EP2909318A1 - A thermostable sucrose and sucrose-6'-phosphate phosphorylase - Google Patents

A thermostable sucrose and sucrose-6'-phosphate phosphorylase

Info

Publication number
EP2909318A1
EP2909318A1 EP13776826.3A EP13776826A EP2909318A1 EP 2909318 A1 EP2909318 A1 EP 2909318A1 EP 13776826 A EP13776826 A EP 13776826A EP 2909318 A1 EP2909318 A1 EP 2909318A1
Authority
EP
European Patent Office
Prior art keywords
sucrose
phosphate
seq
amino acid
acid sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP13776826.3A
Other languages
German (de)
French (fr)
Inventor
Karel DE WINTER
Wim Soetaert
Tom Desmet
Dirk AERTS
Tom Verhaeghe
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Universiteit Gent
Original Assignee
Universiteit Gent
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Universiteit Gent filed Critical Universiteit Gent
Priority to EP13776826.3A priority Critical patent/EP2909318A1/en
Publication of EP2909318A1 publication Critical patent/EP2909318A1/en
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1048Glycosyltransferases (2.4)
    • C12N9/1051Hexosyltransferases (2.4.1)
    • C12N9/1066Sucrose phosphate synthase (2.4.1.14)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1048Glycosyltransferases (2.4)
    • C12N9/1051Hexosyltransferases (2.4.1)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P19/00Preparation of compounds containing saccharide radicals
    • C12P19/44Preparation of O-glycosides, e.g. glucosides
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y204/00Glycosyltransferases (2.4)
    • C12Y204/01Hexosyltransferases (2.4.1)
    • C12Y204/01007Sucrose phosphorylase (2.4.1.7)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y204/00Glycosyltransferases (2.4)
    • C12Y204/01Hexosyltransferases (2.4.1)
    • C12Y204/01014Sucrose-phosphate synthase (2.4.1.14)

Definitions

  • thermostable sucrose and sucrose-6'-phosphate phosphorylase A thermostable sucrose and sucrose-6'-phosphate phosphorylase
  • Sucrose phosphorylase (SP, E.C. 2.4.1.7) is classified in the a-amylase family (GH-13) and catalyzes the reversible phosphorolysis of sucrose into a-D-glucose-l-phosphate (a-Glc-l-P) and D-fructose 1_ 4 . Thanks to its broad acceptor specificity, SP can be employed for the transfer of a glucosyl moiety to a variety of monosaccharides, sugar alcohols and even phenolic compounds. Therefore, SP is a very interesting biocatalyst for the production of a-D-glucosides as industrial fine chemicals 5 .
  • SP have so far only been isolated from mesophilic sources 5 ' 11 with the enzymes originating from Leuconostoc mesenteroides, Bifidobacterium adolescentis and Pelomonas saccharophyla the most extensively described in literature 5 ' 6 .
  • the SP from B. adolescentis is the most thermostable isolate today with a half-life time of 12 hours at 60°C 12 . This limited thermostability of mesophilic isolates could hamper the commercial exploitation of SP.
  • sucrose-6'-phosphate Although progress has been made in stabilizing industrially important biocatalysts, there is still a need to identify a sucrose phosphorylase that is more stable than the best enzymes available today or to identify other, specific substrates of said phosphorylases such as sucrose-6'-phosphate.
  • FIG. 5 Homology model of the Thermobacterium thermosaccharolyticum SP showing the main enzyme-substrate interactions
  • the present invention further relates to the use as described above wherein said amino acid sequence is encoded by the nucleic acid sequence as depicted by SEQ ID N°2 or SEQ ID N°3.
  • nucleic acid sequence as depicted by SEQ I D N° 2 is the following Thermoanaerobacterium thermosaccharolyticum sucrose phosphorylase or sucrose-6'-phosphate phosphorylase encoding nucleic acid sequence:
  • the nucleic acid sequence as depicted by SEQ I D N° 3 is the following Thermoanaerobacterium thermosaccharolyticum sucrose phosphorylase or sucrose-6'-phosphate phosphorylase encoding nucleic acid sequence which, compared to SEQ ID N°2, has been codon optimized for expression in E.
  • the invention further relates to the use as described above wherein said amino acid sequence is depicted by SEQ ID N°4.
  • the amino acid sequence as depicted by SEQ I D N° 4 is the following Thermoanaerobacterium thermosaccharolyticum sucrose phosphorylase or sucrose-6'-phosphate phosphorylase amino acid sequence which, compared to SEQ ID N° 1, comprises a N-terminal His 6 -tag (underlined): MGGSHHHHHHGMASMALKNKVQLITYPDSLGGNLKTLNDVLEKYFSDVFGGVHILPPFPSSGD GFAPITYSEIE PKFGTWYDIKKMAENFDILLDLMVNHVSRRSIYFQDFLKKGRKSEYADMFITLDKLWKDGKPVKGDIEKMFLRRT LPYSTFKIEETGEEEKVWTTFGKTDPSEQIDLDVNSHLVREFLLEVFKTFSNFGVKIVRLDAVGYVIKKIGTSCFFVEP EIYEFLDWAKGQAASYGIELLLEVHSQFEVQYKLAERGFLIYDFILPFTVLYTLINK
  • the term 'thermostability' thus means that the sucrose phosphorylase or sucrose-6'-phosphate phosphorylase of the present invention has, during a phosphorolysis or synthesis reaction as described elsewhere in the present disclosure, at a pH of 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1, 7.2, 7.3, 7.4, or, 7.5, and, at a temperature of 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 or 70 °C, a half-life of 20, 21, 22, 25, 30, 35, 40,..., 45,..., 50, 55,..., 60, 61, 62, 63,..., 70,...75,...80, 81, 82,
  • thermostability means that said sucrose phosphorylase or sucrose-6'-phosphate phosphorylase has, during a phosphorolysis or synthesis reaction at an enzyme concentration of about 8.5 ⁇ g/ml, at a pH between 6.0 and 6.5 and at a temperature of about 60°C, a half-life of at least 60 hours.
  • thermostability thus specifically means that that the sucrose phosphorylase or sucrose-6'-phosphate phosphorylase of the present invention has, during a phosphorolysis or synthesis reaction as described elsewhere in the present disclosure, and at an enzyme concentration of 8.0, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9 or 9.0 ⁇ g/ml, at a pH of 6.0, 6.1, 6.2, 6.3, 6.4 or 6.5 and at a temperature of 55, 56, 57, 58, 59, 60, 61, 62, 63, 64 or 65 °C, a half-life of 60, 61, 62, 63, 64, 65,..., 70,...75,...80, 81, 82, 83, 84, 85, or more hours.
  • the 'thermostability' of the enzyme of the present invention can be determined by any method known in the art. More specific enzyme assays, such as enzyme activity assays, determinations of the temperature optimum of the enzymes, the influence of pH on enzyme activity, determination of the kinetic temperature stability and the determination of the thermodynamic stability of the enzyme of the present invention are described elsewhere in the present disclosure.
  • the present invention further relates to the use as described above wherein said polypeptide has an amino acid sequence which is at least 90% identical to the amino acid sequence as depicted by SEQ ID N°l or wherein said polypeptide is a fragment of the amino acid sequence as depicted by SEQ ID N°l. More specifically, the present invention relates to the use as described above wherein said variant or fragment comprises the amino acid regions 45-56, 131-207, 236-310 and 340-358 of SEQ ID N°l.
  • Such fragment can -for example- be a protein with a deletion of 10% or less of the total number of amino acids at the C- and/or N-terminus. More specifically, said fragment comprises the amino acid regions 45-56, 131- 207, 236-310 and 340-358 of SEQ ID N°l or comprises the amino acid histidine at amino acid position 344 of SEQ ID N° 1.
  • the term "variant" refers to a protein having at least 90 % sequence identity (i.e. having at least 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity) with SEQ ID N° 1 and that retains said sucrose phosphorylase- or sucrose-6'-phosphate phosphorylase activity. More specifically, said variant comprises the amino acid regions 45-56, 131-207, 236-310 and 340-358 of SEQ ID N°l or comprises the amino acid histidine at amino acid position 344 of SEQ ID N° 1.
  • the percentage of amino acid sequence identity is determined by alignment of the two sequences and identification of the number of positions with identical amino acids divided by the number of amino acids in the shorter of the sequences x 100.
  • the latter 'variant' may differ from the protein as depicted by SEQ ID N° 1 only in conservative substitutions and/or modifications, such that the ability of the protein to have sucrose phosphorylase- or sucrose-6'-phosphate phosphorylase activity is retained.
  • a "conservative substitution” is one in which an amino acid is substituted for another amino acid that has similar properties, such that one skilled in the art of protein chemistry would expect the nature of the protein to be substantially unchanged.
  • amino acids represent conservative changes: (1) ala, pro, gly, glu, asp, gin, asn, ser, thr; (2) cys, ser, tyr, thr; (3) val, ile, leu, met, ala, phe; (4) lys, arg, his; and (5) phe, tyr, trp, his.
  • Variants may also (or alternatively) be proteins as described herein modified by, for example, the deletion or addition of amino acids that have minimal influence on the sucrose phosphorylase- or sucrose-6'-phosphate phosphorylase activity as defined above, secondary structure and hydropathic nature of the enzyme.
  • variants also refers to any glycosylated protein or fragments thereof as described above.
  • the present invention further relates to a method to produce D-fructose, D-fructose-6-phosphate and/or alpha-D-glucose -1-phosphate at a temperature above 50°C (i.e. 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 or 70°C) comprising: i) contacting a polypeptide as defined above with sucrose or sucrose-6'-phosphate and inorganic phosphate, ii) phosphorolyse sucrose or sucrose-6'-phosphate to obtain D-fructose, D-fructose-6-phosphate and/or alpha-D- glucose -1-phosphate, and iii) purifying said D-fructose, D-fructose-6-phosphate and/or alpha-D- glucose -1-phosphate.
  • the present invention also relates to a method to produce an alpha-D-glucoside at a temperature above 50°C (i.e. 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 or 70°C)comprising: i) contacting a polypeptide as defined above with either alpha-D-glucose -1- phosphate, sucrose or sucrose-6'-phosphate as donor and an appropriate acceptor such as a monosaccharide, a phosphorylated monosaccharide, an aliphatic or aromatic alcohol, a furanone, a flavanoid or a phenolic compound, ii) glycosylating said monosaccharide, phosphorylated monosaccharide, aliphatic or aromatic alcohol, furanone, flavanoi
  • the present invention also relates to an isolated amino acid sequence as depicted by SEQ ID N°4 and an isolated nucleic acid sequence as depicted by SEQ ID N°3.
  • the term 'nucleic acid' as used herein corresponds for example to DNA, cDNA, NA, sense and anti- sense nucleic acids and the like.
  • Said nucleic acids can be incorporated in appropriate vectors such as plasmids and appropriate host cells such as Escherichia can be transfected with said vectors.
  • the present invention further relates to a method to produce an alpha-D-glucoside comprising: i) contacting a polypeptide as defined above with either alpha-D-glucose -1-phosphate, sucrose or sucrose-6'-phosphate as donor and an appropriate acceptor, ii) glycosylating said acceptor to obtain an alpha-D-glucoside, and iii) purifying said alpha-D-glucoside, wherein said glycosylation is carried out in a two-phase system with an organic solvent phase containing the acceptor and an aqueous buffer phase containing said polypeptide as defined above and said donor.
  • the term 'a two-phase system' relates to any two-phase system described in the art such as for example described in the work of Vulfson 17 and Carrea 18 .
  • the term 'organic phase' relates to a phase wherein for example ethyl acetate, n-butyl acetate, methyl ieri-butyl ether, diethyl ether, pentane, hexane or octane is present as solvent and further contains the acceptor molecule (for example at a concentration of 1-500 g/L).
  • aqueous buffer phase' contains the enzyme of the present invention (for example at a concentration of 0.1-500 U mL "1 ) and donor substrate (for example at a concentration of 0.05-3 M).
  • the latter method can take place at temperature between 30 and 70 °C, at a pH between 6 and 9, and the ratio between the aqueous and organic (solvent) phase can be between 0.01 and 100.
  • the present invention specifically relates to a method as described above wherein said acceptor is a non-carbohydrate acceptor (i.e. any appropriate acceptor which is not a carbohydrate), and more specifically to a method as describe above wherein said non-carbohydrate acceptor is cinnamyl alcohol, geraniol, propyl gallate, ethyl gallate, resorcinol, pyrogallol, saligenin or methyl gallate.
  • a non-carbohydrate acceptor i.e. any appropriate acceptor which is not a carbohydrate
  • the present finally relates to the use as described above wherein said amino acid sequence is encoded by the nucleic acid sequence as depicted by SEQ ID N°2 or SEQ ID N°3.
  • the present invention will further be illustrated by the following non-limiting examples.
  • the synthetic genes were cloned into the constitutive expression vector pCXP34h 11 using the respective restriction endonucleases.
  • the resulting expression plasmids were transformed in E. coli CGSC 8974.
  • for the SP from B for the SP from B.
  • the expression plasmid constructed in 11 was used.
  • 2 % of an overnight culture was inoculated in 500 mL LB medium containing 100 ⁇ g/mL ampicillin in a 2 L shake flask and incubated at 37 °C with continuous shaking at 200 rpm for 6 hours.
  • the produced biomass was harvested by centrifugation for 15 minutes at 12000 x g and 4 °C, washed with 50 mL PBS buffer (300 mM NaCI and 50 mM NaH 2 P0 4 at pH 8) and the obtained cell pellets were stored at -20 °C.
  • the cell pellets were then thawed and dissolved in 20 mL lysis buffer (300 mM NaCI, 10 mM imidazole , 0.1 mM PMSF and 50 mM NaH 2 P0 4 at pH 8) supplemented with lysozyme and DNasel in a final concentration of 1 mg/mL and 6 mU/mL, respectively.
  • This cell suspension was incubated on ice for 30 minutes and sonicated 3 times for 2.5 minutes (Branson sonifier 250, level 3, 50 % duty cycle).
  • the His 6 -tagged proteins were purified by Ni-NTA chromatography as described by the supplier (Qiagen), after which the buffer was exchanged to 50 mM MOPS pH 7 in a Centricon YM-30 (Millipore). The protein content was analyzed measuring the absorbance at 280 nm. The extinction coefficients for the His 6 -tagged proteins were calculated using the Protparam tool on the expasy server (URL: http://web.expasy.org/protparam/).
  • Enzyme assays and enzyme characterization The enzyme activity has been measured in both directions of the equilibrium reaction using a discontinuous assay.
  • Initial reaction rates for the phosphorolysis of sucrose were measured by quantifying the release of fructose using the bicinchoninic acid (BCA) assay and the release of inorganic phosphate from a-glucose-l-phosphate was monitored in the synthetic direction using the phosphomolybdate assay like described before 6 .
  • First the temperature optimum was determined in the phosphorolytic direction using 350 mM sucrose and 350 mM sodium phosphate buffer at pH 6.5 in a range from 40 to 70 °C. Reactions were monitored for 15 min in a heating block with sampling at regular intervals. Inactivation of the samples occurred by the alkaline environment of the assay solution.
  • the influence of pH on enzyme activity was measured in the range of pH 4.5 to 8 using acetate (pH 4.5), MES (pH 5.0 - 6.5) and MOPS (pH 7 - 8)) buffers with a concentration of 50 mM.
  • the pH of the substrate solutions was set at the temperature of measurement with NaOH or HCI.
  • the apparent kinetic parameters for sucrose as well as a-Glc-l-P as donor and for inorganic phosphate and fructose as acceptor were determined at optimal pH and temperature. The parameters were calculated by non-linear regression of the Michaelis-Menten equation using Sigma Plot 11.0.
  • the kinetic temperature stability was examined by incubating purified enzyme (35 ⁇ g/mL) for 1 h in a gradient thermocycler (Biometra, Goettingen, Germany) set to a temperature range of 57 - 73°C, followed by 15 min cooling to 16°C.
  • the residual activity of the enzyme was determined in the phophorolytic direction using the standard conditions described above.
  • the half life time (tso) was evaluated by incubating purified enzyme (8.5 ⁇ g/mL) in a water bath at 60 °C with sampling at regular time intervals. The residual activity was then measured and compared to the activity of the untreated enzyme.
  • thermodynamic stability was measured using differential scanning fluorimetry (DSF) 21 in a Rotor-Gene Q cycler with HRM channel (Qiagen).
  • DSF differential scanning fluorimetry
  • 10 ⁇ g purified protein was used with 1.25 ⁇ SYPRO Orange (400x diluted) (Sigma-Aldrich) in 25 ⁇ .
  • the gain was optimized before the temperature increase was started. The temperature increases from 35°C to 95°C, rising 1°C each step in 5 s steps.
  • the fluorescent signal is detected at 510 nm with the green detection filter and the excitation occurs at 460 nm with a HRM lamp.
  • the melting temperature (T m ) is determined by calculating the maximum of the first derivative of the melt curve using the Rotor-Gene Q software (Qiagen).
  • Enzymatic glucosylation of non-carbohydrate acceptors The glucosylation of various non-carbohydrate acceptors was carried out at 100 mL scale in magnetically stirred reaction vessels. To that end, a two-phase system was used with either ethyl acetate, n-butyl acetate, methyl ieri-butyl ether, diethyl ether, pentane, hexane or octane as organic phase containing the acceptor molecule (1-500 g L 1 ), and an aqueous buffer system containing the enzyme (0.1-500 U mL "1 ) and donor substrate (0.05-3 M).
  • the temperature was varied between 30 and 70 °C, the pH between 6 and 9, and the ratio between the aqueous and solvent phase between 0.01 and 100.
  • samples were taken and subjected to HPLC analysis. Separation was achieved using a Waters X-bridge amide column (250 x 4.6 mm, 3.5 ⁇ ) with milliQ water (solvent A) and acetonitrile (solvent B), both containing 0.2 % triethylamine, as the mobile phase.
  • the flow rate and temperature were set at 1.0 mL min "1 and 30 °C, respectively.
  • the gradient elution was as follows: 95 % of solvent A (0 - 12 min), 5 to 25 % solvent B (12 - 15 min), 25 % solvent B (15 - 40 min), 25 to 5 % solvent B (40 - 41 min) and 95 % solvent A (41 - 50 min). Adequate detection was obtained with an Alltech 2000ES evaporative light scattering detector (ELSD).
  • ELSD evaporative light scattering detector
  • thermostable sequences To obtain a better understanding in the genetic diversity of SP, a phylogenetic tree was constructed from all the putative SP genes classified in the a-amylase family subfamily 18 (GH13-18). So far, there is only one specificity demonstrated for this subfamily, i.e. the phosphorolysis of sucrose 4 .
  • a-amylase family subfamily 18 GH13-18. So far, there is only one specificity demonstrated for this subfamily, i.e. the phosphorolysis of sucrose 4 .
  • Thermaceae From the 115 different species harboring a (putative) SP gene, 8 of them grow with optimal temperatures between 55 and 67.5 °C (Table 1). From the family Thermaceae, putative SP sequences from 4 different species are available and they are 555 to 588 AA in length and phylogenetically related. Besides members from the Thermaceae family, two sequences originating from Thermoanaerobacterium are classified in GH13-18 (Table 1) and they are for 91 % identical. The sequences are 488 AA long and they are most related to SPs from lactic acid bacteria which are extensively described in literature. Furthermore a putative SP can be found in Spicrochaeta thermophila and Geobacillus thermodenitrificans.
  • fructose-6-phosphate was found to generate an activity that is almost twice as high as that on fructose (Table 3). Furthermore, detailed kinetic analysis revealed that the affinity for the phosphorylated acceptor is also much higher, corresponding to a Km of 15 mM instead of 42 mM.
  • the enzyme also prefers sucrose-6'-phosphate over sucrose as substrate in the phosphorolysis reaction. It represents a unique specificity that has never before been described and can be designated as sucrose-6'-phosphate phosphorylase. It is important to note that the phosphate group can only be present on the fructose moiety and not on the glucose moiety (Fig. 6). Indeed, absolutely no activity could be detected with fructose as acceptor and glucose-l,6-bisphosphate as donor.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Enzymes And Modification Thereof (AREA)

Abstract

The present invention relates to the identification, recombinant expression and characterization of a sucrose and sucrose-6'-phosphate phosphorylase of the thermophilic bacterium Thermoanaerobacterium thermosaccharolyticum. The enzyme has an optimal temperature of about 55°C and has a high specificity for its substrates. More importantly, the sucrose and sucrose-6'-phosphate phosphorylase of the present invention has a half-life of at least 60 hours at the industrially relevant temperature of about 60°C. This enzyme is thus -for example-useful for the industrial production of D-fructose,D-fructose-6-phosphate,alpha-D-glucose -1-phosphate or alpha-D-glucosides.

Description

A thermostable sucrose and sucrose-6'-phosphate phosphorylase
Technical field of invention
The present invention relates to the identification, recombinant expression and characterization of a sucrose and sucrose-6'-phosphate phosphorylase of the thermophilic bacterium Thermoanaerobacterium thermosaccharolyticum. The enzyme has an optimal temperature of about 55°C and has a high specificity for its substrates. More importantly, the sucrose and sucrose- 6'-phosphate phosphorylase of the present invention has a half-life of at least 60 hours at the industrially relevant temperature of about 60°C. This enzyme is thus -for example- useful for the industrial production of D-fructose, D-fructose-6-phosphate, alpha-D-glucose -1-phosphate or alpha-D-glucosides.
Background art
Sucrose phosphorylase (SP, E.C. 2.4.1.7) is classified in the a-amylase family (GH-13) and catalyzes the reversible phosphorolysis of sucrose into a-D-glucose-l-phosphate (a-Glc-l-P) and D-fructose 1_ 4. Thanks to its broad acceptor specificity, SP can be employed for the transfer of a glucosyl moiety to a variety of monosaccharides, sugar alcohols and even phenolic compounds. Therefore, SP is a very interesting biocatalyst for the production of a-D-glucosides as industrial fine chemicals 5. For the majority of interesting acceptor molecules however, the transglucosylation activity was found to be rather low and the optimization of reaction conditions is therefore very important in the development of commercial processes 6. One nice example of a carefully designed process is the production of 2-0-(a-D-glucopyranosyl)-sn-glycerol 1. This product is a moisturizing agent for cosmetics and is commercially available under the trade name Glycoin®.
A sucrose-6'-phosphate phosphorylase has not been described before.
To avoid microbial contamination, industrial carbohydrate processes are preferably run at 60 °C or higher. In addition, a higher process yield is usually obtained due to the elevated temperature that not only alleviates solubility and viscosity problems of substrate molecules, but also displaces the equilibrium in a more favourable direction for endothermic reactions 8. Besides better suited for industrial application, thermostable enzymes are also desired for enzyme engineering. Compared to its mesophilic homologues, thermostable enzymes have a higher capacity to evolve because of a higher mutational robustness conferred by the extra stability 9' 10. Unfortunately, SP have so far only been isolated from mesophilic sources 5' 11 with the enzymes originating from Leuconostoc mesenteroides, Bifidobacterium adolescentis and Pelomonas saccharophyla the most extensively described in literature 5' 6. Among the available SPs, the SP from B. adolescentis is the most thermostable isolate today with a half-life time of 12 hours at 60°C 12. This limited thermostability of mesophilic isolates could hamper the commercial exploitation of SP.
However, mesophilic isolates can be stabilized by immobilization or by mutagenesis 13. The SP enzyme from B. adolescentis, for example, has been covalently attached to Sepabeads and prepared as cross-linked enzyme aggregate (CLEAS), resulting in a drastically improved thermostability 12 14. In addition, increasing the stability by mutagenesis is a good alternative, of which two examples are available today. The first one is the SP from Streptococcus mutans, which has been stabilized by the introduction of 8 mutations 1S. Unfortunately, the resulting enzyme variant retains only 60% of its activity after 20 minutes incubation at 60 °C, which is not enough for industrial applications. The second example is a variant of the SP from B. adolescentis containing 6 mutations and whose half-life at the industrially relevant temperature of 60 °C has more than doubled compared to the wild-type enzyme 16.
Although progress has been made in stabilizing industrially important biocatalysts, there is still a need to identify a sucrose phosphorylase that is more stable than the best enzymes available today or to identify other, specific substrates of said phosphorylases such as sucrose-6'-phosphate.
Brief description of figures
Figure 1: Temperature optimum (left) and pH optimum (right) for T. thermosaccharolyticum SP. The activity was assayed using 350 mM substrate in the phosphorolysis reaction and 200 mM substrate in the synthetic reaction.
Figure 2: The kinetic stability of the SP enzymes of Thermoanaerobacterium thermosaccharolyticum and Bifidobacterium adolescentis. The enzymes were incubated at 60°C for various times at a protein concentration of 8.5 μg/mL, after which their residual activity was compared with that of the untreated enzymes. All assays were performed in triplicate and had a coefficient of variation (CV) of <10%.
Figure 3: Temperature of inactivation for 1 hour incubation for the SP enzymes of Thermoanaerobacterium thermosaccharolyticum (TtSP) and Bifidobacterium adolescentis (BaSP). Inactivation was carried out at a protein concentration of 35 μg/mL for both enzymes. Figure 4: Differential scanning fluorometry for Bifidobacterium adolescentis SP (BaSP), Thermoanaerobacterium. thermosaccharolyticum SP (TtSP). The spectrum was recorded at a protein concentration of 400 μg/mL.
Figure 5: Homology model of the Thermobacterium thermosaccharolyticum SP showing the main enzyme-substrate interactions
Figure 6: Structure of sucrose and its phosphorylated derivatives.
Description of invention
In this invention, three putative sucrose phosphorylases (SP) isolated from thermophiles and classified among the a-amylase subfamily 18 were recombinantly expressed in Escherichia coli. Surprisingly, only the enzyme from Thermoanaerobacterium thermosaccharolyticum DSM 571 catalyzes the phosphorolysis of sucrose with an optimal temperature of 55°C. This new enzyme was found to be the most stable SP enzyme so far, with a half-life time of 60 hours at the industrially relevant temperature of 60°C and a half temperature of inactivation (Γ50) of 69°C after 1 hour incubation. In addition, this new SP had a melting temperature of 78.5°C. In contrast to the T. thermosaccharolyticum SP, the putative SPs from Meiothermus silvanus DSM 9946 and Spirochaeta thermophila DSM 6192 did not catalyze the phosphorolysis of sucrose.
In addition, the present invention discloses that the above-described SP enzyme from Thermoanaerobacterium thermosaccharolyticum DSM 571 is much more active on fructose-6- phosphate as acceptor than on free fructose. The latter enzyme has thus a unique specificity that has never been described before and could be designated as a sucrose-6'-phosphate phosphorylase (S6'PP).
Therefore, the present invention relates in first instance to the use of a polypeptide having the amino acid sequence as depicted by SEQ ID N°l as a thermostable sucrose phosphorylase and/or as a thermostable sucrose-6'-phosphate phosphorylase.
The 'amino acid sequence as depicted by SEQ ID N° is the following Thermoanaerobacterium thermosaccharolyticum sucrose phosphorylase (TtSP) protein sequence:
MALKNKVQLITYPDSLGGNLKTLNDVLEKYFSDVFGGVHILPPFPSSGD GFAPITYSEIEPKFGTWYDIKKMAENF DILLDLMVNHVSRRSIYFQDFLKKGRKSEYADMFITLDKLWKDGKPVKGDIEKMFLRRTLPYSTFKIEETGEEEKV WTTFGKTDPSEQIDLDVNSHLV EFLLEVFKTFSN FGVKIV LDAVGYVI KKIGTSCFFVEPEIYEFLDWAKGQAAS YGI ELLLEVHSQFEVQYKLAERGFLIYDFILPFTVLYTLI NKSN EM LYHYLKN RPINQFTM LDCHDGI PVKPDLDGLI D TKKAKEVVDICVQRGAN LSLIYGDKYKSEDGFDVHQI NCTYYSALNCDDDAYLAARAIQFFTPGI PQVYYVGLLAG VN DFEAVKKTKEGREI NRH NYGLKEI EESVQKNVVQRLLKLI RFRNEYEAFNGEFFIEDCRKDEIRLTWKKDDKRCS LFI DLKTYKTTIDYI NENGEEVKYLV
The term 'sucrose-6'-phosphate phosphorylase' refers to an enzyme which catalyzes the reversible phosphorolysis of sucrose-6'-phosphate into a-D-glucose-l-phosphate (a-Glc-l-P) and D-fructose-6- phosphate.
The present invention further relates to the use as described above wherein said amino acid sequence is encoded by the nucleic acid sequence as depicted by SEQ ID N°2 or SEQ ID N°3.
The nucleic acid sequence as depicted by SEQ I D N° 2 is the following Thermoanaerobacterium thermosaccharolyticum sucrose phosphorylase or sucrose-6'-phosphate phosphorylase encoding nucleic acid sequence:
ATGGCACTGAAAAACAAAGTCCAACTGATTACCTATCCGGACAGCCTGGGCGGTAACCTGAAAACCCTGAAT GACGTTCTGGAAAAATATTTCAGCGATGTGTTTGGCGGTGTTCATATCCTGCCGCCGTTCCCGAGCTCTGGT GACCGTGGTTTTGCACCGATTACCTACTCTGAAATCGAACCGAAATTCGGCACGTGGTACGATATTAAGAAA ATGGCTGAAAACTTCGACATCCTGCTGGATCTGATGGTTAATCACGTCAGTCGTCGCTCCATTTACTTTCAGG ACTTCCTGAAAAAAGGCCGCAAAAGTGAATATGCGGATATGTTTATTACCCTGGACAAACTGTGGAAAGATG GCAAACCGGTTAAAGGTGATATCGAAAAAATGTTCCTGCGTCGCACCCTGCCGTACTCCACGTTTAAAATTG AAGAAACCGGTGAAGAAGAAAAAGTCTGGACCACGTTCGGCAAAACGGATCCGTCAGAACAGATCGACCT G G ATGTC A ACTCG C ATCTG GTG CGTG A ATTTCTG CTG G AAGTGTTC AA AACCTTCTC A AACTTCG GTGTG A A AATTGTTCGCCTGGATGCGGTCGGCTATGTGATTAAGAAAATTGGCACGTCGTGCTTTTTCGTTGAACCGGA AATCTACGAATTTCTGGATTGGGCCAAAGGCCAGGCGGCCAGTTATGGTATTGAACTGCTGCTGGAAGTTCA CTCCCAGTTCGAAGTCCAATATAAACTGGCAGAACGTGGCTTTCTGATTTACGATTTCATCCTGCCGTTTACC GTGCTGTATACGCTGATCAACAAAAGTAACGAAATGCTGTACCATTACCTGAAAAACCGCCCGATTAATCAA TTTACCATGCTGGACTGCCACGATGGTATTCCGGTCAAACCGGACCTGGATGGCCTGATCGACACGAAAAAA GCGAAAGAAGTGGTTGATATTTGTGTGCAGCGTGGCGCCAACCTGAGCCTGATCTATGGTGATAAATACAA ATCTGAAGACGGCTTCGATGTTCATCAAATTAACTGCACCTATTACAGCGCTCTGAATTGTGATGACGATGCG TATCTGGCAGCTCGCGCCATTCAGTTTTTCACGCCGGGTATCCCGCAAGTTTATTACGTCGGCCTGCTGGCAG GTGTGAACGATTTTGAAGCTGTGAAGAAAACCAAAGAAGGTCGTGAAATTAACCGCCACAATTACGGCCTG AAAGAAATCGAAGAATCTGTGCAGAAAAATGTCGTGCAACGTCTGCTGAAACTGATCCGTTTCCGCAACGAA TATGAAGCCTTTAATGGCGAATTTTTCATTGAAGACTGCCGTAAAGATGAAATCCGCCTGACCTGGAAAAAA GACGATAAACGCTGTAGCCTGTTTATTGATCTGAAAACCTACAAAACGACGATTGATTACATTAACGAAAAC GGTGAAGAAGTGAAATACCTGGTTTAA
The nucleic acid sequence as depicted by SEQ I D N° 3 is the following Thermoanaerobacterium thermosaccharolyticum sucrose phosphorylase or sucrose-6'-phosphate phosphorylase encoding nucleic acid sequence which, compared to SEQ ID N°2, has been codon optimized for expression in E. coli and comprises a sequence coding for a N-terminal His6-tag (underlined): ATG GGCGGTTCGCACCACCACCACCACCACGG C ATG G CTAG C ATG G C ACTG A A AA AC AA AGTCC A ACTG ATT ACCTATCCGGACAGCCTGGGCGGTAACCTGAAAACCCTGAATGACGTTCTGGAAAAATATTTCAGCGATGTG TTTGGCGGTGTTCATATCCTGCCGCCGTTCCCGAGCTCTGGTGACCGTGGTTTTGCACCGATTACCTACTCTG AAATCGAACCGAAATTCGGCACGTGGTACGATATTAAGAAAATGGCTGAAAACTTCGACATCCTGCTGGATC TGATGGTTAATCACGTCAGTCGTCGCTCCATTTACTTTCAGGACTTCCTGAAAAAAGGCCGCAAAAGTGAAT ATGCGGATATGTTTATTACCCTGGACAAACTGTGGAAAGATGGCAAACCGGTTAAAGGTGATATCGAAAAA ATGTTCCTGCGTCGCACCCTGCCGTACTCCACGTTTAAAATTGAAGAAACCGGTGAAGAAGAAAAAGTCTGG ACCACGTTCGGCAAAACGGATCCGTCAGAACAGATCGACCTGGATGTCAACTCGCATCTGGTGCGTGAATTT CTGCTGGAAGTGTTCAAAACCTTCTCAAACTTCGGTGTGAAAATTGTTCGCCTGGATGCGGTCGGCTATGTG ATTAAGAAAATTGGCACGTCGTGCTTTTTCGTTGAACCGGAAATCTACGAATTTCTGGATTGGGCCAAAGGC CAGGCGGCCAGTTATGGTATTGAACTGCTGCTGGAAGTTCACTCCCAGTTCGAAGTCCAATATAAACTGGCA GAACGTGGCTTTCTGATTTACGATTTCATCCTGCCGTTTACCGTGCTGTATACGCTGATCAACAAAAGTAACG AAATGCTGTACCATTACCTGAAAAACCGCCCGATTAATCAATTTACCATGCTGGACTGCCACGATGGTATTCC GGTCAAACCGGACCTGGATGGCCTGATCGACACGAAAAAAGCGAAAGAAGTGGTTGATATTTGTGTGCAGC GTGGCGCCAACCTGAGCCTGATCTATGGTGATAAATACAAATCTGAAGACGGCTTCGATGTTCATCAAATTA ACTGCACCTATTACAGCGCTCTGAATTGTGATGACGATGCGTATCTGGCAGCTCGCGCCATTCAGTTTTTCAC GCCGGGTATCCCGCAAGTTTATTACGTCGGCCTGCTGGCAGGTGTGAACGATTTTGAAGCTGTGAAGAAAA CCAAAGAAGGTCGTGAAATTAACCGCCACAATTACGGCCTGAAAGAAATCGAAGAATCTGTGCAGAAAAAT GTCGTGCAACGTCTGCTGAAACTGATCCGTTTCCGCAACGAATATGAAGCCTTTAATGGCGAATTTTTCATTG AAGACTGCCGTAAAGATGAAATCCGCCTGACCTGGAAAAAAGACGATAAACGCTGTAGCCTGTTTATTGATC TGAAAACCTACAAAACGACGATTGATTACATTAACGAAAACGGTGAAGAAGTGAAATACCTGGTTTAA
The invention further relates to the use as described above wherein said amino acid sequence is depicted by SEQ ID N°4.
The amino acid sequence as depicted by SEQ I D N° 4 is the following Thermoanaerobacterium thermosaccharolyticum sucrose phosphorylase or sucrose-6'-phosphate phosphorylase amino acid sequence which, compared to SEQ ID N° 1, comprises a N-terminal His6-tag (underlined): MGGSHHHHHHGMASMALKNKVQLITYPDSLGGNLKTLNDVLEKYFSDVFGGVHILPPFPSSGD GFAPITYSEIE PKFGTWYDIKKMAENFDILLDLMVNHVSRRSIYFQDFLKKGRKSEYADMFITLDKLWKDGKPVKGDIEKMFLRRT LPYSTFKIEETGEEEKVWTTFGKTDPSEQIDLDVNSHLVREFLLEVFKTFSNFGVKIVRLDAVGYVIKKIGTSCFFVEP EIYEFLDWAKGQAASYGIELLLEVHSQFEVQYKLAERGFLIYDFILPFTVLYTLINKSNEMLYHYLKNRPINQFTMLD CHDGIPVKPDLDGLIDTKKAKEVVDICVQRGANLSLIYGDKYKSEDGFDVHQINCTYYSALNCDDDAYLAARAIQF FTPGIPQVYYVGLLAGVNDFEAVKKTKEGREINRHNYGLKEIEESVQKNVVQRLLKLIRFRNEYEAFNGEFFIEDCR KDEIRLTWKKDDKRCSLFIDLKTYKTTIDYINENGEEVKYLV
The present invention relates to the use as described above wherein said thermostability means that said sucrose phosphorylase or said sucrose-6'-phosphate phosphorylase has, during a phosphorolysis or synthesis reaction at a pH between 5.0 and 7.5 and a temperature between 50°C and 70°C, a half-life of at least 20 hours. The term 'thermostability' thus means that the sucrose phosphorylase or sucrose-6'-phosphate phosphorylase of the present invention has, during a phosphorolysis or synthesis reaction as described elsewhere in the present disclosure, at a pH of 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1, 7.2, 7.3, 7.4, or, 7.5, and, at a temperature of 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 or 70 °C, a half-life of 20, 21, 22, 25, 30, 35, 40,..., 45,..., 50, 55,..., 60, 61, 62, 63,..., 70,...75,...80, 81, 82, 83, or more hours. More specifically, the present invention relates to the use as described above wherein said thermostability means that said sucrose phosphorylase or sucrose-6'-phosphate phosphorylase has, during a phosphorolysis or synthesis reaction at an enzyme concentration of about 8.5 μg/ml, at a pH between 6.0 and 6.5 and at a temperature of about 60°C, a half-life of at least 60 hours. The latter thermostability thus specifically means that that the sucrose phosphorylase or sucrose-6'-phosphate phosphorylase of the present invention has, during a phosphorolysis or synthesis reaction as described elsewhere in the present disclosure, and at an enzyme concentration of 8.0, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9 or 9.0 μg/ml, at a pH of 6.0, 6.1, 6.2, 6.3, 6.4 or 6.5 and at a temperature of 55, 56, 57, 58, 59, 60, 61, 62, 63, 64 or 65 °C, a half-life of 60, 61, 62, 63, 64, 65,..., 70,...75,...80, 81, 82, 83, 84, 85, or more hours.
The 'thermostability' of the enzyme of the present invention can be determined by any method known in the art. More specific enzyme assays, such as enzyme activity assays, determinations of the temperature optimum of the enzymes, the influence of pH on enzyme activity, determination of the kinetic temperature stability and the determination of the thermodynamic stability of the enzyme of the present invention are described elsewhere in the present disclosure.
The present invention further relates to the use as described above wherein said polypeptide has an amino acid sequence which is at least 90% identical to the amino acid sequence as depicted by SEQ ID N°l or wherein said polypeptide is a fragment of the amino acid sequence as depicted by SEQ ID N°l. More specifically, the present invention relates to the use as described above wherein said variant or fragment comprises the amino acid regions 45-56, 131-207, 236-310 and 340-358 of SEQ ID N°l.
The present invention further discloses that the amino acid histidine (=1-1 or His) on amino acid position 344 of SEQ ID N° 1 is important for the enzyme's activity on fructose-6-phosphate as acceptor. The present invention relates to the use as described above wherein said variant or fragment phosphorolyzes sucrose-6'-phosphate and comprises the amino acid histidine at amino acid position 344. The term 'fragment' refers to a protein (or peptide or polypeptide) containing fewer amino acids than the amino acid sequence as depicted by SEQ ID N° 1 and that retains said sucrose phosphorylase- or sucrose-6'-phosphate phosphorylase activity. Such fragment can -for example- be a protein with a deletion of 10% or less of the total number of amino acids at the C- and/or N-terminus. More specifically, said fragment comprises the amino acid regions 45-56, 131- 207, 236-310 and 340-358 of SEQ ID N°l or comprises the amino acid histidine at amino acid position 344 of SEQ ID N° 1. The term "variant" refers to a protein having at least 90 % sequence identity (i.e. having at least 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity) with SEQ ID N° 1 and that retains said sucrose phosphorylase- or sucrose-6'-phosphate phosphorylase activity. More specifically, said variant comprises the amino acid regions 45-56, 131-207, 236-310 and 340-358 of SEQ ID N°l or comprises the amino acid histidine at amino acid position 344 of SEQ ID N° 1.
The percentage of amino acid sequence identity is determined by alignment of the two sequences and identification of the number of positions with identical amino acids divided by the number of amino acids in the shorter of the sequences x 100. Typically the latter 'variant' may differ from the protein as depicted by SEQ ID N° 1 only in conservative substitutions and/or modifications, such that the ability of the protein to have sucrose phosphorylase- or sucrose-6'-phosphate phosphorylase activity is retained. A "conservative substitution" is one in which an amino acid is substituted for another amino acid that has similar properties, such that one skilled in the art of protein chemistry would expect the nature of the protein to be substantially unchanged. In general, the following groups of amino acids represent conservative changes: (1) ala, pro, gly, glu, asp, gin, asn, ser, thr; (2) cys, ser, tyr, thr; (3) val, ile, leu, met, ala, phe; (4) lys, arg, his; and (5) phe, tyr, trp, his.
Variants may also (or alternatively) be proteins as described herein modified by, for example, the deletion or addition of amino acids that have minimal influence on the sucrose phosphorylase- or sucrose-6'-phosphate phosphorylase activity as defined above, secondary structure and hydropathic nature of the enzyme. Furthermore, the term variants also refers to any glycosylated protein or fragments thereof as described above.
The present invention further relates to a method to produce D-fructose, D-fructose-6-phosphate and/or alpha-D-glucose -1-phosphate at a temperature above 50°C (i.e. 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 or 70°C) comprising: i) contacting a polypeptide as defined above with sucrose or sucrose-6'-phosphate and inorganic phosphate, ii) phosphorolyse sucrose or sucrose-6'-phosphate to obtain D-fructose, D-fructose-6-phosphate and/or alpha-D- glucose -1-phosphate, and iii) purifying said D-fructose, D-fructose-6-phosphate and/or alpha-D- glucose -1-phosphate.
Specific but non-limiting embodiments of the above-cited method are described elsewhere in the present disclosure. Alternatively, the present invention also relates to a method to produce an alpha-D-glucoside at a temperature above 50°C (i.e. 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 or 70°C)comprising: i) contacting a polypeptide as defined above with either alpha-D-glucose -1- phosphate, sucrose or sucrose-6'-phosphate as donor and an appropriate acceptor such as a monosaccharide, a phosphorylated monosaccharide, an aliphatic or aromatic alcohol, a furanone, a flavanoid or a phenolic compound, ii) glycosylating said monosaccharide, phosphorylated monosaccharide, aliphatic or aromatic alcohol, furanone, flavanoid or phenolic compound to obtain an alpha-D-glucoside, and iii) purifying said alpha-D-glucoside.
More specifically, the present invention relates to a method as described above wherein said acceptor is L-sorbose, D-fructose, D-fructose-6-phosphate, D-psicose, D-tagatose, D-glucose, ascorbic acid, hexanol, catechol, pyridoxine, catechin, quercetin, glycerol, vanillin or 4-hydroxy-2,5- dimethyl-3(2H)- furanone (= furanone HDMF). Specific but non-limiting embodiments of the above-cited method are described elsewhere in the present disclosure.
The present invention also relates to an isolated amino acid sequence as depicted by SEQ ID N°4 and an isolated nucleic acid sequence as depicted by SEQ ID N°3. The term 'nucleic acid' as used herein corresponds for example to DNA, cDNA, NA, sense and anti- sense nucleic acids and the like. Said nucleic acids can be incorporated in appropriate vectors such as plasmids and appropriate host cells such as Escherichia can be transfected with said vectors. The present invention further relates to the use of a microorganism expressing a polypeptide having the amino acid sequence as depicted by SEQ ID N°l or SEQ ID N°4 to provide a thermostable sucrose phosphorylase or a thermostable sucrose-6'-phosphate phosphorylase. The latter microorganism can be any microorganism known in the art but specifically relates to the thermophilic bacterium Thermoanaerobacterium thermosaccharolyticum or to the bacterium Escherichia coli.
The present invention further relates to a method to produce an alpha-D-glucoside comprising: i) contacting a polypeptide as defined above with either alpha-D-glucose -1-phosphate, sucrose or sucrose-6'-phosphate as donor and an appropriate acceptor, ii) glycosylating said acceptor to obtain an alpha-D-glucoside, and iii) purifying said alpha-D-glucoside, wherein said glycosylation is carried out in a two-phase system with an organic solvent phase containing the acceptor and an aqueous buffer phase containing said polypeptide as defined above and said donor. The term 'a two-phase system' relates to any two-phase system described in the art such as for example described in the work of Vulfson17 and Carrea 18.The term 'organic phase' relates to a phase wherein for example ethyl acetate, n-butyl acetate, methyl ieri-butyl ether, diethyl ether, pentane, hexane or octane is present as solvent and further contains the acceptor molecule (for example at a concentration of 1-500 g/L). The term 'aqueous buffer phase' contains the enzyme of the present invention (for example at a concentration of 0.1-500 U mL"1) and donor substrate (for example at a concentration of 0.05-3 M). The latter method can take place at temperature between 30 and 70 °C, at a pH between 6 and 9, and the ratio between the aqueous and organic (solvent) phase can be between 0.01 and 100.
The present invention specifically relates to a method as described above wherein said acceptor is a non-carbohydrate acceptor (i.e. any appropriate acceptor which is not a carbohydrate), and more specifically to a method as describe above wherein said non-carbohydrate acceptor is cinnamyl alcohol, geraniol, propyl gallate, ethyl gallate, resorcinol, pyrogallol, saligenin or methyl gallate.
The present finally relates to the use as described above wherein said amino acid sequence is encoded by the nucleic acid sequence as depicted by SEQ ID N°2 or SEQ ID N°3. The present invention will further be illustrated by the following non-limiting examples.
Examples
A. Materials and methods Sequence analysis All the available full length protein sequences to date classified in family GH13 subfamily 18 were extracted from the CAzy database (URL: http://www.cazy.org/) 19 and aligned using ClustalW2. The extracted sequences were subjected to a pair wise and slow alignment using the Gonnet protein weight matrix with a gap opening of 10, a gap extension of 0.2 and a gap distance of 5. The neighbor joining algorithm was used to cluster and to build a non-rooted tree. Finally the tree was visualized using Mega 4.0 20 and rooted on the midpoint.
Enzyme production and purification
The new SP genes were codon optimized for Escherichia coli and chemically synthesized by GenScript (Piscataway, NJ, USA) including a sequence coding for a N-terminal His6-tag and the EcoRI restriction site (underlined) at the 5' prime end (GAATTCGGAGGAAACAAAGATGGGCGGTTCGCACCACCACCAC CACCACGGCATGGCTAGC = SEQ ID N°5) and a Pstl restriction site at the 3' prime end. Next the synthetic genes were cloned into the constitutive expression vector pCXP34h 11 using the respective restriction endonucleases. The resulting expression plasmids were transformed in E. coli CGSC 8974. In addition, for the SP from B. adoloscentis, the expression plasmid constructed in 11 was used. For enzyme production, 2 % of an overnight culture was inoculated in 500 mL LB medium containing 100 μg/mL ampicillin in a 2 L shake flask and incubated at 37 °C with continuous shaking at 200 rpm for 6 hours. The produced biomass was harvested by centrifugation for 15 minutes at 12000 x g and 4 °C, washed with 50 mL PBS buffer (300 mM NaCI and 50 mM NaH2P04 at pH 8) and the obtained cell pellets were stored at -20 °C. The cell pellets were then thawed and dissolved in 20 mL lysis buffer (300 mM NaCI, 10 mM imidazole , 0.1 mM PMSF and 50 mM NaH2P04 at pH 8) supplemented with lysozyme and DNasel in a final concentration of 1 mg/mL and 6 mU/mL, respectively. This cell suspension was incubated on ice for 30 minutes and sonicated 3 times for 2.5 minutes (Branson sonifier 250, level 3, 50 % duty cycle). The His6-tagged proteins were purified by Ni-NTA chromatography as described by the supplier (Qiagen), after which the buffer was exchanged to 50 mM MOPS pH 7 in a Centricon YM-30 (Millipore). The protein content was analyzed measuring the absorbance at 280 nm. The extinction coefficients for the His6-tagged proteins were calculated using the Protparam tool on the expasy server (URL: http://web.expasy.org/protparam/).
Enzyme assays and enzyme characterization The enzyme activity has been measured in both directions of the equilibrium reaction using a discontinuous assay. Initial reaction rates for the phosphorolysis of sucrose were measured by quantifying the release of fructose using the bicinchoninic acid (BCA) assay and the release of inorganic phosphate from a-glucose-l-phosphate was monitored in the synthetic direction using the phosphomolybdate assay like described before 6. First the temperature optimum was determined in the phosphorolytic direction using 350 mM sucrose and 350 mM sodium phosphate buffer at pH 6.5 in a range from 40 to 70 °C. Reactions were monitored for 15 min in a heating block with sampling at regular intervals. Inactivation of the samples occurred by the alkaline environment of the assay solution.
The influence of pH on enzyme activity was measured in the range of pH 4.5 to 8 using acetate (pH 4.5), MES (pH 5.0 - 6.5) and MOPS (pH 7 - 8)) buffers with a concentration of 50 mM. The pH of the substrate solutions was set at the temperature of measurement with NaOH or HCI. The apparent kinetic parameters for sucrose as well as a-Glc-l-P as donor and for inorganic phosphate and fructose as acceptor were determined at optimal pH and temperature. The parameters were calculated by non-linear regression of the Michaelis-Menten equation using Sigma Plot 11.0. The specificity toward different putative acceptors (Table 3) of reducing and non-reducing nature was analyzed in assays of 30 min with the phosphate and BCA assay, respectively, using 100 mM donor and 200 mM acceptor at pH 6.5 and 55°C. However, to improve the solubility of the hydrophobic acceptors, 25 % (v/v) DMSO was added to the reaction mixture and acceptor was added up to the solubility barrier, not exceeding 200 mM. The kinetic temperature stability was examined by incubating purified enzyme (35 μg/mL) for 1 h in a gradient thermocycler (Biometra, Goettingen, Germany) set to a temperature range of 57 - 73°C, followed by 15 min cooling to 16°C. The residual activity of the enzyme was determined in the phophorolytic direction using the standard conditions described above. In addition the half life time (tso), was evaluated by incubating purified enzyme (8.5 μg/mL) in a water bath at 60 °C with sampling at regular time intervals. The residual activity was then measured and compared to the activity of the untreated enzyme.
The thermodynamic stability was measured using differential scanning fluorimetry (DSF) 21 in a Rotor-Gene Q cycler with HRM channel (Qiagen). For optimal results 10 μg purified protein was used with 1.25 μΙ SYPRO Orange (400x diluted) (Sigma-Aldrich) in 25 μί. The gain was optimized before the temperature increase was started. The temperature increases from 35°C to 95°C, rising 1°C each step in 5 s steps. The fluorescent signal is detected at 510 nm with the green detection filter and the excitation occurs at 460 nm with a HRM lamp. The melting temperature (Tm) (inflection point of melt curve) is determined by calculating the maximum of the first derivative of the melt curve using the Rotor-Gene Q software (Qiagen).
Homology modeling and mutagenesis A homology model was generated with the YASARA software (YASARA biosciences, Vienna) using 1R7A, 2GDV and 2GDU of the closely related SP from B. adolescenstis as model templates 22' 23. The structure was visualized with PyMol 1.2 (DeLano Scientific LLC). Selected positions were mutated following a modified two-stage megaprimer-based whole-plasmid PCR method, as described previously 36. The constructs were subjected to nucleotide sequencing (AGOWA sequence service, Berlin) to confirm that the correct mutations had been introduced, and to exclude the presence of undesirable mutations. The mutated genes were then expressed, purified and characterized as described for the wild-type enzyme.
Enzymatic glucosylation of non-carbohydrate acceptors The glucosylation of various non-carbohydrate acceptors was carried out at 100 mL scale in magnetically stirred reaction vessels. To that end, a two-phase system was used with either ethyl acetate, n-butyl acetate, methyl ieri-butyl ether, diethyl ether, pentane, hexane or octane as organic phase containing the acceptor molecule (1-500 g L 1), and an aqueous buffer system containing the enzyme (0.1-500 U mL"1) and donor substrate (0.05-3 M). The temperature was varied between 30 and 70 °C, the pH between 6 and 9, and the ratio between the aqueous and solvent phase between 0.01 and 100. After 24 h, samples were taken and subjected to HPLC analysis. Separation was achieved using a Waters X-bridge amide column (250 x 4.6 mm, 3.5 μιτι) with milliQ water (solvent A) and acetonitrile (solvent B), both containing 0.2 % triethylamine, as the mobile phase. The flow rate and temperature were set at 1.0 mL min"1 and 30 °C, respectively. The gradient elution was as follows: 95 % of solvent A (0 - 12 min), 5 to 25 % solvent B (12 - 15 min), 25 % solvent B (15 - 40 min), 25 to 5 % solvent B (40 - 41 min) and 95 % solvent A (41 - 50 min). Adequate detection was obtained with an Alltech 2000ES evaporative light scattering detector (ELSD).
B. Results
Selection of thermostable sequences To obtain a better understanding in the genetic diversity of SP, a phylogenetic tree was constructed from all the putative SP genes classified in the a-amylase family subfamily 18 (GH13-18). So far, there is only one specificity demonstrated for this subfamily, i.e. the phosphorolysis of sucrose 4. Currently, around 250 sequences have been assigned as putative SPs originating from about 115 bacterial species. To date no putative SP genes could be identified in archaea or eukaryotes (URL: www.cazy.org/). Genes classified among subfamily 18 are found in a genetic diverse group of microorganisms like lactic acid bacteria (25% of the sequences), soil and marine bacteria, inhabitants of the gastro-intestinal tract and even in cyanobacteria.
From the 115 different species harboring a (putative) SP gene, 8 of them grow with optimal temperatures between 55 and 67.5 °C (Table 1). From the family Thermaceae, putative SP sequences from 4 different species are available and they are 555 to 588 AA in length and phylogenetically related. Besides members from the Thermaceae family, two sequences originating from Thermoanaerobacterium are classified in GH13-18 (Table 1) and they are for 91 % identical. The sequences are 488 AA long and they are most related to SPs from lactic acid bacteria which are extensively described in literature. Furthermore a putative SP can be found in Spicrochaeta thermophila and Geobacillus thermodenitrificans.
Table 1. Putative SP sequences from thermophilic sources
Organism Uniprot ID Growth Reference temperature5 (°C)
Thermaceae 24
Marinithermus hydrothermalis DSM 14884 AEB11435.1* 50-72.5 (67.5)
25
Meiothermus ruber DSM 1279 D3PQE0 35-70 (60)
26
Meiothermus silvanus DSM 9946 D7BAR0 40-65 (55)
27
Oceanithermus profundus DSM 14977 E4U9 0 40-68 (60)
Thermoanaerobacterales Family III. Incertae
Sedis
28
Thermoanaerobacterium D9TT09 45-70 (60)
thermosaccharolyticum DSM 571
28
Thermoanaerobacterium xylanolyticum LX-11 AEF16977.1* 45-70 (60)
Spirochaetaceae
29
Spirochaeta thermophila DSM 6192 E0RTJ0 40-73 (66)
Bacillaceae
30
Geobacillus thermodenitrificans NG80-2 A4ITA6 45-73 (65)
* Genbank identifier
$ Optimal growth temperature is given between brackets
Selected sequences are in bold
Determination of substrate specificity
Three genetically diverse GH13-18 enzymes originating from the thermophiles Meiothermus silvanus DSM 9946 (MsSP), Spirochaeta thermophila DSM 6192 (StSP) and Thermoanaerobacterium thermosaccharolyticum DSM 571 (TtSP) were selected for recombinant expression. To that end, their genes were chemically synthesized with a codon usage that is optimal for the host strain E. coli. Furthermore, a N-terminal His-tag was also added, which allowed their purification in a single- step by means of affinity chromatography.
First, the purified enzymes were assayed for phosphorolytic activity on different a-linked disaccharides existing of a glucose moiety connected to either a fructose or glucose moiety. Surprisingly, only the enzyme from T. saccharolyticum could catalyze the phosphorolysis of sucrose. In contrast, the isolates from S. thermophila and M. silvanus did not phosphorolyze any of the selected dissacharides with a significant activity. Changing the reaction pH in the range of 4.5 to 8 or adding CaCI2 or MgCI2 as cofactors (0.1-10 mM) did not help to phosphorolyze sucrose. Therefore the latter enzymes (StSP and MsSP) cannot be assigned as sucrose phosphorylases, and must thus represent a new specificity that has not yet been identified. This shows that enzyme annotations based on sequence alignments are merely predictions that cannot be taken for granted. Indeed, activity measurements can still yield surprising results and reveal unexpected patterns in substrate profiles. Determination of kinetic parameters of the SP of T. thermosaccharolyticum
Since no phosphorolysis of sucrose could be demonstrated for the enzymes from S. thermophila and M. silvanus, only the SP from T. thermosaccharolyticum was studied in detail. First the optimal temperature was determined and found to be 55°C for TtSP (Figure 1). Unexpectedly, this enzyme had a broad temperature optimum in the range of 45 to 65°C (> 80% relative activity) and has a substantial higher optimal temperature than the SP enzymes isolated from lactic acid bacteria or Pelomonas for example, which have an optimal temperature between 30 and 37 °C 5. On the other hand the optimal temperature of the SP from B. adolescentis, which is astonishingly high for a mesophilic isolate (58°C), is comparable with the T. thermosaccharolyticum isolate 12.
Next the influence of the pH on the phosphorolysis and synthesis reaction was investigated in a range between 4.5 and 8 (Figure 1). For both reactions, the optimum was pH 6.5, but for the synthesis reaction pH 6 nearly had the same maximal activity. This result is in good agreement with other characterized mesophilic homologues which all had an optimal pH between 6 and 7 5.
The apparent kinetic parameters have been determined for donor and acceptor in both directions at pH 6.5 and 55°C (Table 2) Surprisingly, TtSP has a somewhat higher Km of 76.5 ± 10.3 mM for sucrose than what is typically expected for a SP, i.e. between 1 and 15 mM for mesophilic isolates 6. On the other hand, the Km for a-Glc-l-P and inorganic phosphate is in the same range as previously reported for other SPs 31. In terms of catalytic turnover, TtSP has a kcat of around 60 s"1 and this is in the same range as the most efficient SP enzymes like those from Leuconostoc mesenteroides ATTC 12291 and B. adolescentis 6.
Table 2. Apparent kinetic parameters for Thermoanaerobacterium thermosaccharolyticum SP (TtSP). Michaelis Menten curves were obtained using 11 levels of varying substrate concentration together with 350 mM of co-substrate in the phophorolytic direction and 200 mM of co-substrate in the synthetic direction at 55°C and pH 6.5.
Enzyme Varying substrate Km (mM) kcat is 1) kcat/Km TtSP Sucrose 76.5 ± 10.3 66.2 ± 4.5 0.87
Phosphate 6.9 ± 0.6 59.3 ± 3.1 8.82
a-Glc-lP 15.6 ± 1.8 12.4 ± 0.7 0.79
Fructose 41.6 ± 5.3 19.1 ± 1.3 0.45
Activity on alternative acceptor substrates
Because the affinity of TtSP for fructose is rather low, alternative acceptors were also tested. Interestingly, fructose-6-phosphate was found to generate an activity that is almost twice as high as that on fructose (Table 3). Furthermore, detailed kinetic analysis revealed that the affinity for the phosphorylated acceptor is also much higher, corresponding to a Km of 15 mM instead of 42 mM. The enzyme also prefers sucrose-6'-phosphate over sucrose as substrate in the phosphorolysis reaction. It represents a unique specificity that has never before been described and can be designated as sucrose-6'-phosphate phosphorylase. It is important to note that the phosphate group can only be present on the fructose moiety and not on the glucose moiety (Fig. 6). Indeed, absolutely no activity could be detected with fructose as acceptor and glucose-l,6-bisphosphate as donor.
As widely known, SP is a promiscuous enzyme that is able to transfer a glucose moiety from either sucrose or a-Glc-l-P to various alternative acceptors, al beit a reduced rate 6. The acceptor specificity of TtSP was, therefore, tested with different monosaccharides, sugars alcohols and non- carbohydrate molecules. As found for other SPs, the monosaccharide /.-sorbose is the best alternative acceptor for TtSP and generates an activity that is almost half of that of the wild-type reaction. In contrast, D-psicose and D-tagatose generate a 10-fold lower transglucosylation rate, while D-galactose and D-mannose are almost not accepted. The transglucosylation efficiency is also pretty high with glycerol (a sugar alcohol), whereas activity towards non-carbohydrate acceptors is low but in the same order as with other SP enzymes (2).
Table 3. Transglucosylation activity of TtSP. D-Psicose* 1.7 Catechol5 0.4
D-Tagatose* 2.6 Pyridoxine* 0.7
/.-Sorbose* 9.9 Catechin$ 0.1
D-Glucose* 0.3 Quercetin$ 0.1
D-mannose* 1.5 Glycerol* 3.1
D-Galactose* 1.2 furanone HDMF$ 0.1
ascorbic acid* 0.3 vanillin5 0.5
* 100 mM a-Glc-l-P as donor and 200 mM acceptor in 50 mM MES, pH 6.5 and 55°C.
$ 100 mM sucrose as donor and 200 mM acceptor in 50 mM MES, pH 6.5 and 25 % (v/v) DMSO at
55°C.
Enzymatic synthesis of glycosides
Surprisingly, the use of a two-phase system allowed the efficient glucosylation of a wide range of non-carbohydrate acceptors (Table 4). These reactions were first evaluated with 10 U mL"1 SP at pH 7, using ethyl acetate used as second phase in a 1:1 ratio. The yields were then optimized by varying the concentration of sucrose (0.05-3 M), acceptor (1-500 g L 1) and the reaction temperature (30-70 °C). All of these parameters were found to significantly influence glucosylation yields, with optima at 2 M sucrose, 100 g L"1 acceptor and 50 °C. Next, the pH of the aqueous phase was varied, revealing an optimum at pH 7.5. Finally, different solvents were tested, but none of these performed significantly better than ethyl acetate, which gave the highest yields when buffer was added at a ratio of 5:3.
Optimal activities were thus observed with ethyl acetate containing 100 g L"1 acceptor as organic phase, and a buffer at pH 7.5 containing SP and 2 M sucrose as aqueous phase. Both phases were mixed at a ratio of 5:3 and incubated at 50 °C (Table 4). After several hours, glycosylated products could clearly be observed by HPLC. At the end of the reactions, yields in the range of 60 % were obtained for ethyl and propyl gallate, and the yields even went up to 70-80 % for resorcinol and pyrogallol. However, the highest glucosylation yields were observed when using saligenin (97%) and methyl gallate (98%) as acceptor. Moreover, the concentration of the produced glycosides is well within the industrial relevant range (35-85 g L"1). Although the yields with cinnamyl alcohol and geraniol are rather low due to the use of the pure acceptor as solvent phase, more than reasonable product concentrations of 41 and 61 g L"1, respectively, were achieved. Table 4. Production of glycosides with TtSP
Determination of thermostability of the SP of T. thermosaccharolyticum The influence of the temperature on the stability was determined for the TtSP enzyme and compared to currently the most stable SP enzyme, isolated from B. adolescentis (BaSP). The kinetic stability, i.e. the length of time a protein remains active before undergoing irreversible denaturation 32, was assessed using two measures. First, the half-life (t50) at the industrially relevant temperature of 60°C was evaluated and was found to have increased almost 3-fold for TtSP (60 h) compared to BaSP (21h) (Figure 2). Similarly, the half temperature of inactivation (Γ50) after 1 hour incubation was found to be 3°C higher for TtSP (69°C) than for BaSP (66°C) (Figure 3). In addition, the enzyme's thermodynamic stability, i.e. the tendency of a protein to reversibly unfold 32, was evaluated using differential scanning fluorimetry. In contrast to the kinetic stability, the two SP enzymes were found to have a similar thermodynamic stability, corresponding to a melting temperature (Tm) of about 78°C (Figure 4). Structural analysis of the SP of T. thermosaccharolyticum
To identify crucial residues in the structure of TtSP, a homology model was constructed using the crystal structure (2GDU) of the closely related SP from B. adolescentis as template 11. From the 488 target residues 441 were aligned to template residues (90.4%). Among these aligned residues, the sequence identity is 39.5% and the sequence similarity is 60.8%. The unaligned residues comprising 13 loops were modeled with the YASA A software. From the final model (Figure 5), Aspl97 can be assigned as the catalytic nucleophile, Glu238 as the catalytic acid-base and Asp296 as the transition state stabilizer (11). In addition, two aromatic residues are known to interact with the sugar moiety in the donor subsite, i.e. the hydrophobic platform Phel57 33 and the hydrophobic sandwich Phe52 34.
All of the residues that are found here to make up the enzyme's active site are located on either the a-helix 236-245 or on the loops 45-56, 131-166, 184-207, 279-310 and 340-358. These regions must thus be considered to be crucial for the enzyme's activity. For example, the significance of Asp342 for the binding of fructose has already been demonstrated 3S, while His240 and Gln345 are seen here to form a hydrogen bond with the C3-OH and C3/6-OH of fructose, respectively. In addition, His344 and Argl35 were found to be crucial for the binding of phosphate groups, since mutating these to alanine resulted in a dramatic decrease in phosphorolytic activity. Furthermore, a multiple sequence alignment revealed that His344 is replaced by a tyrosine in all other sucrose phosphorylases, and introducing the corresponding mutation in TtSP resulted in a loss of preference for fructose-6-phosphate over fructose as acceptor substrate. This position thus plays a pivotal role in determining the enzymes' specificity.
Taken together, sucrose phosphorylase is a promising biocatalyst for the production of a- glucosides. For the commercial exploitation of its transglucosylation potential, however, thermostable respresentatives are desired. In this invention, the SP from the thermophilic organism T. thermosaccharolyticum is described. Determination of the enzymatic properties revealed that this enzyme is the most stable SP yet reported, with a half-life of 60 hours at 60°C. Inspection of its acceptor promiscuity showed a similar pattern as for other SP enzymes 6, reflecting the industrial potential of this new biocatalyst. References
1. B. Henrissat, Biochemical Journal, 1991, 280, 309-316.
2. B. Henrissat and A. Bairoch, Biochemical Journal, 1996, 316, 695-696.
3. B. O. Kagan, S. n. Latker and E. M. Zfasman, Biokhimiya, 1942, 7, 93-108.
4. M. R. Stam, E. G. J. Danchin, C. Rancurel, P. M. Coutinho and B. Henrissat, Protein Engineering Design & Selection, 2006, 19, 555-562.
5. C. Goedl, T. Sawangwan, P. Wildberger and B. Nidetzky, Biocatal. Biotransform, 2010, 28,
10-21.
6. D. Aerts, T. F. Verhaeghe, B. I. Roman, C. V. Stevens, T. Desmet and W. Soetaert, Carbohydrate Research, 2011, 346, 1860-1867.
7. C. Goedl, T. Sawangwan, M. Mueller, A. Schwarz and B. Nidetzky, Angewandte Chemie- International Edition, 2008, 47, 10086-10089.
8. G. D. Haki and S. K. Rakshit, Bioresource Technology, 2003, 89, 17-34.
9. S. Bershtein, K. Goldin and D. S. Tawfik, Journal of Molecular Biology, 2008, 379, 1029-1044. 10. J. D. Bloom, S. T. Labthavikul, C. R. Otey and F. H. Arnold, Proc. Natl. Acad. Sci. U. S. A., 2006,
103, 5869-5874.
11. D. Aerts, T. Verhaeghe, M. De Mey, T. Desmet and W. Soetaert, Engineering in Life Sciences, 2011, 11, 10-19.
12. A. Cerdobbel, T. Desmet, K. De Winter, J. Maertens and W. Soetaert, J. Biotechnol., 2010,
150, 125-130.
13. L. D. Unsworth, J. van der Oost and S. Koutsopoulos, Febs Journal, 2007, 274, 4044-4056.
14. A. Cerdobbel, K. De Winter, T. Desmet and W. Soetaert, Biotechnol. J., 2010, 5, 1192-1197.
15. K. Fujii, M. liboshi, M. Yanase, T. Takaha and T. Kuriki, Journal of applied glycoscience, 2006,
53, 91-97.
16. A. Cerdobbel, K. De Winter, D. Aerts, R. K. P. Kuipers, H. J. Joosten, W. Soetaert and T.
Desmet, Protein Eng., Des. Sel., 2011, submitted.
17. E. N. Vulfson, R. Patel and B. A. Law, Biotechnology Letters, 1990, 12, 397-402.
18. G. Carrea and P. Cremonesi, Methods in Enzymology, 1987, 136, 150-157.
19. B. L. Cantarel, P. M. Coutinho, C. Rancurel, T. Bernard, V. Lombard and B. Henrissat, Nucleic Acids Research, 2009, 37, D233-D238.
20. K. Tamura, J. Dudley, M. Nei and S. Kumar, Molecular Biology and Evolution, 2007, 24, 1596- 1599.
21. F. H. Niesen, H. Berglund and M. Vedadi, Nature Protocols, 2007, 2, 2212-2221. 22. O. Mirza, L. K. Skov, D. Sprogoe, L. A. M. van den Broek, G. Beldman, J. S. Kastrup and M. Gajhede, . Biol. Chem., 2006, 281, 35576-35584.
23. D. Sprogoe, L. A. M. van den Broek, O. Mirza, J. S. Kastrup, A. G. J. Voragen, M. Gajhede and L. K. Skov, Biochemistry, 2004, 43, 1156-1162.
24. Y. Sako, S. Nakagawa, K. Takai and K. Horikoshi, International Journal of Systematic and Evolutionary Microbiology, 2003, 53, 59-65.
25. B. J. Tindall, J. Sikorski, S. Lucas, E. Goltsman, A. Copeland, T. G. Del Rio, M. Nolan, H. Tice, J.
F. Cheng, C. Han, S. Pitluck, K. Liolios, N. Ivanova, K. Mavromatis, G. Ovchinnikova, A. Pati, R. Fahnrich, L. Goodwin, A. Chen, K. Palaniappan, M. Land, L. Hauser, Y. J. Chang, C. D. Jeffries, M. Rohde, M. Goker, T. Woyke, J. Bristow, J. A. Eisen, V. Markowitz, P. Hugenholtz, N. C.
Kyrpides, H. P. Klenk and A. Lapidus, Standards in Genomic Sciences, 3, 26-36.
26. J. Sikorski, B. J. Tindall, S. Lowry, S. Lucas, M. Nolan, A. Copeland, T. G. Del Rio, H. Tice, J.-F.
Cheng, C. Han, S. Pitluck, K. Liolios, N. Ivanova, K. Mavromatis, N. Mikhailova, A. Pati, L. Goodwin, A. Chen, K. Palaniappan, M. Land, L. Hauser, Y.-J. Chang, C. D. Jeffries, M. Rohde, M. Goeker, T. Woyke, J. Bristow, J. A. Eisen, V. Markowitz, P. Hugenholtz, N. C. Kyrpides, H.-P.
Klenk and A. Lapidus, Standards in Genomic Sciences, 3, 37-46.
27. M. L. Miroshnichenko, S. L'Haridon, C. Jeanthon, A. N. Antipov, N. A. Kostrikina, B. J. Tindall, P. Schumann, S. Spring, E. Stackebrandt and E. A. Bonch-Osmolovskaya, International Journal of Systematic and Evolutionary Microbiology, 2003, 53, 747-752.
28. Y.-E. Lee, M. K. Jain, C. Lee and J. G. Zeikus, International Journal of Systematic Bacteriology, 1993, 43, 41-51.
29. H. Y. Aksenova, F. A. Rainey, P. H. Janssen, G. A. Zavarzin and H. W. Morgan, International Journal of Systematic Bacteriology, 1992, 42, 175-177.
30. L. Feng, W. Wang, J. Cheng, Y. Ren, G. Zhao, C. Gao, Y. Tang, X. Liu, W. Han, X. Peng, R. Liu and L. Wang, Proc. Natl. Acad. Sci. U. S. A., 2007, 104, 5602-5607.
31. C. Goedl, A. Schwarz, A. Minani and B. Nidetzky, J. Biotechnol., 2007, 129, 77-86.
32. K. M. Polizzi, A. S. Bommarius, J. M. Broering and J. F. Chaparro-Riggers, Current Opinion in Chemical Biology, 2007, 11, 220-225.
33. W. Nerinckx, T. Desmet and M. Claeyssens, Febs Letters, 2003, 538, 1-7.
34. P. Wildberger, C. Luley-Goedl and B. Nidetzky, Febs Letters, 585, 499-504.
35. M. Mueller and B. Nidetzky, Febs Letters, 2007, 581, 3814-3818.
36. J. Sanchis, L. Fernandez, J. D. Carballeira, J. Drone, Y. Gumulya, H. Hobenreich, D.
Kahakeaw, S. Kille, R. Lohmer, J. J. -P. Peyralans, J. Podtetenieff, S. Prasad, P. Soni, A. Taglieber, S. Wu, F. E. Zilly, and M. T. Reetz, Applied Microbiology and Biotechnology, 2008, 81, 387-97.

Claims

Claims
1. Use of polypeptide having the amino acid sequence as depicted by SEQ ID N°l as a thermostable sucrose phosphorylase and/or as a thermostable sucrose-6'-phosphate phosphorylase.
2. Use according to claim 1 wherein said amino acid sequence is encoded by the nucleic acid sequence as depicted by SEQ ID N°2 or SEQ ID N°3.
3. Use according to claim 1 wherein said amino acid sequence is depicted by SEQ ID N°4.
4. Use according to claims 1-3 wherein said thermostability means that said sucrose phosphorylase or said sucrose-6'-phosphate phosphorylase has, during a phosphorolysis or synthesis reaction at a pH between 5.0 and 7.5 and a temperature between 50°C and 70°C, a half-life of at least 20 hours.
5. Use according to claim 4 wherein said thermostability means that said sucrose phosphorylase or said sucrose-6'-phosphate phosphorylase has, during a phosphorolysis or synthesis reaction at an enzyme concentration of about 8.5 μg/ml, at a pH between 6.0 and 6.5 and at a temperature of about 60°C, a half-life of at least 60 hours.
6. Use according to any of claims 1 to 5 wherein said polypeptide has an amino acid sequence which is at least 90% identical to the amino acid sequence as depicted by SEQ ID N°l or wherein said polypeptide is a fragment of the amino acid sequence as depicted by SEQ ID N°l.
7. Use according to claim 6 wherein said variant or fragment comprises the amino acid regions 45-56, 131-166, 184-207, 236-245, 279-310 and 340-358 of SEQ ID N°l.
8. Use according to claim 6 wherein said variant or fragment phosphorolyzes sucrose-6'- phosphate and comprises the amino acid histidine at amino acid position 344.
9. A method to produce D-fructose, D-fructose-6-phosphate and/or alpha-D-glucose -1- phosphate at a temperature above 50°C comprising: i) contacting a polypeptide as defined by claims 1-8 with sucrose or sucrose-6'-phosphate and inorganic phosphate, ii) phosphorolysing sucrose or sucrose-6'-phosphate to obtain D-fructose, D-fructose-6- phosphate and/or alpha-D-glucose -1-phosphate, and iii) purifying said D-fructose, D- fructose-6-phosphate and/or alpha-D-glucose -1-phosphate.
10. A method to produce an alpha-D-glucoside at a temperature above 50°C comprising: i) contacting a polypeptide as defined by claims 1-8 with either alpha-D-glucose -1- phosphate, sucrose or sucrose-6'-phosphate as donor and an appropriate acceptor such as a monosaccharide, a phosphorylated monosaccharide, an aliphatic or aromatic alcohol, a furanone, a flavanoid or a phenolic compound, ii) glycosylating said monosaccharide, phosphorylated monosaccharide, aliphatic or aromatic alcohol, furanone, flavanoid or phenolic compound to obtain an alpha-D-glucoside, and iii) purifying said alpha-D- glucoside.
11. A method according to claim 10 wherein said acceptor is L-sorbose, D-fructose, D-fructose- 6-phosphate, D-psicose, D-tagatose, D-glucose, ascorbic acid, hexanol, catechol, pyridoxine, catechin, quercetin, glycerol, vanillin or 4-hydroxy-2,5-dimethyl-3(2H)- furanone.
12. An isolated amino acid sequence as depicted by SEQ ID N°4.
13. An isolated nucleic acid sequence as depicted by SEQ ID N°3.
14. Use of a microorganism expressing a polypeptide having the amino acid sequence as depicted by SEQ ID N°l or SEQ ID N° 4 to provide a thermostable sucrose phosphorylase or a thermostable sucrose-6'-phosphate phosphorylase.
15. Use according to claim 14 wherein said amino acid sequence is encoded by the nucleic acid sequence as depicted by SEQ ID N°2 or SEQ ID N°3, respectively.
16. A method to produce an alpha-D-glucoside comprising: i) contacting a polypeptide as defined by claims 1-8 with either alpha-D-glucose -1-phosphate, sucrose or sucrose-6'- phosphate as donor and an appropriate acceptor, ii) glycosylating said acceptor to obtain an alpha-D-glucoside, and iii) purifying said alpha-D-glucoside, wherein said glycosylation is carried out in a two-phase system with an organic solvent phase containing the acceptor and an aqueous buffer phase containing said polypeptide as defined by claims 1-8 and said donor.
17. A method according to claim 15 wherein said acceptor is a non-carbohydrate acceptor.
18. A method according to claim 16 wherein said non-carbohydrate acceptor is cinnamyl alcohol, geraniol, propyl gallate, ethyl gallate, resorcinol, pyrogallol, saligenin or methyl gallate.
EP13776826.3A 2012-10-18 2013-10-16 A thermostable sucrose and sucrose-6'-phosphate phosphorylase Withdrawn EP2909318A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
EP13776826.3A EP2909318A1 (en) 2012-10-18 2013-10-16 A thermostable sucrose and sucrose-6'-phosphate phosphorylase

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
EP12188966 2012-10-18
EP13159683 2013-03-18
PCT/EP2013/071587 WO2014060452A1 (en) 2012-10-18 2013-10-16 A thermostable sucrose and sucrose-6'-phosphate phosphorylase
EP13776826.3A EP2909318A1 (en) 2012-10-18 2013-10-16 A thermostable sucrose and sucrose-6'-phosphate phosphorylase

Publications (1)

Publication Number Publication Date
EP2909318A1 true EP2909318A1 (en) 2015-08-26

Family

ID=49356455

Family Applications (1)

Application Number Title Priority Date Filing Date
EP13776826.3A Withdrawn EP2909318A1 (en) 2012-10-18 2013-10-16 A thermostable sucrose and sucrose-6'-phosphate phosphorylase

Country Status (2)

Country Link
EP (1) EP2909318A1 (en)
WO (1) WO2014060452A1 (en)

Families Citing this family (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10494616B2 (en) 2014-09-10 2019-12-03 Pfeifer & Langen GmbH & Co. KG Cellobiose phosphorylase
WO2016116472A1 (en) * 2015-01-22 2016-07-28 Universiteit Gent Production of specific glucosides with cellobiose phosphorylase
WO2016180818A1 (en) * 2015-05-12 2016-11-17 Universiteit Gent Mutant sucrose phosphorylases with improved glycosylation activity towards polyphenols
JP7000327B2 (en) * 2015-09-25 2022-02-04 ビーエーエスエフ ビューティ ケア ソリューションズ フランス エスエーエス Methods for Small Molecule Glycosylation
CN107630057B (en) * 2016-07-18 2021-08-24 中国科学院微生物研究所 A kind of method for producing 2-oxo-α-D-glucopyranosyl ascorbic acid and its special engineering bacteria
KR102114865B1 (en) * 2017-12-08 2020-05-27 씨제이제일제당 주식회사 Novel psicose-6-phosphate phosphatase, composition for producing psicose including the phosphatase, and method for producing psicose using the phosphatase
CN109576239B (en) * 2018-12-17 2022-06-28 清华大学 Thermostable phosphorylase and its application
CN111172127A (en) * 2020-01-17 2020-05-19 浙江工业大学 Application of a kind of sucrose phosphorylase in the preparation of glycerol glucoside
CN116144625A (en) * 2023-02-24 2023-05-23 杭州佳嘉乐生物技术有限公司 Recombinant sucrose phosphorylase and method for catalyzing glycosylation reaction
CN119842654B (en) * 2024-12-31 2025-08-05 南京诺云生物科技有限公司 A sucrose phosphorylase with enhanced heat resistance and its application in high-temperature catalytic preparation of α-arbutin

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO2014060452A1 *

Also Published As

Publication number Publication date
WO2014060452A1 (en) 2014-04-24

Similar Documents

Publication Publication Date Title
WO2014060452A1 (en) A thermostable sucrose and sucrose-6&#39;-phosphate phosphorylase
Goedl et al. Recombinant sucrose phosphorylase from Leuconostoc mesenteroides: characterization, kinetic studies of transglucosylation, and application of immobilised enzyme for production of α-D-glucose 1-phosphate
US12385029B2 (en) Engineered synthase for production of tryptophan derivatives and intransigent substrates
Verhaeghe et al. The quest for a thermostable sucrose phosphorylase reveals sucrose 6′-phosphate phosphorylase as a novel specificity
JP2016528925A (en) Improved variants of D-psicose 3-epimerase and uses thereof
Bhuiyan et al. Characterization of a hyperthermostable glycogen phosphorylase from Aquifex aeolicus expressed in Escherichia coli
Borg et al. Mechanistic characterization of UDP‐glucuronic acid 4‐epimerase
KR20220128581A (en) Enzymatic hexosaminidization of lactose
US10494616B2 (en) Cellobiose phosphorylase
Tantanarat et al. Expression and characterization of 4-α-glucanotransferase genes from Manihot esculenta Crantz and Arabidopsis thaliana and their use for the production of cycloamyloses
Li et al. Characterisation of a Thermobacillus sucrose phosphorylase and its utility in enzymatic synthesis of 2-O-α-D-glucopyranosyl-L-ascorbic acid
CN116113645A (en) Modified nicotinamide riboside phosphate transferase
Wahl et al. Characterization of a new UDP-sugar pyrophosphorylase from Hordeum vulgare (barley)
Nidetzky et al. Cellobiose phosphorylase from Cellulomonas uda: gene cloning and expression in Escherichia coli, and application of the recombinant enzyme in a ‘glycosynthase-type’reaction
Suryanti et al. Cloning, over-expression, purification, and characterisation of N-acetylneuraminate synthase from Streptococcus agalactiae
Choi et al. Enhanced production of turanose using a mutant amylosucrase from Bifidobacterium thermophilum immobilized on silica carriers
JP5383175B2 (en) Novel β-fructofuranosidase, production method thereof and use thereof
ES3052614T3 (en) Trehalose phosphorylase
Xing et al. Cloning, expression and mutation of a novel thermophilic GH1 β-galactosidase from Vulcanisaeta thermophila with transglycosylation activity for tyrosol galactoside synthesis
Gu et al. Gene cloning and enzymatic properties of hyperthermostable β-glycosidase from Thermus thermophilus HJ6
Iqbal et al. Exploiting the biocatalytic potential of co-expressed l-fucose isomerase and d-tagatose 3-epimerase for the biosynthesis of 6-deoxy-l-sorbose
KR101574952B1 (en) Screening methods for variants of α-2,3 and α-2,6 sialyltransferases and their application to the production of sialyl oligosaccharides
JP7025941B2 (en) New enzyme preparation, its manufacturing method and its use
Li Heterologous expression of a novel galactose-1-phosphate uridylyltransferase from Thermodesulfatator indicus and its application for bioproduction of Gal-β-1, 4-GlcNAc-X
US10378034B2 (en) Use of a N-acetylneuraminate lyase derived from the bacterium Aliivibrio salmonicida in the production of neuraminic acid and derivatives thereof

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20150512

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

AX Request for extension of the european patent

Extension state: BA ME

DAX Request for extension of the european patent (deleted)
17Q First examination report despatched

Effective date: 20160317

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20160728