic animals such as cats and dogs. A preferred mammal in the context of the invention is a human.
The means of the invention (vector, bacterium, medicament, pharmaceutical composition) can be administered by any suitable conventional route, in particular selected from the oral, subcutaneous, intramuscular, intravenous, intrarectal, enema and intratracheal routes. Oral administration is preferred, wherein the drug is in the form of tablets, hard gelatin capsules (e.g., gastroprotective gelatin capsules), soft capsules, powders for direct use or for dilution (e.g., lyophilisates), syrups, gels, etc. Said means can be administered in a single or repeated dose one or more times spaced over a certain interval of time. The suitable administration route and dosing schedule can vary according to various parameters, such as the subject to be treated and/or the substance of interest.
The invention also relates to a method for therapeutic or prophylactic treatment of a subject in need thereof, comprising the step of administering to said subject a therapeutically effective amount of at least one compound selected from the group consisting of:
a vector according to the invention;
- a bacterium according to the invention; and
a medicament (pharmaceutical composition) according to the invention.
The invention also relates to a method for therapeutic or prophylactic treatment of a disease, in particular a cancer, more particularly a colorectal cancer, comprising the step of administering to a subject in need thereof a therapeutically effective amount of at least one compound selected from the group consisting of:
a vector according to the invention;
a bacterium according to the invention, in particular a bacterium belonging to the genus Propionibacterium and more particularly to the species Propionibacterium freudenreichii; and a medicament (pharmaceutical composition) according to the invention;
particularly wherein said substance of interest is the proapoptotic TRAIL protein or the C-terminal extracellular domain of the TRAIL protein (in particular of sequence from amino acids 114 to 281 of the protein TRAIL sequence set forth in SEQ ID NO: 58).
The present invention further relates to the use of a vector and/or a bacterium according to the invention to produce and secrete, preferably into the extracellular medium, one or more substance of interest.
The present invention further relates to a method for producing and secreting into the extracellular medium, at least one substance of interest, by at least one bacterium according to the invention, said method comprising the steps of:
- culturing said bacterium under suitable conditions; and
- recovering the culture medium containing said substance of interest; and
- optionally, purifying said substance of interest.
Preferably, the method according to the invention makes it possible to produce and secrete substances of interest on a large scale, that is, on an industrial scale.
The "suitable conditions" (in terms of the composition of the culture medium, temperature, time, ventilation, stirring, etc.) for culturing bacteria and in particular propionibacteria are known to those persons skilled in the art (see in particular documents US 20090312425 in the name of Meiji Dairies Corp. and CN 101045910 in the name of Nanjing University of Technology). Once again, propionibacteria are robust, are able to grow on particular substrates such as whey or molasses and are able to adapt to non-standard culture conditions, characteristics which a large number of other bacteria do not share.
Purification of substance of interest calls upon the general knowledge of those persons skilled in the art and can be carried out without any difficulty using classic techniques.
The invention further relates to a product comprising:
- at least one vector according to the invention and/or at least one bacterium according to the invention; and - at least another active agent, in particular chosen in the group consisting of an anti-tumoral agent, an anti- inflammatory agent and an immunomodulatory agent, more particularly an anti-tumoral agent;
as a combination product for simultaneous, separate or sequential use for the prevention and/or treatment of at least one disease, in particular selected from the group consisting of allergies, hypertension (e.g., the substance of interest has a hypotensive activity), obesity (e.g., the substance of interest has an anorexiant activity), cancers, in particular colorectal cancers (e.g., the substance of interest has a proapoptotic activity) and inflammatory colon diseases, in particular Crohn's disease (wherein the substance of interest is advantageously an antiinflammatory cytokine, for example IL-10).
Said active agent can be a short-chain fatty acid (SCFA), preferably propionate or acetate.
The invention also relates to an isolated nucleic acid molecule of sequence selected from the group consisting of:
- the nucleic acid sequences encoding the peptides of sequences SEQ ID NO: 59 to 68;
- the nucleic acid sequence SEQ ID NO: 69; and
- the sequences having at least 80%, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with one of said sequences over the entire length of said sequence.
Particularly, the sequences having at least 80% of identity with one of the nucleic acid sequences encoding the peptides of sequences SEQ ID NO: 59 to 68 over the entire length of said sequence, encode a signal peptide, particularly a secretory signal peptide.
Particularly, the sequences having at least 80% of identity with the nucleic acid sequence SEQ ID NO: 69 over the entire length of said sequence, comprise a promoter and a sequence encoding a signal peptide, particularly a secretory signal peptide.
The invention further relates to a vector comprising at least one nucleic acid sequence selected from the group consisting of: - the nucleic acid sequences encoding the peptides of sequences SEQ ID NO: 59 to 68;
- the nucleic acid sequence SEQ ID NO: 69; and
- the sequences having at least 80%, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with one of said sequences over the entire length of said sequence.
The invention also relates to a bacterium comprising a vector comprising at least one nucleic acid sequence selected from the group consisting of:
- the nucleic acid sequences encoding the peptides of sequences SEQ ID NO: 59 to 68;
- the nucleic acid sequence SEQ ID NO: 69; and
- the sequences having at least 80%>, more particularly at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% and even more particularly at least 99% of identity with one of said sequences over the entire length of said sequence.
The advantageous embodiments are as describe above.
The present invention is illustrated by the following figures:
Figure 1 : Graphs illustrating the synergy observed in vitro between TRAIL and P. freudenreichii metabolites. HT29 colon cancer cells were treated with sublethal doses of TRAIL (25 ng/ml, 50 ng/ml and 100 ng/ml). Various doses of SCFA (propionate/acetate SCFA, figure 1 A) or of P. freudenreichii supernatant (figure IB) were used in co-treatment. Viability of the HT29 cells was determined after 24 hours of treatment.
Figure 2: Identification of the protein secreted in the majority by P. freudenreichii, PF963. A: growth of two strains of P . freudenreichii, one auto lytic (□) and the other nonlytic (o). B and C: electrophoretic analysis (SDS-PAGE) of proteins secreted by a strain of lytic (B) and nonlytic (C) P. freudenreichii. Protein PF963 was identified by mass spectrometry. Figure 3 : Diagram detailing the cloning strategy to obtain the pFB4:TRAIL plasmid (deposited with the CNCM on July 23, 2009 under number 1-4213). A: the promoter region and signal peptide of the P. freudenreichii protein PF963 were amplified by PCR with introduction (PCR mutagenesis) of restriction sites Nde\ and ΗίηάΙΙΙ. The active extracellular portion of TRAIL (residues 1 14 to 281) was amplified by PCR with introduction of restriction sites HmdIII and Pstl . B and C: the two PCR products were purified and linked in order to obtain the ligation product SP-TRAIL. D: plasmid pK705 was opened by digestion using two enzymes Ndel and Pstl . The ligation product SP-TRAIL was introduced into the open plasmid. The new plasmid pFB4 includes a promoter and a signal peptide enabling the secretion, in particular into the extracellular medium, by P. freudenreichii of a heterologous protein. The arrows and the scissors represent PCR primers and restriction sites, respectively.
Figure 4: Map of the pFB4:TRAIL plasmid (deposited with the CNCM, Institut Pasteur, 28 rue du Docteur Roux, F-75724 Paris Cedex 15, on July 23, 2009 under number 1-4213).
Figure 5: Sequence of the fusion protein coded for by the pFB4:TRAIL plasmid. In this sequence, the underlined region corresponds to the PF963 protein signal sequence and the region in bold corresponds to the TRAIL extracellular domain sequence (residues 1 14 to 281 ).
Figure 6: Detection by Western blot of the fusion protein coded for by the pFB4:TRAIL plasmid. The samples deposited were culture supernatants of wild P. freudenreichii CIP103027 (1) or of P. freudenreichii CIP103027 carrying the pFB4:TRAIL plasmid (2 and 3). A solution of Superjft/ZerTRAIL™ (Alexis Biochemicals, Coger, France) was deposited as positive control (4). The Western blot was developed using a commercial "PAb to TRAIL" antibody (Alexis Biochemicals).
Figure 7: Map of the pCHH04: TRAIL plasmid (deposited with the CNCM on November 13, 2012 under number CNCM 1-4692).
Figure 8: Proteomic comparative analysis of Propionibacterium freudenreichii exoproteomes. Strains CIRM BIA 1 , 129, 1 18, 456, 127, 508, 516 and 512 were grown in YEL medium and the culture supernatants analyzed by SDS PAGE followed by Coomassie Blue staining. The reference strain CIRM BIA 1 , the first sequenced in 2010, secretes 4 proteins with equivalent efficiency, including PF963. Other strains, sequenced since then (unpublished data), secrete a major extracellular 60 kDa protein abundantly. This was identified in strain 118 as SlpA.
Figure 9: Western Blot detection. The plasmids pFB4:TRAIL and pCHH04:TRAIL are compared within the same CIRM BIA 118 strain with respect to TRAIL secretion into the extracellular medium. Secretion of TRAIL into the extracellular medium is then compared in different strains harboring the pCHH04:TRAIL plasmid :The pCHH04:TRAIL plasmid was transformed into different strains of Propionibacterium freudenreichii and the resulting supernatants were analyzed with respect to TRAIL secretion by western blotting.
The present invention will be explained in detail with examples in the following, but the technical scope of the present invention is not limited to these examples.
EXAMPLES
I-Induction of the intrinsic mitochondrial pathway of apoptosis by
Propionibacterium freudenreichii.
During preliminary studies, the Inventors showed that certain selected strains of P. freudenreichii surviving the stresses undergone during intestinal transit in humans (Herve et al., 2007), as well as in the rat (Lan et al., 2007b), express the genes coding for fermentative metabolism enzymes and produce propionate and acetate short-chain fatty acids (SCFA) in situ in the colon (Lan et al., 2007b).
Furthermore, this bacterium induced the apoptosis of human colon adenocarcinoma cells in vitro via these SCFA which act on cancer cell mitochondria (Jan et al., 2002). The mitochondrial pathway of apoptosis induction has been clearly identified in the triggering of programmed cell death of HT29 cells by dairy propionibacteria (Jan et al., 2002; Lan et al., 2007a). Said SCFA cause the opening of mitochondrial permeability transition pores (PTP), the depolarization of mitochondria, the leaking of proapoptotic mitochondrial proteins and the activation of effector caspases.
Such an induction of apoptosis was then researched in vivo in a rat model of human digestive flora. Rats were treated or not treated by the carcinogen dimethylhydrazine (DMH) for the purpose of causing the appearance of damaged colonic epithelial cells likely to develop into colon cancer. These rats received by gavage, or did not receive, the P. freudenreichii bacterium. Colonic epithelial cell apoptosis and proliferation were quantified by anatomopathological analysis of histological sections of colon. The administration in healthy rats of P. freudenreichii had no effect on these parameters. On the other hand, a significant increase in apoptosis was observed in the rats treated with DMH (Lan et al, 2008). It thus appears that a specific apoptosis of cancer cells can be induced by dairy propionibacteria.
II-Induction of the extrinsic pathway of apoptosis by TRAIL via death receptors, synergy with Propionibacterium freudenreichii.
TRAIL is a cytokine capable of inducing the apoptosis of human colon cancer cells by binding to death receptors. TRAIL thus induces a different apoptotic pathway on the cellular and molecular levels and potentiates the action of other proapoptotic molecules used in cancer chemotherapy (Lacour et al., 2001; Lacour et al, 2003; Meurette et al, 2005; Meurette et al, 2006). Cell death induced by TRAIL or by SCFA is promoted by an acidic environment (Meurette et al, 2007; Lan et al, 2007a).
By viability tests (figure 1), and by in vitro apoptosis quantification methods (Hoechst staining and caspases activity, data not shown), the Inventors showed a synergistic proapoptotic effect of the cytokine TRAIL in combination with the propionate/acetate mixture or the propionibacteria culture supernatant in HT29 human colon cancer cells (figure 1). More precisely, the viability illustrated in figure 1 was determined using the following cytotoxicity test. HT29 human colon cancer cells (ATCC, Biovalley) were cultured in 96-well plates (30,000 cells/well) for 24 hours. They were then treated with TRAIL (0 ng/ml, 25 ng/ml, 50 ng/ml and 100 ng/ml) (Super TzY/erTRAIL™, Alexis Biochemicals,
Coger, France) in the presence of increasing concentrations of propionate/acetate (7.5 mmol/3.5 mmol; 15 mmol/7.5 mmol; 30 mmol/15 mmol; 60 mmol/30 mmol) or of bacterial supernatant {P . freudenreichii bacteria) (1/6, 1/4, 1/2, pure). At the end of treatment (24 hours), the medium was discarded and the adherent cells were washed three times with IX PBS (100 μΐ/well) and fixed in 99% ethanol
(100 μΐ/well) for 30 minutes. After discarding the ethanol, the fixed cells were air dried and then stained for 30 minutes with methylene blue (diluted in IX borate buffer). After three washings in water and drying (roughly 30 minutes), 100 μΐ of hydrochloric acid (0.1 N) was added to the wells. The plates were then analyzed by spectrophotometer at a wavelength of 620 nm (iEMS Reader MF; Lab- systems, Helsinki, Finland).
Figure 1 shows that sublethal doses of TRAIL (25 ng/ml, 50 ng/ml and lOO ng/ml) do not significantly induce cell death during the treatment period. Moreover, the smallest doses of SCFA alone induce little or no cell death, but induce massive death in the presence of TRAIL (figures 1A and IB). These results show a synergy of proapoptotic action on human colon cancer cells between SCFA metabolites produced by P. freudenreichii and TRAIL. Ill-Development of a first recombinant propionibacterium with the goal of inducing both the intrinsic and extrinsic apoptotic pathways.
III.1 Summary
The Inventors sought to make a bacterium, harmless to healthy cells, produce inducers of the two apoptotic pathways. These inducers are the SCFA produced by P. freudenreichii for the intrinsic pathway and TRAIL for the extrinsic pathway. Since propionibacteria have a positive tropism for the mucosa of the colon, said recombinant bacterium will not only be likely to produce TRAIL in situ in the colon, but also to carry SCFA and TRAIL toward colon epithelial cells.
To this end, a recombinant propionibacterium expressing TRAIL fused with a secretion signal peptide was developed for in situ production in experimental models of cancer colon.
Briefly, the major protein secreted by P. freudenreichii during its growth and in the absence of lysis, named PF963, was identified. The experimental procedure (e.g., electrophoresis, trypsino lysis, nano-LC and MS/MS) which led to the identification of PF963 is similar to that which had previously enabled the Inventors to identify GAPDH (Tarze et al., 2007). Very briefly, the supernatant of the nonlytic strain of P. freudenreichii was analyzed by electrophoresis. The gel fragment containing the major protein secreted was removed, rinsed and then subjected to "in gel" trypsin proteolysis. The resulting peptides were separated by nano-LC and then analyzed with tandem mass spectrometry (MS/MS).
PF963 is an enzyme secreted via the machinery of the "Sec" pathway which recognizes and cleaves a signal peptide (SP). By genetic engineering, said SP was fused with the active C-terminal extracellular domain of TRAIL. This construction was carried out in E. coli on a cloning plasmid. The fusion thus obtained was introduced into an expression vector (pK705) previously developed for the cloning and expression of propionibacterial genes in dairy propionibacteria and efficient in P . freudenreichii (Kiatpapan et al., 2000) in order to express the fusion protein. The expression and the extracellular addressing of the fusion protein were then analyzed by Western blot.
According to figure 2 A, the growth of P. freudenreichii shows that certain strains are lysed (□) and others not (o). In the latter case, protein PF963 is secreted in the medium (figure 2C) without leakage of cytoplasmic proteins as in the case of spontaneous bacterial lysis (figure 2B). The upstream portion of the PF963 gene, comprising the promoter and the signal peptide, was amplified by PCR and fused with the C-terminal portion of TRAIL (figures 3A to 3C). The following step consisted of its introduction in a P. freudenreichii expression plasmid (figure 3D). III.2 Obtaining the strain Propionibacterium freudenreichii subsp. shermanii CIRM BIA 1 carrying the pFB4:TRAIL plasmid.
III.2.1 Identification of the protein PF963 secreted by Propionibacterium freudenreichii subsp. shermanii.
In order to identify a secreted protein, strains were screened on the basis of aptitude for autolysis. Indeed, it is known that certain strains of said bacterium make use of a programmed cell suicide, autolysis. In this case, cytoplasmic proteins are released in the surrounding medium. On the other hand, other strains, including strain CIRM BIA 1 , do not undergo autolysis and on the contrary make use of a tolerance reaction with respect to various stresses, called the starvation- induced multi-tolerance response. In principle, these nonlytic strains thus only release actively secreted proteins and do not release proteins by accident. Figure 2A shows the evolution of the bacterial population for an autolytic strain (□) and for a nonlytic strain (o) of Propionibacterium freudenreichii subsp. shermanii. Figure 2C shows the electrophoretic analysis (SDS-PAGE) of proteins secreted by a nonlytic strain, CIRM BIA 1. This analysis reveals several secreted proteins, including protein PF963, identified in the culture supernatant of all the nonlytic strains tested. This protein was cut out of a preparative SDS-PAGE gel and subjected to digestion by trypsin. The resulting peptides were analyzed by electrospray ionization tandem mass spectrometry (ESI-MS/MS) on a hybrid triple quadrupole time-of- flight apparatus (QSTAR®XL, Applied Biosystems) according to a standard laboratory procedure (Science and Technology of Milk and Eggs) described in Tarze et al. (2007).
By this analysis, the Inventors identified protein PF963, a secreted bacterial wall peptidase belonging to the NlpC/P60 family. The complete 5 sequence of protein PF963 (SEQ ID NO 36; table I) can be deduced after determination of the complete sequence of the genome of strain CIP 103027 by the Inventors.
III.2.2 Fusion of the N-terminal portion of protein PF963 with the C-
1 0 terminal portion of TRAIL
The presence of a signal peptide at the N-terminal end of PF963 indicates that this enzyme is secreted via the Sec secretion pathway. The sequence of said signal peptide is SEQ ID NO 36. PCR primers were designed to amplify the DNA sequence corresponding to the promoter and to the signal peptide of protein
15 PF963 (figure 3). Another pair of primers was designed to amplify the sequence of the human cytokine TRAIL. Only the active extracellular sequence Val1 14- Gly281 was amplified. The primer sequences are indicated in the following Table IV. 0 Table IV
The construction resulting from the fusion between 1) the promoter and the signal peptide of PF963 and 2) the Val1 14-Gly281 sequence of TRAIL was introduced in cloning vector pPK705 (Kiatpapan et al., 2000). The new pFB4:TPvAIL expression plasmid is presented in figure 4.
III.2.3 Verification of the genetic construction
The sequence of the pFB4:TRAIL plasmid was verified (SEQ ID NO 42). The portion corresponding to the fusion protein ranges from nucleotides 8451 to 9070. This portion is translated in figure 5 (SEQ ID NO 43): the sequence corresponding to the PF963 peptide signal protein is underlined and the Val114- Gly281 sequence of TRAIL appears in bold.
The fusion protein has a sequence of 205 amino acid residues corresponding to a mass of 23,190 Da and an isoelectric point of 9.08. The elimination of the signal peptide leads to a sequence of 171 amino acid residues corresponding to a mass of 19,822 Da and an isoelectric point of 8.60.
Expression and secretion of the fusion protein were verified by Western blot using a commercial anti-TRAIL polyclonal antibody (Pab to TRAIL, Alexis Biochemicals). This antibody recognizes the monomeric form (31 kDa) as well as the dimeric form (63 kDa) of TRAIL in the SuperAiY/erTRAIL™ preparation (figure 6; lane 4). In the supernatant of the two clones of the transformed P. freudenreichii strain carrying the plasmid, a protein of 22 kDa, corresponding to the expected size, was detected by this antibody. This protein was absent in the supernatant of the wild strain.
IV-Development of a second recombinant propionibacterium with the goal of inducing both the intrinsic and extrinsic apoptotic pathways.
The inventors have optimized the plasmid pFB4: TRAIL by changing both the promoter region and the signal peptide to obtain the pCHH04: TRAIL plasmid, allowing secretion into the extracellular medium, of a higher amount of TRAIL into the supernatant.
IV.1 Materials and methods
The construction of pCHH04:TRAIL is described in Figure 7. The pFB4:TRAIL plasmid, which is a shuttle plasmid, was transformed into Escherichia coli. The propionibacterial insert containing the promoter PF963 and the signal peptide PS963 were excised using the appropriate restriction endonucleases. A new propionibacterial DNA fragment (set forth in SEQ ID NO: 69), containing the promoter region and the signal peptide of protein slpA of the Propionibacterium freudenreichii CIRM BIA 118 strain, was introduced in order to put the signal peptide in frame with the TRAIL coding sequence. The corresponding sequence was amplified by PCR (PSlpA fwd BamHl, which has the sequence set forth in SEQ ID NO: 70 and PS SlpA-EcoRV-Rev bis, which has the sequence set forth in SEQ ID NO: 71) from Propionibacterium freudenreichii CIRM BIA 1 genomic sequence, which was previously sequenced and annotated (Falentin et al., 2010a). This new plasmid, pCHH04:TRAIL, was then transformed into different strains of Propionibacterium freudenreichii. The corresponding supernatants were then analyzed by western blot with respect to TRAIL secretion as above described. Proteomic experiments, including gel electrophoresis and mass spectrometry, was conducted as previously described (Leverrier et al., 2004). TRAIL concentration was further quantified by Enzyme- Linked Immunosorbent Assay (ELISA) in supernatant of Propionibacterium freudenreichii transformed with pFB4:TRAIL or pCHH04:TRAIL plasmid according to the manufacturer's instructions (R&D System Europe, Lille, France). Human TRAIL standard concentration-response curves were used to quantify TRAIL levels in supernatants. TRAIL concentrations were determined using an automatic plate reader associated with genesis software (LabSystems Spectrophotometer, Cambridge, UK) and data were expressed in ng/ml.
IV.2 Results
In order to investigate secretion abilities in Propionibacterium freudenreichii, supernatants of several strains were analyzed by SDS-PAGE electrophoresis. Figure 8 shows great variability, between strains, in terms of both number and amount of secreted proteins. In particular, Propionibacterium freudenreichii CIRM BIA 118 secreted elevated amounts of a 60 kDa protein identified by mass spectrometry as slpA. A translational fusion including slpA signal peptide and TRAIL C-terminal active extracellular part was then obtained (Figure 7, pCHH04:TRAIL). This new construct was compared to pFB4:TRAIL in terms of TRAIL secretion in the CIRM BIA 118 strain. Western blot analysis of the corresponding culture supernatants revealed the presence of a 21 kDa polypeptide identified as TRAIL by immunoblotting. As shown in Figure 9 (left panel), secretion into the extracellular medium of TRAIL was higher using the pCHH04:TRAIL construct, compared to pFB4:TRAIL. Furthermore, different strains of Propionibacterium freudenreichii were transformed using pCHH04:TRAIL and secreted TRAIL (Figure 9, right panel). The amount of TRAIL secreted by Propionibacterium freudenreichii CIRM BIA 118 (pFB4:TRAIL) was 0.178 ng/ml while it was 22 ng/ml in Propionibacterium freudenreichii CIRM BIA 118 (pCHH04:TRAIL) (Table V). This evidences a 100-fold increase in secretion efficiency. Moreover, similar secretion efficiency was demonstrated in different strains of Propionibacterium freudenreichii (including CIRM BIA 512, 125, 1 18, 129 and 122 strains, Figure 9 right panel and Table V). Table V - ELISA quantification of human TRAIL in Propionibacterium freudenreichii supernatants (corresponding to supernatants analysed by western
IV.3 Discussion
The expression and secretion construction pCHH04: TRAIL allows higher amounts of TRAIL secretion into the extracellular medium than the pFB4: TRAIL construction. The sip A promoter, isolated from strain CIRM BIA 118, is most probably stronger than PF963 promoter. The slpA signal peptide allows efficient secretion of the TRAIL human cytokine in different Propionibacterium strains. Other sip proteins were then identified from the genomic sequence of several Propionibacterium freudenreichii strains. The corresponding signal peptides are presented in Table III and may also be used to allow heterologous protein expression in Bacteria, in particular belonging to the order Actinomycetales, in particular to the genus Propionibacterium, and more particularly to the species Propionibacterium freudenreichii. REFERENCES
- Ashkenazi A et al. 1999. J. Clin. Invest. 104: 155-162.
- Bougie et al. 1999. Scand. J. Gastroenterol. 34: 144-148.
- Deutsch et al. 2012. Applied and Environmental Microbiology 78: 1765-1775 - Emanuelsson et al. 2007. Nature Protocols 2:953-971.
- Falentin et al. 2010a. Plos One 5:el 1748.
- Falentin et al. 2010b. Int. J Food Microbiol. 144 : 10-19.
- Ganai et al. 2009. British Journal of Cancer. 101 : 1683-1691.
- Herve et al. 2007. Int J Food Microbiol. 113:303-314.
- Hu et al. 2009. Cancer Gene Therapy. 16:655-663.
- Jan et al. 2002. Cell Death Differ. 9: 179-188.
- Kiatpapan et al. 2000. Appl. Environ. Microbiol. 66:4688-4695.
- Lan et al. 2007a. Apoptosis 12:573-591.
- Lan et al. 2007b. Br J Nutr. 97:714-724.
- Lan et al. 2008. Br J Nutr. 100: 1251-1259.
- Lacour et al. 2001. Cancer Res. 61 : 1645-1651.
- Lacour et al. 2003. Oncogene 22: 1807-1816.
- Leverrier et al. 2004. Arch. Microbiol. 181 :215-230.
- Lortal et al. 1993. Applied and Environmental Microbiology 59(8): 2369. - Meurette et al. 2005. Clin. Cancer Res. 1 1 :3075-3083.
- Meurette et al. 2006. Ann N Y Acad Sci. 1090:209-216.
- Meurette et al. 2007. Cancer Res. 67:218-226.
- Patch J.A. and Barron A.E., 2002. Curr. Opin. Chem. Biol., 6(6):872-877.
Review.
- Strater J. et al. 2002. Gastroenterology 122:659-666.
- Sambrook and Russell (2001) Molecular Cloning: A Laboratory Manual (3rd Ed.) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.
- Tarze et al. 2007. Oncogene 26:2606-2620.
- Zarate et al. 2000. J. Food Prot. 63: 1214-1221.
- Zhang et al. 2010. Cancer Gene Therapy 17:334-343 Print Out (Original in Electronic Form)
(This sheet is not part of and does not count as a sheet of the international application)
Indications are Made All designations
FOR RECEIVING OFFICE USE ONLY
Corapci, Mustafa
FOR INTERNATIONAL BUREAU USE ONLY
0-5 This form was received by the
international Bureau on:
0-5-1 Authorized officer

Claims

1. A vector comprising:
- at least one promoter operatively linked to
- at least one nucleic acid sequence encoding a signal peptide translationally fused to
- at least one nucleic acid sequence encoding a substance of interest;
wherein said nucleic acid sequence encoding a signal peptide is selected from the group consisting of:
- the sequence of the signal peptide of a gene encoding a surface layer protein of a Propionibacterium freudenreichii; and
- the sequences having at least 80% of identity with said sequence over the entire length of said sequence;
and/or
■ wherein the sequence of said promoter is selected from the group consisting of:
- the sequence of the promoter of a gene encoding a surface layer protein of a Propionibacterium freudenreichii; and
- the sequences having at least 80% of identity with said sequence over the entire length of said sequence.
2. The vector according to claim 1, wherein said nucleic acid sequence encoding a signal peptide is selected from the group consisting of:
- the sequence of the signal peptide of a gene encoding a surface layer protein of a Propionibacterium freudenreichii; and
- the sequences having at least 80%> of identity with said sequence over the entire length of said sequence;
and wherein the sequence of said promoter is selected from the group consisting of:
- the sequence of the promoter of a gene encoding a surface layer protein of a Propionibacterium freudenreichii; and
- the sequences having at least 80%> of identity with said sequence over the entire length of said sequence.
3. The vector according to claim 1 or 2, wherein said surface layer protein is selected from the group consisting of the surface layer protein A, the surface layer protein B, the surface layer protein C, the surface layer protein D, the surface layer protein E and the surface layer protein F.
4. The vector according to claim 3, wherein said nucleic acid sequence encoding a signal peptide is selected from the group consisting of:
- the nucleic acid sequences encoding the signal peptides of sequences SEQ ID NO: 59 to 68; and
- the sequences having at least 80% of identity with one of said sequences over the entire length of said sequence.
5. The vector according to claim 4, comprising the nucleic acid sequence SEQ ID NO: 69 or a sequence having at least 80% of identity with SEQ ID NO: 69 over the entire length of said sequence, translationally fused to said nucleic acid sequence encoding a substance of interest.
6. The vector according to any one of claims 1 to 5, wherein said substance of interest is a peptide or a protein chosen in the group consisting of antibodies, receptor ligands, hormones, cytokines, growth factors, cell adhesion molecules, blood clotting factors, enzymes, fragments thereof and combinations thereof, more particularly in the group consisting of cytokines, antibodies and hormones, and even more particularly from the group consisting of proapoptotic TRAIL protein and the C-terminal extracellular domain of the TRAIL protein.
7. The vector according to claim 6, wherein said substance of interest is the C- terminal extracellular domain of the TRAIL protein consisting of the sequence from amino acids 114 to 281 of the sequence set forth in SEQ ID NO: 58.
8. A bacterium comprising a vector according to any one of claims 1 to 7.
9. The bacterium according to claim 8, which belongs to the order
Actinomycetales, in particular to the genus Propionibacterium, and more particularly to the species Propionibacterium freudenreichii.
10. The propionibacterium deposited on November 13, 2012 under number CNCM 1-4692 with the Collection Nationale de Cultures de Microorganismes (CNCM, Institut Pasteur, 25 rue du Docteur Roux, 75724 Paris Cedex 15, France).
11. A composition comprising at least one vector according to any one of claims 1 to 7 and/or at least one bacterium according to any one of claims 8 to 10.
12. A vector according to any one of claims 1 to 7 or a bacterium according to any one of claims 8 to 10 for use as a medicament.
13. A vector according to any one of claims 1 to 5 or a bacterium according to any one of claims 8 to 10 for use in the prevention and/or treatment of cancer; wherein said substance of interest is the proapoptotic TRAIL protein or the C- terminal extracellular domain of the TRAIL protein.
14. The bacterium for use according to claim 13, said bacterium belonging to the genus Propionibacterium, particularly to the species Propionibacterium freudenreichii.
15. A product comprising :
- at least one vector according to any one of claims 1 to 7 and/or at least one bacterium according to any one of claims 8 to 10; and
- at least another active agent, in particular chosen in the group consisting of an anti-tumoral agent, an anti-inflammatory agent and an immunomodulatory agent;
as a combination product for simultaneous, separate or sequential use for the prevention and/or treatment of at least one disease, in particular selected from the group consisting of allergies, hypertension, obesity, cancers and inflammatory colon diseases.
16. A method for producing and secreting into the extracellular medium at least one substance of interest, by at least one bacterium as defined in any one of claims 8 to 10, said method comprising the steps of:
- culturing said bacterium under suitable conditions; and
- recovering the culture medium containing said substance of interest.
17. An isolated nucleic acid molecule of sequence selected from the group consisting of:
- the nucleic acid sequences encoding the peptides of sequences SEQ ID NO: 59 to 68;
- the nucleic acid sequence SEQ ID NO: 69; and
- the sequences having at least 80% of identity with one of said sequences over the entire length of said sequence.
EP14744523.3A 2013-07-25 2014-07-24 Vectors for producing and secreting substance of interest by bacteria and applications thereof Withdrawn EP3024469A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
EP14744523.3A EP3024469A1 (en) 2013-07-25 2014-07-24 Vectors for producing and secreting substance of interest by bacteria and applications thereof

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
EP20130306080 EP2829274A1 (en) 2013-07-25 2013-07-25 Vectors for producing and secreting substance of interest by bacteria and applications thereof
PCT/EP2014/065982 WO2015011250A1 (en) 2013-07-25 2014-07-24 Vectors for producing and secreting substance of interest by bacteria and applications thereof
EP14744523.3A EP3024469A1 (en) 2013-07-25 2014-07-24 Vectors for producing and secreting substance of interest by bacteria and applications thereof

Publications (1)

Publication Number Publication Date
EP3024469A1 true EP3024469A1 (en) 2016-06-01

Family

ID=48918333

Family Applications (2)

Application Number Title Priority Date Filing Date
EP20130306080 Withdrawn EP2829274A1 (en) 2013-07-25 2013-07-25 Vectors for producing and secreting substance of interest by bacteria and applications thereof
EP14744523.3A Withdrawn EP3024469A1 (en) 2013-07-25 2014-07-24 Vectors for producing and secreting substance of interest by bacteria and applications thereof

Family Applications Before (1)

Application Number Title Priority Date Filing Date
EP20130306080 Withdrawn EP2829274A1 (en) 2013-07-25 2013-07-25 Vectors for producing and secreting substance of interest by bacteria and applications thereof

Country Status (2)

Country Link
EP (2) EP2829274A1 (en)
WO (1) WO2015011250A1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10287326B2 (en) * 2014-07-15 2019-05-14 Institut National De La Recherche Agronomique (Inra) Anti-inflammatory properties of a surface protein of propionibacterium freudenreichii

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017122197A1 (en) * 2016-01-11 2017-07-20 3Plw Ltd. Lactic acid-utilizing bacteria genetically modified to secrete polysaccharide-degrading enzymes
FR3085387B1 (en) * 2018-09-05 2021-01-29 Inst Nat De La Rech Agronomique Inra NEW TREATMENT OF MUCITIS

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2004500042A (en) 1999-10-04 2004-01-08 ヴァイオン ファーマシューティカルズ、インコーポレーテッド Compositions and methods for tumor-targeted delivery of effector molecules
AU2002323899B2 (en) 2001-08-10 2007-06-28 Meiji Dairies Corporation Process for producing 1,4-dihydroxy -2-naphthoic acid
CN100475951C (en) 2007-03-13 2009-04-08 南京工业大学 Preparation of propionic acid and co-production of vitamin B by using propionibacterium freudenre NX-412Method (2)
WO2009111177A2 (en) 2008-03-05 2009-09-11 Mount Sinai School Of Medicine Of New York University Compositions and methods comprising genetically enhanced obligate and facultative anaerobic bacteria for oncopathic cancer therapy
GB0821729D0 (en) * 2008-11-28 2008-12-31 Plant Bioscience Ltd Composition and method for enhanced secretion of peptides and proteins from bacteria
FR2960001A1 (en) 2010-05-12 2011-11-18 Univ Rennes RECOMBINANT VECTOR FOR THE PRODUCTION AND SECRETION OF AMINO ACID SEQUENCES OF INTEREST BY PROPIONIC BACTERIA AND ITS APPLICATIONS

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
None *
See also references of WO2015011250A1 *

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10287326B2 (en) * 2014-07-15 2019-05-14 Institut National De La Recherche Agronomique (Inra) Anti-inflammatory properties of a surface protein of propionibacterium freudenreichii

Also Published As

Publication number Publication date
EP2829274A1 (en) 2015-01-28
WO2015011250A1 (en) 2015-01-29

Similar Documents

Publication Publication Date Title
Ribeiro et al. Production and targeting of the Brucella abortus antigen L7/L12 in Lactococcus lactis: a first step towards food-grade live vaccines against brucellosis
US10744192B2 (en) Vaccine
US20130108584A1 (en) Recombinant vector for producing and secreting amino acid sequences of interest by propionibacteria and applications thereof
CN103221420A (en) Compositions and methods for delivering therapeutic peptides
US20240390433A1 (en) Genetically modified bacillus subtilis strain and use as a live delivery and production system
EP3315599A1 (en) Oral tumor vaccine
CA2886883A1 (en) Immunomodulatory minicells and methods of use
JP2002508939A (en) Delivery of proteins to eukaryotes by recombinant Erzinia
JP2021521798A (en) Recombinant therapeutic intervention for cancer
KR20180054587A (en) Modified yeast-brachyury immunotherapeutic composition
CN105085641A (en) Cytomembrane positioning signal peptide and coding sequence and application thereof
WO2015011250A1 (en) Vectors for producing and secreting substance of interest by bacteria and applications thereof
JP6213969B2 (en) Immunogenic polypeptide surface expression bifidobacteria
US9476056B2 (en) Recombinant vector for producing and secreting peptide or protein of interest by propionibacteria and applications thereof
NZ535312A (en) Bacteria as carriers of nucleotide sequences coding for cell antigens used for the treatment of tumors
US20190351038A1 (en) Cancer Therapy Utilizing Combination Of Oral Tumor Vaccine And Immunosuppression Inhibitor
Punj et al. Microbial based therapy of cancer: a new twist to an age old practice
US10287326B2 (en) Anti-inflammatory properties of a surface protein of propionibacterium freudenreichii
US12280078B2 (en) Modified microorganisms expressing saga and related compositions for immunomodulation against infection and cancer immunotherapy
CN102000323B (en) Application of SJ16 protein in preparing immunosuppressive drugs
Chalet Surface proteins of Propionibacterium freudenreichii are involved in its anti-inflammatory properties
CN121450556A (en) Construction method, product and application of methionine-depleted genetic engineering strain
Le Maréchal et al. are involved in its anti-inflammatory properties
Klotz Functional Characterization of the Lactobacillus acidophilus S-layer Associated Proteome
Naser et al. The 19 kDa protein from Mycobacterium avium subspecies paratuberculosis is a glycolipoprotein

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20160216

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

AX Request for extension of the european patent

Extension state: BA ME

DAX Request for extension of the european patent (deleted)
17Q First examination report despatched

Effective date: 20170309

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20200201