EP2909318A1 - A thermostable sucrose and sucrose-6'-phosphate phosphorylase - Google Patents
A thermostable sucrose and sucrose-6'-phosphate phosphorylaseInfo
- Publication number
- EP2909318A1 EP2909318A1 EP13776826.3A EP13776826A EP2909318A1 EP 2909318 A1 EP2909318 A1 EP 2909318A1 EP 13776826 A EP13776826 A EP 13776826A EP 2909318 A1 EP2909318 A1 EP 2909318A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- sucrose
- phosphate
- seq
- amino acid
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 108020000005 Sucrose phosphorylase Proteins 0.000 title claims abstract description 74
- 229930006000 Sucrose Natural products 0.000 title claims abstract description 37
- 239000005720 sucrose Substances 0.000 title claims abstract description 37
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 title claims abstract description 36
- 101710153274 Sucrose 6(F)-phosphate phosphorylase Proteins 0.000 title claims abstract description 27
- 102000004190 Enzymes Human genes 0.000 claims abstract description 60
- 108090000790 Enzymes Proteins 0.000 claims abstract description 60
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 claims abstract description 19
- GSXOAOHZAIYLCY-UHFFFAOYSA-N D-F6P Natural products OCC(=O)C(O)C(O)C(O)COP(O)(O)=O GSXOAOHZAIYLCY-UHFFFAOYSA-N 0.000 claims abstract description 15
- 150000008496 α-D-glucosides Chemical class 0.000 claims abstract description 14
- HXXFSFRBOHSIMQ-VFUOTHLCSA-N alpha-D-glucose 1-phosphate Chemical compound OC[C@H]1O[C@H](OP(O)(O)=O)[C@H](O)[C@@H](O)[C@@H]1O HXXFSFRBOHSIMQ-VFUOTHLCSA-N 0.000 claims abstract description 12
- RFSUNEUAIZKAJO-VRPWFDPXSA-N D-Fructose Natural products OC[C@H]1OC(O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-VRPWFDPXSA-N 0.000 claims abstract description 11
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 32
- 238000000034 method Methods 0.000 claims description 22
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 18
- 229920001184 polypeptide Polymers 0.000 claims description 17
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 17
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 claims description 13
- 150000001413 amino acids Chemical class 0.000 claims description 13
- 150000007523 nucleic acids Chemical group 0.000 claims description 13
- PJTTXANTBQDXME-UGDNZRGBSA-N sucrose 6(F)-phosphate Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@]1(CO)[C@@H](O)[C@H](O)[C@@H](COP(O)(O)=O)O1 PJTTXANTBQDXME-UGDNZRGBSA-N 0.000 claims description 13
- 150000001720 carbohydrates Chemical class 0.000 claims description 11
- 150000002772 monosaccharides Chemical class 0.000 claims description 11
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 10
- 239000012634 fragment Substances 0.000 claims description 10
- GSXOAOHZAIYLCY-HSUXUTPPSA-N keto-D-fructose 6-phosphate Chemical compound OCC(=O)[C@@H](O)[C@H](O)[C@H](O)COP(O)(O)=O GSXOAOHZAIYLCY-HSUXUTPPSA-N 0.000 claims description 10
- 238000003786 synthesis reaction Methods 0.000 claims description 9
- OOCCDEMITAIZTP-QPJJXVBHSA-N (E)-cinnamyl alcohol Chemical group OC\C=C\C1=CC=CC=C1 OOCCDEMITAIZTP-QPJJXVBHSA-N 0.000 claims description 6
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 claims description 6
- GLZPCOQZEFWAFX-UHFFFAOYSA-N Geraniol Chemical compound CC(C)=CCCC(C)=CCO GLZPCOQZEFWAFX-UHFFFAOYSA-N 0.000 claims description 6
- ZTHYODDOHIVTJV-UHFFFAOYSA-N Propyl gallate Chemical compound CCCOC(=O)C1=CC(O)=C(O)C(O)=C1 ZTHYODDOHIVTJV-UHFFFAOYSA-N 0.000 claims description 6
- REFJWTPEDVJJIY-UHFFFAOYSA-N Quercetin Chemical compound C=1C(O)=CC(O)=C(C(C=2O)=O)C=1OC=2C1=CC=C(O)C(O)=C1 REFJWTPEDVJJIY-UHFFFAOYSA-N 0.000 claims description 6
- RHDGNLCLDBVESU-UHFFFAOYSA-N but-3-en-4-olide Chemical compound O=C1CC=CO1 RHDGNLCLDBVESU-UHFFFAOYSA-N 0.000 claims description 6
- YCIMNLLNPGFGHC-UHFFFAOYSA-N catechol Chemical compound OC1=CC=CC=C1O YCIMNLLNPGFGHC-UHFFFAOYSA-N 0.000 claims description 6
- FBSFWRHWHYMIOG-UHFFFAOYSA-N methyl 3,4,5-trihydroxybenzoate Chemical compound COC(=O)C1=CC(O)=C(O)C(O)=C1 FBSFWRHWHYMIOG-UHFFFAOYSA-N 0.000 claims description 6
- LXNHXLLTXMVWPM-UHFFFAOYSA-N pyridoxine Chemical compound CC1=NC=C(CO)C(CO)=C1O LXNHXLLTXMVWPM-UHFFFAOYSA-N 0.000 claims description 6
- WQGWDDDVZFFDIG-UHFFFAOYSA-N pyrogallol Chemical compound OC1=CC=CC(O)=C1O WQGWDDDVZFFDIG-UHFFFAOYSA-N 0.000 claims description 6
- GHMLBKRAJCXXBS-UHFFFAOYSA-N resorcinol Chemical compound OC1=CC=CC(O)=C1 GHMLBKRAJCXXBS-UHFFFAOYSA-N 0.000 claims description 6
- VFPFQHQNJCMNBZ-UHFFFAOYSA-N ethyl gallate Chemical compound CCOC(=O)C1=CC(O)=C(O)C(O)=C1 VFPFQHQNJCMNBZ-UHFFFAOYSA-N 0.000 claims description 5
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 claims description 5
- 229910052816 inorganic phosphate Inorganic materials 0.000 claims description 5
- 244000005700 microbiome Species 0.000 claims description 5
- 150000002989 phenols Chemical class 0.000 claims description 5
- DNIAPMSPPWPWGF-GSVOUGTGSA-N (R)-(-)-Propylene glycol Chemical compound C[C@@H](O)CO DNIAPMSPPWPWGF-GSVOUGTGSA-N 0.000 claims description 4
- INAXVXBDKKUCGI-UHFFFAOYSA-N 4-hydroxy-2,5-dimethylfuran-3-one Chemical compound CC1OC(C)=C(O)C1=O INAXVXBDKKUCGI-UHFFFAOYSA-N 0.000 claims description 4
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 claims description 4
- BJHIKXHVCXFQLS-PUFIMZNGSA-N D-psicose Chemical compound OC[C@@H](O)[C@@H](O)[C@@H](O)C(=O)CO BJHIKXHVCXFQLS-PUFIMZNGSA-N 0.000 claims description 4
- LKDRXBCSQODPBY-OEXCPVAWSA-N D-tagatose Chemical compound OCC1(O)OC[C@@H](O)[C@H](O)[C@@H]1O LKDRXBCSQODPBY-OEXCPVAWSA-N 0.000 claims description 4
- 239000012062 aqueous buffer Substances 0.000 claims description 4
- 125000004387 flavanoid group Chemical group 0.000 claims description 4
- 230000001279 glycosylating effect Effects 0.000 claims description 4
- ZSIAUFGUXNUGDI-UHFFFAOYSA-N hexan-1-ol Chemical compound CCCCCCO ZSIAUFGUXNUGDI-UHFFFAOYSA-N 0.000 claims description 4
- PFTAWBLQPZVEMU-DZGCQCFKSA-N (+)-catechin Chemical compound C1([C@H]2OC3=CC(O)=CC(O)=C3C[C@@H]2O)=CC=C(O)C(O)=C1 PFTAWBLQPZVEMU-DZGCQCFKSA-N 0.000 claims description 3
- 239000004262 Ethyl gallate Substances 0.000 claims description 3
- 239000005792 Geraniol Substances 0.000 claims description 3
- GLZPCOQZEFWAFX-YFHOEESVSA-N Geraniol Natural products CC(C)=CCC\C(C)=C/CO GLZPCOQZEFWAFX-YFHOEESVSA-N 0.000 claims description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 claims description 3
- ZVOLCUVKHLEPEV-UHFFFAOYSA-N Quercetagetin Natural products C1=C(O)C(O)=CC=C1C1=C(O)C(=O)C2=C(O)C(O)=C(O)C=C2O1 ZVOLCUVKHLEPEV-UHFFFAOYSA-N 0.000 claims description 3
- HWTZYBCRDDUBJY-UHFFFAOYSA-N Rhynchosin Natural products C1=C(O)C(O)=CC=C1C1=C(O)C(=O)C2=CC(O)=C(O)C=C2O1 HWTZYBCRDDUBJY-UHFFFAOYSA-N 0.000 claims description 3
- OOCCDEMITAIZTP-UHFFFAOYSA-N allylic benzylic alcohol Natural products OCC=CC1=CC=CC=C1 OOCCDEMITAIZTP-UHFFFAOYSA-N 0.000 claims description 3
- 235000010323 ascorbic acid Nutrition 0.000 claims description 3
- 229960005070 ascorbic acid Drugs 0.000 claims description 3
- 239000011668 ascorbic acid Substances 0.000 claims description 3
- ADRVNXBAWSRFAJ-UHFFFAOYSA-N catechin Natural products OC1Cc2cc(O)cc(O)c2OC1c3ccc(O)c(O)c3 ADRVNXBAWSRFAJ-UHFFFAOYSA-N 0.000 claims description 3
- 235000005487 catechin Nutrition 0.000 claims description 3
- 229950001002 cianidanol Drugs 0.000 claims description 3
- 235000019277 ethyl gallate Nutrition 0.000 claims description 3
- 229940113087 geraniol Drugs 0.000 claims description 3
- MWDZOUNAPSSOEL-UHFFFAOYSA-N kaempferol Natural products OC1=C(C(=O)c2cc(O)cc(O)c2O1)c3ccc(O)cc3 MWDZOUNAPSSOEL-UHFFFAOYSA-N 0.000 claims description 3
- IBKQQKPQRYUGBJ-UHFFFAOYSA-N methyl gallate Natural products CC(=O)C1=CC(O)=C(O)C(O)=C1 IBKQQKPQRYUGBJ-UHFFFAOYSA-N 0.000 claims description 3
- 235000010388 propyl gallate Nutrition 0.000 claims description 3
- 239000000473 propyl gallate Substances 0.000 claims description 3
- 229940075579 propyl gallate Drugs 0.000 claims description 3
- 235000008160 pyridoxine Nutrition 0.000 claims description 3
- 239000011677 pyridoxine Substances 0.000 claims description 3
- 229940079877 pyrogallol Drugs 0.000 claims description 3
- 229960001285 quercetin Drugs 0.000 claims description 3
- 235000005875 quercetin Nutrition 0.000 claims description 3
- CQRYARSYNCAZFO-UHFFFAOYSA-N salicyl alcohol Chemical compound OCC1=CC=CC=C1O CQRYARSYNCAZFO-UHFFFAOYSA-N 0.000 claims description 3
- MWOOGOJBHIARFG-UHFFFAOYSA-N vanillin Chemical compound COC1=CC(C=O)=CC=C1O MWOOGOJBHIARFG-UHFFFAOYSA-N 0.000 claims description 3
- FGQOOHJZONJGDT-UHFFFAOYSA-N vanillin Natural products COC1=CC(O)=CC(C=O)=C1 FGQOOHJZONJGDT-UHFFFAOYSA-N 0.000 claims description 3
- 235000012141 vanillin Nutrition 0.000 claims description 3
- 229940011671 vitamin b6 Drugs 0.000 claims description 3
- BJHIKXHVCXFQLS-OTWZMJIISA-N L-sorbose group Chemical group OCC(=O)[C@@H](O)[C@H](O)[C@@H](O)CO BJHIKXHVCXFQLS-OTWZMJIISA-N 0.000 claims description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 claims description 2
- 229960005150 glycerol Drugs 0.000 claims description 2
- 235000011187 glycerol Nutrition 0.000 claims description 2
- 230000013595 glycosylation Effects 0.000 claims description 2
- 238000006206 glycosylation reaction Methods 0.000 claims description 2
- 239000003960 organic solvent Substances 0.000 claims description 2
- 229940117960 vanillin Drugs 0.000 claims description 2
- 239000000758 substrate Substances 0.000 abstract description 19
- 241000193446 Thermoanaerobacterium thermosaccharolyticum Species 0.000 abstract description 18
- 238000012512 characterization method Methods 0.000 abstract description 3
- 238000003259 recombinant expression Methods 0.000 abstract description 3
- 238000009776 industrial production Methods 0.000 abstract description 2
- BGWGXPAPYGQALX-VRPWFDPXSA-N D-fructofuranose 6-phosphate Chemical compound OCC1(O)O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O BGWGXPAPYGQALX-VRPWFDPXSA-N 0.000 abstract 1
- 229940088598 enzyme Drugs 0.000 description 53
- 239000000370 acceptor Substances 0.000 description 41
- 230000000694 effects Effects 0.000 description 27
- 108090000623 proteins and genes Proteins 0.000 description 23
- 235000018102 proteins Nutrition 0.000 description 20
- 102000004169 proteins and genes Human genes 0.000 description 20
- 235000001014 amino acid Nutrition 0.000 description 19
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 15
- 238000006243 chemical reaction Methods 0.000 description 15
- 239000012071 phase Substances 0.000 description 15
- 239000002904 solvent Substances 0.000 description 12
- 241000186018 Bifidobacterium adolescentis Species 0.000 description 11
- 229930091371 Fructose Natural products 0.000 description 11
- 239000005715 Fructose Substances 0.000 description 11
- 235000014633 carbohydrates Nutrition 0.000 description 9
- 238000003556 assay Methods 0.000 description 7
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 6
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 6
- 241000588724 Escherichia coli Species 0.000 description 6
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 6
- 238000004519 manufacturing process Methods 0.000 description 6
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical compound CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 6
- 239000000872 buffer Substances 0.000 description 5
- 125000002791 glucosyl group Chemical group C1([C@H](O)[C@@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 5
- 230000002779 inactivation Effects 0.000 description 5
- 230000035772 mutation Effects 0.000 description 5
- WQZGKKKJIJFFOK-SVZMEOIVSA-N (+)-Galactose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-SVZMEOIVSA-N 0.000 description 4
- 241000894006 Bacteria Species 0.000 description 4
- OFBQJSOFQDEBGM-UHFFFAOYSA-N Pentane Chemical compound CCCCC OFBQJSOFQDEBGM-UHFFFAOYSA-N 0.000 description 4
- BGWGXPAPYGQALX-ARQDHWQXSA-N beta-D-fructofuranose 6-phosphate Chemical group OC[C@@]1(O)O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O BGWGXPAPYGQALX-ARQDHWQXSA-N 0.000 description 4
- 239000011942 biocatalyst Substances 0.000 description 4
- DKPFZGUDAPQIHT-UHFFFAOYSA-N butyl acetate Chemical compound CCCCOC(C)=O DKPFZGUDAPQIHT-UHFFFAOYSA-N 0.000 description 4
- BJHIKXHVCXFQLS-UYFOZJQFSA-N fructose group Chemical group OCC(=O)[C@@H](O)[C@H](O)[C@H](O)CO BJHIKXHVCXFQLS-UYFOZJQFSA-N 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 3
- 239000004382 Amylase Substances 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- 241001082267 Meiothermus silvanus DSM 9946 Species 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 241000585997 Spirochaeta thermophila DSM 6192 Species 0.000 description 3
- 241001129210 Thermaceae Species 0.000 description 3
- 241001137870 Thermoanaerobacterium Species 0.000 description 3
- 241001561311 Thermoanaerobacterium thermosaccharolyticum DSM 571 Species 0.000 description 3
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 3
- AFYNADDZULBEJA-UHFFFAOYSA-N bicinchoninic acid Chemical compound C1=CC=CC2=NC(C=3C=C(C4=CC=CC=C4N=3)C(=O)O)=CC(C(O)=O)=C21 AFYNADDZULBEJA-UHFFFAOYSA-N 0.000 description 3
- 230000003197 catalytic effect Effects 0.000 description 3
- 238000002022 differential scanning fluorescence spectroscopy Methods 0.000 description 3
- 230000002255 enzymatic effect Effects 0.000 description 3
- 238000001952 enzyme assay Methods 0.000 description 3
- 229930182470 glycoside Natural products 0.000 description 3
- 150000002338 glycosides Chemical class 0.000 description 3
- 230000002209 hydrophobic effect Effects 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 235000014655 lactic acid Nutrition 0.000 description 3
- 239000004310 lactic acid Substances 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 238000002844 melting Methods 0.000 description 3
- 230000008018 melting Effects 0.000 description 3
- 238000002703 mutagenesis Methods 0.000 description 3
- 231100000350 mutagenesis Toxicity 0.000 description 3
- 108020004707 nucleic acids Proteins 0.000 description 3
- 102000039446 nucleic acids Human genes 0.000 description 3
- 239000012074 organic phase Substances 0.000 description 3
- 230000000865 phosphorylative effect Effects 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 108020004705 Codon Proteins 0.000 description 2
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 2
- 241000192130 Leuconostoc mesenteroides Species 0.000 description 2
- 239000007993 MOPS buffer Substances 0.000 description 2
- 241000508289 Meiothermus silvanus Species 0.000 description 2
- 101100086667 Mus musculus Rbms1 gene Proteins 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 241000372441 Pelomonas Species 0.000 description 2
- 241000589887 Spirochaeta thermophila Species 0.000 description 2
- 239000008346 aqueous phase Substances 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000000105 evaporative light scattering detection Methods 0.000 description 2
- 239000013613 expression plasmid Substances 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 2
- TVMXDCGIABBOFY-UHFFFAOYSA-N octane Chemical compound CCCCCCCC TVMXDCGIABBOFY-UHFFFAOYSA-N 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 238000005070 sampling Methods 0.000 description 2
- 229910000162 sodium phosphate Inorganic materials 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- HKSZLNNOFSGOKW-HMWZOHBLSA-N staurosporine Chemical compound C12=C3N4C5=CC=CC=C5C3=C3CNC(=O)C3=C2C2=CC=CC=C2N1[C@@H]1C[C@H](NC)[C@H](OC)[C@@]4(C)O1 HKSZLNNOFSGOKW-HMWZOHBLSA-N 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 150000005846 sugar alcohols Chemical class 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 239000013598 vector Substances 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- AQTKXCPRNZDOJU-ZEBDFXRSSA-N 2-O-(alpha-D-glucopyranosyl)glycerol Chemical compound OCC(CO)O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O AQTKXCPRNZDOJU-ZEBDFXRSSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 241000203069 Archaea Species 0.000 description 1
- 241001112741 Bacillaceae Species 0.000 description 1
- 239000002028 Biomass Substances 0.000 description 1
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 description 1
- 108700010070 Codon Usage Proteins 0.000 description 1
- 241000192700 Cyanobacteria Species 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 241000588722 Escherichia Species 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 241001468175 Geobacillus thermodenitrificans Species 0.000 description 1
- 241001307979 Geobacillus thermodenitrificans NG80-2 Species 0.000 description 1
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- 241000058951 Marinithermus hydrothermalis DSM 14884 Species 0.000 description 1
- 241000343831 Meiothermus ruber DSM 1279 Species 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- 241000896325 Oceanithermus profundus DSM 14977 Species 0.000 description 1
- 108010073135 Phosphorylases Proteins 0.000 description 1
- 102000009097 Phosphorylases Human genes 0.000 description 1
- 101150064547 SP gene Proteins 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- 241000589971 Spirochaetaceae Species 0.000 description 1
- 241000194019 Streptococcus mutans Species 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- 241000970807 Thermoanaerobacterales Species 0.000 description 1
- 241001137871 Thermoanaerobacterium saccharolyticum Species 0.000 description 1
- 241001342736 Thermoanaerobacterium xylanolyticum LX-11 Species 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 230000008033 biological extinction Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 238000010960 commercial process Methods 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 239000002537 cosmetic Substances 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 239000012847 fine chemical Substances 0.000 description 1
- 238000005558 fluorometry Methods 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 229930182478 glucoside Natural products 0.000 description 1
- 102000035122 glycosylated proteins Human genes 0.000 description 1
- 108091005608 glycosylated proteins Proteins 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 238000012933 kinetic analysis Methods 0.000 description 1
- 238000012417 linear regression Methods 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 239000000155 melt Substances 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000003020 moisturizing effect Effects 0.000 description 1
- 238000002887 multiple sequence alignment Methods 0.000 description 1
- 230000000869 mutational effect Effects 0.000 description 1
- 239000012038 nucleophile Substances 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 230000000630 rising effect Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000012064 sodium phosphate buffer Substances 0.000 description 1
- 239000002689 soil Substances 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000012916 structural analysis Methods 0.000 description 1
- 125000000185 sucrose group Chemical group 0.000 description 1
- -1 sugars alcohols Chemical class 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 230000007306 turnover Effects 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 239000003643 water by type Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/1048—Glycosyltransferases (2.4)
- C12N9/1051—Hexosyltransferases (2.4.1)
- C12N9/1066—Sucrose phosphate synthase (2.4.1.14)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/1048—Glycosyltransferases (2.4)
- C12N9/1051—Hexosyltransferases (2.4.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P19/00—Preparation of compounds containing saccharide radicals
- C12P19/44—Preparation of O-glycosides, e.g. glucosides
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y204/00—Glycosyltransferases (2.4)
- C12Y204/01—Hexosyltransferases (2.4.1)
- C12Y204/01007—Sucrose phosphorylase (2.4.1.7)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y204/00—Glycosyltransferases (2.4)
- C12Y204/01—Hexosyltransferases (2.4.1)
- C12Y204/01014—Sucrose-phosphate synthase (2.4.1.14)
Definitions
- thermostable sucrose and sucrose-6'-phosphate phosphorylase A thermostable sucrose and sucrose-6'-phosphate phosphorylase
- Sucrose phosphorylase (SP, E.C. 2.4.1.7) is classified in the a-amylase family (GH-13) and catalyzes the reversible phosphorolysis of sucrose into a-D-glucose-l-phosphate (a-Glc-l-P) and D-fructose 1_ 4 . Thanks to its broad acceptor specificity, SP can be employed for the transfer of a glucosyl moiety to a variety of monosaccharides, sugar alcohols and even phenolic compounds. Therefore, SP is a very interesting biocatalyst for the production of a-D-glucosides as industrial fine chemicals 5 .
- SP have so far only been isolated from mesophilic sources 5 ' 11 with the enzymes originating from Leuconostoc mesenteroides, Bifidobacterium adolescentis and Pelomonas saccharophyla the most extensively described in literature 5 ' 6 .
- the SP from B. adolescentis is the most thermostable isolate today with a half-life time of 12 hours at 60°C 12 . This limited thermostability of mesophilic isolates could hamper the commercial exploitation of SP.
- sucrose-6'-phosphate Although progress has been made in stabilizing industrially important biocatalysts, there is still a need to identify a sucrose phosphorylase that is more stable than the best enzymes available today or to identify other, specific substrates of said phosphorylases such as sucrose-6'-phosphate.
- FIG. 5 Homology model of the Thermobacterium thermosaccharolyticum SP showing the main enzyme-substrate interactions
- the present invention further relates to the use as described above wherein said amino acid sequence is encoded by the nucleic acid sequence as depicted by SEQ ID N°2 or SEQ ID N°3.
- nucleic acid sequence as depicted by SEQ I D N° 2 is the following Thermoanaerobacterium thermosaccharolyticum sucrose phosphorylase or sucrose-6'-phosphate phosphorylase encoding nucleic acid sequence:
- the nucleic acid sequence as depicted by SEQ I D N° 3 is the following Thermoanaerobacterium thermosaccharolyticum sucrose phosphorylase or sucrose-6'-phosphate phosphorylase encoding nucleic acid sequence which, compared to SEQ ID N°2, has been codon optimized for expression in E.
- the invention further relates to the use as described above wherein said amino acid sequence is depicted by SEQ ID N°4.
- the amino acid sequence as depicted by SEQ I D N° 4 is the following Thermoanaerobacterium thermosaccharolyticum sucrose phosphorylase or sucrose-6'-phosphate phosphorylase amino acid sequence which, compared to SEQ ID N° 1, comprises a N-terminal His 6 -tag (underlined): MGGSHHHHHHGMASMALKNKVQLITYPDSLGGNLKTLNDVLEKYFSDVFGGVHILPPFPSSGD GFAPITYSEIE PKFGTWYDIKKMAENFDILLDLMVNHVSRRSIYFQDFLKKGRKSEYADMFITLDKLWKDGKPVKGDIEKMFLRRT LPYSTFKIEETGEEEKVWTTFGKTDPSEQIDLDVNSHLVREFLLEVFKTFSNFGVKIVRLDAVGYVIKKIGTSCFFVEP EIYEFLDWAKGQAASYGIELLLEVHSQFEVQYKLAERGFLIYDFILPFTVLYTLINK
- the term 'thermostability' thus means that the sucrose phosphorylase or sucrose-6'-phosphate phosphorylase of the present invention has, during a phosphorolysis or synthesis reaction as described elsewhere in the present disclosure, at a pH of 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1, 7.2, 7.3, 7.4, or, 7.5, and, at a temperature of 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 or 70 °C, a half-life of 20, 21, 22, 25, 30, 35, 40,..., 45,..., 50, 55,..., 60, 61, 62, 63,..., 70,...75,...80, 81, 82,
- thermostability means that said sucrose phosphorylase or sucrose-6'-phosphate phosphorylase has, during a phosphorolysis or synthesis reaction at an enzyme concentration of about 8.5 ⁇ g/ml, at a pH between 6.0 and 6.5 and at a temperature of about 60°C, a half-life of at least 60 hours.
- thermostability thus specifically means that that the sucrose phosphorylase or sucrose-6'-phosphate phosphorylase of the present invention has, during a phosphorolysis or synthesis reaction as described elsewhere in the present disclosure, and at an enzyme concentration of 8.0, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9 or 9.0 ⁇ g/ml, at a pH of 6.0, 6.1, 6.2, 6.3, 6.4 or 6.5 and at a temperature of 55, 56, 57, 58, 59, 60, 61, 62, 63, 64 or 65 °C, a half-life of 60, 61, 62, 63, 64, 65,..., 70,...75,...80, 81, 82, 83, 84, 85, or more hours.
- the 'thermostability' of the enzyme of the present invention can be determined by any method known in the art. More specific enzyme assays, such as enzyme activity assays, determinations of the temperature optimum of the enzymes, the influence of pH on enzyme activity, determination of the kinetic temperature stability and the determination of the thermodynamic stability of the enzyme of the present invention are described elsewhere in the present disclosure.
- the present invention further relates to the use as described above wherein said polypeptide has an amino acid sequence which is at least 90% identical to the amino acid sequence as depicted by SEQ ID N°l or wherein said polypeptide is a fragment of the amino acid sequence as depicted by SEQ ID N°l. More specifically, the present invention relates to the use as described above wherein said variant or fragment comprises the amino acid regions 45-56, 131-207, 236-310 and 340-358 of SEQ ID N°l.
- Such fragment can -for example- be a protein with a deletion of 10% or less of the total number of amino acids at the C- and/or N-terminus. More specifically, said fragment comprises the amino acid regions 45-56, 131- 207, 236-310 and 340-358 of SEQ ID N°l or comprises the amino acid histidine at amino acid position 344 of SEQ ID N° 1.
- the term "variant" refers to a protein having at least 90 % sequence identity (i.e. having at least 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity) with SEQ ID N° 1 and that retains said sucrose phosphorylase- or sucrose-6'-phosphate phosphorylase activity. More specifically, said variant comprises the amino acid regions 45-56, 131-207, 236-310 and 340-358 of SEQ ID N°l or comprises the amino acid histidine at amino acid position 344 of SEQ ID N° 1.
- the percentage of amino acid sequence identity is determined by alignment of the two sequences and identification of the number of positions with identical amino acids divided by the number of amino acids in the shorter of the sequences x 100.
- the latter 'variant' may differ from the protein as depicted by SEQ ID N° 1 only in conservative substitutions and/or modifications, such that the ability of the protein to have sucrose phosphorylase- or sucrose-6'-phosphate phosphorylase activity is retained.
- a "conservative substitution” is one in which an amino acid is substituted for another amino acid that has similar properties, such that one skilled in the art of protein chemistry would expect the nature of the protein to be substantially unchanged.
- amino acids represent conservative changes: (1) ala, pro, gly, glu, asp, gin, asn, ser, thr; (2) cys, ser, tyr, thr; (3) val, ile, leu, met, ala, phe; (4) lys, arg, his; and (5) phe, tyr, trp, his.
- Variants may also (or alternatively) be proteins as described herein modified by, for example, the deletion or addition of amino acids that have minimal influence on the sucrose phosphorylase- or sucrose-6'-phosphate phosphorylase activity as defined above, secondary structure and hydropathic nature of the enzyme.
- variants also refers to any glycosylated protein or fragments thereof as described above.
- the present invention further relates to a method to produce D-fructose, D-fructose-6-phosphate and/or alpha-D-glucose -1-phosphate at a temperature above 50°C (i.e. 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 or 70°C) comprising: i) contacting a polypeptide as defined above with sucrose or sucrose-6'-phosphate and inorganic phosphate, ii) phosphorolyse sucrose or sucrose-6'-phosphate to obtain D-fructose, D-fructose-6-phosphate and/or alpha-D- glucose -1-phosphate, and iii) purifying said D-fructose, D-fructose-6-phosphate and/or alpha-D- glucose -1-phosphate.
- the present invention also relates to a method to produce an alpha-D-glucoside at a temperature above 50°C (i.e. 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 or 70°C)comprising: i) contacting a polypeptide as defined above with either alpha-D-glucose -1- phosphate, sucrose or sucrose-6'-phosphate as donor and an appropriate acceptor such as a monosaccharide, a phosphorylated monosaccharide, an aliphatic or aromatic alcohol, a furanone, a flavanoid or a phenolic compound, ii) glycosylating said monosaccharide, phosphorylated monosaccharide, aliphatic or aromatic alcohol, furanone, flavanoi
- the present invention also relates to an isolated amino acid sequence as depicted by SEQ ID N°4 and an isolated nucleic acid sequence as depicted by SEQ ID N°3.
- the term 'nucleic acid' as used herein corresponds for example to DNA, cDNA, NA, sense and anti- sense nucleic acids and the like.
- Said nucleic acids can be incorporated in appropriate vectors such as plasmids and appropriate host cells such as Escherichia can be transfected with said vectors.
- the present invention further relates to a method to produce an alpha-D-glucoside comprising: i) contacting a polypeptide as defined above with either alpha-D-glucose -1-phosphate, sucrose or sucrose-6'-phosphate as donor and an appropriate acceptor, ii) glycosylating said acceptor to obtain an alpha-D-glucoside, and iii) purifying said alpha-D-glucoside, wherein said glycosylation is carried out in a two-phase system with an organic solvent phase containing the acceptor and an aqueous buffer phase containing said polypeptide as defined above and said donor.
- the term 'a two-phase system' relates to any two-phase system described in the art such as for example described in the work of Vulfson 17 and Carrea 18 .
- the term 'organic phase' relates to a phase wherein for example ethyl acetate, n-butyl acetate, methyl ieri-butyl ether, diethyl ether, pentane, hexane or octane is present as solvent and further contains the acceptor molecule (for example at a concentration of 1-500 g/L).
- aqueous buffer phase' contains the enzyme of the present invention (for example at a concentration of 0.1-500 U mL "1 ) and donor substrate (for example at a concentration of 0.05-3 M).
- the latter method can take place at temperature between 30 and 70 °C, at a pH between 6 and 9, and the ratio between the aqueous and organic (solvent) phase can be between 0.01 and 100.
- the present invention specifically relates to a method as described above wherein said acceptor is a non-carbohydrate acceptor (i.e. any appropriate acceptor which is not a carbohydrate), and more specifically to a method as describe above wherein said non-carbohydrate acceptor is cinnamyl alcohol, geraniol, propyl gallate, ethyl gallate, resorcinol, pyrogallol, saligenin or methyl gallate.
- a non-carbohydrate acceptor i.e. any appropriate acceptor which is not a carbohydrate
- the present finally relates to the use as described above wherein said amino acid sequence is encoded by the nucleic acid sequence as depicted by SEQ ID N°2 or SEQ ID N°3.
- the present invention will further be illustrated by the following non-limiting examples.
- the synthetic genes were cloned into the constitutive expression vector pCXP34h 11 using the respective restriction endonucleases.
- the resulting expression plasmids were transformed in E. coli CGSC 8974.
- for the SP from B for the SP from B.
- the expression plasmid constructed in 11 was used.
- 2 % of an overnight culture was inoculated in 500 mL LB medium containing 100 ⁇ g/mL ampicillin in a 2 L shake flask and incubated at 37 °C with continuous shaking at 200 rpm for 6 hours.
- the produced biomass was harvested by centrifugation for 15 minutes at 12000 x g and 4 °C, washed with 50 mL PBS buffer (300 mM NaCI and 50 mM NaH 2 P0 4 at pH 8) and the obtained cell pellets were stored at -20 °C.
- the cell pellets were then thawed and dissolved in 20 mL lysis buffer (300 mM NaCI, 10 mM imidazole , 0.1 mM PMSF and 50 mM NaH 2 P0 4 at pH 8) supplemented with lysozyme and DNasel in a final concentration of 1 mg/mL and 6 mU/mL, respectively.
- This cell suspension was incubated on ice for 30 minutes and sonicated 3 times for 2.5 minutes (Branson sonifier 250, level 3, 50 % duty cycle).
- the His 6 -tagged proteins were purified by Ni-NTA chromatography as described by the supplier (Qiagen), after which the buffer was exchanged to 50 mM MOPS pH 7 in a Centricon YM-30 (Millipore). The protein content was analyzed measuring the absorbance at 280 nm. The extinction coefficients for the His 6 -tagged proteins were calculated using the Protparam tool on the expasy server (URL: http://web.expasy.org/protparam/).
- Enzyme assays and enzyme characterization The enzyme activity has been measured in both directions of the equilibrium reaction using a discontinuous assay.
- Initial reaction rates for the phosphorolysis of sucrose were measured by quantifying the release of fructose using the bicinchoninic acid (BCA) assay and the release of inorganic phosphate from a-glucose-l-phosphate was monitored in the synthetic direction using the phosphomolybdate assay like described before 6 .
- First the temperature optimum was determined in the phosphorolytic direction using 350 mM sucrose and 350 mM sodium phosphate buffer at pH 6.5 in a range from 40 to 70 °C. Reactions were monitored for 15 min in a heating block with sampling at regular intervals. Inactivation of the samples occurred by the alkaline environment of the assay solution.
- the influence of pH on enzyme activity was measured in the range of pH 4.5 to 8 using acetate (pH 4.5), MES (pH 5.0 - 6.5) and MOPS (pH 7 - 8)) buffers with a concentration of 50 mM.
- the pH of the substrate solutions was set at the temperature of measurement with NaOH or HCI.
- the apparent kinetic parameters for sucrose as well as a-Glc-l-P as donor and for inorganic phosphate and fructose as acceptor were determined at optimal pH and temperature. The parameters were calculated by non-linear regression of the Michaelis-Menten equation using Sigma Plot 11.0.
- the kinetic temperature stability was examined by incubating purified enzyme (35 ⁇ g/mL) for 1 h in a gradient thermocycler (Biometra, Goettingen, Germany) set to a temperature range of 57 - 73°C, followed by 15 min cooling to 16°C.
- the residual activity of the enzyme was determined in the phophorolytic direction using the standard conditions described above.
- the half life time (tso) was evaluated by incubating purified enzyme (8.5 ⁇ g/mL) in a water bath at 60 °C with sampling at regular time intervals. The residual activity was then measured and compared to the activity of the untreated enzyme.
- thermodynamic stability was measured using differential scanning fluorimetry (DSF) 21 in a Rotor-Gene Q cycler with HRM channel (Qiagen).
- DSF differential scanning fluorimetry
- 10 ⁇ g purified protein was used with 1.25 ⁇ SYPRO Orange (400x diluted) (Sigma-Aldrich) in 25 ⁇ .
- the gain was optimized before the temperature increase was started. The temperature increases from 35°C to 95°C, rising 1°C each step in 5 s steps.
- the fluorescent signal is detected at 510 nm with the green detection filter and the excitation occurs at 460 nm with a HRM lamp.
- the melting temperature (T m ) is determined by calculating the maximum of the first derivative of the melt curve using the Rotor-Gene Q software (Qiagen).
- Enzymatic glucosylation of non-carbohydrate acceptors The glucosylation of various non-carbohydrate acceptors was carried out at 100 mL scale in magnetically stirred reaction vessels. To that end, a two-phase system was used with either ethyl acetate, n-butyl acetate, methyl ieri-butyl ether, diethyl ether, pentane, hexane or octane as organic phase containing the acceptor molecule (1-500 g L 1 ), and an aqueous buffer system containing the enzyme (0.1-500 U mL "1 ) and donor substrate (0.05-3 M).
- the temperature was varied between 30 and 70 °C, the pH between 6 and 9, and the ratio between the aqueous and solvent phase between 0.01 and 100.
- samples were taken and subjected to HPLC analysis. Separation was achieved using a Waters X-bridge amide column (250 x 4.6 mm, 3.5 ⁇ ) with milliQ water (solvent A) and acetonitrile (solvent B), both containing 0.2 % triethylamine, as the mobile phase.
- the flow rate and temperature were set at 1.0 mL min "1 and 30 °C, respectively.
- the gradient elution was as follows: 95 % of solvent A (0 - 12 min), 5 to 25 % solvent B (12 - 15 min), 25 % solvent B (15 - 40 min), 25 to 5 % solvent B (40 - 41 min) and 95 % solvent A (41 - 50 min). Adequate detection was obtained with an Alltech 2000ES evaporative light scattering detector (ELSD).
- ELSD evaporative light scattering detector
- thermostable sequences To obtain a better understanding in the genetic diversity of SP, a phylogenetic tree was constructed from all the putative SP genes classified in the a-amylase family subfamily 18 (GH13-18). So far, there is only one specificity demonstrated for this subfamily, i.e. the phosphorolysis of sucrose 4 .
- a-amylase family subfamily 18 GH13-18. So far, there is only one specificity demonstrated for this subfamily, i.e. the phosphorolysis of sucrose 4 .
- Thermaceae From the 115 different species harboring a (putative) SP gene, 8 of them grow with optimal temperatures between 55 and 67.5 °C (Table 1). From the family Thermaceae, putative SP sequences from 4 different species are available and they are 555 to 588 AA in length and phylogenetically related. Besides members from the Thermaceae family, two sequences originating from Thermoanaerobacterium are classified in GH13-18 (Table 1) and they are for 91 % identical. The sequences are 488 AA long and they are most related to SPs from lactic acid bacteria which are extensively described in literature. Furthermore a putative SP can be found in Spicrochaeta thermophila and Geobacillus thermodenitrificans.
- fructose-6-phosphate was found to generate an activity that is almost twice as high as that on fructose (Table 3). Furthermore, detailed kinetic analysis revealed that the affinity for the phosphorylated acceptor is also much higher, corresponding to a Km of 15 mM instead of 42 mM.
- the enzyme also prefers sucrose-6'-phosphate over sucrose as substrate in the phosphorolysis reaction. It represents a unique specificity that has never before been described and can be designated as sucrose-6'-phosphate phosphorylase. It is important to note that the phosphate group can only be present on the fructose moiety and not on the glucose moiety (Fig. 6). Indeed, absolutely no activity could be detected with fructose as acceptor and glucose-l,6-bisphosphate as donor.
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Genetics & Genomics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Enzymes And Modification Thereof (AREA)
Abstract
The present invention relates to the identification, recombinant expression and characterization of a sucrose and sucrose-6'-phosphate phosphorylase of the thermophilic bacterium Thermoanaerobacterium thermosaccharolyticum. The enzyme has an optimal temperature of about 55°C and has a high specificity for its substrates. More importantly, the sucrose and sucrose-6'-phosphate phosphorylase of the present invention has a half-life of at least 60 hours at the industrially relevant temperature of about 60°C. This enzyme is thus -for example-useful for the industrial production of D-fructose,D-fructose-6-phosphate,alpha-D-glucose -1-phosphate or alpha-D-glucosides.
Description
A thermostable sucrose and sucrose-6'-phosphate phosphorylase
Technical field of invention
The present invention relates to the identification, recombinant expression and characterization of a sucrose and sucrose-6'-phosphate phosphorylase of the thermophilic bacterium Thermoanaerobacterium thermosaccharolyticum. The enzyme has an optimal temperature of about 55°C and has a high specificity for its substrates. More importantly, the sucrose and sucrose- 6'-phosphate phosphorylase of the present invention has a half-life of at least 60 hours at the industrially relevant temperature of about 60°C. This enzyme is thus -for example- useful for the industrial production of D-fructose, D-fructose-6-phosphate, alpha-D-glucose -1-phosphate or alpha-D-glucosides.
Background art
Sucrose phosphorylase (SP, E.C. 2.4.1.7) is classified in the a-amylase family (GH-13) and catalyzes the reversible phosphorolysis of sucrose into a-D-glucose-l-phosphate (a-Glc-l-P) and D-fructose 1_ 4. Thanks to its broad acceptor specificity, SP can be employed for the transfer of a glucosyl moiety to a variety of monosaccharides, sugar alcohols and even phenolic compounds. Therefore, SP is a very interesting biocatalyst for the production of a-D-glucosides as industrial fine chemicals 5. For the majority of interesting acceptor molecules however, the transglucosylation activity was found to be rather low and the optimization of reaction conditions is therefore very important in the development of commercial processes 6. One nice example of a carefully designed process is the production of 2-0-(a-D-glucopyranosyl)-sn-glycerol 1. This product is a moisturizing agent for cosmetics and is commercially available under the trade name Glycoin®.
A sucrose-6'-phosphate phosphorylase has not been described before.
To avoid microbial contamination, industrial carbohydrate processes are preferably run at 60 °C or higher. In addition, a higher process yield is usually obtained due to the elevated temperature that not only alleviates solubility and viscosity problems of substrate molecules, but also displaces the equilibrium in a more favourable direction for endothermic reactions 8. Besides better suited for industrial application, thermostable enzymes are also desired for enzyme engineering. Compared to its mesophilic homologues, thermostable enzymes have a higher capacity to evolve because of a higher mutational robustness conferred by the extra stability 9' 10. Unfortunately, SP have so far only been isolated from mesophilic sources 5' 11 with the enzymes originating from Leuconostoc mesenteroides, Bifidobacterium adolescentis and Pelomonas saccharophyla the most extensively
described in literature 5' 6. Among the available SPs, the SP from B. adolescentis is the most thermostable isolate today with a half-life time of 12 hours at 60°C 12. This limited thermostability of mesophilic isolates could hamper the commercial exploitation of SP.
However, mesophilic isolates can be stabilized by immobilization or by mutagenesis 13. The SP enzyme from B. adolescentis, for example, has been covalently attached to Sepabeads and prepared as cross-linked enzyme aggregate (CLEAS), resulting in a drastically improved thermostability 12 14. In addition, increasing the stability by mutagenesis is a good alternative, of which two examples are available today. The first one is the SP from Streptococcus mutans, which has been stabilized by the introduction of 8 mutations 1S. Unfortunately, the resulting enzyme variant retains only 60% of its activity after 20 minutes incubation at 60 °C, which is not enough for industrial applications. The second example is a variant of the SP from B. adolescentis containing 6 mutations and whose half-life at the industrially relevant temperature of 60 °C has more than doubled compared to the wild-type enzyme 16.
Although progress has been made in stabilizing industrially important biocatalysts, there is still a need to identify a sucrose phosphorylase that is more stable than the best enzymes available today or to identify other, specific substrates of said phosphorylases such as sucrose-6'-phosphate.
Brief description of figures
Figure 1: Temperature optimum (left) and pH optimum (right) for T. thermosaccharolyticum SP. The activity was assayed using 350 mM substrate in the phosphorolysis reaction and 200 mM substrate in the synthetic reaction.
Figure 2: The kinetic stability of the SP enzymes of Thermoanaerobacterium thermosaccharolyticum and Bifidobacterium adolescentis. The enzymes were incubated at 60°C for various times at a protein concentration of 8.5 μg/mL, after which their residual activity was compared with that of the untreated enzymes. All assays were performed in triplicate and had a coefficient of variation (CV) of <10%.
Figure 3: Temperature of inactivation for 1 hour incubation for the SP enzymes of Thermoanaerobacterium thermosaccharolyticum (TtSP) and Bifidobacterium adolescentis (BaSP). Inactivation was carried out at a protein concentration of 35 μg/mL for both enzymes.
Figure 4: Differential scanning fluorometry for Bifidobacterium adolescentis SP (BaSP), Thermoanaerobacterium. thermosaccharolyticum SP (TtSP). The spectrum was recorded at a protein concentration of 400 μg/mL.
Figure 5: Homology model of the Thermobacterium thermosaccharolyticum SP showing the main enzyme-substrate interactions
Figure 6: Structure of sucrose and its phosphorylated derivatives.
Description of invention
In this invention, three putative sucrose phosphorylases (SP) isolated from thermophiles and classified among the a-amylase subfamily 18 were recombinantly expressed in Escherichia coli. Surprisingly, only the enzyme from Thermoanaerobacterium thermosaccharolyticum DSM 571 catalyzes the phosphorolysis of sucrose with an optimal temperature of 55°C. This new enzyme was found to be the most stable SP enzyme so far, with a half-life time of 60 hours at the industrially relevant temperature of 60°C and a half temperature of inactivation (Γ50) of 69°C after 1 hour incubation. In addition, this new SP had a melting temperature of 78.5°C. In contrast to the T. thermosaccharolyticum SP, the putative SPs from Meiothermus silvanus DSM 9946 and Spirochaeta thermophila DSM 6192 did not catalyze the phosphorolysis of sucrose.
In addition, the present invention discloses that the above-described SP enzyme from Thermoanaerobacterium thermosaccharolyticum DSM 571 is much more active on fructose-6- phosphate as acceptor than on free fructose. The latter enzyme has thus a unique specificity that has never been described before and could be designated as a sucrose-6'-phosphate phosphorylase (S6'PP).
Therefore, the present invention relates in first instance to the use of a polypeptide having the amino acid sequence as depicted by SEQ ID N°l as a thermostable sucrose phosphorylase and/or as a thermostable sucrose-6'-phosphate phosphorylase.
The 'amino acid sequence as depicted by SEQ ID N° is the following Thermoanaerobacterium thermosaccharolyticum sucrose phosphorylase (TtSP) protein sequence:
MALKNKVQLITYPDSLGGNLKTLNDVLEKYFSDVFGGVHILPPFPSSGD GFAPITYSEIEPKFGTWYDIKKMAENF DILLDLMVNHVSRRSIYFQDFLKKGRKSEYADMFITLDKLWKDGKPVKGDIEKMFLRRTLPYSTFKIEETGEEEKV
WTTFGKTDPSEQIDLDVNSHLV EFLLEVFKTFSN FGVKIV LDAVGYVI KKIGTSCFFVEPEIYEFLDWAKGQAAS YGI ELLLEVHSQFEVQYKLAERGFLIYDFILPFTVLYTLI NKSN EM LYHYLKN RPINQFTM LDCHDGI PVKPDLDGLI D TKKAKEVVDICVQRGAN LSLIYGDKYKSEDGFDVHQI NCTYYSALNCDDDAYLAARAIQFFTPGI PQVYYVGLLAG VN DFEAVKKTKEGREI NRH NYGLKEI EESVQKNVVQRLLKLI RFRNEYEAFNGEFFIEDCRKDEIRLTWKKDDKRCS LFI DLKTYKTTIDYI NENGEEVKYLV
The term 'sucrose-6'-phosphate phosphorylase' refers to an enzyme which catalyzes the reversible phosphorolysis of sucrose-6'-phosphate into a-D-glucose-l-phosphate (a-Glc-l-P) and D-fructose-6- phosphate.
The present invention further relates to the use as described above wherein said amino acid sequence is encoded by the nucleic acid sequence as depicted by SEQ ID N°2 or SEQ ID N°3.
The nucleic acid sequence as depicted by SEQ I D N° 2 is the following Thermoanaerobacterium thermosaccharolyticum sucrose phosphorylase or sucrose-6'-phosphate phosphorylase encoding nucleic acid sequence:
ATGGCACTGAAAAACAAAGTCCAACTGATTACCTATCCGGACAGCCTGGGCGGTAACCTGAAAACCCTGAAT GACGTTCTGGAAAAATATTTCAGCGATGTGTTTGGCGGTGTTCATATCCTGCCGCCGTTCCCGAGCTCTGGT GACCGTGGTTTTGCACCGATTACCTACTCTGAAATCGAACCGAAATTCGGCACGTGGTACGATATTAAGAAA ATGGCTGAAAACTTCGACATCCTGCTGGATCTGATGGTTAATCACGTCAGTCGTCGCTCCATTTACTTTCAGG ACTTCCTGAAAAAAGGCCGCAAAAGTGAATATGCGGATATGTTTATTACCCTGGACAAACTGTGGAAAGATG GCAAACCGGTTAAAGGTGATATCGAAAAAATGTTCCTGCGTCGCACCCTGCCGTACTCCACGTTTAAAATTG AAGAAACCGGTGAAGAAGAAAAAGTCTGGACCACGTTCGGCAAAACGGATCCGTCAGAACAGATCGACCT G G ATGTC A ACTCG C ATCTG GTG CGTG A ATTTCTG CTG G AAGTGTTC AA AACCTTCTC A AACTTCG GTGTG A A AATTGTTCGCCTGGATGCGGTCGGCTATGTGATTAAGAAAATTGGCACGTCGTGCTTTTTCGTTGAACCGGA AATCTACGAATTTCTGGATTGGGCCAAAGGCCAGGCGGCCAGTTATGGTATTGAACTGCTGCTGGAAGTTCA CTCCCAGTTCGAAGTCCAATATAAACTGGCAGAACGTGGCTTTCTGATTTACGATTTCATCCTGCCGTTTACC GTGCTGTATACGCTGATCAACAAAAGTAACGAAATGCTGTACCATTACCTGAAAAACCGCCCGATTAATCAA TTTACCATGCTGGACTGCCACGATGGTATTCCGGTCAAACCGGACCTGGATGGCCTGATCGACACGAAAAAA GCGAAAGAAGTGGTTGATATTTGTGTGCAGCGTGGCGCCAACCTGAGCCTGATCTATGGTGATAAATACAA ATCTGAAGACGGCTTCGATGTTCATCAAATTAACTGCACCTATTACAGCGCTCTGAATTGTGATGACGATGCG TATCTGGCAGCTCGCGCCATTCAGTTTTTCACGCCGGGTATCCCGCAAGTTTATTACGTCGGCCTGCTGGCAG GTGTGAACGATTTTGAAGCTGTGAAGAAAACCAAAGAAGGTCGTGAAATTAACCGCCACAATTACGGCCTG AAAGAAATCGAAGAATCTGTGCAGAAAAATGTCGTGCAACGTCTGCTGAAACTGATCCGTTTCCGCAACGAA
TATGAAGCCTTTAATGGCGAATTTTTCATTGAAGACTGCCGTAAAGATGAAATCCGCCTGACCTGGAAAAAA GACGATAAACGCTGTAGCCTGTTTATTGATCTGAAAACCTACAAAACGACGATTGATTACATTAACGAAAAC GGTGAAGAAGTGAAATACCTGGTTTAA
The nucleic acid sequence as depicted by SEQ I D N° 3 is the following Thermoanaerobacterium thermosaccharolyticum sucrose phosphorylase or sucrose-6'-phosphate phosphorylase encoding nucleic acid sequence which, compared to SEQ ID N°2, has been codon optimized for expression in E. coli and comprises a sequence coding for a N-terminal His6-tag (underlined): ATG GGCGGTTCGCACCACCACCACCACCACGG C ATG G CTAG C ATG G C ACTG A A AA AC AA AGTCC A ACTG ATT ACCTATCCGGACAGCCTGGGCGGTAACCTGAAAACCCTGAATGACGTTCTGGAAAAATATTTCAGCGATGTG TTTGGCGGTGTTCATATCCTGCCGCCGTTCCCGAGCTCTGGTGACCGTGGTTTTGCACCGATTACCTACTCTG AAATCGAACCGAAATTCGGCACGTGGTACGATATTAAGAAAATGGCTGAAAACTTCGACATCCTGCTGGATC TGATGGTTAATCACGTCAGTCGTCGCTCCATTTACTTTCAGGACTTCCTGAAAAAAGGCCGCAAAAGTGAAT ATGCGGATATGTTTATTACCCTGGACAAACTGTGGAAAGATGGCAAACCGGTTAAAGGTGATATCGAAAAA ATGTTCCTGCGTCGCACCCTGCCGTACTCCACGTTTAAAATTGAAGAAACCGGTGAAGAAGAAAAAGTCTGG ACCACGTTCGGCAAAACGGATCCGTCAGAACAGATCGACCTGGATGTCAACTCGCATCTGGTGCGTGAATTT CTGCTGGAAGTGTTCAAAACCTTCTCAAACTTCGGTGTGAAAATTGTTCGCCTGGATGCGGTCGGCTATGTG ATTAAGAAAATTGGCACGTCGTGCTTTTTCGTTGAACCGGAAATCTACGAATTTCTGGATTGGGCCAAAGGC CAGGCGGCCAGTTATGGTATTGAACTGCTGCTGGAAGTTCACTCCCAGTTCGAAGTCCAATATAAACTGGCA GAACGTGGCTTTCTGATTTACGATTTCATCCTGCCGTTTACCGTGCTGTATACGCTGATCAACAAAAGTAACG AAATGCTGTACCATTACCTGAAAAACCGCCCGATTAATCAATTTACCATGCTGGACTGCCACGATGGTATTCC GGTCAAACCGGACCTGGATGGCCTGATCGACACGAAAAAAGCGAAAGAAGTGGTTGATATTTGTGTGCAGC GTGGCGCCAACCTGAGCCTGATCTATGGTGATAAATACAAATCTGAAGACGGCTTCGATGTTCATCAAATTA ACTGCACCTATTACAGCGCTCTGAATTGTGATGACGATGCGTATCTGGCAGCTCGCGCCATTCAGTTTTTCAC GCCGGGTATCCCGCAAGTTTATTACGTCGGCCTGCTGGCAGGTGTGAACGATTTTGAAGCTGTGAAGAAAA CCAAAGAAGGTCGTGAAATTAACCGCCACAATTACGGCCTGAAAGAAATCGAAGAATCTGTGCAGAAAAAT GTCGTGCAACGTCTGCTGAAACTGATCCGTTTCCGCAACGAATATGAAGCCTTTAATGGCGAATTTTTCATTG AAGACTGCCGTAAAGATGAAATCCGCCTGACCTGGAAAAAAGACGATAAACGCTGTAGCCTGTTTATTGATC TGAAAACCTACAAAACGACGATTGATTACATTAACGAAAACGGTGAAGAAGTGAAATACCTGGTTTAA
The invention further relates to the use as described above wherein said amino acid sequence is depicted by SEQ ID N°4.
The amino acid sequence as depicted by SEQ I D N° 4 is the following Thermoanaerobacterium thermosaccharolyticum sucrose phosphorylase or sucrose-6'-phosphate phosphorylase amino acid
sequence which, compared to SEQ ID N° 1, comprises a N-terminal His6-tag (underlined): MGGSHHHHHHGMASMALKNKVQLITYPDSLGGNLKTLNDVLEKYFSDVFGGVHILPPFPSSGD GFAPITYSEIE PKFGTWYDIKKMAENFDILLDLMVNHVSRRSIYFQDFLKKGRKSEYADMFITLDKLWKDGKPVKGDIEKMFLRRT LPYSTFKIEETGEEEKVWTTFGKTDPSEQIDLDVNSHLVREFLLEVFKTFSNFGVKIVRLDAVGYVIKKIGTSCFFVEP EIYEFLDWAKGQAASYGIELLLEVHSQFEVQYKLAERGFLIYDFILPFTVLYTLINKSNEMLYHYLKNRPINQFTMLD CHDGIPVKPDLDGLIDTKKAKEVVDICVQRGANLSLIYGDKYKSEDGFDVHQINCTYYSALNCDDDAYLAARAIQF FTPGIPQVYYVGLLAGVNDFEAVKKTKEGREINRHNYGLKEIEESVQKNVVQRLLKLIRFRNEYEAFNGEFFIEDCR KDEIRLTWKKDDKRCSLFIDLKTYKTTIDYINENGEEVKYLV
The present invention relates to the use as described above wherein said thermostability means that said sucrose phosphorylase or said sucrose-6'-phosphate phosphorylase has, during a phosphorolysis or synthesis reaction at a pH between 5.0 and 7.5 and a temperature between 50°C and 70°C, a half-life of at least 20 hours. The term 'thermostability' thus means that the sucrose phosphorylase or sucrose-6'-phosphate phosphorylase of the present invention has, during a phosphorolysis or synthesis reaction as described elsewhere in the present disclosure, at a pH of 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1, 7.2, 7.3, 7.4, or, 7.5, and, at a temperature of 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 or 70 °C, a half-life of 20, 21, 22, 25, 30, 35, 40,..., 45,..., 50, 55,..., 60, 61, 62, 63,..., 70,...75,...80, 81, 82, 83, or more hours. More specifically, the present invention relates to the use as described above wherein said thermostability means that said sucrose phosphorylase or sucrose-6'-phosphate phosphorylase has, during a phosphorolysis or synthesis reaction at an enzyme concentration of about 8.5 μg/ml, at a pH between 6.0 and 6.5 and at a temperature of about 60°C, a half-life of at least 60 hours. The latter thermostability thus specifically means that that the sucrose phosphorylase or sucrose-6'-phosphate phosphorylase of the present invention has, during a phosphorolysis or synthesis reaction as described elsewhere in the present disclosure, and at an enzyme concentration of 8.0, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9 or 9.0 μg/ml, at a pH of 6.0, 6.1, 6.2, 6.3, 6.4 or 6.5 and at a temperature of 55, 56, 57, 58, 59, 60, 61, 62, 63, 64 or 65 °C, a half-life of 60, 61, 62, 63, 64, 65,..., 70,...75,...80, 81, 82, 83, 84, 85, or more hours.
The 'thermostability' of the enzyme of the present invention can be determined by any method known in the art. More specific enzyme assays, such as enzyme activity assays, determinations of the temperature optimum of the enzymes, the influence of pH on enzyme activity, determination
of the kinetic temperature stability and the determination of the thermodynamic stability of the enzyme of the present invention are described elsewhere in the present disclosure.
The present invention further relates to the use as described above wherein said polypeptide has an amino acid sequence which is at least 90% identical to the amino acid sequence as depicted by SEQ ID N°l or wherein said polypeptide is a fragment of the amino acid sequence as depicted by SEQ ID N°l. More specifically, the present invention relates to the use as described above wherein said variant or fragment comprises the amino acid regions 45-56, 131-207, 236-310 and 340-358 of SEQ ID N°l.
The present invention further discloses that the amino acid histidine (=1-1 or His) on amino acid position 344 of SEQ ID N° 1 is important for the enzyme's activity on fructose-6-phosphate as acceptor. The present invention relates to the use as described above wherein said variant or fragment phosphorolyzes sucrose-6'-phosphate and comprises the amino acid histidine at amino acid position 344. The term 'fragment' refers to a protein (or peptide or polypeptide) containing fewer amino acids than the amino acid sequence as depicted by SEQ ID N° 1 and that retains said sucrose phosphorylase- or sucrose-6'-phosphate phosphorylase activity. Such fragment can -for example- be a protein with a deletion of 10% or less of the total number of amino acids at the C- and/or N-terminus. More specifically, said fragment comprises the amino acid regions 45-56, 131- 207, 236-310 and 340-358 of SEQ ID N°l or comprises the amino acid histidine at amino acid position 344 of SEQ ID N° 1. The term "variant" refers to a protein having at least 90 % sequence identity (i.e. having at least 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% sequence identity) with SEQ ID N° 1 and that retains said sucrose phosphorylase- or sucrose-6'-phosphate phosphorylase activity. More specifically, said variant comprises the amino acid regions 45-56, 131-207, 236-310 and 340-358 of SEQ ID N°l or comprises the amino acid histidine at amino acid position 344 of SEQ ID N° 1.
The percentage of amino acid sequence identity is determined by alignment of the two sequences and identification of the number of positions with identical amino acids divided by the number of amino acids in the shorter of the sequences x 100. Typically the latter 'variant' may differ from the protein as depicted by SEQ ID N° 1 only in conservative substitutions and/or modifications, such that the ability of the protein to have sucrose phosphorylase- or sucrose-6'-phosphate phosphorylase activity is retained. A "conservative substitution" is one in which an amino acid is
substituted for another amino acid that has similar properties, such that one skilled in the art of protein chemistry would expect the nature of the protein to be substantially unchanged. In general, the following groups of amino acids represent conservative changes: (1) ala, pro, gly, glu, asp, gin, asn, ser, thr; (2) cys, ser, tyr, thr; (3) val, ile, leu, met, ala, phe; (4) lys, arg, his; and (5) phe, tyr, trp, his.
Variants may also (or alternatively) be proteins as described herein modified by, for example, the deletion or addition of amino acids that have minimal influence on the sucrose phosphorylase- or sucrose-6'-phosphate phosphorylase activity as defined above, secondary structure and hydropathic nature of the enzyme. Furthermore, the term variants also refers to any glycosylated protein or fragments thereof as described above.
The present invention further relates to a method to produce D-fructose, D-fructose-6-phosphate and/or alpha-D-glucose -1-phosphate at a temperature above 50°C (i.e. 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 or 70°C) comprising: i) contacting a polypeptide as defined above with sucrose or sucrose-6'-phosphate and inorganic phosphate, ii) phosphorolyse sucrose or sucrose-6'-phosphate to obtain D-fructose, D-fructose-6-phosphate and/or alpha-D- glucose -1-phosphate, and iii) purifying said D-fructose, D-fructose-6-phosphate and/or alpha-D- glucose -1-phosphate.
Specific but non-limiting embodiments of the above-cited method are described elsewhere in the present disclosure. Alternatively, the present invention also relates to a method to produce an alpha-D-glucoside at a temperature above 50°C (i.e. 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 or 70°C)comprising: i) contacting a polypeptide as defined above with either alpha-D-glucose -1- phosphate, sucrose or sucrose-6'-phosphate as donor and an appropriate acceptor such as a monosaccharide, a phosphorylated monosaccharide, an aliphatic or aromatic alcohol, a furanone, a flavanoid or a phenolic compound, ii) glycosylating said monosaccharide, phosphorylated monosaccharide, aliphatic or aromatic alcohol, furanone, flavanoid or phenolic compound to obtain an alpha-D-glucoside, and iii) purifying said alpha-D-glucoside.
More specifically, the present invention relates to a method as described above wherein said acceptor is L-sorbose, D-fructose, D-fructose-6-phosphate, D-psicose, D-tagatose, D-glucose, ascorbic acid, hexanol, catechol, pyridoxine, catechin, quercetin, glycerol, vanillin or 4-hydroxy-2,5- dimethyl-3(2H)- furanone (= furanone HDMF).
Specific but non-limiting embodiments of the above-cited method are described elsewhere in the present disclosure.
The present invention also relates to an isolated amino acid sequence as depicted by SEQ ID N°4 and an isolated nucleic acid sequence as depicted by SEQ ID N°3. The term 'nucleic acid' as used herein corresponds for example to DNA, cDNA, NA, sense and anti- sense nucleic acids and the like. Said nucleic acids can be incorporated in appropriate vectors such as plasmids and appropriate host cells such as Escherichia can be transfected with said vectors. The present invention further relates to the use of a microorganism expressing a polypeptide having the amino acid sequence as depicted by SEQ ID N°l or SEQ ID N°4 to provide a thermostable sucrose phosphorylase or a thermostable sucrose-6'-phosphate phosphorylase. The latter microorganism can be any microorganism known in the art but specifically relates to the thermophilic bacterium Thermoanaerobacterium thermosaccharolyticum or to the bacterium Escherichia coli.
The present invention further relates to a method to produce an alpha-D-glucoside comprising: i) contacting a polypeptide as defined above with either alpha-D-glucose -1-phosphate, sucrose or sucrose-6'-phosphate as donor and an appropriate acceptor, ii) glycosylating said acceptor to obtain an alpha-D-glucoside, and iii) purifying said alpha-D-glucoside, wherein said glycosylation is carried out in a two-phase system with an organic solvent phase containing the acceptor and an aqueous buffer phase containing said polypeptide as defined above and said donor. The term 'a two-phase system' relates to any two-phase system described in the art such as for example described in the work of Vulfson17 and Carrea 18.The term 'organic phase' relates to a phase wherein for example ethyl acetate, n-butyl acetate, methyl ieri-butyl ether, diethyl ether, pentane, hexane or octane is present as solvent and further contains the acceptor molecule (for example at a concentration of 1-500 g/L). The term 'aqueous buffer phase' contains the enzyme of the present invention (for example at a concentration of 0.1-500 U mL"1) and donor substrate (for example at a concentration of 0.05-3 M). The latter method can take place at temperature between 30 and 70 °C, at a pH between 6 and 9, and the ratio between the aqueous and organic (solvent) phase can be between 0.01 and 100.
The present invention specifically relates to a method as described above wherein said acceptor is a non-carbohydrate acceptor (i.e. any appropriate acceptor which is not a carbohydrate), and more
specifically to a method as describe above wherein said non-carbohydrate acceptor is cinnamyl alcohol, geraniol, propyl gallate, ethyl gallate, resorcinol, pyrogallol, saligenin or methyl gallate.
The present finally relates to the use as described above wherein said amino acid sequence is encoded by the nucleic acid sequence as depicted by SEQ ID N°2 or SEQ ID N°3. The present invention will further be illustrated by the following non-limiting examples.
Examples
A. Materials and methods Sequence analysis All the available full length protein sequences to date classified in family GH13 subfamily 18 were extracted from the CAzy database (URL: http://www.cazy.org/) 19 and aligned using ClustalW2. The extracted sequences were subjected to a pair wise and slow alignment using the Gonnet protein weight matrix with a gap opening of 10, a gap extension of 0.2 and a gap distance of 5. The neighbor joining algorithm was used to cluster and to build a non-rooted tree. Finally the tree was visualized using Mega 4.0 20 and rooted on the midpoint.
Enzyme production and purification
The new SP genes were codon optimized for Escherichia coli and chemically synthesized by GenScript (Piscataway, NJ, USA) including a sequence coding for a N-terminal His6-tag and the EcoRI restriction site (underlined) at the 5' prime end (GAATTCGGAGGAAACAAAGATGGGCGGTTCGCACCACCACCAC CACCACGGCATGGCTAGC = SEQ ID N°5) and a Pstl restriction site at the 3' prime end. Next the synthetic genes were cloned into the constitutive expression vector pCXP34h 11 using the respective restriction endonucleases. The resulting expression plasmids were transformed in E. coli CGSC 8974. In addition, for the SP from B. adoloscentis, the expression plasmid constructed in 11 was used. For enzyme production, 2 % of an overnight culture was inoculated in 500 mL LB medium containing 100 μg/mL ampicillin in a 2 L shake flask and incubated at 37 °C with continuous shaking at 200 rpm for 6 hours. The produced biomass was harvested by centrifugation for 15 minutes at 12000 x g and 4 °C, washed with 50 mL PBS buffer (300 mM NaCI and 50 mM NaH2P04 at pH 8) and the obtained cell pellets were stored at -20 °C. The cell pellets were then thawed and dissolved in 20 mL lysis buffer (300 mM NaCI, 10 mM
imidazole , 0.1 mM PMSF and 50 mM NaH2P04 at pH 8) supplemented with lysozyme and DNasel in a final concentration of 1 mg/mL and 6 mU/mL, respectively. This cell suspension was incubated on ice for 30 minutes and sonicated 3 times for 2.5 minutes (Branson sonifier 250, level 3, 50 % duty cycle). The His6-tagged proteins were purified by Ni-NTA chromatography as described by the supplier (Qiagen), after which the buffer was exchanged to 50 mM MOPS pH 7 in a Centricon YM-30 (Millipore). The protein content was analyzed measuring the absorbance at 280 nm. The extinction coefficients for the His6-tagged proteins were calculated using the Protparam tool on the expasy server (URL: http://web.expasy.org/protparam/).
Enzyme assays and enzyme characterization The enzyme activity has been measured in both directions of the equilibrium reaction using a discontinuous assay. Initial reaction rates for the phosphorolysis of sucrose were measured by quantifying the release of fructose using the bicinchoninic acid (BCA) assay and the release of inorganic phosphate from a-glucose-l-phosphate was monitored in the synthetic direction using the phosphomolybdate assay like described before 6. First the temperature optimum was determined in the phosphorolytic direction using 350 mM sucrose and 350 mM sodium phosphate buffer at pH 6.5 in a range from 40 to 70 °C. Reactions were monitored for 15 min in a heating block with sampling at regular intervals. Inactivation of the samples occurred by the alkaline environment of the assay solution.
The influence of pH on enzyme activity was measured in the range of pH 4.5 to 8 using acetate (pH 4.5), MES (pH 5.0 - 6.5) and MOPS (pH 7 - 8)) buffers with a concentration of 50 mM. The pH of the substrate solutions was set at the temperature of measurement with NaOH or HCI. The apparent kinetic parameters for sucrose as well as a-Glc-l-P as donor and for inorganic phosphate and fructose as acceptor were determined at optimal pH and temperature. The parameters were calculated by non-linear regression of the Michaelis-Menten equation using Sigma Plot 11.0. The specificity toward different putative acceptors (Table 3) of reducing and non-reducing nature was analyzed in assays of 30 min with the phosphate and BCA assay, respectively, using 100 mM donor and 200 mM acceptor at pH 6.5 and 55°C. However, to improve the solubility of the hydrophobic acceptors, 25 % (v/v) DMSO was added to the reaction mixture and acceptor was added up to the solubility barrier, not exceeding 200 mM. The kinetic temperature stability was examined by incubating purified enzyme (35 μg/mL) for 1 h in a gradient thermocycler (Biometra, Goettingen, Germany) set to a temperature range of 57 - 73°C,
followed by 15 min cooling to 16°C. The residual activity of the enzyme was determined in the phophorolytic direction using the standard conditions described above. In addition the half life time (tso), was evaluated by incubating purified enzyme (8.5 μg/mL) in a water bath at 60 °C with sampling at regular time intervals. The residual activity was then measured and compared to the activity of the untreated enzyme.
The thermodynamic stability was measured using differential scanning fluorimetry (DSF) 21 in a Rotor-Gene Q cycler with HRM channel (Qiagen). For optimal results 10 μg purified protein was used with 1.25 μΙ SYPRO Orange (400x diluted) (Sigma-Aldrich) in 25 μί. The gain was optimized before the temperature increase was started. The temperature increases from 35°C to 95°C, rising 1°C each step in 5 s steps. The fluorescent signal is detected at 510 nm with the green detection filter and the excitation occurs at 460 nm with a HRM lamp. The melting temperature (Tm) (inflection point of melt curve) is determined by calculating the maximum of the first derivative of the melt curve using the Rotor-Gene Q software (Qiagen).
Homology modeling and mutagenesis A homology model was generated with the YASARA software (YASARA biosciences, Vienna) using 1R7A, 2GDV and 2GDU of the closely related SP from B. adolescenstis as model templates 22' 23. The structure was visualized with PyMol 1.2 (DeLano Scientific LLC). Selected positions were mutated following a modified two-stage megaprimer-based whole-plasmid PCR method, as described previously 36. The constructs were subjected to nucleotide sequencing (AGOWA sequence service, Berlin) to confirm that the correct mutations had been introduced, and to exclude the presence of undesirable mutations. The mutated genes were then expressed, purified and characterized as described for the wild-type enzyme.
Enzymatic glucosylation of non-carbohydrate acceptors The glucosylation of various non-carbohydrate acceptors was carried out at 100 mL scale in magnetically stirred reaction vessels. To that end, a two-phase system was used with either ethyl acetate, n-butyl acetate, methyl ieri-butyl ether, diethyl ether, pentane, hexane or octane as organic phase containing the acceptor molecule (1-500 g L 1), and an aqueous buffer system containing the enzyme (0.1-500 U mL"1) and donor substrate (0.05-3 M). The temperature was varied between 30 and 70 °C, the pH between 6 and 9, and the ratio between the aqueous and solvent phase between 0.01 and 100.
After 24 h, samples were taken and subjected to HPLC analysis. Separation was achieved using a Waters X-bridge amide column (250 x 4.6 mm, 3.5 μιτι) with milliQ water (solvent A) and acetonitrile (solvent B), both containing 0.2 % triethylamine, as the mobile phase. The flow rate and temperature were set at 1.0 mL min"1 and 30 °C, respectively. The gradient elution was as follows: 95 % of solvent A (0 - 12 min), 5 to 25 % solvent B (12 - 15 min), 25 % solvent B (15 - 40 min), 25 to 5 % solvent B (40 - 41 min) and 95 % solvent A (41 - 50 min). Adequate detection was obtained with an Alltech 2000ES evaporative light scattering detector (ELSD).
B. Results
Selection of thermostable sequences To obtain a better understanding in the genetic diversity of SP, a phylogenetic tree was constructed from all the putative SP genes classified in the a-amylase family subfamily 18 (GH13-18). So far, there is only one specificity demonstrated for this subfamily, i.e. the phosphorolysis of sucrose 4. Currently, around 250 sequences have been assigned as putative SPs originating from about 115 bacterial species. To date no putative SP genes could be identified in archaea or eukaryotes (URL: www.cazy.org/). Genes classified among subfamily 18 are found in a genetic diverse group of microorganisms like lactic acid bacteria (25% of the sequences), soil and marine bacteria, inhabitants of the gastro-intestinal tract and even in cyanobacteria.
From the 115 different species harboring a (putative) SP gene, 8 of them grow with optimal temperatures between 55 and 67.5 °C (Table 1). From the family Thermaceae, putative SP sequences from 4 different species are available and they are 555 to 588 AA in length and phylogenetically related. Besides members from the Thermaceae family, two sequences originating from Thermoanaerobacterium are classified in GH13-18 (Table 1) and they are for 91 % identical. The sequences are 488 AA long and they are most related to SPs from lactic acid bacteria which are extensively described in literature. Furthermore a putative SP can be found in Spicrochaeta thermophila and Geobacillus thermodenitrificans.
Table 1. Putative SP sequences from thermophilic sources
Organism Uniprot ID Growth Reference temperature5 (°C)
Thermaceae
24
Marinithermus hydrothermalis DSM 14884 AEB11435.1* 50-72.5 (67.5)
25
Meiothermus ruber DSM 1279 D3PQE0 35-70 (60)
26
Meiothermus silvanus DSM 9946 D7BAR0 40-65 (55)
27
Oceanithermus profundus DSM 14977 E4U9 0 40-68 (60)
Thermoanaerobacterales Family III. Incertae
Sedis
28
Thermoanaerobacterium D9TT09 45-70 (60)
thermosaccharolyticum DSM 571
28
Thermoanaerobacterium xylanolyticum LX-11 AEF16977.1* 45-70 (60)
Spirochaetaceae
29
Spirochaeta thermophila DSM 6192 E0RTJ0 40-73 (66)
Bacillaceae
30
Geobacillus thermodenitrificans NG80-2 A4ITA6 45-73 (65)
* Genbank identifier
$ Optimal growth temperature is given between brackets
Selected sequences are in bold
Determination of substrate specificity
Three genetically diverse GH13-18 enzymes originating from the thermophiles Meiothermus silvanus DSM 9946 (MsSP), Spirochaeta thermophila DSM 6192 (StSP) and Thermoanaerobacterium thermosaccharolyticum DSM 571 (TtSP) were selected for recombinant expression. To that end, their genes were chemically synthesized with a codon usage that is optimal for the host strain E. coli. Furthermore, a N-terminal His-tag was also added, which allowed their purification in a single- step by means of affinity chromatography.
First, the purified enzymes were assayed for phosphorolytic activity on different a-linked disaccharides existing of a glucose moiety connected to either a fructose or glucose moiety. Surprisingly, only the enzyme from T. saccharolyticum could catalyze the phosphorolysis of sucrose. In contrast, the isolates from S. thermophila and M. silvanus did not phosphorolyze any of the selected dissacharides with a significant activity. Changing the reaction pH in the range of 4.5 to 8 or adding CaCI2 or MgCI2 as cofactors (0.1-10 mM) did not help to phosphorolyze sucrose. Therefore the latter enzymes (StSP and MsSP) cannot be assigned as sucrose phosphorylases, and
must thus represent a new specificity that has not yet been identified. This shows that enzyme annotations based on sequence alignments are merely predictions that cannot be taken for granted. Indeed, activity measurements can still yield surprising results and reveal unexpected patterns in substrate profiles. Determination of kinetic parameters of the SP of T. thermosaccharolyticum
Since no phosphorolysis of sucrose could be demonstrated for the enzymes from S. thermophila and M. silvanus, only the SP from T. thermosaccharolyticum was studied in detail. First the optimal temperature was determined and found to be 55°C for TtSP (Figure 1). Unexpectedly, this enzyme had a broad temperature optimum in the range of 45 to 65°C (> 80% relative activity) and has a substantial higher optimal temperature than the SP enzymes isolated from lactic acid bacteria or Pelomonas for example, which have an optimal temperature between 30 and 37 °C 5. On the other hand the optimal temperature of the SP from B. adolescentis, which is astonishingly high for a mesophilic isolate (58°C), is comparable with the T. thermosaccharolyticum isolate 12.
Next the influence of the pH on the phosphorolysis and synthesis reaction was investigated in a range between 4.5 and 8 (Figure 1). For both reactions, the optimum was pH 6.5, but for the synthesis reaction pH 6 nearly had the same maximal activity. This result is in good agreement with other characterized mesophilic homologues which all had an optimal pH between 6 and 7 5.
The apparent kinetic parameters have been determined for donor and acceptor in both directions at pH 6.5 and 55°C (Table 2) Surprisingly, TtSP has a somewhat higher Km of 76.5 ± 10.3 mM for sucrose than what is typically expected for a SP, i.e. between 1 and 15 mM for mesophilic isolates 6. On the other hand, the Km for a-Glc-l-P and inorganic phosphate is in the same range as previously reported for other SPs 31. In terms of catalytic turnover, TtSP has a kcat of around 60 s"1 and this is in the same range as the most efficient SP enzymes like those from Leuconostoc mesenteroides ATTC 12291 and B. adolescentis 6.
Table 2. Apparent kinetic parameters for Thermoanaerobacterium thermosaccharolyticum SP (TtSP). Michaelis Menten curves were obtained using 11 levels of varying substrate concentration together with 350 mM of co-substrate in the phophorolytic direction and 200 mM of co-substrate in the synthetic direction at 55°C and pH 6.5.
Enzyme Varying substrate Km (mM) kcat is 1) kcat/Km
TtSP Sucrose 76.5 ± 10.3 66.2 ± 4.5 0.87
Phosphate 6.9 ± 0.6 59.3 ± 3.1 8.82
a-Glc-lP 15.6 ± 1.8 12.4 ± 0.7 0.79
Fructose 41.6 ± 5.3 19.1 ± 1.3 0.45
Activity on alternative acceptor substrates
Because the affinity of TtSP for fructose is rather low, alternative acceptors were also tested. Interestingly, fructose-6-phosphate was found to generate an activity that is almost twice as high as that on fructose (Table 3). Furthermore, detailed kinetic analysis revealed that the affinity for the phosphorylated acceptor is also much higher, corresponding to a Km of 15 mM instead of 42 mM. The enzyme also prefers sucrose-6'-phosphate over sucrose as substrate in the phosphorolysis reaction. It represents a unique specificity that has never before been described and can be designated as sucrose-6'-phosphate phosphorylase. It is important to note that the phosphate group can only be present on the fructose moiety and not on the glucose moiety (Fig. 6). Indeed, absolutely no activity could be detected with fructose as acceptor and glucose-l,6-bisphosphate as donor.
As widely known, SP is a promiscuous enzyme that is able to transfer a glucose moiety from either sucrose or a-Glc-l-P to various alternative acceptors, al beit a reduced rate 6. The acceptor specificity of TtSP was, therefore, tested with different monosaccharides, sugars alcohols and non- carbohydrate molecules. As found for other SPs, the monosaccharide /.-sorbose is the best alternative acceptor for TtSP and generates an activity that is almost half of that of the wild-type reaction. In contrast, D-psicose and D-tagatose generate a 10-fold lower transglucosylation rate, while D-galactose and D-mannose are almost not accepted. The transglucosylation efficiency is also pretty high with glycerol (a sugar alcohol), whereas activity towards non-carbohydrate acceptors is low but in the same order as with other SP enzymes (2).
Table 3. Transglucosylation activity of TtSP.
D-Psicose* 1.7 Catechol5 0.4
D-Tagatose* 2.6 Pyridoxine* 0.7
/.-Sorbose* 9.9 Catechin$ 0.1
D-Glucose* 0.3 Quercetin$ 0.1
D-mannose* 1.5 Glycerol* 3.1
D-Galactose* 1.2 furanone HDMF$ 0.1
ascorbic acid* 0.3 vanillin5 0.5
* 100 mM a-Glc-l-P as donor and 200 mM acceptor in 50 mM MES, pH 6.5 and 55°C.
$ 100 mM sucrose as donor and 200 mM acceptor in 50 mM MES, pH 6.5 and 25 % (v/v) DMSO at
55°C.
Enzymatic synthesis of glycosides
Surprisingly, the use of a two-phase system allowed the efficient glucosylation of a wide range of non-carbohydrate acceptors (Table 4). These reactions were first evaluated with 10 U mL"1 SP at pH 7, using ethyl acetate used as second phase in a 1:1 ratio. The yields were then optimized by varying the concentration of sucrose (0.05-3 M), acceptor (1-500 g L 1) and the reaction temperature (30-70 °C). All of these parameters were found to significantly influence glucosylation yields, with optima at 2 M sucrose, 100 g L"1 acceptor and 50 °C. Next, the pH of the aqueous phase was varied, revealing an optimum at pH 7.5. Finally, different solvents were tested, but none of these performed significantly better than ethyl acetate, which gave the highest yields when buffer was added at a ratio of 5:3.
Optimal activities were thus observed with ethyl acetate containing 100 g L"1 acceptor as organic phase, and a buffer at pH 7.5 containing SP and 2 M sucrose as aqueous phase. Both phases were mixed at a ratio of 5:3 and incubated at 50 °C (Table 4). After several hours, glycosylated products could clearly be observed by HPLC. At the end of the reactions, yields in the range of 60 % were obtained for ethyl and propyl gallate, and the yields even went up to 70-80 % for resorcinol and pyrogallol. However, the highest glucosylation yields were observed when using saligenin (97%) and methyl gallate (98%) as acceptor. Moreover, the concentration of the produced glycosides is well within the industrial relevant range (35-85 g L"1). Although the yields with cinnamyl alcohol and geraniol are rather low due to the use of the pure acceptor as solvent phase, more than reasonable product concentrations of 41 and 61 g L"1, respectively, were achieved.
Table 4. Production of glycosides with TtSP
Determination of thermostability of the SP of T. thermosaccharolyticum The influence of the temperature on the stability was determined for the TtSP enzyme and compared to currently the most stable SP enzyme, isolated from B. adolescentis (BaSP). The kinetic stability, i.e. the length of time a protein remains active before undergoing irreversible denaturation 32, was assessed using two measures. First, the half-life (t50) at the industrially relevant temperature of 60°C was evaluated and was found to have increased almost 3-fold for TtSP (60 h) compared to BaSP (21h) (Figure 2). Similarly, the half temperature of inactivation (Γ50) after 1 hour incubation was found to be 3°C higher for TtSP (69°C) than for BaSP (66°C) (Figure 3). In addition, the enzyme's thermodynamic stability, i.e. the tendency of a protein to reversibly unfold 32, was evaluated using differential scanning fluorimetry. In contrast to the kinetic stability, the two SP enzymes were found to have a similar thermodynamic stability, corresponding to a melting temperature (Tm) of about 78°C (Figure 4).
Structural analysis of the SP of T. thermosaccharolyticum
To identify crucial residues in the structure of TtSP, a homology model was constructed using the crystal structure (2GDU) of the closely related SP from B. adolescentis as template 11. From the 488 target residues 441 were aligned to template residues (90.4%). Among these aligned residues, the sequence identity is 39.5% and the sequence similarity is 60.8%. The unaligned residues comprising 13 loops were modeled with the YASA A software. From the final model (Figure 5), Aspl97 can be assigned as the catalytic nucleophile, Glu238 as the catalytic acid-base and Asp296 as the transition state stabilizer (11). In addition, two aromatic residues are known to interact with the sugar moiety in the donor subsite, i.e. the hydrophobic platform Phel57 33 and the hydrophobic sandwich Phe52 34.
All of the residues that are found here to make up the enzyme's active site are located on either the a-helix 236-245 or on the loops 45-56, 131-166, 184-207, 279-310 and 340-358. These regions must thus be considered to be crucial for the enzyme's activity. For example, the significance of Asp342 for the binding of fructose has already been demonstrated 3S, while His240 and Gln345 are seen here to form a hydrogen bond with the C3-OH and C3/6-OH of fructose, respectively. In addition, His344 and Argl35 were found to be crucial for the binding of phosphate groups, since mutating these to alanine resulted in a dramatic decrease in phosphorolytic activity. Furthermore, a multiple sequence alignment revealed that His344 is replaced by a tyrosine in all other sucrose phosphorylases, and introducing the corresponding mutation in TtSP resulted in a loss of preference for fructose-6-phosphate over fructose as acceptor substrate. This position thus plays a pivotal role in determining the enzymes' specificity.
Taken together, sucrose phosphorylase is a promising biocatalyst for the production of a- glucosides. For the commercial exploitation of its transglucosylation potential, however, thermostable respresentatives are desired. In this invention, the SP from the thermophilic organism T. thermosaccharolyticum is described. Determination of the enzymatic properties revealed that this enzyme is the most stable SP yet reported, with a half-life of 60 hours at 60°C. Inspection of its acceptor promiscuity showed a similar pattern as for other SP enzymes 6, reflecting the industrial potential of this new biocatalyst.
References
1. B. Henrissat, Biochemical Journal, 1991, 280, 309-316.
2. B. Henrissat and A. Bairoch, Biochemical Journal, 1996, 316, 695-696.
3. B. O. Kagan, S. n. Latker and E. M. Zfasman, Biokhimiya, 1942, 7, 93-108.
4. M. R. Stam, E. G. J. Danchin, C. Rancurel, P. M. Coutinho and B. Henrissat, Protein Engineering Design & Selection, 2006, 19, 555-562.
5. C. Goedl, T. Sawangwan, P. Wildberger and B. Nidetzky, Biocatal. Biotransform, 2010, 28,
10-21.
6. D. Aerts, T. F. Verhaeghe, B. I. Roman, C. V. Stevens, T. Desmet and W. Soetaert, Carbohydrate Research, 2011, 346, 1860-1867.
7. C. Goedl, T. Sawangwan, M. Mueller, A. Schwarz and B. Nidetzky, Angewandte Chemie- International Edition, 2008, 47, 10086-10089.
8. G. D. Haki and S. K. Rakshit, Bioresource Technology, 2003, 89, 17-34.
9. S. Bershtein, K. Goldin and D. S. Tawfik, Journal of Molecular Biology, 2008, 379, 1029-1044. 10. J. D. Bloom, S. T. Labthavikul, C. R. Otey and F. H. Arnold, Proc. Natl. Acad. Sci. U. S. A., 2006,
103, 5869-5874.
11. D. Aerts, T. Verhaeghe, M. De Mey, T. Desmet and W. Soetaert, Engineering in Life Sciences, 2011, 11, 10-19.
12. A. Cerdobbel, T. Desmet, K. De Winter, J. Maertens and W. Soetaert, J. Biotechnol., 2010,
150, 125-130.
13. L. D. Unsworth, J. van der Oost and S. Koutsopoulos, Febs Journal, 2007, 274, 4044-4056.
14. A. Cerdobbel, K. De Winter, T. Desmet and W. Soetaert, Biotechnol. J., 2010, 5, 1192-1197.
15. K. Fujii, M. liboshi, M. Yanase, T. Takaha and T. Kuriki, Journal of applied glycoscience, 2006,
53, 91-97.
16. A. Cerdobbel, K. De Winter, D. Aerts, R. K. P. Kuipers, H. J. Joosten, W. Soetaert and T.
Desmet, Protein Eng., Des. Sel., 2011, submitted.
17. E. N. Vulfson, R. Patel and B. A. Law, Biotechnology Letters, 1990, 12, 397-402.
18. G. Carrea and P. Cremonesi, Methods in Enzymology, 1987, 136, 150-157.
19. B. L. Cantarel, P. M. Coutinho, C. Rancurel, T. Bernard, V. Lombard and B. Henrissat, Nucleic Acids Research, 2009, 37, D233-D238.
20. K. Tamura, J. Dudley, M. Nei and S. Kumar, Molecular Biology and Evolution, 2007, 24, 1596- 1599.
21. F. H. Niesen, H. Berglund and M. Vedadi, Nature Protocols, 2007, 2, 2212-2221.
22. O. Mirza, L. K. Skov, D. Sprogoe, L. A. M. van den Broek, G. Beldman, J. S. Kastrup and M. Gajhede, . Biol. Chem., 2006, 281, 35576-35584.
23. D. Sprogoe, L. A. M. van den Broek, O. Mirza, J. S. Kastrup, A. G. J. Voragen, M. Gajhede and L. K. Skov, Biochemistry, 2004, 43, 1156-1162.
24. Y. Sako, S. Nakagawa, K. Takai and K. Horikoshi, International Journal of Systematic and Evolutionary Microbiology, 2003, 53, 59-65.
25. B. J. Tindall, J. Sikorski, S. Lucas, E. Goltsman, A. Copeland, T. G. Del Rio, M. Nolan, H. Tice, J.
F. Cheng, C. Han, S. Pitluck, K. Liolios, N. Ivanova, K. Mavromatis, G. Ovchinnikova, A. Pati, R. Fahnrich, L. Goodwin, A. Chen, K. Palaniappan, M. Land, L. Hauser, Y. J. Chang, C. D. Jeffries, M. Rohde, M. Goker, T. Woyke, J. Bristow, J. A. Eisen, V. Markowitz, P. Hugenholtz, N. C.
Kyrpides, H. P. Klenk and A. Lapidus, Standards in Genomic Sciences, 3, 26-36.
26. J. Sikorski, B. J. Tindall, S. Lowry, S. Lucas, M. Nolan, A. Copeland, T. G. Del Rio, H. Tice, J.-F.
Cheng, C. Han, S. Pitluck, K. Liolios, N. Ivanova, K. Mavromatis, N. Mikhailova, A. Pati, L. Goodwin, A. Chen, K. Palaniappan, M. Land, L. Hauser, Y.-J. Chang, C. D. Jeffries, M. Rohde, M. Goeker, T. Woyke, J. Bristow, J. A. Eisen, V. Markowitz, P. Hugenholtz, N. C. Kyrpides, H.-P.
Klenk and A. Lapidus, Standards in Genomic Sciences, 3, 37-46.
27. M. L. Miroshnichenko, S. L'Haridon, C. Jeanthon, A. N. Antipov, N. A. Kostrikina, B. J. Tindall, P. Schumann, S. Spring, E. Stackebrandt and E. A. Bonch-Osmolovskaya, International Journal of Systematic and Evolutionary Microbiology, 2003, 53, 747-752.
28. Y.-E. Lee, M. K. Jain, C. Lee and J. G. Zeikus, International Journal of Systematic Bacteriology, 1993, 43, 41-51.
29. H. Y. Aksenova, F. A. Rainey, P. H. Janssen, G. A. Zavarzin and H. W. Morgan, International Journal of Systematic Bacteriology, 1992, 42, 175-177.
30. L. Feng, W. Wang, J. Cheng, Y. Ren, G. Zhao, C. Gao, Y. Tang, X. Liu, W. Han, X. Peng, R. Liu and L. Wang, Proc. Natl. Acad. Sci. U. S. A., 2007, 104, 5602-5607.
31. C. Goedl, A. Schwarz, A. Minani and B. Nidetzky, J. Biotechnol., 2007, 129, 77-86.
32. K. M. Polizzi, A. S. Bommarius, J. M. Broering and J. F. Chaparro-Riggers, Current Opinion in Chemical Biology, 2007, 11, 220-225.
33. W. Nerinckx, T. Desmet and M. Claeyssens, Febs Letters, 2003, 538, 1-7.
34. P. Wildberger, C. Luley-Goedl and B. Nidetzky, Febs Letters, 585, 499-504.
35. M. Mueller and B. Nidetzky, Febs Letters, 2007, 581, 3814-3818.
36. J. Sanchis, L. Fernandez, J. D. Carballeira, J. Drone, Y. Gumulya, H. Hobenreich, D.
Kahakeaw, S. Kille, R. Lohmer, J. J. -P. Peyralans, J. Podtetenieff, S. Prasad, P. Soni, A.
Taglieber, S. Wu, F. E. Zilly, and M. T. Reetz, Applied Microbiology and Biotechnology, 2008, 81, 387-97.
Claims
1. Use of polypeptide having the amino acid sequence as depicted by SEQ ID N°l as a thermostable sucrose phosphorylase and/or as a thermostable sucrose-6'-phosphate phosphorylase.
2. Use according to claim 1 wherein said amino acid sequence is encoded by the nucleic acid sequence as depicted by SEQ ID N°2 or SEQ ID N°3.
3. Use according to claim 1 wherein said amino acid sequence is depicted by SEQ ID N°4.
4. Use according to claims 1-3 wherein said thermostability means that said sucrose phosphorylase or said sucrose-6'-phosphate phosphorylase has, during a phosphorolysis or synthesis reaction at a pH between 5.0 and 7.5 and a temperature between 50°C and 70°C, a half-life of at least 20 hours.
5. Use according to claim 4 wherein said thermostability means that said sucrose phosphorylase or said sucrose-6'-phosphate phosphorylase has, during a phosphorolysis or synthesis reaction at an enzyme concentration of about 8.5 μg/ml, at a pH between 6.0 and 6.5 and at a temperature of about 60°C, a half-life of at least 60 hours.
6. Use according to any of claims 1 to 5 wherein said polypeptide has an amino acid sequence which is at least 90% identical to the amino acid sequence as depicted by SEQ ID N°l or wherein said polypeptide is a fragment of the amino acid sequence as depicted by SEQ ID N°l.
7. Use according to claim 6 wherein said variant or fragment comprises the amino acid regions 45-56, 131-166, 184-207, 236-245, 279-310 and 340-358 of SEQ ID N°l.
8. Use according to claim 6 wherein said variant or fragment phosphorolyzes sucrose-6'- phosphate and comprises the amino acid histidine at amino acid position 344.
9. A method to produce D-fructose, D-fructose-6-phosphate and/or alpha-D-glucose -1- phosphate at a temperature above 50°C comprising: i) contacting a polypeptide as defined by claims 1-8 with sucrose or sucrose-6'-phosphate and inorganic phosphate, ii) phosphorolysing sucrose or sucrose-6'-phosphate to obtain D-fructose, D-fructose-6- phosphate and/or alpha-D-glucose -1-phosphate, and iii) purifying said D-fructose, D- fructose-6-phosphate and/or alpha-D-glucose -1-phosphate.
10. A method to produce an alpha-D-glucoside at a temperature above 50°C comprising: i) contacting a polypeptide as defined by claims 1-8 with either alpha-D-glucose -1- phosphate, sucrose or sucrose-6'-phosphate as donor and an appropriate acceptor such as a monosaccharide, a phosphorylated monosaccharide, an aliphatic or aromatic alcohol, a
furanone, a flavanoid or a phenolic compound, ii) glycosylating said monosaccharide, phosphorylated monosaccharide, aliphatic or aromatic alcohol, furanone, flavanoid or phenolic compound to obtain an alpha-D-glucoside, and iii) purifying said alpha-D- glucoside.
11. A method according to claim 10 wherein said acceptor is L-sorbose, D-fructose, D-fructose- 6-phosphate, D-psicose, D-tagatose, D-glucose, ascorbic acid, hexanol, catechol, pyridoxine, catechin, quercetin, glycerol, vanillin or 4-hydroxy-2,5-dimethyl-3(2H)- furanone.
12. An isolated amino acid sequence as depicted by SEQ ID N°4.
13. An isolated nucleic acid sequence as depicted by SEQ ID N°3.
14. Use of a microorganism expressing a polypeptide having the amino acid sequence as depicted by SEQ ID N°l or SEQ ID N° 4 to provide a thermostable sucrose phosphorylase or a thermostable sucrose-6'-phosphate phosphorylase.
15. Use according to claim 14 wherein said amino acid sequence is encoded by the nucleic acid sequence as depicted by SEQ ID N°2 or SEQ ID N°3, respectively.
16. A method to produce an alpha-D-glucoside comprising: i) contacting a polypeptide as defined by claims 1-8 with either alpha-D-glucose -1-phosphate, sucrose or sucrose-6'- phosphate as donor and an appropriate acceptor, ii) glycosylating said acceptor to obtain an alpha-D-glucoside, and iii) purifying said alpha-D-glucoside, wherein said glycosylation is carried out in a two-phase system with an organic solvent phase containing the acceptor and an aqueous buffer phase containing said polypeptide as defined by claims 1-8 and said donor.
17. A method according to claim 15 wherein said acceptor is a non-carbohydrate acceptor.
18. A method according to claim 16 wherein said non-carbohydrate acceptor is cinnamyl alcohol, geraniol, propyl gallate, ethyl gallate, resorcinol, pyrogallol, saligenin or methyl gallate.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP13776826.3A EP2909318A1 (en) | 2012-10-18 | 2013-10-16 | A thermostable sucrose and sucrose-6'-phosphate phosphorylase |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP12188966 | 2012-10-18 | ||
| EP13159683 | 2013-03-18 | ||
| EP13776826.3A EP2909318A1 (en) | 2012-10-18 | 2013-10-16 | A thermostable sucrose and sucrose-6'-phosphate phosphorylase |
| PCT/EP2013/071587 WO2014060452A1 (en) | 2012-10-18 | 2013-10-16 | A thermostable sucrose and sucrose-6'-phosphate phosphorylase |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP2909318A1 true EP2909318A1 (en) | 2015-08-26 |
Family
ID=49356455
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP13776826.3A Withdrawn EP2909318A1 (en) | 2012-10-18 | 2013-10-16 | A thermostable sucrose and sucrose-6'-phosphate phosphorylase |
Country Status (2)
| Country | Link |
|---|---|
| EP (1) | EP2909318A1 (en) |
| WO (1) | WO2014060452A1 (en) |
Families Citing this family (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| HUE047736T2 (en) | 2014-09-10 | 2020-05-28 | Pfeifer & Langen Gmbh & Co Kg | Cellobiose phosphorylase |
| WO2016116472A1 (en) * | 2015-01-22 | 2016-07-28 | Universiteit Gent | Production of specific glucosides with cellobiose phosphorylase |
| EP3294898B1 (en) * | 2015-05-12 | 2020-08-19 | Universiteit Gent | Mutant sucrose phosphorylases with improved glycosylation activity towards polyphenols |
| US20180291410A1 (en) * | 2015-09-25 | 2018-10-11 | Acib Gmbh | Method for small molecule glycosylation |
| CN107630057B (en) * | 2016-07-18 | 2021-08-24 | 中国科学院微生物研究所 | A kind of method for producing 2-oxo-α-D-glucopyranosyl ascorbic acid and its special engineering bacteria |
| AR124613A1 (en) * | 2017-12-08 | 2023-04-19 | Cj Cheiljedang Corp | NEW PSYCHOSE-6-PHOSPHATE PHOSPHASE, COMPOSITION FOR PRODUCING PSYCHOSE INCLUDING PHOSPHASE AND METHOD FOR PRODUCING PSYCHOSE USING PHOSPHASE |
| CN109576239B (en) * | 2018-12-17 | 2022-06-28 | 清华大学 | Thermostable phosphorylase and its application |
| CN111172127A (en) * | 2020-01-17 | 2020-05-19 | 浙江工业大学 | Application of a kind of sucrose phosphorylase in the preparation of glycerol glucoside |
| CN116144625A (en) * | 2023-02-24 | 2023-05-23 | 杭州佳嘉乐生物技术有限公司 | Recombinant sucrose phosphorylase and method for catalyzing glycosylation reaction by same |
| CN119842654B (en) * | 2024-12-31 | 2025-08-05 | 南京诺云生物科技有限公司 | A sucrose phosphorylase with enhanced heat resistance and its application in high-temperature catalytic preparation of α-arbutin |
-
2013
- 2013-10-16 WO PCT/EP2013/071587 patent/WO2014060452A1/en not_active Ceased
- 2013-10-16 EP EP13776826.3A patent/EP2909318A1/en not_active Withdrawn
Non-Patent Citations (1)
| Title |
|---|
| See references of WO2014060452A1 * |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2014060452A1 (en) | 2014-04-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP2909318A1 (en) | A thermostable sucrose and sucrose-6'-phosphate phosphorylase | |
| Goedl et al. | Recombinant sucrose phosphorylase from Leuconostoc mesenteroides: characterization, kinetic studies of transglucosylation, and application of immobilised enzyme for production of α-D-glucose 1-phosphate | |
| US12385029B2 (en) | Engineered synthase for production of tryptophan derivatives and intransigent substrates | |
| Verhaeghe et al. | The quest for a thermostable sucrose phosphorylase reveals sucrose 6′-phosphate phosphorylase as a novel specificity | |
| JP2016528925A (en) | Improved variants of D-psicose 3-epimerase and uses thereof | |
| KR20190003553A (en) | Cell-free production of ribonucleic acid | |
| Bhuiyan et al. | Characterization of a hyperthermostable glycogen phosphorylase from Aquifex aeolicus expressed in Escherichia coli | |
| Borg et al. | Mechanistic characterization of UDP‐glucuronic acid 4‐epimerase | |
| KR20220128581A (en) | Enzymatic hexosaminidization of lactose | |
| Tantanarat et al. | Expression and characterization of 4-α-glucanotransferase genes from Manihot esculenta Crantz and Arabidopsis thaliana and their use for the production of cycloamyloses | |
| Li et al. | Characterisation of a Thermobacillus sucrose phosphorylase and its utility in enzymatic synthesis of 2-O-α-D-glucopyranosyl-L-ascorbic acid | |
| CN116113645A (en) | Modified nicotinamide riboside phosphate transferase | |
| Wahl et al. | Characterization of a new UDP-sugar pyrophosphorylase from Hordeum vulgare (barley) | |
| US20180216086A1 (en) | Cellobiose Phosphorylase | |
| Nidetzky et al. | Cellobiose phosphorylase from Cellulomonas uda: gene cloning and expression in Escherichia coli, and application of the recombinant enzyme in a ‘glycosynthase-type’reaction | |
| Suryanti et al. | Cloning, over-expression, purification, and characterisation of N-acetylneuraminate synthase from Streptococcus agalactiae | |
| Choi et al. | Enhanced production of turanose using a mutant amylosucrase from Bifidobacterium thermophilum immobilized on silica carriers | |
| JP5383175B2 (en) | Novel β-fructofuranosidase, production method thereof and use thereof | |
| ES3052614T3 (en) | Trehalose phosphorylase | |
| KR101574952B1 (en) | Screening methods for variants of α-2,3 and α-2,6 sialyltransferases and their application to the production of sialyl oligosaccharides | |
| Xing et al. | Cloning, expression and mutation of a novel thermophilic GH1 β-galactosidase from Vulcanisaeta thermophila with transglycosylation activity for tyrosol galactoside synthesis | |
| Gu et al. | Gene cloning and enzymatic properties of hyperthermostable β-glycosidase from Thermus thermophilus HJ6 | |
| Iqbal et al. | Exploiting the biocatalytic potential of co-expressed l-fucose isomerase and d-tagatose 3-epimerase for the biosynthesis of 6-deoxy-l-sorbose | |
| JP7025941B2 (en) | New enzyme preparation, its manufacturing method and its use | |
| Li | Heterologous expression of a novel galactose-1-phosphate uridylyltransferase from Thermodesulfatator indicus and its application for bioproduction of Gal-β-1, 4-GlcNAc-X |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20150512 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| AX | Request for extension of the european patent |
Extension state: BA ME |
|
| DAX | Request for extension of the european patent (deleted) | ||
| 17Q | First examination report despatched |
Effective date: 20160317 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20160728 |