EP2807275A1 - Schizophrenia-related isoform of knch2 and development of antipsycotic drugs - Google Patents
Schizophrenia-related isoform of knch2 and development of antipsycotic drugsInfo
- Publication number
- EP2807275A1 EP2807275A1 EP13702565.6A EP13702565A EP2807275A1 EP 2807275 A1 EP2807275 A1 EP 2807275A1 EP 13702565 A EP13702565 A EP 13702565A EP 2807275 A1 EP2807275 A1 EP 2807275A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- isoform
- kcnh2
- expression
- schizophrenia
- gene
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 108010029485 Protein Isoforms Proteins 0.000 title claims abstract description 469
- 102000001708 Protein Isoforms Human genes 0.000 title claims abstract description 469
- 201000000980 schizophrenia Diseases 0.000 title claims abstract description 233
- 239000003814 drug Substances 0.000 title claims description 76
- 229940079593 drug Drugs 0.000 title claims description 69
- 238000011161 development Methods 0.000 title description 10
- 101001047090 Homo sapiens Potassium voltage-gated channel subfamily H member 2 Proteins 0.000 claims abstract description 42
- 230000004044 response Effects 0.000 claims abstract description 33
- 102100022807 Potassium voltage-gated channel subfamily H member 2 Human genes 0.000 claims abstract description 24
- 238000000034 method Methods 0.000 claims description 191
- 230000014509 gene expression Effects 0.000 claims description 174
- 108090000623 proteins and genes Proteins 0.000 claims description 172
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 152
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 138
- 229920001184 polypeptide Polymers 0.000 claims description 133
- 108700028369 Alleles Proteins 0.000 claims description 97
- 239000000523 sample Substances 0.000 claims description 96
- 102000040430 polynucleotide Human genes 0.000 claims description 93
- 108091033319 polynucleotide Proteins 0.000 claims description 93
- 239000002157 polynucleotide Substances 0.000 claims description 93
- 150000007523 nucleic acids Chemical class 0.000 claims description 90
- 102000039446 nucleic acids Human genes 0.000 claims description 85
- 108020004707 nucleic acids Proteins 0.000 claims description 85
- 239000003550 marker Substances 0.000 claims description 79
- 239000002773 nucleotide Substances 0.000 claims description 77
- 125000003729 nucleotide group Chemical group 0.000 claims description 77
- 238000003556 assay Methods 0.000 claims description 73
- 238000004458 analytical method Methods 0.000 claims description 56
- 238000011282 treatment Methods 0.000 claims description 56
- 229940124604 anti-psychotic medication Drugs 0.000 claims description 47
- 101150051809 KCNH2 gene Proteins 0.000 claims description 46
- 238000009396 hybridization Methods 0.000 claims description 43
- 108091032973 (ribonucleotides)n+m Proteins 0.000 claims description 38
- 239000002299 complementary DNA Substances 0.000 claims description 32
- 239000012634 fragment Substances 0.000 claims description 32
- 230000035772 mutation Effects 0.000 claims description 29
- 230000000295 complement effect Effects 0.000 claims description 28
- 239000012472 biological sample Substances 0.000 claims description 25
- 210000001519 tissue Anatomy 0.000 claims description 25
- 230000000698 schizophrenic effect Effects 0.000 claims description 24
- 230000007423 decrease Effects 0.000 claims description 21
- 238000005259 measurement Methods 0.000 claims description 21
- 229960005017 olanzapine Drugs 0.000 claims description 20
- KVWDHTXUZHCGIO-UHFFFAOYSA-N olanzapine Chemical compound C1CN(C)CCN1C1=NC2=CC=CC=C2NC2=C1C=C(C)S2 KVWDHTXUZHCGIO-UHFFFAOYSA-N 0.000 claims description 20
- 238000005516 engineering process Methods 0.000 claims description 17
- 230000008901 benefit Effects 0.000 claims description 16
- 239000003153 chemical reaction reagent Substances 0.000 claims description 16
- 208000011580 syndromic disease Diseases 0.000 claims description 16
- 238000012163 sequencing technique Methods 0.000 claims description 12
- 238000004949 mass spectrometry Methods 0.000 claims description 11
- 230000003321 amplification Effects 0.000 claims description 9
- 239000003693 atypical antipsychotic agent Substances 0.000 claims description 9
- 229940127236 atypical antipsychotics Drugs 0.000 claims description 9
- 210000005013 brain tissue Anatomy 0.000 claims description 9
- 238000003199 nucleic acid amplification method Methods 0.000 claims description 9
- 230000009286 beneficial effect Effects 0.000 claims description 8
- 230000002596 correlated effect Effects 0.000 claims description 7
- 238000002965 ELISA Methods 0.000 claims description 6
- 229960001534 risperidone Drugs 0.000 claims description 6
- RAPZEAPATHNIPO-UHFFFAOYSA-N risperidone Chemical compound FC1=CC=C2C(C3CCN(CC3)CCC=3C(=O)N4CCCCC4=NC=3C)=NOC2=C1 RAPZEAPATHNIPO-UHFFFAOYSA-N 0.000 claims description 6
- RGCVKNLCSQQDEP-UHFFFAOYSA-N Perphenazine Chemical compound C1CN(CCO)CCN1CCCN1C2=CC(Cl)=CC=C2SC2=CC=CC=C21 RGCVKNLCSQQDEP-UHFFFAOYSA-N 0.000 claims description 5
- 210000004369 blood Anatomy 0.000 claims description 5
- 239000008280 blood Substances 0.000 claims description 5
- 229960000762 perphenazine Drugs 0.000 claims description 5
- 229960004431 quetiapine Drugs 0.000 claims description 5
- URKOMYMAXPYINW-UHFFFAOYSA-N quetiapine Chemical compound C1CN(CCOCCO)CCN1C1=NC2=CC=CC=C2SC2=CC=CC=C12 URKOMYMAXPYINW-UHFFFAOYSA-N 0.000 claims description 5
- 230000009467 reduction Effects 0.000 claims description 5
- 229960000607 ziprasidone Drugs 0.000 claims description 5
- MVWVFYHBGMAFLY-UHFFFAOYSA-N ziprasidone Chemical compound C1=CC=C2C(N3CCN(CC3)CCC3=CC=4CC(=O)NC=4C=C3Cl)=NSC2=C1 MVWVFYHBGMAFLY-UHFFFAOYSA-N 0.000 claims description 5
- 238000003935 denaturing gradient gel electrophoresis Methods 0.000 claims description 4
- 238000001114 immunoprecipitation Methods 0.000 claims description 4
- 230000006872 improvement Effects 0.000 claims description 4
- 210000002700 urine Anatomy 0.000 claims description 4
- 108091027305 Heteroduplex Proteins 0.000 claims description 3
- 102000008394 Immunoglobulin Fragments Human genes 0.000 claims description 3
- 108010021625 Immunoglobulin Fragments Proteins 0.000 claims description 3
- 239000013060 biological fluid Substances 0.000 claims description 3
- 210000003491 skin Anatomy 0.000 claims description 3
- 238000000018 DNA microarray Methods 0.000 claims description 2
- 238000003559 RNA-seq method Methods 0.000 claims description 2
- 241000239226 Scorpiones Species 0.000 claims description 2
- 238000007844 allele-specific PCR Methods 0.000 claims description 2
- 238000007481 next generation sequencing Methods 0.000 claims description 2
- 230000004952 protein activity Effects 0.000 claims description 2
- 238000012175 pyrosequencing Methods 0.000 claims description 2
- 210000003296 saliva Anatomy 0.000 claims description 2
- 210000001138 tear Anatomy 0.000 claims description 2
- 210000002751 lymph Anatomy 0.000 claims 1
- 210000003205 muscle Anatomy 0.000 claims 1
- 210000004556 brain Anatomy 0.000 abstract description 73
- 230000002068 genetic effect Effects 0.000 abstract description 49
- 241000288906 Primates Species 0.000 abstract description 23
- 238000002560 therapeutic procedure Methods 0.000 abstract description 18
- 230000000694 effects Effects 0.000 description 157
- 150000001875 compounds Chemical class 0.000 description 145
- 210000004027 cell Anatomy 0.000 description 122
- 238000012360 testing method Methods 0.000 description 105
- 102000004169 proteins and genes Human genes 0.000 description 100
- 235000018102 proteins Nutrition 0.000 description 93
- 108020004414 DNA Proteins 0.000 description 60
- 108091006146 Channels Proteins 0.000 description 54
- 235000001014 amino acid Nutrition 0.000 description 47
- 210000001320 hippocampus Anatomy 0.000 description 46
- 230000027455 binding Effects 0.000 description 43
- 108020004999 messenger RNA Proteins 0.000 description 43
- 239000000203 mixture Substances 0.000 description 41
- 150000001413 amino acids Chemical class 0.000 description 39
- 102000054766 genetic haplotypes Human genes 0.000 description 36
- 210000002569 neuron Anatomy 0.000 description 36
- 125000003275 alpha amino acid group Chemical group 0.000 description 35
- 239000000969 carrier Substances 0.000 description 34
- 230000001965 increasing effect Effects 0.000 description 31
- 230000000971 hippocampal effect Effects 0.000 description 30
- 230000015654 memory Effects 0.000 description 30
- 230000009849 deactivation Effects 0.000 description 29
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 29
- 238000003752 polymerase chain reaction Methods 0.000 description 29
- 239000000047 product Substances 0.000 description 28
- 239000013598 vector Substances 0.000 description 28
- 230000001225 therapeutic effect Effects 0.000 description 26
- 230000000561 anti-psychotic effect Effects 0.000 description 25
- 239000003795 chemical substances by application Substances 0.000 description 25
- 230000004913 activation Effects 0.000 description 24
- 238000001994 activation Methods 0.000 description 24
- 239000000164 antipsychotic agent Substances 0.000 description 24
- 239000000090 biomarker Substances 0.000 description 24
- 230000008859 change Effects 0.000 description 24
- 210000004884 grey matter Anatomy 0.000 description 24
- 208000024891 symptom Diseases 0.000 description 24
- 108090000994 Catalytic RNA Proteins 0.000 description 22
- 102000053642 Catalytic RNA Human genes 0.000 description 22
- VYFYYTLLBUKUHU-UHFFFAOYSA-N dopamine Chemical compound NCCC1=CC=C(O)C(O)=C1 VYFYYTLLBUKUHU-UHFFFAOYSA-N 0.000 description 22
- 238000012545 processing Methods 0.000 description 22
- 108091092562 ribozyme Proteins 0.000 description 22
- 230000001537 neural effect Effects 0.000 description 20
- 238000001514 detection method Methods 0.000 description 19
- 238000012216 screening Methods 0.000 description 19
- 241000700159 Rattus Species 0.000 description 18
- 230000006870 function Effects 0.000 description 18
- 101001128156 Homo sapiens Nanos homolog 3 Proteins 0.000 description 17
- 101001124309 Homo sapiens Nitric oxide synthase, endothelial Proteins 0.000 description 17
- 102100031893 Nanos homolog 3 Human genes 0.000 description 17
- 238000010304 firing Methods 0.000 description 17
- 239000008194 pharmaceutical composition Substances 0.000 description 17
- 108091028043 Nucleic acid sequence Proteins 0.000 description 16
- 239000000074 antisense oligonucleotide Substances 0.000 description 16
- 238000012230 antisense oligonucleotides Methods 0.000 description 16
- 230000001419 dependent effect Effects 0.000 description 16
- 239000000902 placebo Substances 0.000 description 16
- 229940068196 placebo Drugs 0.000 description 16
- 238000006467 substitution reaction Methods 0.000 description 16
- 108091034117 Oligonucleotide Proteins 0.000 description 15
- 230000004075 alteration Effects 0.000 description 15
- 230000000875 corresponding effect Effects 0.000 description 15
- 238000003745 diagnosis Methods 0.000 description 15
- 201000010099 disease Diseases 0.000 description 15
- 239000012528 membrane Substances 0.000 description 15
- 102000002131 PAS domains Human genes 0.000 description 14
- 108050009469 PAS domains Proteins 0.000 description 14
- 239000011324 bead Substances 0.000 description 14
- 210000003618 cortical neuron Anatomy 0.000 description 14
- 238000013461 design Methods 0.000 description 14
- 208000035475 disorder Diseases 0.000 description 14
- 230000001404 mediated effect Effects 0.000 description 14
- 108020001213 potassium channel Proteins 0.000 description 14
- 210000002442 prefrontal cortex Anatomy 0.000 description 14
- 239000000243 solution Substances 0.000 description 14
- 208000012902 Nervous system disease Diseases 0.000 description 13
- 208000025966 Neurological disease Diseases 0.000 description 13
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 13
- 238000013459 approach Methods 0.000 description 13
- 230000001149 cognitive effect Effects 0.000 description 13
- 230000001054 cortical effect Effects 0.000 description 13
- 230000005714 functional activity Effects 0.000 description 13
- 230000003993 interaction Effects 0.000 description 13
- 230000007246 mechanism Effects 0.000 description 13
- 239000000126 substance Substances 0.000 description 13
- 230000019771 cognition Effects 0.000 description 12
- 229960003638 dopamine Drugs 0.000 description 12
- 108020001507 fusion proteins Proteins 0.000 description 12
- 102000037865 fusion proteins Human genes 0.000 description 12
- LNEPOXFFQSENCJ-UHFFFAOYSA-N haloperidol Chemical compound C1CC(O)(C=2C=CC(Cl)=CC=2)CCN1CCCC(=O)C1=CC=C(F)C=C1 LNEPOXFFQSENCJ-UHFFFAOYSA-N 0.000 description 12
- 239000003446 ligand Substances 0.000 description 12
- 238000011144 upstream manufacturing Methods 0.000 description 12
- 102000004257 Potassium Channel Human genes 0.000 description 11
- 238000010367 cloning Methods 0.000 description 11
- 230000002829 reductive effect Effects 0.000 description 11
- 238000007423 screening assay Methods 0.000 description 11
- -1 cationic lipid Chemical class 0.000 description 10
- 238000012217 deletion Methods 0.000 description 10
- 230000037430 deletion Effects 0.000 description 10
- 238000011988 family based association test Methods 0.000 description 10
- 210000002216 heart Anatomy 0.000 description 10
- 239000007787 solid Substances 0.000 description 10
- 241000894007 species Species 0.000 description 10
- 241000699666 Mus <mouse, genus> Species 0.000 description 9
- 238000007792 addition Methods 0.000 description 9
- 125000000539 amino acid group Chemical group 0.000 description 9
- 244000309464 bull Species 0.000 description 9
- 238000004113 cell culture Methods 0.000 description 9
- 238000006243 chemical reaction Methods 0.000 description 9
- 230000000763 evoking effect Effects 0.000 description 9
- 239000000499 gel Substances 0.000 description 9
- 238000012417 linear regression Methods 0.000 description 9
- 238000004519 manufacturing process Methods 0.000 description 9
- 238000002483 medication Methods 0.000 description 9
- 230000035479 physiological effects, processes and functions Effects 0.000 description 9
- 102000054765 polymorphisms of proteins Human genes 0.000 description 9
- 238000000746 purification Methods 0.000 description 9
- 238000001890 transfection Methods 0.000 description 9
- 230000014616 translation Effects 0.000 description 9
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 8
- 230000036982 action potential Effects 0.000 description 8
- 239000005557 antagonist Substances 0.000 description 8
- 230000007614 genetic variation Effects 0.000 description 8
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 8
- 238000002493 microarray Methods 0.000 description 8
- 230000001105 regulatory effect Effects 0.000 description 8
- 238000000926 separation method Methods 0.000 description 8
- 150000003384 small molecules Chemical group 0.000 description 8
- 238000013518 transcription Methods 0.000 description 8
- 230000035897 transcription Effects 0.000 description 8
- 238000013519 translation Methods 0.000 description 8
- 238000001262 western blot Methods 0.000 description 8
- 108020004705 Codon Proteins 0.000 description 7
- 102000004190 Enzymes Human genes 0.000 description 7
- 108090000790 Enzymes Proteins 0.000 description 7
- 108700024394 Exon Proteins 0.000 description 7
- 108091023040 Transcription factor Proteins 0.000 description 7
- 102000040945 Transcription factor Human genes 0.000 description 7
- 102000003734 Voltage-Gated Potassium Channels Human genes 0.000 description 7
- 108090000013 Voltage-Gated Potassium Channels Proteins 0.000 description 7
- 230000009471 action Effects 0.000 description 7
- 230000006978 adaptation Effects 0.000 description 7
- 239000000556 agonist Substances 0.000 description 7
- 230000033228 biological regulation Effects 0.000 description 7
- 230000000747 cardiac effect Effects 0.000 description 7
- 238000003776 cleavage reaction Methods 0.000 description 7
- 239000003937 drug carrier Substances 0.000 description 7
- 238000011156 evaluation Methods 0.000 description 7
- 102000046896 human KCNH2 Human genes 0.000 description 7
- 238000001727 in vivo Methods 0.000 description 7
- 235000006109 methionine Nutrition 0.000 description 7
- 239000012071 phase Substances 0.000 description 7
- 238000000159 protein binding assay Methods 0.000 description 7
- 238000011002 quantification Methods 0.000 description 7
- 238000003753 real-time PCR Methods 0.000 description 7
- 230000007017 scission Effects 0.000 description 7
- 230000019491 signal transduction Effects 0.000 description 7
- 230000000007 visual effect Effects 0.000 description 7
- 101150098516 3.1 gene Proteins 0.000 description 6
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 6
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 6
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 6
- 241000283984 Rodentia Species 0.000 description 6
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 6
- 230000004071 biological effect Effects 0.000 description 6
- 230000005540 biological transmission Effects 0.000 description 6
- 230000003920 cognitive function Effects 0.000 description 6
- 230000003247 decreasing effect Effects 0.000 description 6
- 230000002999 depolarising effect Effects 0.000 description 6
- 210000005153 frontal cortex Anatomy 0.000 description 6
- 229960003878 haloperidol Drugs 0.000 description 6
- 238000003018 immunoassay Methods 0.000 description 6
- 239000003112 inhibitor Substances 0.000 description 6
- 208000004731 long QT syndrome Diseases 0.000 description 6
- 239000000463 material Substances 0.000 description 6
- 239000011159 matrix material Substances 0.000 description 6
- 230000009456 molecular mechanism Effects 0.000 description 6
- 239000011148 porous material Substances 0.000 description 6
- 238000002360 preparation method Methods 0.000 description 6
- 230000008569 process Effects 0.000 description 6
- 208000020016 psychiatric disease Diseases 0.000 description 6
- 230000002336 repolarization Effects 0.000 description 6
- 238000003757 reverse transcription PCR Methods 0.000 description 6
- 150000003839 salts Chemical class 0.000 description 6
- 210000002966 serum Anatomy 0.000 description 6
- 239000011780 sodium chloride Substances 0.000 description 6
- 239000002904 solvent Substances 0.000 description 6
- 108020003589 5' Untranslated Regions Proteins 0.000 description 5
- 241000894006 Bacteria Species 0.000 description 5
- 108091026890 Coding region Proteins 0.000 description 5
- 108020004635 Complementary DNA Proteins 0.000 description 5
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 5
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 5
- 241000282412 Homo Species 0.000 description 5
- 101710141175 Photoactive yellow protein Proteins 0.000 description 5
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 5
- 239000002671 adjuvant Substances 0.000 description 5
- 229940005529 antipsychotics Drugs 0.000 description 5
- 238000012512 characterization method Methods 0.000 description 5
- 238000004587 chromatography analysis Methods 0.000 description 5
- 229960004170 clozapine Drugs 0.000 description 5
- QZUDBNBUXVUHMW-UHFFFAOYSA-N clozapine Chemical compound C1CN(C)CCN1C1=NC2=CC(Cl)=CC=C2NC2=CC=CC=C12 QZUDBNBUXVUHMW-UHFFFAOYSA-N 0.000 description 5
- 230000009918 complex formation Effects 0.000 description 5
- 239000013068 control sample Substances 0.000 description 5
- 230000001276 controlling effect Effects 0.000 description 5
- 238000012937 correction Methods 0.000 description 5
- 210000005110 dorsal hippocampus Anatomy 0.000 description 5
- 239000012091 fetal bovine serum Substances 0.000 description 5
- 239000012530 fluid Substances 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 238000002599 functional magnetic resonance imaging Methods 0.000 description 5
- 230000000984 immunochemical effect Effects 0.000 description 5
- 239000004615 ingredient Substances 0.000 description 5
- 230000005764 inhibitory process Effects 0.000 description 5
- 150000002500 ions Chemical class 0.000 description 5
- 230000028161 membrane depolarization Effects 0.000 description 5
- 229930182817 methionine Natural products 0.000 description 5
- 230000008062 neuronal firing Effects 0.000 description 5
- 230000007310 pathophysiology Effects 0.000 description 5
- 230000002974 pharmacogenomic effect Effects 0.000 description 5
- 108020003175 receptors Proteins 0.000 description 5
- 102000005962 receptors Human genes 0.000 description 5
- 230000010076 replication Effects 0.000 description 5
- 230000000391 smoking effect Effects 0.000 description 5
- 239000000758 substrate Substances 0.000 description 5
- 229940124597 therapeutic agent Drugs 0.000 description 5
- 239000003981 vehicle Substances 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 4
- 102100026031 Beta-glucuronidase Human genes 0.000 description 4
- 241000588724 Escherichia coli Species 0.000 description 4
- 108700039887 Essential Genes Proteins 0.000 description 4
- 108010024636 Glutathione Proteins 0.000 description 4
- 101000933465 Homo sapiens Beta-glucuronidase Proteins 0.000 description 4
- 101001067140 Homo sapiens Porphobilinogen deaminase Proteins 0.000 description 4
- 108060003951 Immunoglobulin Proteins 0.000 description 4
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 4
- 241000124008 Mammalia Species 0.000 description 4
- 241000283973 Oryctolagus cuniculus Species 0.000 description 4
- 102100034391 Porphobilinogen deaminase Human genes 0.000 description 4
- 208000028017 Psychotic disease Diseases 0.000 description 4
- 108091028664 Ribonucleotide Proteins 0.000 description 4
- 230000002159 abnormal effect Effects 0.000 description 4
- 239000013543 active substance Substances 0.000 description 4
- 238000000540 analysis of variance Methods 0.000 description 4
- 238000010171 animal model Methods 0.000 description 4
- 239000000427 antigen Substances 0.000 description 4
- 108091007433 antigens Proteins 0.000 description 4
- 102000036639 antigens Human genes 0.000 description 4
- 238000000423 cell based assay Methods 0.000 description 4
- 230000021615 conjugation Effects 0.000 description 4
- 230000010367 cortical information processing Effects 0.000 description 4
- 239000005547 deoxyribonucleotide Substances 0.000 description 4
- 239000006185 dispersion Substances 0.000 description 4
- 238000002001 electrophysiology Methods 0.000 description 4
- 230000007831 electrophysiology Effects 0.000 description 4
- 230000002255 enzymatic effect Effects 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 239000011521 glass Substances 0.000 description 4
- 229960003180 glutathione Drugs 0.000 description 4
- 238000003384 imaging method Methods 0.000 description 4
- 102000018358 immunoglobulin Human genes 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 230000014759 maintenance of location Effects 0.000 description 4
- 238000002844 melting Methods 0.000 description 4
- 230000008018 melting Effects 0.000 description 4
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 238000010369 molecular cloning Methods 0.000 description 4
- 238000013425 morphometry Methods 0.000 description 4
- 230000008587 neuronal excitability Effects 0.000 description 4
- 230000002018 overexpression Effects 0.000 description 4
- 230000001766 physiological effect Effects 0.000 description 4
- 239000002244 precipitate Substances 0.000 description 4
- 238000000751 protein extraction Methods 0.000 description 4
- 238000011160 research Methods 0.000 description 4
- 230000002441 reversible effect Effects 0.000 description 4
- 239000002336 ribonucleotide Substances 0.000 description 4
- 125000002652 ribonucleotide group Chemical group 0.000 description 4
- 230000002459 sustained effect Effects 0.000 description 4
- 238000005406 washing Methods 0.000 description 4
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 3
- 101100009524 Anas platyrhynchos HSD17B12 gene Proteins 0.000 description 3
- 108091023037 Aptamer Proteins 0.000 description 3
- 206010004224 Belligerence Diseases 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 102100027314 Beta-2-microglobulin Human genes 0.000 description 3
- 241000282693 Cercopithecidae Species 0.000 description 3
- 102000053602 DNA Human genes 0.000 description 3
- 230000004544 DNA amplification Effects 0.000 description 3
- 230000004568 DNA-binding Effects 0.000 description 3
- 102000016911 Deoxyribonucleases Human genes 0.000 description 3
- 108010053770 Deoxyribonucleases Proteins 0.000 description 3
- 241000196324 Embryophyta Species 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 3
- 238000000729 Fisher's exact test Methods 0.000 description 3
- 101001077417 Gallus gallus Potassium voltage-gated channel subfamily H member 6 Proteins 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- 102000005720 Glutathione transferase Human genes 0.000 description 3
- 108010070675 Glutathione transferase Proteins 0.000 description 3
- 101000937544 Homo sapiens Beta-2-microglobulin Proteins 0.000 description 3
- 238000009015 Human TaqMan MicroRNA Assay kit Methods 0.000 description 3
- 108090000862 Ion Channels Proteins 0.000 description 3
- 102000004310 Ion Channels Human genes 0.000 description 3
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- 238000011529 RT qPCR Methods 0.000 description 3
- 108020004511 Recombinant DNA Proteins 0.000 description 3
- 101100256975 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) SIP2 gene Proteins 0.000 description 3
- 101100203850 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) SPT2 gene Proteins 0.000 description 3
- 101100291461 Schizosaccharomyces pombe (strain 972 / ATCC 24843) spm2 gene Proteins 0.000 description 3
- 238000012300 Sequence Analysis Methods 0.000 description 3
- 108010090804 Streptavidin Proteins 0.000 description 3
- 108700009124 Transcription Initiation Site Proteins 0.000 description 3
- 238000010521 absorption reaction Methods 0.000 description 3
- 239000004480 active ingredient Substances 0.000 description 3
- 239000003242 anti bacterial agent Substances 0.000 description 3
- 206010003119 arrhythmia Diseases 0.000 description 3
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 230000003542 behavioural effect Effects 0.000 description 3
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 238000010804 cDNA synthesis Methods 0.000 description 3
- 239000001506 calcium phosphate Substances 0.000 description 3
- 229910000389 calcium phosphate Inorganic materials 0.000 description 3
- 235000011010 calcium phosphates Nutrition 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 210000003169 central nervous system Anatomy 0.000 description 3
- 210000000349 chromosome Anatomy 0.000 description 3
- 230000009137 competitive binding Effects 0.000 description 3
- 238000011109 contamination Methods 0.000 description 3
- 230000001086 cytosolic effect Effects 0.000 description 3
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 3
- 239000002612 dispersion medium Substances 0.000 description 3
- 238000004520 electroporation Methods 0.000 description 3
- 238000000132 electrospray ionisation Methods 0.000 description 3
- 229960000555 fenyramidol Drugs 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 238000001502 gel electrophoresis Methods 0.000 description 3
- 238000004128 high performance liquid chromatography Methods 0.000 description 3
- 210000004408 hybridoma Anatomy 0.000 description 3
- 230000001771 impaired effect Effects 0.000 description 3
- 230000001976 improved effect Effects 0.000 description 3
- 230000002779 inactivation Effects 0.000 description 3
- 238000011835 investigation Methods 0.000 description 3
- 238000002955 isolation Methods 0.000 description 3
- 230000000155 isotopic effect Effects 0.000 description 3
- 238000002372 labelling Methods 0.000 description 3
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 3
- 238000007477 logistic regression Methods 0.000 description 3
- 230000004630 mental health Effects 0.000 description 3
- 230000000701 neuroleptic effect Effects 0.000 description 3
- 230000010355 oscillation Effects 0.000 description 3
- 239000001301 oxygen Substances 0.000 description 3
- 229910052760 oxygen Inorganic materials 0.000 description 3
- 230000000144 pharmacologic effect Effects 0.000 description 3
- 235000021317 phosphate Nutrition 0.000 description 3
- 210000002381 plasma Anatomy 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 239000002243 precursor Substances 0.000 description 3
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 3
- 230000001681 protective effect Effects 0.000 description 3
- 238000004445 quantitative analysis Methods 0.000 description 3
- 230000035484 reaction time Effects 0.000 description 3
- 230000001177 retroviral effect Effects 0.000 description 3
- 238000012552 review Methods 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 230000035945 sensitivity Effects 0.000 description 3
- 238000002864 sequence alignment Methods 0.000 description 3
- 239000007790 solid phase Substances 0.000 description 3
- 238000007619 statistical method Methods 0.000 description 3
- 238000003860 storage Methods 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- 230000002103 transcriptional effect Effects 0.000 description 3
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 3
- YMXHPSHLTSZXKH-RVBZMBCESA-N (2,5-dioxopyrrolidin-1-yl) 5-[(3as,4s,6ar)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]pentanoate Chemical compound C([C@H]1[C@H]2NC(=O)N[C@H]2CS1)CCCC(=O)ON1C(=O)CCC1=O YMXHPSHLTSZXKH-RVBZMBCESA-N 0.000 description 2
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 2
- 108020005345 3' Untranslated Regions Proteins 0.000 description 2
- 206010001497 Agitation Diseases 0.000 description 2
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 2
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 2
- 238000000035 BCA protein assay Methods 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- 102000014914 Carrier Proteins Human genes 0.000 description 2
- 102000034573 Channels Human genes 0.000 description 2
- 108091033380 Coding strand Proteins 0.000 description 2
- 102100038696 Cytochrome P450 3A43 Human genes 0.000 description 2
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 2
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 2
- 108050004812 Dopamine receptor Proteins 0.000 description 2
- 102000015554 Dopamine receptor Human genes 0.000 description 2
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 238000012286 ELISA Assay Methods 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 239000007995 HEPES buffer Substances 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 2
- 101000957698 Homo sapiens Cytochrome P450 3A43 Proteins 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- 108091092195 Intron Proteins 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- 108060001084 Luciferase Proteins 0.000 description 2
- 239000005089 Luciferase Substances 0.000 description 2
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 2
- OTCCIMWXFLJLIA-UHFFFAOYSA-N N-acetyl-DL-aspartic acid Natural products CC(=O)NC(C(O)=O)CC(O)=O OTCCIMWXFLJLIA-UHFFFAOYSA-N 0.000 description 2
- OTCCIMWXFLJLIA-BYPYZUCNSA-N N-acetyl-L-aspartic acid Chemical compound CC(=O)N[C@H](C(O)=O)CC(O)=O OTCCIMWXFLJLIA-BYPYZUCNSA-N 0.000 description 2
- 238000000636 Northern blotting Methods 0.000 description 2
- 108700026244 Open Reading Frames Proteins 0.000 description 2
- 108010067902 Peptide Library Proteins 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 229940122907 Phosphatase inhibitor Drugs 0.000 description 2
- 108010010677 Phosphodiesterase I Proteins 0.000 description 2
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 2
- 108091034057 RNA (poly(A)) Proteins 0.000 description 2
- 108700008625 Reporter Genes Proteins 0.000 description 2
- PYMYPHUHKUWMLA-LMVFSUKVSA-N Ribose Natural products OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 2
- 229920002684 Sepharose Polymers 0.000 description 2
- 108091081024 Start codon Proteins 0.000 description 2
- 238000000692 Student's t-test Methods 0.000 description 2
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 125000005600 alkyl phosphonate group Chemical group 0.000 description 2
- HMFHBZSHGGEWLO-UHFFFAOYSA-N alpha-D-Furanose-Ribose Natural products OCC1OC(O)C(O)C1O HMFHBZSHGGEWLO-UHFFFAOYSA-N 0.000 description 2
- VREFGVBLTWBCJP-UHFFFAOYSA-N alprazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NN=C2CN=C1C1=CC=CC=C1 VREFGVBLTWBCJP-UHFFFAOYSA-N 0.000 description 2
- 239000012491 analyte Substances 0.000 description 2
- 230000002547 anomalous effect Effects 0.000 description 2
- 230000000844 anti-bacterial effect Effects 0.000 description 2
- 230000000692 anti-sense effect Effects 0.000 description 2
- 229940121375 antifungal agent Drugs 0.000 description 2
- 239000003429 antifungal agent Substances 0.000 description 2
- 239000011668 ascorbic acid Substances 0.000 description 2
- 235000010323 ascorbic acid Nutrition 0.000 description 2
- 229960005070 ascorbic acid Drugs 0.000 description 2
- 238000003149 assay kit Methods 0.000 description 2
- 230000006399 behavior Effects 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 238000007413 biotinylation Methods 0.000 description 2
- 230000006287 biotinylation Effects 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 210000001124 body fluid Anatomy 0.000 description 2
- 230000007177 brain activity Effects 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- 238000004422 calculation algorithm Methods 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 229910052799 carbon Inorganic materials 0.000 description 2
- 229910002092 carbon dioxide Inorganic materials 0.000 description 2
- 230000003197 catalytic effect Effects 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- ZPEIMTDSQAKGNT-UHFFFAOYSA-N chlorpromazine Chemical compound C1=C(Cl)C=C2N(CCCN(C)C)C3=CC=CC=C3SC2=C1 ZPEIMTDSQAKGNT-UHFFFAOYSA-N 0.000 description 2
- 229960001076 chlorpromazine Drugs 0.000 description 2
- 238000013375 chromatographic separation Methods 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 230000007278 cognition impairment Effects 0.000 description 2
- 230000003931 cognitive performance Effects 0.000 description 2
- 230000036992 cognitive tasks Effects 0.000 description 2
- 238000004440 column chromatography Methods 0.000 description 2
- 238000004590 computer program Methods 0.000 description 2
- 238000005094 computer simulation Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- 230000034994 death Effects 0.000 description 2
- 238000001212 derivatisation Methods 0.000 description 2
- 239000003599 detergent Substances 0.000 description 2
- 239000008121 dextrose Substances 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 230000002526 effect on cardiovascular system Effects 0.000 description 2
- 230000002616 endonucleolytic effect Effects 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 230000007613 environmental effect Effects 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 230000007717 exclusion Effects 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 239000007850 fluorescent dye Substances 0.000 description 2
- 238000002290 gas chromatography-mass spectrometry Methods 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 238000003205 genotyping method Methods 0.000 description 2
- 229940050410 gluconate Drugs 0.000 description 2
- 235000011187 glycerol Nutrition 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 2
- 230000003100 immobilizing effect Effects 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 238000003364 immunohistochemistry Methods 0.000 description 2
- 238000005462 in vivo assay Methods 0.000 description 2
- 230000010365 information processing Effects 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 239000007951 isotonicity adjuster Substances 0.000 description 2
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 2
- 239000004816 latex Substances 0.000 description 2
- 229920000126 latex Polymers 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 229910001629 magnesium chloride Inorganic materials 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 238000002595 magnetic resonance imaging Methods 0.000 description 2
- 238000013507 mapping Methods 0.000 description 2
- 238000000816 matrix-assisted laser desorption--ionisation Methods 0.000 description 2
- 230000017813 membrane repolarization Effects 0.000 description 2
- 230000002503 metabolic effect Effects 0.000 description 2
- 150000002742 methionines Chemical class 0.000 description 2
- OSWPMRLSEDHDFF-UHFFFAOYSA-N methyl salicylate Chemical compound COC(=O)C1=CC=CC=C1O OSWPMRLSEDHDFF-UHFFFAOYSA-N 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 230000005012 migration Effects 0.000 description 2
- 238000013508 migration Methods 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 230000002107 myocardial effect Effects 0.000 description 2
- 210000004165 myocardium Anatomy 0.000 description 2
- 239000003176 neuroleptic agent Substances 0.000 description 2
- 230000000926 neurological effect Effects 0.000 description 2
- 239000002858 neurotransmitter agent Substances 0.000 description 2
- 238000010606 normalization Methods 0.000 description 2
- 238000003499 nucleic acid array Methods 0.000 description 2
- 239000002674 ointment Substances 0.000 description 2
- 210000000287 oocyte Anatomy 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 2
- 239000000816 peptidomimetic Substances 0.000 description 2
- 230000002085 persistent effect Effects 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 230000004962 physiological condition Effects 0.000 description 2
- 239000004033 plastic Substances 0.000 description 2
- 229920003023 plastic Polymers 0.000 description 2
- 238000007747 plating Methods 0.000 description 2
- 229920005862 polyol Polymers 0.000 description 2
- 150000003077 polyols Chemical class 0.000 description 2
- 230000004481 post-translational protein modification Effects 0.000 description 2
- 229910052700 potassium Inorganic materials 0.000 description 2
- 239000011591 potassium Substances 0.000 description 2
- 230000036515 potency Effects 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 238000004393 prognosis Methods 0.000 description 2
- 230000004853 protein function Effects 0.000 description 2
- 239000012474 protein marker Substances 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 239000000376 reactant Substances 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 238000003345 scintillation counting Methods 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- 210000002027 skeletal muscle Anatomy 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 238000001228 spectrum Methods 0.000 description 2
- 238000012421 spiking Methods 0.000 description 2
- 238000009987 spinning Methods 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- 238000013517 stratification Methods 0.000 description 2
- 238000012916 structural analysis Methods 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 2
- 230000009897 systematic effect Effects 0.000 description 2
- 238000012353 t test Methods 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 230000004797 therapeutic response Effects 0.000 description 2
- 230000001256 tonic effect Effects 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 239000003656 tris buffered saline Substances 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- 230000003936 working memory Effects 0.000 description 2
- 238000002424 x-ray crystallography Methods 0.000 description 2
- NLEBIOOXCVAHBD-YHBSTRCHSA-N (2r,3r,4s,5s,6r)-2-[(2r,3s,4r,5r,6s)-6-dodecoxy-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound O[C@@H]1[C@@H](O)[C@@H](OCCCCCCCCCCCC)O[C@H](CO)[C@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 NLEBIOOXCVAHBD-YHBSTRCHSA-N 0.000 description 1
- ASWBNKHCZGQVJV-UHFFFAOYSA-N (3-hexadecanoyloxy-2-hydroxypropyl) 2-(trimethylazaniumyl)ethyl phosphate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(O)COP([O-])(=O)OCC[N+](C)(C)C ASWBNKHCZGQVJV-UHFFFAOYSA-N 0.000 description 1
- BGRJTUBHPOOWDU-NSHDSACASA-N (S)-(-)-sulpiride Chemical compound CCN1CCC[C@H]1CNC(=O)C1=CC(S(N)(=O)=O)=CC=C1OC BGRJTUBHPOOWDU-NSHDSACASA-N 0.000 description 1
- 230000006269 (delayed) early viral mRNA transcription Effects 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- PXFBZOLANLWPMH-UHFFFAOYSA-N 16-Epiaffinine Natural products C1C(C2=CC=CC=C2N2)=C2C(=O)CC2C(=CC)CN(C)C1C2CO PXFBZOLANLWPMH-UHFFFAOYSA-N 0.000 description 1
- ZIIUUSVHCHPIQD-UHFFFAOYSA-N 2,4,6-trimethyl-N-[3-(trifluoromethyl)phenyl]benzenesulfonamide Chemical compound CC1=CC(C)=CC(C)=C1S(=O)(=O)NC1=CC=CC(C(F)(F)F)=C1 ZIIUUSVHCHPIQD-UHFFFAOYSA-N 0.000 description 1
- UFBJCMHMOXMLKC-UHFFFAOYSA-N 2,4-dinitrophenol Chemical compound OC1=CC=C([N+]([O-])=O)C=C1[N+]([O-])=O UFBJCMHMOXMLKC-UHFFFAOYSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- SNBCLPGEMZEWLU-QXFUBDJGSA-N 2-chloro-n-[[(2r,3s,5r)-3-hydroxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methyl]acetamide Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CNC(=O)CCl)[C@@H](O)C1 SNBCLPGEMZEWLU-QXFUBDJGSA-N 0.000 description 1
- SVTBMSDMJJWYQN-UHFFFAOYSA-N 2-methylpentane-2,4-diol Chemical compound CC(O)CC(C)(C)O SVTBMSDMJJWYQN-UHFFFAOYSA-N 0.000 description 1
- GYJNVSAUBGJVLV-UHFFFAOYSA-N 3-(dimethylazaniumyl)propane-1-sulfonate Chemical compound CN(C)CCCS(O)(=O)=O GYJNVSAUBGJVLV-UHFFFAOYSA-N 0.000 description 1
- UMCMPZBLKLEWAF-BCTGSCMUSA-N 3-[(3-cholamidopropyl)dimethylammonio]propane-1-sulfonate Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCC[N+](C)(C)CCCS([O-])(=O)=O)C)[C@@]2(C)[C@@H](O)C1 UMCMPZBLKLEWAF-BCTGSCMUSA-N 0.000 description 1
- GUQQBLRVXOUDTN-XOHPMCGNSA-N 3-[dimethyl-[3-[[(4r)-4-[(3r,5s,7r,8r,9s,10s,12s,13r,14s,17r)-3,7,12-trihydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthren-17-yl]pentanoyl]amino]propyl]azaniumyl]-2-hydroxypropane-1-sulfonate Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCC[N+](C)(C)CC(O)CS([O-])(=O)=O)C)[C@@]2(C)[C@@H](O)C1 GUQQBLRVXOUDTN-XOHPMCGNSA-N 0.000 description 1
- 102000040125 5-hydroxytryptamine receptor family Human genes 0.000 description 1
- 108091032151 5-hydroxytryptamine receptor family Proteins 0.000 description 1
- DLFVBJFMPXGRIB-UHFFFAOYSA-N Acetamide Chemical compound CC(N)=O DLFVBJFMPXGRIB-UHFFFAOYSA-N 0.000 description 1
- HJCMDXDYPOUFDY-WHFBIAKZSA-N Ala-Gln Chemical compound C[C@H](N)C(=O)N[C@H](C(O)=O)CCC(N)=O HJCMDXDYPOUFDY-WHFBIAKZSA-N 0.000 description 1
- 102100021325 Antizyme inhibitor 1 Human genes 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 208000002109 Argyria Diseases 0.000 description 1
- 102100034193 Aspartate aminotransferase, mitochondrial Human genes 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 241000972773 Aulopiformes Species 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 102100031680 Beta-catenin-interacting protein 1 Human genes 0.000 description 1
- 101000800130 Bos taurus Thyroglobulin Proteins 0.000 description 1
- 238000009010 Bradford assay Methods 0.000 description 1
- 208000014644 Brain disease Diseases 0.000 description 1
- 102100025752 CASP8 and FADD-like apoptosis regulator Human genes 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 102100038563 Calcium-binding mitochondrial carrier protein Aralar1 Human genes 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical group [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 108091005462 Cation channels Proteins 0.000 description 1
- 241000819038 Chichester Species 0.000 description 1
- 208000017667 Chronic Disease Diseases 0.000 description 1
- 208000028698 Cognitive impairment Diseases 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 206010010356 Congenital anomaly Diseases 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 206010011168 Cortical dysfunction Diseases 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- KDXKERNSBIXSRK-RXMQYKEDSA-N D-lysine Chemical compound NCCCC[C@@H](N)C(O)=O KDXKERNSBIXSRK-RXMQYKEDSA-N 0.000 description 1
- HMFHBZSHGGEWLO-SOOFDHNKSA-N D-ribofuranose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H]1O HMFHBZSHGGEWLO-SOOFDHNKSA-N 0.000 description 1
- 101150049660 DRD2 gene Proteins 0.000 description 1
- 241000252212 Danio rerio Species 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 241000792859 Enema Species 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 238000001134 F-test Methods 0.000 description 1
- 241000724791 Filamentous phage Species 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 108010001515 Galectin 4 Proteins 0.000 description 1
- 102100039556 Galectin-4 Human genes 0.000 description 1
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- 239000012981 Hank's balanced salt solution Substances 0.000 description 1
- 101710154606 Hemagglutinin Proteins 0.000 description 1
- 101000895049 Homo sapiens Antizyme inhibitor 1 Proteins 0.000 description 1
- 101000799549 Homo sapiens Aspartate aminotransferase, mitochondrial Proteins 0.000 description 1
- 101000993469 Homo sapiens Beta-catenin-interacting protein 1 Proteins 0.000 description 1
- 101000914211 Homo sapiens CASP8 and FADD-like apoptosis regulator Proteins 0.000 description 1
- 101100465255 Homo sapiens CFP gene Proteins 0.000 description 1
- 101001050286 Homo sapiens Jupiter microtubule associated homolog 1 Proteins 0.000 description 1
- 101001056308 Homo sapiens Malate dehydrogenase, cytoplasmic Proteins 0.000 description 1
- 101000598416 Homo sapiens Mitochondrial import inner membrane translocase subunit Tim17-A Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102100023133 Jupiter microtubule associated homolog 1 Human genes 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- 241000713666 Lentivirus Species 0.000 description 1
- 102100026475 Malate dehydrogenase, cytoplasmic Human genes 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 206010027336 Menstruation delayed Diseases 0.000 description 1
- 244000246386 Mentha pulegium Species 0.000 description 1
- 235000016257 Mentha pulegium Nutrition 0.000 description 1
- 235000004357 Mentha x piperita Nutrition 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 102100037824 Mitochondrial import inner membrane translocase subunit Tim17-A Human genes 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 108010021466 Mutant Proteins Proteins 0.000 description 1
- 102000008300 Mutant Proteins Human genes 0.000 description 1
- PKFBJSDMCRJYDC-GEZSXCAASA-N N-acetyl-s-geranylgeranyl-l-cysteine Chemical compound CC(C)=CCC\C(C)=C\CC\C(C)=C\CC\C(C)=C\CSC[C@@H](C(O)=O)NC(C)=O PKFBJSDMCRJYDC-GEZSXCAASA-N 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 208000019740 Neurodevelopmental abnormality Diseases 0.000 description 1
- 206010060860 Neurological symptom Diseases 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 239000004677 Nylon Substances 0.000 description 1
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 1
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 1
- 229930040373 Paraformaldehyde Natural products 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 102000011420 Phospholipase D Human genes 0.000 description 1
- 108090000553 Phospholipase D Proteins 0.000 description 1
- 108010064785 Phospholipases Proteins 0.000 description 1
- 102000015439 Phospholipases Human genes 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 101710176177 Protein A56 Proteins 0.000 description 1
- 241000125945 Protoparvovirus Species 0.000 description 1
- 101100084022 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) lapA gene Proteins 0.000 description 1
- 239000012083 RIPA buffer Substances 0.000 description 1
- 238000002123 RNA extraction Methods 0.000 description 1
- 102100037420 Regulator of G-protein signaling 4 Human genes 0.000 description 1
- 101710140404 Regulator of G-protein signaling 4 Proteins 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- 108091006419 SLC25A12 Proteins 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 1
- 108091081021 Sense strand Proteins 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- XUIMIQQOPSSXEZ-UHFFFAOYSA-N Silicon Chemical compound [Si] XUIMIQQOPSSXEZ-UHFFFAOYSA-N 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- DWAQJAXMDSEUJJ-UHFFFAOYSA-M Sodium bisulfite Chemical compound [Na+].OS([O-])=O DWAQJAXMDSEUJJ-UHFFFAOYSA-M 0.000 description 1
- 241000256248 Spodoptera Species 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- 208000037065 Subacute sclerosing leukoencephalitis Diseases 0.000 description 1
- 206010042297 Subacute sclerosing panencephalitis Diseases 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 206010049418 Sudden Cardiac Death Diseases 0.000 description 1
- 206010042434 Sudden death Diseases 0.000 description 1
- 206010065604 Suicidal behaviour Diseases 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical class OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 1
- KLBQZWRITKRQQV-UHFFFAOYSA-N Thioridazine Chemical compound C12=CC(SC)=CC=C2SC2=CC=CC=C2N1CCC1CCCCN1C KLBQZWRITKRQQV-UHFFFAOYSA-N 0.000 description 1
- 108010022394 Threonine synthase Proteins 0.000 description 1
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Natural products O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 1
- 102000009843 Thyroglobulin Human genes 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- 108700029229 Transcriptional Regulatory Elements Proteins 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 102000014384 Type C Phospholipases Human genes 0.000 description 1
- 108010079194 Type C Phospholipases Proteins 0.000 description 1
- 108700041682 VBM protocol Proteins 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 241000269370 Xenopus <genus> Species 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 150000001242 acetic acid derivatives Chemical class 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000003044 adaptive effect Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 238000009098 adjuvant therapy Methods 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 238000012867 alanine scanning Methods 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 150000001408 amides Chemical group 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 230000001090 anti-dopaminergic effect Effects 0.000 description 1
- 230000002932 anti-schizophrenic effect Effects 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- PYMYPHUHKUWMLA-WDCZJNDASA-N arabinose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)C=O PYMYPHUHKUWMLA-WDCZJNDASA-N 0.000 description 1
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 101150024767 arnT gene Proteins 0.000 description 1
- 238000003491 array Methods 0.000 description 1
- 230000006793 arrhythmia Effects 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 230000000712 assembly Effects 0.000 description 1
- 238000000429 assembly Methods 0.000 description 1
- 238000012098 association analyses Methods 0.000 description 1
- 244000052616 bacterial pathogen Species 0.000 description 1
- 230000003385 bacteriostatic effect Effects 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 1
- 239000003833 bile salt Substances 0.000 description 1
- 229940093761 bile salts Drugs 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 230000003851 biochemical process Effects 0.000 description 1
- 229920000249 biocompatible polymer Polymers 0.000 description 1
- 239000012620 biological material Substances 0.000 description 1
- 229920001222 biopolymer Polymers 0.000 description 1
- 230000017531 blood circulation Effects 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 210000004958 brain cell Anatomy 0.000 description 1
- 230000003925 brain function Effects 0.000 description 1
- 238000009395 breeding Methods 0.000 description 1
- 230000001488 breeding effect Effects 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 150000004657 carbamic acid derivatives Chemical class 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 150000004649 carbonic acid derivatives Chemical class 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 125000002057 carboxymethyl group Chemical group [H]OC(=O)C([H])([H])[*] 0.000 description 1
- 238000005277 cation exchange chromatography Methods 0.000 description 1
- 230000030570 cellular localization Effects 0.000 description 1
- 230000007248 cellular mechanism Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 230000002490 cerebral effect Effects 0.000 description 1
- 229940125400 channel inhibitor Drugs 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000005285 chemical preparation method Methods 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol group Chemical group [C@@H]1(CC[C@H]2[C@@H]3CC=C4C[C@@H](O)CC[C@]4(C)[C@H]3CC[C@]12C)[C@H](C)CCCC(C)C HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 230000027288 circadian rhythm Effects 0.000 description 1
- 150000001860 citric acid derivatives Chemical class 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 208000010877 cognitive disease Diseases 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 229940075614 colloidal silicon dioxide Drugs 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 230000006957 competitive inhibition Effects 0.000 description 1
- 230000000536 complexating effect Effects 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 210000001608 connective tissue cell Anatomy 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000013270 controlled release Methods 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 230000007585 cortical function Effects 0.000 description 1
- 239000006059 cover glass Substances 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 229960003964 deoxycholic acid Drugs 0.000 description 1
- 230000000368 destabilizing effect Effects 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 229960002086 dextran Drugs 0.000 description 1
- 229960000633 dextran sulfate Drugs 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 125000004427 diamine group Chemical group 0.000 description 1
- 239000010432 diamond Substances 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 230000009274 differential gene expression Effects 0.000 description 1
- 102000004419 dihydrofolate reductase Human genes 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000003113 dilution method Methods 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 238000011038 discontinuous diafiltration by volume reduction Methods 0.000 description 1
- 238000002224 dissection Methods 0.000 description 1
- NAGJZTKCGNOGPW-UHFFFAOYSA-N dithiophosphoric acid Chemical class OP(O)(S)=S NAGJZTKCGNOGPW-UHFFFAOYSA-N 0.000 description 1
- 230000003291 dopaminomimetic effect Effects 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 238000009509 drug development Methods 0.000 description 1
- 238000002651 drug therapy Methods 0.000 description 1
- 230000004064 dysfunction Effects 0.000 description 1
- 238000000835 electrochemical detection Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 230000008451 emotion Effects 0.000 description 1
- 230000002996 emotional effect Effects 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 239000007920 enema Substances 0.000 description 1
- 229940079360 enema for constipation Drugs 0.000 description 1
- 108010048367 enhanced green fluorescent protein Proteins 0.000 description 1
- 238000001952 enzyme assay Methods 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 230000001073 episodic memory Effects 0.000 description 1
- 230000002922 epistatic effect Effects 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- 238000012869 ethanol precipitation Methods 0.000 description 1
- RTZKZFJDLAIYFH-UHFFFAOYSA-N ether Substances CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 1
- DEFVIWRASFVYLL-UHFFFAOYSA-N ethylene glycol bis(2-aminoethyl)tetraacetic acid Chemical compound OC(=O)CN(CC(O)=O)CCOCCOCCN(CC(O)=O)CC(O)=O DEFVIWRASFVYLL-UHFFFAOYSA-N 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- 238000000105 evaporative light scattering detection Methods 0.000 description 1
- 230000002964 excitative effect Effects 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 238000010195 expression analysis Methods 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 238000000556 factor analysis Methods 0.000 description 1
- 230000002550 fecal effect Effects 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 238000001917 fluorescence detection Methods 0.000 description 1
- 238000001215 fluorescent labelling Methods 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 238000002825 functional assay Methods 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- IECPWNUMDGFDKC-MZJAQBGESA-N fusidic acid Chemical class O[C@@H]([C@@H]12)C[C@H]3\C(=C(/CCC=C(C)C)C(O)=O)[C@@H](OC(C)=O)C[C@]3(C)[C@@]2(C)CC[C@@H]2[C@]1(C)CC[C@@H](O)[C@H]2C IECPWNUMDGFDKC-MZJAQBGESA-N 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 238000010359 gene isolation Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 230000008303 genetic mechanism Effects 0.000 description 1
- 230000004034 genetic regulation Effects 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- 210000004209 hair Anatomy 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 230000008801 hippocampal function Effects 0.000 description 1
- 235000001050 hortel pimenta Nutrition 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 1
- 230000002102 hyperpolarization Effects 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000002055 immunohistochemical effect Effects 0.000 description 1
- 239000012133 immunoprecipitate Substances 0.000 description 1
- 230000003116 impacting effect Effects 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 238000012405 in silico analysis Methods 0.000 description 1
- 238000000126 in silico method Methods 0.000 description 1
- 238000007901 in situ hybridization Methods 0.000 description 1
- 238000011503 in vivo imaging Methods 0.000 description 1
- 230000000415 inactivating effect Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 210000004969 inflammatory cell Anatomy 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 238000012482 interaction analysis Methods 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 229940045996 isethionic acid Drugs 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 210000002510 keratinocyte Anatomy 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 230000002045 lasting effect Effects 0.000 description 1
- 230000014725 late viral mRNA transcription Effects 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 238000004811 liquid chromatography Methods 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 239000012160 loading buffer Substances 0.000 description 1
- 230000033001 locomotion Effects 0.000 description 1
- 230000006742 locomotor activity Effects 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000010297 mechanical methods and process Methods 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 210000002752 melanocyte Anatomy 0.000 description 1
- 230000006386 memory function Effects 0.000 description 1
- 230000007334 memory performance Effects 0.000 description 1
- 230000003340 mental effect Effects 0.000 description 1
- 238000010197 meta-analysis Methods 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- STZCRXQWRGQSJD-GEEYTBSJSA-M methyl orange Chemical compound [Na+].C1=CC(N(C)C)=CC=C1\N=N\C1=CC=C(S([O-])(=O)=O)C=C1 STZCRXQWRGQSJD-GEEYTBSJSA-M 0.000 description 1
- 229940012189 methyl orange Drugs 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 229960001047 methyl salicylate Drugs 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 230000037230 mobility Effects 0.000 description 1
- 238000000329 molecular dynamics simulation Methods 0.000 description 1
- 230000001730 monoaminergic effect Effects 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 239000012120 mounting media Substances 0.000 description 1
- 239000002324 mouth wash Substances 0.000 description 1
- 229940051866 mouthwash Drugs 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- UMWKZHPREXJQGR-XOSAIJSUSA-N n-methyl-n-[(2s,3r,4r,5r)-2,3,4,5,6-pentahydroxyhexyl]decanamide Chemical compound CCCCCCCCCC(=O)N(C)C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO UMWKZHPREXJQGR-XOSAIJSUSA-N 0.000 description 1
- SBWGZAXBCCNRTM-CTHBEMJXSA-N n-methyl-n-[(2s,3r,4r,5r)-2,3,4,5,6-pentahydroxyhexyl]octanamide Chemical compound CCCCCCCC(=O)N(C)C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO SBWGZAXBCCNRTM-CTHBEMJXSA-N 0.000 description 1
- 239000007922 nasal spray Substances 0.000 description 1
- 239000006199 nebulizer Substances 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 210000000653 nervous system Anatomy 0.000 description 1
- 238000007857 nested PCR Methods 0.000 description 1
- 210000000933 neural crest Anatomy 0.000 description 1
- 230000007106 neurocognition Effects 0.000 description 1
- 238000002610 neuroimaging Methods 0.000 description 1
- 230000008555 neuronal activation Effects 0.000 description 1
- 230000007171 neuropathology Effects 0.000 description 1
- 210000004179 neuropil Anatomy 0.000 description 1
- 238000010855 neuropsychological testing Methods 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 231100000956 nontoxicity Toxicity 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 238000007899 nucleic acid hybridization Methods 0.000 description 1
- 230000000474 nursing effect Effects 0.000 description 1
- 229920001778 nylon Polymers 0.000 description 1
- HEGSGKPQLMEBJL-RKQHYHRCSA-N octyl beta-D-glucopyranoside Chemical compound CCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O HEGSGKPQLMEBJL-RKQHYHRCSA-N 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 230000003534 oscillatory effect Effects 0.000 description 1
- 230000020477 pH reduction Effects 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 229920002866 paraformaldehyde Polymers 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000001991 pathophysiological effect Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000013610 patient sample Substances 0.000 description 1
- 230000010412 perfusion Effects 0.000 description 1
- 238000001558 permutation test Methods 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- 101150009573 phoA gene Proteins 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 229940080469 phosphocellulose Drugs 0.000 description 1
- 150000004713 phosphodiesters Chemical class 0.000 description 1
- 150000008298 phosphoramidates Chemical class 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 150000003014 phosphoric acid esters Chemical class 0.000 description 1
- 230000029553 photosynthesis Effects 0.000 description 1
- 238000010672 photosynthesis Methods 0.000 description 1
- 230000007084 physiological dysfunction Effects 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920000447 polyanionic polymer Polymers 0.000 description 1
- 230000003234 polygenic effect Effects 0.000 description 1
- 239000004633 polyglycolic acid Substances 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 238000013105 post hoc analysis Methods 0.000 description 1
- 238000011886 postmortem examination Methods 0.000 description 1
- 230000001242 postsynaptic effect Effects 0.000 description 1
- 239000004036 potassium channel stimulating agent Substances 0.000 description 1
- 230000003334 potential effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000002360 prefrontal effect Effects 0.000 description 1
- 210000001176 projection neuron Anatomy 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 239000003380 propellant Substances 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 238000002331 protein detection Methods 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 238000000163 radioactive labelling Methods 0.000 description 1
- 238000013180 random effects model Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- 230000000284 resting effect Effects 0.000 description 1
- 230000036390 resting membrane potential Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 230000033764 rhythmic process Effects 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 125000000548 ribosyl group Chemical group C1([C@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 1
- 239000012146 running buffer Substances 0.000 description 1
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 1
- 229940081974 saccharin Drugs 0.000 description 1
- 235000019204 saccharin Nutrition 0.000 description 1
- 239000000901 saccharin and its Na,K and Ca salt Substances 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 239000012723 sample buffer Substances 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 208000022610 schizoaffective disease Diseases 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 210000000582 semen Anatomy 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 239000012679 serum free medium Substances 0.000 description 1
- 238000004088 simulation Methods 0.000 description 1
- 210000002460 smooth muscle Anatomy 0.000 description 1
- 210000000329 smooth muscle myocyte Anatomy 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- FHHPUSMSKHSNKW-SMOYURAASA-M sodium deoxycholate Chemical compound [Na+].C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC([O-])=O)C)[C@@]2(C)[C@@H](O)C1 FHHPUSMSKHSNKW-SMOYURAASA-M 0.000 description 1
- 235000010267 sodium hydrogen sulphite Nutrition 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 239000006104 solid solution Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 230000003595 spectral effect Effects 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 201000009032 substance abuse Diseases 0.000 description 1
- 231100000736 substance abuse Toxicity 0.000 description 1
- 208000011117 substance-related disease Diseases 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 150000005846 sugar alcohols Polymers 0.000 description 1
- 229960004940 sulpiride Drugs 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000002511 suppository base Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000000672 surface-enhanced laser desorption--ionisation Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 210000004243 sweat Anatomy 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 210000000225 synapse Anatomy 0.000 description 1
- 230000000946 synaptic effect Effects 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 238000004885 tandem mass spectrometry Methods 0.000 description 1
- 210000003478 temporal lobe Anatomy 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 231100001274 therapeutic index Toxicity 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 229960002784 thioridazine Drugs 0.000 description 1
- 238000003161 three-hybrid assay Methods 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 229960002175 thyroglobulin Drugs 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 230000005026 transcription initiation Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- HRXKRNGNAMMEHJ-UHFFFAOYSA-K trisodium citrate Chemical compound [Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O HRXKRNGNAMMEHJ-UHFFFAOYSA-K 0.000 description 1
- 229940038773 trisodium citrate Drugs 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 238000003160 two-hybrid assay Methods 0.000 description 1
- 238000010396 two-hybrid screening Methods 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 238000000825 ultraviolet detection Methods 0.000 description 1
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 1
- 229940045145 uridine Drugs 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 238000009777 vacuum freeze-drying Methods 0.000 description 1
- 230000007497 verbal memory Effects 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 238000012800 visualization Methods 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- 239000008215 water for injection Substances 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
- C12Q1/6883—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/156—Polymorphic or mutational markers
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/158—Expression markers
Definitions
- the invention is related to a novel primate specific brain isoform of the potassium channel KCNH2 and genetic association with risk for schizophrenia.
- prefrontal cortex PFC
- hippocampal formation HF
- memory functions both of which are impaired in patients with schizophrenia and in their healthy relatives
- PFC prefrontal cortex
- HF hippocampal formation
- Biological abnormalities in hippocampal and prefrontal cortices also are frequently reported in patients with schizophrenia and are also found with increased frequency in their healthy relatives, suggesting that they are heritable traits related to susceptibility genes.
- schizophrenia patients and their healthy relatives show reductions in HF volumes (L. J. Seidman et al. 2003 Schizophr Bull 29:803; M. D. Nelson et al.
- the invention is related to a novel primate specific brain isoform of the voltage-gated potassium channel KCNH2 and genetic association with risk for schizophrenia, and to related nucleic acid molecules, polypeptides, antibodies, screening assays, and diagnostics.
- polynucleotide sequence that is at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to a nucleotide sequence encoding a polypeptide comprising the amino acid sequence of SEQ ID NO:5. More embodiments concern the isolated nucleic acid molecule above, wherein the first amino acid of said polypeptide is replaced with M S S H S A (SEQ ID NO: 16) or M F S H S T (SEQ ID NO: 17). Still more embodiments concern the nucleic acid molecule above comprising a polynucleotide sequence that is at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the cDNA having SEQ ID NO:3.
- the isolated nucleic acid molecule above is a nucleic acid that encodes the amino acid sequence of SEQ ID NO: 5.
- the isolated nucleic acid molecule above is a nucleic acid that encodes the polypeptide of SEQ ID NO: 5, wherein the first amino acid of said polypeptide is replaced with M S S H S A (SEQ ID NO: 16) or M F S H S T (SEQ ID NO: 17).
- Still more embodiments concern an isolated nucleic acid molecule that hybridizes under stringent hybridization conditions to the nucleic acid molecule above, wherein said nucleic acid molecule that hybridizes does not hybridize under stringent hybridization conditions to a nucleic acid molecule having a nucleotide sequence consisting of only A residues or of only T residues.
- More embodiments concern an isolated polypeptide comprising an amino acid sequence that is at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to a polypeptide comprising the amino acid sequence of SEQ ID NO: 5.
- the isolated polypeptide above is modified in that the first amino acid of said polypeptide is replaced with M S S H S A (SEQ ID NO: 16) or M F S H S T (SEQ ID NO: 17).
- said polypeptide comprises the amino acid sequence of SEQ ID NO: 5 and, in yet more embodiments, the isolated polypeptide above is modified such that the first amino acid of said polypeptide is replaced with M S S H S A (SEQ ID NO: 16) or M F S H S T (SEQ ID NO: 17).
- Some aspects of the invention also concern a method of making a recombinant vector comprising inserting any of the isolated nucleic acid molecules described above into a vector.
- Recombinant vectors produced by the method above and methods of making a recombinant host cell comprising introducing this vector into a host cell are also contemplated embodiments.
- Recombinant host cells produced by these methods are also embodiments.
- some aspects of the invention concern a method of making a recombinant polypeptide comprising culturing the host cell above under conditions such that said recombinant polypeptide is expressed.
- An isolated antibody capable of specifically binding to any one of the polypeptides described above is also a contemplated embodiment.
- More embodiments concern a method of screening for therapeutic agents useful in the treatment of a neurological disease in a human comprising contacting a test compound with any one of the polypeptides described above; and detecting binding of said test compound to said polypeptide. Still more embodiments concern a method of screening for therapeutic agents useful in the treatment of a neurological disease in a human comprising (a) determining the activity of any one of the polypeptides described above, at a first concentration of a test compound or in the absence of said test compound, (b) determining the activity of said polypeptide at a second concentration of said test compound, and comparing the activity of said polypeptide under conditions (a) and (b) to the activity of the polypeptide in the presence of a known regulator. In some embodiments, the activity is current. Additional embodiments concern a method of screening for therapeutic agents useful in the treatment of a neurological disease in a human comprising contacting a test compound with a nucleic acid molecule comprising a
- polynucleotide sequence that encodes any one of the polypeptides described above, and detecting binding of said test compound to said polynucleotide.
- some aspects of the invention concern a method for the preparation of a pharmaceutical composition useful for the treatment of a neurological disease in a human comprising identifying a regulator of any one of the polypeptides described above, determining whether said regulator ameliorates the symptoms of said neurological disease in a human, and combining said regulator with an acceptable pharmaceutical carrier.
- said regulator is a small molecule, an R A molecule, an antisense oligonucleotide, a polypeptide, an antibody, or a ribozyme.
- Still further embodiments concern a method for predicting the likelihood that an individual will have schizophrenia or will have increased symptomology associated with schizophrenia comprising obtaining a DNA sample from an individual to be assessed, and determining the nucleotide present at a single nucleotide polymorphism (SNP) selected from Marker Ml, M2, M3, M4, M5, M6, M7, M8, M9, MIO, Mi l , M12, M13, M14, M15, M16, M17, M18, M19, M20, M21 , M22, M23, M24, M25, M26, M27, M28, M29, M30, M31 , M32, M33, M34, M35, M36, M37, M38, M39, M40, M41, M42, or M43, wherein the presence of a nucleotide from the risk allele at the SNP indicates that the individual has a greater likelihood of having schizophrenia, or a likelihood of having increased symptomology associated with schizophrenia, than an individual
- FIG. 3 Protein and cDNA sequences for KCNH2-1A and Isoform 3.1 in human.
- KCNH2-1 A protein SEQ ID NO: 2
- KCNH2-1 A cDNA SEQ ID NO: 1
- Isoform 3.1 protein SEQ ID NO: 4
- Isoform 3.1 cDNA SEQ ID NO: 3
- HERG ⁇ 2-102 is defined as a protein lacking amino acids 2-102 of HERG (SEQ ID NO: 2), thus making it SEQ ID NO: 5.
- Figure 6 Association of risk SNPs with (A) cognitive measures, (B) brain structure volumes, and (C) regional brain activity during memory-based tasks.
- Figure 7 (A) Regional gene expression and (B) association with risk genotype.
- Figure 8 Detection and quantification of Isoform 3.1 mRNA and protein.
- A Tissue-specific PCR
- B Tissue-specific QPCR
- C Protein Expression
- D Transfection and Cellular localization.
- FIG. 1 Characterization of KCNH2 currents in HEK293T cells expressing KCNH2-1A and Isoform 3.1.
- A Diagram of domain structures;
- B Currents evoked by voltage steps;
- C Effects on tail currents;
- D Activation curves;
- E Tail currents evoked by voltage steps; and
- F Deactivation time constants.
- Figure 10 Effect of Isoform 3.1 on KCNH2 currents and firing patterns in cortical neurons.
- A Tail currents in GFP-transfected neurons;
- B Tail currents in Isoform 3.1- transfected neurons;
- C Deactivation time constants;
- D Action potential discharge;
- E Spike frequencies; and
- F Effect of Isoform 3.1 on spike frequency adaptation.
- Figure 11 Physical map of SNPs, transcripts, QPCR assays, PCR primers, and re- sequenced regions.
- Figure 13 Pedigrees of 8 families with rare SNP M25 and association tables excluding these families.
- Figure 14 Genotype based differences in right hippocampal gray matter volume (MNI coordinates: 26, -12, -22 mm) for SNP M30, derived using optimized VBM.
- FIG. 15 Genotype based differences in right hippocampal gray matter volume (MNI coordinates: 26, -9, -24 mm) for SNP M31, derived using optimized VBM.
- FIG. 16 Genotype based differences in right hippocampal gray matter volume (MNI coordinates: 26, -9, -24 mm) for SNP M33, derived using optimized VBM.
- Figure 17 Genotype based differences in hippocampal engagement during a declarative memory task for SNP M31.
- FIG. 1 Genotype based differences in hippocampal engagement during a declarative memory task for SNP M33.
- Figure 19 NOS3 and KCNH2-1A expression in frontal cortex of neuroleptic treated rats.
- Figure 20 Tissue differences in Isoform 3.1 and KCNH2-1A using PCR and QPCR.
- Figure 21 Alignment and conservation of Isoform 3.1 5'-UTR sequence in primate and non-primate species.
- A DNA Sequence alignment of upstream region of exon 3. Human, (SEQ ID NO: 8); Rhesus, (SEQ ID NO: 9); Mouse, (SEQ ID NO: 10); Rat, (SEQ ID NO: 1 1).
- B Predicted longest ORF upstream of hERG-la Exon 3. Human, (SEQ ID NO: 12); Rhesus, (SEQ ID NO: 13); Mouse, (SEQ ID NO: 14); Rat, (SEQ ID NO: 15).
- HERG human eag-related gene
- eag ether-a-go.go K+ channel family
- LQT2 Long-QT2
- HERG has a subunit topology of six membrane-spanning stretches (Fig. 1).
- the HERG channel monomer has six transmembrane segments labeled SI to S6; S4 is the voltage sensor, and it contains six positively charged amino acids as indicated by the + symbols.
- the channel has a large C terminus and the characteristic N-terminal eag domain, both cytosolic; the pore region is situated between S5 and S6.
- the functional channel is a tetramer with a central ion conduction pathway.
- HERG exhibits two distinct and physiologically significant gating characteristics: rapid inactivation and slow deactivation (Trudeau, M. C. et al. 1995 Science 269:92-95; Smith, et al. 1996 Nature 379:833-836; Spector, P.S. et al. 1996 J Gen Physiol 107:611 -619).
- rapid inactivation means that when the channel is opened with cell membrane depolarization it very quickly enters a nonconducting (inactivated) state, passing very little current in the outward direction.
- the membrane is returned to its normal resting potential near -80 mV, the channel apparently retraces its conformational steps and passes through the open state on the way back to its closed configuration.
- PAS acronym for the gene products of Per, Arnt, and Sim
- PAS domains are found in proteins involved in the circadian rhythm, the cyclic patterns of hormone secretion, breeding, and locomotor activity in mammals and the oscillation of photosynthesis in plants.
- PAS domains regulate a variety of biochemical processes by serving as light and chemical sensors.
- the eag domains of KCNH2 (top) and Photoactive Yellow Protein (PYP) (bottom) are aligned according to superimposed structural models. It is clear that the eag domain and PYP have highly similar three-dimensional structures.
- the dashed boxes mark stretches of sequence where aligned residues occupy the same position in secondary structural elements that are common to both structures. Secondary structural elements are marked above and below the corresponding sequences: a helices as arrows, ⁇ strands as filled rectangles, 3io helix as open rectangle.
- the structural elements of the eag domain structure are labeled.
- the solid box marks residues that are disordered in the eag domain structure.
- the eag domain is an ⁇ + ⁇ protein with a five-stranded antiparallel ⁇ sheet ( ⁇ to ⁇ ) packed against a long ordered "vine" composed of coil and a single turn of 3io helix (a'A).
- the sheet is decorated on two sides by a helices (aA to aC).
- the structure has its N and C termini positioned side by side forming two central strands of the ⁇ sheet.
- HERG and other members of the eag K+ channel family contain a PAS domain on their cytoplasmic N terminus.
- Cabral et al. 1998 (Cabral et al. 1998 Cell 95:649-655) artificially created an N-terminally truncated protein (HERG ⁇ 2-135) lacking amino acids 2-135 of HERG.
- the cDNA sequence (SEQ ID NO: 1) and deduced amino acid sequence (SEQ ID NO:2) of KCNH2 are shown in Fig. 3; the general domain layouts are illustrated in Fig. 4.
- the cDNA sequence (SEQ ID NO:3) and deduced amino acid sequence (SEQ ID NO:4) of Isoform 3.1 are shown in Fig. 3; the general domain layouts are illustrated in Fig. 4.
- the present invention provides isolated nucleic acid molecules comprising
- HERG ⁇ 2-102 means an N-terminally truncated polypeptide lacking amino acids 2-102 of HERG (SEQ ID NO: 2) thus missing much of the PAS domain but retaining secondary structural elements ⁇ and ⁇ sheets and making it SEQ ID NO: 5, and, in some embodiments, replacing the first amino acid with 6 amino acids unique to the isoform in humans (M S S H S A; SEQ ID NO: 16), in monkeys (M F S H S T; SEQ ID NO: 17), or in other species.
- the invention further provides a nucleotide sequence determined from a mRNA molecule encoding isoform 3.1 , which comprises the cDNA encoding isoform 3.1, including the 1.1 Kb 5' untranslated region unique to isoform 3.1 (SEQ ID NO:3).
- isolated means that the material is removed from its original environment (e.g., the natural environment if it is naturally occurring).
- a naturally-occurring nucleic acid molecule or polynucleotide present in a living organism is not isolated, but the same nucleic acid molecule or polynucleotide, separated from some or all of the coexisting materials in the natural environment, is isolated.
- nucleic acid molecule could be part of a vector and/or such polynucleotide could be part of a composition, and still be isolated in that such vector or composition is not part of the natural environment of the nucleic acid molecule or polynucleotide.
- nucleotide sequence of a nucleic acid molecule or polynucleotide is intended, for a DNA molecule or polynucleotide, a sequence of deoxyribonucleotides, and for an RNA molecule or polynucleotide, the corresponding sequence of ribonucleotides (A, G, C and U), where each thymidine deoxyribonucleotide (T) in the specified deoxyribonucleotide sequence is replaced by the ribonucleotide uridine (U).
- a nucleic acid molecule of the present invention encoding a polypeptide may be obtained using standard cloning and screening procedures, such as those for cloning cDNAs using mRNA as starting material. See, for example, Molecular Cloning: a Laboratory Manual, 3rd edition, Sambrook et al. 2001 Cold Spring Harbor Laboratory Press, New York and Current Protocols in Molecular Biology, Ausubel et al. eds., John Wiley & Sons, 1994.
- Nucleic acid molecules of the present invention may be in the form of RNA, such as mRNA, or in the form of DNA, including, for instance, cDNA and genomic DNA obtained by cloning or produced synthetically.
- the DNA may be double-stranded or single-stranded.
- Single- stranded DNA or RNA may be the coding strand, also known as the sense strand, or it may be the non-coding strand, also referred to as the anti-sense strand.
- isolated nucleic acid molecules of the invention include DNA molecules that comprise a sequence substantially different from those described above but that, due to the degeneracy of the genetic code, still encode the proteins shown in the sequence listing.
- the genetic code and species- specific codon preferences are well known in the art.
- the invention further provides a nucleic acid molecule having a sequence complementary to one of the above sequences.
- Such isolated molecules are useful as probes for gene mapping, by in situ hybridization with chromosomes, and for detecting expression of the corresponding gene(s) in human tissue, for instance, by Northern blot analysis.
- the present invention is further directed to nucleic acid molecules encoding portions of the nucleotide sequences described herein as-well as to fragments of the isolated nucleic acid molecules described herein.
- fragments of an isolated nucleic acid molecule is intended fragments at least about 15 nt, and more preferably at least about 20 nt, still more preferably at least about 30 nt, and even more preferably, at least about 40 nt in length that are useful as diagnostic probes and primers.
- larger fragments 50-500 nt in length are also useful according to the present invention as are fragments corresponding to most, if not all, of the nucleic acid molecules encoding isoform 3.1.
- fragment “at least 20 nt in length” is intended fragments that include 20 or more contiguous bases from the nucleic acid molecules encoding isoform 3.1.
- Some nucleic acid fragments of the present invention include the 1.1 Kb 5' untranslated region unique to isoform 3.1.
- the invention provides an isolated nucleic acid molecule comprising a polynucleotide that hybridizes under stringent hybridization conditions to a portion of a nucleic acid molecule of the invention described above.
- stringent hybridization conditions is intended overnight incubation at 42°C in a solution comprising: 50% formamide, 5x SSC (750 mM NaCl, 75 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5x Denhardt's solution, 10%) dextran sulfate, and 20 ⁇ g/ml denatured, sheared salmon sperm DNA, followed by washing the filters in O.lx SSC at about 650C.
- a polynucleotide that hybridizes to a "portion" of a polynucleotide is intended a polynucleotide (either DNA or RNA) hybridizing to at least about 15 nucleotides (nt), and more preferably at least about 20 nt, still more preferably at least about 30 nt, and even more preferably about 30-70 (e.g., 50) nt, or 50-500 nts in length or fragments corresponding to most, if not all, of the reference polynucleotide.
- nt nucleotides
- a polynucleotide that hybridizes only to a poly A sequence such as any 3' terminal poly(A) tract of a cDNA), or to a complementary stretch of T (or U) residues, would not be included in a polynucleotide of the invention used to hybridize to a portion of a nucleic acid of the invention, since such a polynucleotide would hybridize to any nucleic acid molecule containing a poly (A) stretch or the complement thereof (e.g., practically any double-stranded cDNA clone).
- nucleic acids of the invention are the amino acid sequences of the invention together with additional, non-coding sequences, including for example, but not limited to introns and non-coding 5' and 3' sequences, such as the transcribed, non-translated sequences that play a role in transcription, mRNA processing, including splicing and polyadenylation signals, for example— ribosome binding and stability of mRNA; and additional coding sequence that codes for additional amino acids, such as those that provide additional functionalities.
- additional, non-coding sequences including for example, but not limited to introns and non-coding 5' and 3' sequences, such as the transcribed, non-translated sequences that play a role in transcription, mRNA processing, including splicing and polyadenylation signals, for example— ribosome binding and stability of mRNA
- additional coding sequence that codes for additional amino acids, such as those that provide additional functionalities.
- sequence encoding the polypeptide may be fused to a marker sequence, such as a sequence encoding a peptide that facilitates purification of the fused polypeptide.
- the marker amino acid sequence is a hexa- histidine peptide, such as the tag provided in a pQE vector (QIAGEN Inc., 28159 Avenue
- hexa-histidine provides for convenient purification of the fusion protein.
- the "HA” tag is another peptide useful for purification that corresponds to an epitope derived from the influenza hemagglutinin protein, which has been described by Wilson et al. 1984 Cell 37:767-778.
- the present invention further relates to variants of the nucleic acid molecules of the i 0 present invention, which encode portions, analogs or derivatives of the isoform.
- Variants may occur naturally, such as a natural allelic variant.
- allelic variant is intended one of several alternate forms of a gene occupying a given locus on a chromosome of an organism. Genes II, Lewin, B., ed., John Wiley & Sons, New York (1985). Non-naturally occurring variants may be produced using art-known mutagenesis techniques.
- variants include those produced by nucleotide substitutions, deletions or additions.
- the substitutions, deletions or additions may involve one or more nucleotides.
- the variants may be altered in coding regions, non-coding regions, or both. Alterations in the coding regions may produce conservative or non-conservative amino acid substitutions, deletions or additions.
- nucleic acid molecules encoding isoform 3.1 having the amino acid sequence of SEQ ID NO: 5 and the nucleotide sequence of the cDNA having SEQ ID NO: 3.
- Further embodiments include an isolated nucleic acid molecule comprising a polynucleotide having a nucleotide sequence at least 85% identical, more preferably at least 90% identical, and most preferably at least 95%, 96%, 97%, 98% or 99% identical to a polynucleotide of the invention, or a polynucleotide that hybridizes under stringent hybridization conditions to such a polynucleotide.
- This polynucleotide that hybridizes does not hybridize under stringent hybridization conditions to a polynucleotide 0 having a nucleotide sequence consisting of only A residues or of only T residues.
- An additional nucleic acid embodiment of the invention relates to an isolated nucleic acid molecule comprising a polynucleotide that includes the 1.1 Kb 5' untranslated region unique to isoform 3.1.
- nucleotide sequence at least, for example, 95% “identical" to a reference nucleotide sequence is intended that the nucleotide sequence of the polynucleotide is identical to the reference sequence except that the polynucleotide sequence may include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence encoding the reference polypeptide.
- a polynucleotide having a nucleotide sequence at least 95% identical to a reference nucleotide sequence up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence may be inserted into the reference sequence.
- These mutations of the reference sequence may occur at the 5' or 3' terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among nucleotides in the reference sequence or in one or more contiguous groups within the reference sequence.
- nucleotide sequence encoding isoform 3.1 having the amino acid sequence of SEQ ID NO: 5 and the nucleotide sequence of the cDNA having SEQ ID NO: 3 can be determined conventionally using known computer programs such as the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, Wis. 5371 1). Bestfit uses the local homology algorithm of Smith and Waterman 1981 Advances in Applied Mathematics 2:482-489, to find the best segment of homology between two sequences.
- the parameters are set, of course, such that the percentage of identity is calculated over the full length of the reference nucleotide sequence and that gaps in homology of up to 5% of the total number of nucleotides in the reference sequence are allowed.
- the present invention also relates to vectors that include the isolated DNA molecules of the present invention, host cells that are genetically engineered with the recombinant vectors, and the production of polypeptides or fragments thereof by recombinant techniques.
- the vector may be, for example, a phage, plasmid, viral or retroviral vector. Retroviral vectors may be
- replication competent or replication defective In the latter case, viral propagation generally will occur only in complementing host cells.
- the polynucleotides may be joined to a vector containing a selectable marker for propagation in a host.
- a plasmid vector is introduced in a precipitate, such as a calcium phosphate precipitate, or in a complex with a charged lipid. If the vector is a virus, it may be packaged in vitro using an appropriate packaging cell line and then transduced into host cells.
- the DNA insert should be operatively linked to an appropriate promoter, such as the phage lambda PL promoter, the E. coli lac, tip, phoA and tac promoters, the SV40 early and late promoters and promoters of retroviral LTRs, to name a few.
- an appropriate promoter such as the phage lambda PL promoter, the E. coli lac, tip, phoA and tac promoters, the SV40 early and late promoters and promoters of retroviral LTRs, to name a few.
- Other suitable promoters will be known to the skilled artisan.
- the expression constructs will further contain sites for transcription initiation, termination and, in the transcribed region, a ribosome binding site for translation.
- the coding portion of the transcripts expressed by the constructs will preferably include a translation initiating codon at the beginning and a termination codon (UAA, UGA or UAG) appropriately positioned at the end of the polypeptide to be translated.
- the expression vectors will preferably include at least one selectable marker.
- markers include dihydrofolate reductase, G418 or neomycin resistance for eukaryotic cell culture and tetracycline, kanamycin or ampicillin resistance genes for culturing in E. coli and other bacteria.
- Representative examples of appropriate hosts include, but are not limited to, bacterial cells, such as E. coli, Streptomyces and Salmonella typhimurium cells; fungal cells, such as yeast cells; insect cells such as Drosophila S2 and Spodoptera Sf9 cells; animal cells such as CHO, COS, and 293 cells; and plant cells. Appropriate culture mediums and conditions for the above-described host cells are known in the art.
- vectors available for use in bacteria include pQE70, pQE60 and pQE-9, available from QIAGEN, Inc., supra; pBluescript vectors, Phagescript vectors, pNH8A, pNH16a, pNH18A, pNH46A, available from Stratagene Cloning Systems, Inc.; and ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5 available from Pharmacia Biotech, Inc.
- eukaryotic vectors are pWLNEO, pSV2CAT, pOG44, pXTl and pSG available from Stratagene; and pSVK3, pBPV, pMSG and pSVL available from Pharmacia.
- Other suitable vectors will be readily apparent to the skilled artisan.
- Introduction of the construct into the host cell can be effected by calcium phosphate transfection, DEAE-dextran mediated transfection, cationic lipid-mediated transfection, electroporation, transduction, infection or other methods. Such methods are described in many standard laboratory manuals, such as Davis et al., Basic Methods In Molecular Biology (1986).
- the polypeptide may be expressed in a modified form, such as a fusion protein, and may include not only secretion signals, but also additional heterologous functional regions. For instance, a region of additional amino acids, particularly charged amino acids, may be added to the N-terminus of the polypeptide to improve stability and persistence in the host cell, during purification, or during subsequent handling and storage. Also, peptide moieties may be added to the polypeptide to facilitate purification. Such regions may be removed prior to final preparation of the polypeptide. The addition of peptide moieties to polypeptides to engender secretion or excretion, to improve stability and to facilitate purification, among others, are familiar and routine techniques in the art.
- a representative fusion protein comprises a heterologous region from immunoglobulin that is useful to stabilize and purify proteins.
- a protein of this invention can be recovered and purified from recombinant cell cultures by well-known methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. Most preferably, high performance liquid chromatography (“HPLC”) is employed for purification.
- HPLC high performance liquid chromatography
- Polypeptides of the present invention include: products purified from natural sources, including bodily fluids, tissues and cells, whether directly isolated or cultured; products of chemical synthetic procedures; and products produced by recombinant techniques from a prokaryotic or eukaryotic host, including, for example, bacterial, yeast, higher plant, insect and mammalian cells.
- a prokaryotic or eukaryotic host including, for example, bacterial, yeast, higher plant, insect and mammalian cells.
- the polypeptides of the present invention may be glycosylated or may be non- glycosylated.
- polypeptides of the invention may also include an initial modified methionine residue, in some cases as a result of host-mediated processes.
- N-terminal methionine encoded by the translation initiation codon generally is removed with high efficiency from any protein after translation in all eukaryotic cells. While the N-terminal methionine on most proteins also is efficiently removed in most prokaryotes, for some proteins this prokaryotic removal process is inefficient, depending on the nature of the amino acid to which the N-terminal methionine is covalently linked.
- the invention further provides isolated polypeptides having an amino acid sequence encoded by isoform 3.1 nucleic acid molecules, or a peptide or polypeptide comprising a portion of the above polypeptides.
- the amino acid sequence can be synthesized using commercially available peptide synthesizers. This is particularly useful in producing small peptides and fragments of larger polypeptides. Such fragments are useful, for example, in generating antibodies against the native polypeptide.
- polypeptides of the invention protein engineering may be employed.
- Recombinant DNA technology known to those skilled in the art can be used to create novel mutant proteins or "muteins" including single or multiple amino acid substitutions, deletions, additions or fusion proteins.
- Such modified polypeptides can show, e.g., enhanced activity or increased stability.
- they may be purified in higher yields and show better solubility than the corresponding natural polypeptide, at least under certain purification and storage conditions.
- the invention further includes variants of a polypeptide that show substantial biological activity or that include regions of the protein such as the portions discussed below.
- mutants include deletions, insertions, inversions, repeats, and type substitutions selected according to general rules known in the art so as have little effect on activity.
- guidance concerning how to make phenotypically silent amino acid substitutions is provided in Bowie, J. U. et al., 1990 Science 247: 1306-1310, wherein the authors indicate that there are two main approaches for studying the tolerance of an amino acid sequence to change.
- the first method relies on the process of evolution, in which mutations are either accepted or rejected by natural selection.
- the second approach uses genetic engineering to introduce amino acid changes at specific positions of a cloned gene and selections or screens to identify sequences that maintain functionality.
- the fragment, derivative or analog of a polypeptide of the invention may be (i) one in which one or more of the amino acid residues are substituted with a conserved or non- conserved amino acid residue (preferably a conserved amino acid residue) and such substituted amino acid residue may or may not be one encoded by the genetic code, or (ii) one in which one or more of the amino acid residues includes a substituent group, or (iii) one in which the mature polypeptide is fused with another compound, such as a compound to increase the half-life of the polypeptide (for example, polyethylene glycol), or (iv) one in which the additional amino acids are fused to the above form of the polypeptide, such as an IgG Fc fusion region peptide or leader or secretory sequence or a sequence that is employed for purification of the above form of the polypeptide or a proprotein sequence.
- a conserved or non- conserved amino acid residue preferably a conserved amino acid residue
- substituted amino acid residue may or may not
- polypeptides of the present invention may include one or more amino acid substitutions, deletions or additions, either from natural mutations or human manipulation.
- changes are preferably of a minor nature, such as conservative amino acid substitutions that do not significantly affect the folding or activity of the protein (refer to Table ! ⁇
- Amino acids in the protein of the present invention that are essential for function can be identified by methods known in the art, such as site-directed mutagenesis or alanine-scanning mutagenesis (Cunningham and Wells 1989 Science 244: 1081-1085). The latter procedure introduces single alanine mutations at every residue in the molecule. The resulting mutant molecules are then tested for biological activity such as binding characteristics or in vitro or in vivo channel activity.
- polypeptides of the present invention are preferably provided in an isolated form.
- a recombinantly produced version of a polypeptide of the invention can be substantially purified by the one-step method described in Smith and Johnson, 1988 Gene 67:31-40.
- Polypeptides of the invention also can be purified from natural or recombinant sources using antibodies of the invention raised against the protein in methods that are well known in the art of protein purification.
- polypeptides of the present invention include polypeptides that have at least 90% similarity, more preferably at least 95% similarity, and still more preferably at least 96%>, 97%», 98%o or 99% similarity to those described above.
- the polypeptides of the invention also comprise those that are at least 85% identical, more preferably at least 90% or 95% identical, still more preferably at least 96%, 97%, 98% or 99% identical to the polypeptide encoded by isoform 3.1 nucleic acid molecules, and also include portions of such polypeptides with at least 30 amino acids and more preferably at least 50 amino acids.
- % similarity for two polypeptides is intended a similarity score produced by comparing the amino acid sequences of the two polypeptides using the Bestfit program
- polypeptide having an amino acid sequence at least, for example, 95% "identical" to a reference amino acid sequence of a polypeptide described herein is intended that the amino acid sequence of the polypeptide is identical to the reference sequence except that the polypeptide sequence may include up to five amino acid alterations per each 100 amino acids of the reference amino acid of the polypeptide of the invention.
- up to 5% of the amino acid residues in the reference sequence may be deleted or substituted with another amino acid, or a number of amino acids up to 5% of the total amino acid residues in the reference sequence may be inserted into the reference sequence.
- These alterations of the reference sequence may occur at the amino or carboxy terminal positions of the reference amino acid sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence or in one or more contiguous groups within the reference sequence.
- Antibody as used herein includes intact immunoglobulin molecules, as well as fragments thereof, such as Fab, F(ab')2, and Fv, which are capable of binding an epitope of isoform 3.1.
- Fab fragments thereof
- F(ab')2 fragments thereof
- Fv fragments thereof
- epitopes that involve non-contiguous amino acids may require more, e.g., at least 15, 25, or 50 amino acid.
- An antibody that specifically binds to an epitope of isoform 3.1 can be used therapeutically, as well as in immunochemical assays, such as Western blots, ELISAs, radio immunoassays, immunohistochemical assays, immunoprecipitations, or other immunochemical assays known in the art.
- immunochemical assays such as Western blots, ELISAs, radio immunoassays, immunohistochemical assays, immunoprecipitations, or other immunochemical assays known in the art.
- Various immunoassays can be used to identify antibodies having the desired specificity. Numerous protocols for competitive binding or immunoradiometric assays are well known in the art. Such immunoassays typically involve the measurement of complex formation between an immunogen and an antibody that specifically binds to the isoform 3.1 immunogen.
- an antibody that specifically binds to isoform 3.1 provides a detection signal at least 5-, 10-, or 20-fold higher than a detection signal provided with other proteins when used in an immunochemical assay.
- antibodies that specifically bind to isoform 3.1 do not detect other proteins, especially KCNH2, in immunochemical assays and can immunoprecipitate isoform 3.1 from solution.
- Isoform 3.1 can be used to immunize a mammal, such as a mouse, rat or rabbit to produce polyclonal antibodies. If desired, isoform 3.1 can be conjugated to a carrier protein, such as bovine serum albumin, thyroglobulin, and keyhole limpet hemocyanin. Depending on the host species, various adjuvants can be used to increase the immunological response. Such adjuvants include, but are not limited to, Freund's adjuvant, mineral gels (e.g., aluminum hydroxide), and surface active substances (e.g., lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, and dinitrophenol). Among adjuvants used in humans, BCG (bacilli Calmette-Guerin) and Corynebacterium parvum are especially useful.
- BCG Bacilli Calmette-Guerin
- Corynebacterium parvum are
- Monoclonal antibodies that specifically bind to isoform 3.1 can be prepared using any technique that provides for the production of antibody molecules by continuous cell lines in culture. These techniques include, but are not limited to, the hybridoma technique, the human B- cell hybridoma technique, and the EBV-hybridoma technique.
- chimeric antibodies the splicing of mouse antibody genes to human antibody genes to obtain a molecule with appropriate antigen specificity and biological activity, can be used.
- Monoclonal and other antibodies also can be “humanized” to prevent a patient from mounting an immune response against the antibody when it is used therapeutically. Such antibodies may be sufficiently similar in sequence to human antibodies to be used directly in therapy or may require alteration of a few key residues.
- Sequence differences between rodent antibodies and human sequences can be minimized by replacing residues that differ from those in the human sequences by site directed mutagenesis of individual residues or by grafting of entire complementarily determining regions.
- Antibodies that specifically bind to isoform 3.1 can contain antigen binding sites that are either partially or fully humanized.
- single chain antibodies can be adapted using methods known in the art to produce single chain antibodies that specifically bind to isoform 3.1.
- Antibodies with related specificity, but of distinct idiotypic composition can be generated by chain shuffling from random combinatorial immunoglobin libraries.
- Single-chain antibodies also can be constructed using a DNA amplification method, such as PCR, using hybridoma cDNA as a template.
- Single-chain antibodies can be mono- or bispecific, and can be bivalent or tetravalent. Construction of tetravalent, bispecific single-chain antibodies is taught.
- a nucleotide sequence encoding a single-chain antibody can be constructed using manual or automated nucleotide synthesis, cloned into an expression construct using standard recombinant DNA methods, and introduced into a cell to express the coding sequence.
- single- chain antibodies can be produced directly using, for example, filamentous phage technology.
- Antibodies that specifically bind to isoform 3.1 also can be produced by inducing in vivo production in the lymphocyte population or by screening immunoglobulin libraries or panels of highly specific binding reagents. Other types of antibodies can be constructed and used therapeutically in methods of the invention. Binding proteins that are derived from
- Antibodies according to the invention can be purified by methods well known in the art. For example, antibodies can be affinity purified by passage over a column to which isoform 3.1 is bound. The bound antibodies can then be eluted from the column using a buffer with a high salt concentration.
- Antisense oligonucleotides are nucleotide sequences that are complementary to a specific DNA or RNA sequence. Once introduced into a cell, the complementary nucleotides combine with natural sequences produced by the cell to form complexes and block either transcription or translation.
- an antisense oligonucleotide is at least 1 1 nucleotides in length, but can be at least 12, 15, 20, 25, 30, 35, 40, 45, or 50 or more nucleotides long. Longer sequences also can be used.
- Antisense oligonucleotide molecules can be provided in a DNA construct and introduced into a cell as described above to decrease the level of isoform 3.1 gene products in the cell.
- Antisense oligonucleotides can be deoxyribonucleotides, ribonucleotides, or a combination of both. Oligonucleotides can be synthesized manually or by an automated synthesizer, by covalently linking the 5' end of one nucleotide with the 3' end of another nucleotide with non-phosphodiester internucleotide linkages such alkylphosphonates, phosphorothioates, phosphorodithioates, alkylphosphonothioates, alkylphosphonates, phosphoramidates, phosphate esters, carbamates, acetamidate, carboxymethyl esters, carbonates, and phosphate triesters.
- Modifications of isoform 3.1 gene expression can be obtained by designing antisense oligonucleotides that will form duplexes to the control, 5', or regulatory regions of the isoform 3.1 gene. Oligonucleotides derived from the transcription initiation site, e.g., between positions -10 and +10 from the start site, are preferred. Similarly, inhibition can be achieved using "triple helix" base- pairing methodology. Triple helix pairing is useful because it causes inhibition of the ability of the double helix to open sufficiently for the binding of polymerases, transcription factors, or chaperons. Therapeutic advances using triplex DNA have been described in the literature. An antisense oligonucleotide also can be designed to block translation of mRNA by preventing the transcript from binding to ribosomes.
- Antisense oligo nucleotides that comprise, for example, 2, 3, 4, or 5 or more stretches of contiguous nucleotides that are precisely complementary to an isoform 3.1 polynucleotide, each separated by a stretch of contiguous nucleotides that are not complementary to adjacent isoform 3.1 nucleotides, can provide sufficient targeting specificity for isoform 3.1 mRNA.
- each stretch of complementary contiguous nucleotides is at least 4, 5, 6, 7, or 8 or more nucleotides in length.
- Non- complementary intervening sequences are preferably 1 , 2, 3, or 4 nucleotides in length.
- One skilled in the art can easily use the calculated melting point of an antisense-sense pair to determine the degree of mismatching that will be tolerated between a particular antisense oligonucleotide and a particular isoform 3.1 polynucleotide sequence.
- Antisense oligonucleotides can be modified without affecting their ability to hybridize to an isoform 3.1 polynucleotide. These modifications can be internal or at one or both ends of the antisense molecule.
- internucleoside phosphate linkages can be modified by adding cholesteryl or diamine moieties with varying numbers of carbon residues between the amino groups and terminal ribose.
- Modified bases and/or sugars such as arabinose instead of ribose, or a 3', 5 '-substituted oligonucleotide in which the 3' hydroxyl group or the 5' phosphate group are substituted, also can be employed in a modified antisense oligonucleotide. These modified oligonucleotides can be prepared by methods well known in the art.
- Ribozymes are RNA molecules with catalytic activity. Ribozymes can be used to inhibit gene function by cleaving an RNA sequence, as is known in the art. The mechanism of ribozyme action involves sequence-specific hybridization of the ribozyme molecule to complementary target RNA, followed by endonucleolytic cleavage. Examples include engineered hammerhead motif ribozyme molecules that can specifically and efficiently catalyze endonucleolytic cleavage of specific nucleotide sequences. The coding sequence of an isoform 3.1 polynucleotide can be used to generate ribozymes that will specifically bind to mRNA transcribed from an isoform 3.1 polynucleotide.
- RNA sequences can be designed and constructed that can cleave other RNA molecules in trans in a highly sequence specific manner.
- the cleavage activity of ribozymes can be targeted to specific RNAs by engineering a discrete "hybridization" region into the ribozyme.
- the hybridization region contains a sequence complementary to the target RNA and thus specifically hybridizes with the target RNA.
- Specific ribozyme cleavage sites within an isoform 3.1 RNA target can be identified by scanning the target molecule for ribozyme cleavage sites that include the following sequences: GUA, GUU, and GUC. Once identified, short RNA sequences of between 15 and 20
- ribonucleotides corresponding to the region of the target RNA containing the cleavage site can be evaluated for secondary structural features that may render the target inoperable.
- Suitability of candidate isoform 3.1 RNA targets also can be evaluated by testing accessibility to hybridization with complementary oligonucleotides using ribonuclease protection assays.
- the nucleotide sequences shown in SEQ ID NO: 3 and its complement provide sources of suitable hybridization region sequences. Longer complementary sequences can be used to increase the affinity of the hybridization sequence for the target.
- the hybridizing and cleavage regions of the ribozyme can be integrally related such that upon hybridizing to the target RNA through the complementary regions, the catalytic region of the ribozyme can cleave the target.
- Ribozymes can be introduced into cells as part of a DNA construct. Mechanical methods, such as microinjection, liposome-mediated transfection, electroporation, or calcium phosphate precipitation, can be used to introduce a ribozyme-containing DNA construct into cells in which it is desired to decrease isoform 3.1 expression. Alternatively, if it is desired that the cells stably retain the DNA construct, the construct can be supplied on a plasmid and maintained as a separate element or integrated into the genome of the cells, as is known in the art.
- a ribozyme- encoding DNA construct can include transcriptional regulatory elements, such as a promoter element, an enhancer or UAS element, and a transcriptional terminator signal, for controlling transcription of ribozymes in the cells. Ribozymes also can be engineered to provide an additional level of regulation, so that destruction of mRNA occurs only when both a ribozyme and a target gene are induced in the cells.
- Regulators as used herein refer to compounds that affect the functional activity of an isoform 3.1 in vitro and/or in vivo. Regulators can be agonists and antagonists of an isoform 3.1 polypeptide and can be compounds that exert their effect on the isoform 3.1 activity via the expression, via post-translational modifications, by direct interaction with the channel protein or by other means.
- Agonists of isoform 3.1 are molecules that, when bound to isoform 3.1, increase or prolong the functional activity of isoform 3.1.
- Agonists of isoform 3.1 include proteins, nucleic acids, carbohydrates, small molecules, or any other molecule that activate isoform 3.1.
- Antagonists of isoform 3.1 are molecules that, when bound to isoform 3.1 , decrease the amount or the duration of the functional activity of isoform 3.1 .
- Antagonists include proteins, nucleic acids, carbohydrates, antibodies, small molecules, or any other molecule that decrease the activity of isoform 3.1.
- modulate refers to a change in the activity of isoform 3.1 polypeptide. For example, modulation may cause an increase or a decrease in functional activity, binding characteristics, or any other biological, functional, or immunological properties of isoform 3.1 .
- the terms “specific binding” or “specifically binding” refer to that interaction between a protein or peptide and an agonist, an antibody, or an antagonist. The interaction is dependent upon the presence of a particular structure of the protein recognized by the binding molecule (i. e., the antigenic determinant or epitope). For example, if an antibody is specific for epitope "A" the presence of a polypeptide containing the epitope A, or the presence of free unlabeled A, in a reaction containing free labeled A and the antibody will reduce the amount of labeled A that binds to the antibody.
- the invention provides methods (also referred to herein as "screening assays") for identifying compounds that can be used for the treatment of neurological diseases, e.g., schizophrenia.
- the methods entail the identification of candidate or test compounds or agents (e.g., peptides, peptidomimetics, small molecules or other molecules) that bind to isoform 3.1 and/or have a stimulatory or inhibitory effect on the biological functional activity of isoform 3.1 or its expression and then determining which of these compounds have an effect on symptoms or diseases regarding neurological diseases, e.g., schizophrenia, in an in vivo assay.
- candidate or test compounds or agents e.g., peptides, peptidomimetics, small molecules or other molecules
- Candidate or test compounds or agents that bind to isoform 3.1 and/or have a stimulatory or inhibitory effect on the functional activity or the expression of isoform 3.1 are identified either in assays that employ cells that express isoform 3.1 on the cell surface (cell-based assays) or in assays with isolated isoform 3.1 (cell-free assays).
- the various assays can employ a variety of variants of isoform 3.1 (e.g., full-length isoform 3.1 , a biologically active fragment of isoform 3.1 , or a fusion protein that includes all or a portion of isoform 3.1).
- isoform 3.1 can be derived from any suitable mammalian species (e.g., human or monkey isoform 3.1).
- the assay can be a binding assay entailing direct or indirect measurement of the binding of a test compound or a known isoform 3.1 ligand to isoform 3.1.
- the assay can also be an activity assay entailing direct or indirect measurement of the activity of isoform 3.1.
- the assay can also be an expression assay entailing direct or indirect measurement of the expression of isoform 3.1 mRNA or isoform 3.1 protein.
- the various screening assays are combined with an in vivo assay entailing measuring the effect of the test compound on the symptoms of neurological diseases, e.g., schizophrenia.
- the invention provides assays for screening candidate or test compounds that bind to or modulate the functional activity of a membrane-bound (cell surface expressed) form of isoform 3.1.
- assays can employ full-length isoform 3.1, a biologically active fragment of isoform 3.1 , or a fusion protein that includes all or a portion of isoform 3.1.
- the test compound can be obtained by any suitable means, e.g., from conventional compound libraries.
- Determining the ability of the test compound to bind to a membrane-bound form of isoform 3.1 can be accomplished, for example, by coupling the test compound with a radioisotope or enzymatic label such that binding of the test compound to the isoform 3.1 -expressing cell can be measured by detecting the labeled compound in a complex.
- the test compound can be labelled with 125 1 , 35 S, 1 C, or 3 H, either directly or indirectly, and the radioisotope detected by direct counting of radioemmission or by scintillation counting.
- test compound can be enzymatically labelled with, for example, horseradish peroxidase, alkaline phosphatase, or luciferase, and the enzymatic label detected by determination of conversion of an appropriate substrate to product.
- the assay comprises contacting an isoform 3.1 expressing cell with a known compound that carries a detectable label and that binds to isoform 3.1 to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with the isoform 3.1 expressing cell, wherein determining the ability of the test compound to interact with the isoform 3.1 expressing cell comprises determining the ability of the test compound to preferentially bind the isoform 3.1 expressing cell as compared to the known compound.
- the assay is a cell-based assay comprising contacting a cell expressing a membrane-bound form of isoform 3.1 (e.g., full-length isoform 3.1 , a biologically active fragment of isoform 3.1 , or a fusion protein that includes all or a portion of isoform 3.1) expressed on the cell surface with a test compound and determining the ability of the test compound to modulate (e.g., stimulate or inhibit) the functional activity of the membrane-bound form of isoform 3.1.
- a membrane-bound form of isoform 3.1 e.g., full-length isoform 3.1 , a biologically active fragment of isoform 3.1 , or a fusion protein that includes all or a portion of isoform 3.1
- Determining the ability of the test compound to modulate the functional activity of the membrane-bound form of isoform 3.1 can be accomplished by any method suitable for measuring the functional activity of isoform 3.1 , e.g., any method suitable for measuring the activity of any ion channel or other electrogenic target protein (described in greater detail below).
- the activity of an electrogenic target can be measured in a number of ways, not all of which are suitable for any given target protein. Among the measures of activity are: alteration in ion concentrations, measuring alterations in microphysiometric conditions, measuring alterations in voltage or measuring alterations in currents.
- the present invention also includes cell-free assays.
- Such assays involve contacting a form of isoform 3.1 (e.g., full-length isoform 3.1 , a biologically active fragment of isoform 3.1 , or a fusion protein comprising all or a portion of isoform 3.1) with a test compound and determining the ability of the test compound to bind to isoform 3.1 . Binding of the test compound to isoform 3.1 can be determined either directly or indirectly as described above.
- the assay includes contacting isoform 3.1 with a known compound that carries a detectable label and that binds isoform 3.1 to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with isoform 3.1 , wherein determining the ability of the test compound to interact with isoform 3.1 comprises determining the ability of the test compound to preferentially bind to isoform 3.1 as compared to the known compound.
- the cell-free assays of the present invention are amenable to use of either a membrane- bound form of isoform 3.1 or a soluble fragment thereof.
- a solubilizing agent such that the membrane-bound form of the polypeptide is maintained in solution.
- solubilizing agents include but are not limited to non-ionic detergents such as n-octylglucoside, n-dodecylglucoside, n-dodecylmaltoside, octanoyl-N- methylglucamide, decanoyl-N-methyl- glucamide, Triton X-100, Triton X- l 14, Thesit,
- isoform 3.1 (or an isoform 3.1 target molecule) to facilitate separation of complexed from uncomplexed forms of one or both of the proteins, as well as to accommodate automation of the assay. Binding of a test compound to isoform 3.1 , or interaction of isoform 3.1 with a target molecule in the presence and absence of a candidate compound, can be
- a fusion protein can be provided that adds a domain that allows one or both of the proteins to be bound to a matrix.
- glutathione-S-transferase (GST) fusion proteins can be adsorbed onto glutathione sepharose beads (Sigma Chemical; St. Louis, Mo.) or glutathione derivatized microtiter plates, which are then combined with the test compound or the test compound and either the non-adsorbed target protein or isoform 3.1 , and the mixture incubated under conditions conducive to complex formation (e.g., at physiological conditions for salt and pH).
- the beads or microtitre plate wells are washed to remove any unbound components and complex formation is measured either directly or indirectly, for example, as described above.
- the complexes can be dissociated from the matrix, and the level of binding or activity of isoform 3.1 can be determined using standard techniques.
- Biotinylated polypeptide of the invention or target molecules can be prepared from biotin-NHS (N-hydroxy-succinimide) using techniques well known in the art (e.g., biotinylation kit, Pierce Chemicals; Rockford, IU.), and immobilized in the wells of streptavidin- coated plates (Pierce Chemical).
- biotinylation kit N-hydroxy-succinimide
- streptavidin- coated plates Piereptavidin- coated plates
- antibodies reactive with isoform 3.1 or target molecules but that do not interfere with binding of the polypeptide of the invention to its target molecule can be derivatized to the wells of the plate, and unbound target or polypeptide of the invention trapped in the wells by antibody conjugation.
- Methods for detecting such complexes include immunodetection of complexes using antibodies reactive with isoform 3.1 or target molecule, as well as enzyme-linked assays that rely on detecting an enzymatic activity associated with isoform 3.1 or target molecule.
- the screening assay can also involve monitoring the expression of isoform 3.1.
- regulators of expression of isoform 3.1 can be identified in a method in which a cell is contacted with a candidate compound and the expression of isoform 3.1 protein or mRNA in the cell is determined. The level of expression of isoform 3.1 protein or mRNA the presence of the candidate compound is compared to the level of expression of isoform 3. 1 protein or mRNA in the absence of the candidate compound. The candidate compound can then be identified as a regulator of expression of isoform 3.1 based on this comparison.
- the candidate compound is identified as a stimulator of isoform 3.1 protein or mRNA expression.
- the candidate compound is identified as an inhibitor of isoform 3.1 protein or mRNA expression.
- the level of isoform 3.1 protein or mRNA expression in the cells can be determined by methods described below.
- the test compound is preferably a small molecule that potentially binds to a regulatory channel site or nearby the channel pore of isoform 3.1 , thereby competing with physiological modulators for said regulatory site, blocking the channel pore, or holding it in its open or closed state such that normal biological activity is prevented, enhanced or otherwise modified.
- small molecules include, but are not limited to, small peptides or peptide-like molecules as well as small compounds.
- Potential ligands that bind to a polypeptide of the invention include, but are not limited to, the natural ligands of known isoform 3.1 ion channels and analogues or derivatives thereof.
- either the test compound or the isoform 3.1 polypeptide can comprise a detectable label, such as a fluorescent, radioisotopic, chemiluminescent, or enzymatic label, such as horseradish peroxidase, alkaline phosphatase, or luciferase.
- Detection of a test compound that is bound to isoform 3.1 polypeptide can then be accomplished, for example, by direct counting of radioemmission, by scintillation counting, or by determining conversion of an appropriate substrate to a detectable product.
- binding of a test compound to an isoform 3.1 polypeptide can be determined without labeling either of the interactants.
- a microphysiometer can be used to detect binding of a test compound with a isoform 3.1 polypeptide.
- a microphysio- meter e.g., CytosensorTM
- a microphysio- meter is an analytical instrument that measures the rate at which a cell acidifies its environment using a light-addressable potentiometric sensor (LAPS). Changes in this acidification rate can be used as an indicator of the interaction between a test compound and isoform 3.1.
- BIA Biomolecular Interaction Analysis
- BIAcoreTM Changes in the optical phenomenon surface plasmon resonance (SPR) can be used as an indication of real-time reactions between biological molecules.
- the assay includes contacting isoform 3.1 with a known compound that carries a detectable label and that is coupled to a detectable label and that binds isoform 3.1 to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with isoform 3.1 , wherein determining the ability of the test compound to interact with isoform 3.1 comprises determining the ability of the test compound to preferentially bind to isoform 3.1 as compared to the known compound.
- an isoform 3.1 -like polypeptide can be used as a "bait protein" in a two-hybrid assay or three-hybrid assay to identify other proteins that bind to or interact with isoform 3.1 and modulate its activity.
- the two-hybrid system is based on the modular nature of most transcription factors, which consist of separable DNA-binding and activation domains.
- the assay utilizes two different DNA constructs.
- polynucleotide encoding isoform 3.1 can be fused to a polynucleotide encoding the DNA binding domain of a known transcription factor (e.g., GAL-4).
- a DNA sequence that encodes an unidentified protein (“prey" or "sample” can be fused to a polynucleotide that codes for the activation domain of the known transcription factor.
- the DNA-binding and activation domains of the transcription factor are brought into close proximity. This proximity allows transcription of a reporter gene (e.g., LacZ), which is operably linked to a transcriptional regulatory site responsive to the transcription factor. Expression of the reporter gene can be detected, and cell colonies containing the functional transcription factor can be isolated and used to obtain the DNA sequence encoding the protein that interacts with isoform 3.1.
- a reporter gene e.g., LacZ
- the isoform 3.1 or polynucleotide
- the test compound may be desirable to immobilize either the isoform 3.1 (or polynucleotide) or the test compound to facilitate separation of the bound form from unbound forms of one or both of the interactants, as well as to accommodate automation of the assay.
- either the isoform 3.1 - like polypeptide (or polynucleotide) or the test compound can be bound to a solid support.
- Suitable solid supports include, but are not limited to, glass or plastic slides, tissue culture plates, microtiter wells, tubes, silicon chips, or particles such as beads (including, but not limited to, latex, polystyrene, or glass beads). Any method known in the art can be used to attach isoform 3.1 -like polypeptide (or polynucleotide) or test compound to a solid support, including use of covalent and non-covalent linkages, passive absorption, or pairs of binding moieties attached respectively to the polypeptide (or polynucleotide) or test compound and the solid support. Test compounds are preferably bound to the solid support in an array, so that the location of individual test compounds can be tracked.
- Binding of a test compound to isoform 3.1 can be accomplished in any vessel suitable for containing the reactants.
- examples of such vessels include microtiter plates, test tubes, and microcentrifuge tubes.
- isoform 3.1 is a fusion protein comprising a domain that allows binding of isoform 3.1 to a solid support.
- glutathione- S- transferase fusion proteins can be adsorbed onto glutathione sepharose beads (Sigma Chemical, St. Louis, Mo.) or glutathione derivatized microtiter plates, which are then combined with the test compound or the test compound and the non-adsorbed isoform 3.1 ; the mixture is then incubated under conditions conducive to complex formation ⁇ e.g., at physiological conditions for salt and pH). Following incubation, the beads or microtiter plate wells are washed to remove any unbound components. Binding of the interactants can be determined either directly or indirectly, as described above. Alternatively, the complexes can be dissociated from the solid support before binding is determined.
- isoform 3.1 or a polynucleotide encoding isoform 3.1
- a test compound can be immobilized utilizing conjugation of biotin and streptavidin.
- Biotinylated isoform 3.1 (or a polynucleotide encoding biotinylated isoform 3.1) or test compounds can be prepared from biotin-NHS (N- hydroxysuccinimide) using techniques well known in the art ⁇ e.g., biotinylation kit, Pierce Chemicals, Rockford, 1 1 1.) and immobilized in the wells of streptavidin-coated plates (Pierce Chemical).
- antibodies that specifically bind to isoform 3.1, polynucleotide, or a test compound, but that do not interfere with a desired binding site, such as the active site of isoform 3.1 can be derivatized to the wells of the plate. Unbound target or protein can be trapped in the wells by antibody conjugation.
- Methods for detecting such complexes include immunodetection of complexes using antibodies that specifically bind to isoform 3.1 polypeptide or test compound, enzyme-linked assays that rely on detecting an activity of isoform 3.1 polypeptide, and SDS gel electrophoresis under non- reducing conditions.
- Screening for test compounds that bind to an isoform 3.1 polypeptide or polynucleotide also can be carried out in an intact cell. Any cell that comprises an isoform 3.1 polypeptide or polynucleotide can be used in a cell- based assay system. An isoform 3.1 polynucleotide can be naturally occurring in the cell or can be introduced using techniques such as those described above. Binding of the test compound to isoform 3.1 or a polynucleotide encoding isoform 3.1 is determined as described above.
- Test compounds can be tested for the ability to increase or decrease isoform 3.1 functional activity of an isoform 3.1 polypeptide.
- the isoform 3.1 activity can be measured, for example, using methods described in the specific examples, below.
- Isoform 3.1 functional activity can be measured after contacting an intact cell having functional ion channel activity with a test compound.
- a test compound that decreases isoform 3.1 activity by at least about 10, preferably about 50, more preferably about 75, 90, or 100% is identified as a potential agent for decreasing isoform 3.1 activity.
- a test compound that increases isoform 3.1 activity by at least about 10, preferably about 50, more preferably about 75, 90, or 100% is identified as a potential agent for increasing isoform 3.1 activity.
- screening techniques include the use of cells that express isoform 3.1 (for example, transfected CHO cells) in a system that measures extracellular pH changes caused by channel activation.
- compounds may be contacted with a cell that expresses the channel polypeptide of the present invention and a second messenger response, e.g., signal transduction or pH changes, can be measured to determine whether the potential compound activates or inhibits the channel.
- a second messenger response e.g., signal transduction or pH changes
- Another such screening technique involves introducing R A or DNA encoding isoform 3.1 into Xenopus oocytes to transiently express the channel. The receptor oocytes can then be contacted with the channel ligand or activated otherwise and a compound to be screened, followed by detection of modulation of the observed control signal.
- Other screening techniques include the use of cells that express isoform 3.1 (for example, transfected CHO cells) in a system that measures voltage changes caused by channel activation.
- compounds may be contacted with a cell that expresses the channel polypeptide of the present invention and voltage changes can be measured to determine whether the potential compound activates or inhibits the channel.
- Another screening technique involves expressing isoform 3.1 in cells in which the channel is linked to a phospholipase C or D.
- Such cells include endothelial cells, smooth muscle cells, embryonic kidney cells, etc.
- the screening may be accomplished as described above by quantifying the degree of activation of the channel from changes in the phospholipase activity.
- test compounds that increase or decrease isoform 3.1 gene expression are identified.
- polynucleotide indicates that the detection of the presence of nucleic acids, the same or related to a nucleic acid sequence encoding isoform 3.1, by northern analysis or real-time PCR is indicative of the presence of nucleic acids encoding isoform 3.1 in a sample, and thereby correlates with expression of the transcript from the polynucleotide encoding isoform 3.1.
- microarray refers to an array of distinct polynucleotides or
- oligonucleotides arrayed on a substrate such as paper, nylon or any other type of membrane, filter, chip, glass slide, or any other suitable solid support.
- a substrate such as paper, nylon or any other type of membrane, filter, chip, glass slide, or any other suitable solid support.
- An isoform 3.1 polynucleotide is contacted with a test compound, and the expression of an R A or polypeptide product of isoform 3.1 polynucleotide is determined.
- the level of expression of appropriate mRNA or polypeptide in the presence of the test compound is compared to the level of expression of mRNA or polypeptide in the absence of the test compound.
- the test compound can then be identified as a regulator of expression based on this comparison.
- the test compound when expression of mRNA or polypeptide is greater in the presence of the test compound than in its absence, the test compound is identified as a stimulator or enhancer of the mRNA or polypeptide expression.
- the test compound when expression of the mRNA or polypeptide is less in the presence of the test compound than in its absence, the test compound is identified as an inhibitor of the rnRNA or polypeptide expression.
- the level of isoform 3.1 mRNA or polypeptide expression in the cells can be determined by methods well known in the art for detecting mRNA or polypeptide. Either qualitative or quantitative methods can be used.
- polypeptide products of isoform 3.1 polynucleotide can be determined, for example, using a variety of techniques known in the art, including immuno chemical methods such as radioimmunoassay, Western blotting, and immunohistochemistry.
- polypeptide synthesis can be determined in vivo, in a cell culture, or in an in vitro translation system by detecting incorporation of labelled amino acids into isoform 3.1.
- Such screening can be carried out either in a cell-free assay system or in an intact cell.
- Any cell that expresses isoform 3.1 polynucleotide can be used in a cell-based assay system.
- the isoform 3.1 polynucleotide can be naturally occurring in the cell or can be introduced using techniques such as those described above. Either a primary culture or an established cell line can be used.
- test compounds for use in the screening assays of the invention can be obtained from any suitable source, e.g., conventional compound libraries.
- the test compounds can also be obtained using any of the numerous approaches in combinatorial library methods known in the art, including: biological libraries; spatially addressable parallel solid phase or solution phase libraries; synthetic library methods requiring deconvolution; the "one-bead one-compound” library method; and synthetic library methods using affinity chromatography selection.
- the biological library approach is limited to peptide libraries, while the other four approaches are applicable to peptide, non-peptide oligomer or small molecule libraries of compounds. Examples of methods for the synthesis of molecular libraries can be found in the art. Libraries of compounds may be presented in solution or on beads, bacteria, spores, plasmids or phage.
- Computer modeling and searching technologies permit identification of compounds, or the improvement of already identified compounds, that can modulate isoform 3.1 expression or activity. Having identified such a compound or composition, the active sites or regions are identified. Such active sites might typically be ligand binding sites, such as the interaction domain of the ligand with isoform 3.1.
- the active site can be identified using methods known in the art including, for example, from the amino acid sequences of peptides, from the nucleotide sequences of nucleic acids, or from study of complexes of the relevant compound or composition with its natural ligand. In the latter case, chemical or X-ray crystallographic methods can be used to find the active site by finding where on the factor the complexed ligand is found.
- the three dimensional geometric structure of the active site is determined. This can be done by known methods, including X-ray crystallography, which can determine a complete molecular structure. On the other hand, solid or liquid phase NMR can be used to determine certain intramolecular distances. Any other experimental method of structure determination can be used to obtain partial or complete geometric structures.
- the geometric structures may be measured with a complexed ligand, natural or artificial, which may increase the accuracy of the active site structure determined.
- the methods of computer based numerical modeling can be used to complete the structure or improve its accuracy. Any recognized modeling method may be used, including parameterized models specific to particular biopolymers such as proteins or nucleic acids, molecular dynamics models based on computing molecular motions, statistical mechanics models based on thermal ensembles, or combined models.
- candidate modulating compounds can be identified by searching databases containing compounds along with information on their molecular structure. Such a search seeks compounds having structures that match the determined active site structure and that interact with the groups defining the active site. Such a search can be manual, but is preferably computer-assisted. These compounds found from this search are potential isoform 3.1 modulating compounds.
- these methods can be used to identify improved modulating compounds from an already known modulating compound or ligand.
- the composition of the known compound can be modified and the structural effects of modification can be determined using the experimental and computer modeling methods described above applied to the new composition.
- the altered structure is then compared to the active site structure of the compound to determine if an improved fit or interaction results. In this manner systematic variations in composition, such as by varying side groups, can be quickly evaluated to obtain modified modulating compounds or ligands of improved specificity or activity.
- the present invention provides for both prophylactic and therapeutic methods for neurological diseases, e.g., schizophrenia.
- the regulatory method of the invention involves contacting a cell with an agent that modulates one or more of the activities of isoform 3.1.
- An agent that modulates activity can be an agent as described herein, such as a nucleic acid or a protein, a naturally-occurring cognate ligand of the polypeptide, a peptide, a peptidomimetic, or any small molecule.
- the agent stimulates one or more of the biological activities of isoform 3.1. In another embodiment, the agent inhibits one or more of the biological activities of isoform 3.1.
- the present invention provides methods of treating an individual afflicted with a disease or disorder characterized by unwanted expression or activity of isoform 3.1 or a protein in the isoform 3.1 signaling pathway.
- the method involves administering an agent like any agent identified or being identifiable by a screening assay as described herein, or combination of such agents that may upregulate or downregulate the expression or activity of isoform 3.1 or of any protein in the isoform 3.1 signaling pathway.
- the method involves administering a regulator of isoform 3.1 as therapy to compensate for increased or undesirably high expression or activity, or, alternatively, reduced or undesirably low expression or activity of isoform 3.1 or a protein in the isoform 3.1 signaling pathway.
- Stimulation of activity or expression of isoform 3.1 is desirable in situations in which activity or expression is abnormally low and in which increased activity is likely to have a beneficial effect. Conversely, inhibition of activity or expression of isoform 3.1 is desirable in situations in which activity or expression of isoform 3.1 is abnormally high and in which decreasing its activity is likely to have a beneficial effect.
- compositions suitable for administration typically comprise the active agents and a pharmaceutically acceptable carrier.
- pharmaceutically acceptable carrier is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration.
- the use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
- the invention includes pharmaceutical compositions comprising a regulator of isoform 3.1 expression or activity (and/or a regulator of the activity or expression of a protein in the isoform 3.1 signaling pathway) as well as methods for preparing such compositions by combining one or more such regulators and a pharmaceutically acceptable carrier.
- pharmaceutical compositions comprising a regulator identified using the screening assays of the invention packaged with instructions for use.
- the instructions would specify use of the pharmaceutical composition for treatment of neurological diseases, e.g., schizophrenia.
- the instructions would specify use of the pharmaceutical composition for treatment of other neurological diseases.
- An antagonist of isoform 3.1 may be produced using methods that are generally known in the art.
- purified isoform 3.1 may be used to produce antibodies or to screen libraries of pharmaceutical agents to identify those that specifically bind isoform 3.1.
- Antibodies to isoform 3.1 may also be generated using methods that are well known in the art. Such antibodies may include, but are not limited to, polyclonal, monoclonal, chimeric, single chain antibodies, Fab fragments, and fragments produced by a Fab expression library.
- the polynucleotides encoding isoform 3.1 may be used for therapeutic purposes.
- the complement of the polynucleotide encoding isoform 3.1 may be used in situations in which it would be desirable to block the transcription of the mRNA.
- cells may be transformed with sequences complementary to polynucleotides encoding isoform 3.1.
- complementary molecules or fragments may be used to modulate isoform 3.1 activity, or to achieve regulation of gene function.
- sense or antisense oligonucleotides or larger fragments can be designed from various locations along the coding or control regions of sequences encoding isoform 3.1.
- Expression vectors derived from lentiviruses may be used for delivery of nucleotide sequences to the targeted organ, tissue, or cell population. Methods that are well known to those skilled in the art can be used to construct vectors that will express nucleic acid sequence complementary to the polynucleotides of the gene encoding isoform 3.1. These techniques are described, for example, in the scientific literature.
- any of the therapeutic methods described above may be applied to any subject in need of such therapy, including, preferably, humans.
- compositions containing isoform 3.1 in conjunction with a pharmaceutically acceptable carrier, for any of the therapeutic effects discussed above.
- Such pharmaceutical compositions may constitute isoform 3.1 , antibodies to isoform 3.1 , and mimetics, agonists, antagonists, or inhibitors of isoform 3.1.
- the compositions may be administered alone or in combination with at least one other agent, such as a stabilizing compound, which may be administered in any sterile, biocompatible pharmaceutical carrier including, but not limited to, saline, buffered saline, dextrose, and water.
- the compositions may be administered to a patient alone, or in combination with other agents, drugs or hormones.
- a pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration.
- routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (topical), transmucosal, and rectal administration.
- Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
- the parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
- compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
- suitable carriers include physiological saline, bacteriostatic water or phosphate buffered saline (PBS).
- PBS phosphate buffered saline
- the composition must be sterile and should be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, a pharmaceutically acceptable polyol like glycerol, propylene glycol, liquid polyetheylene glycol, and suitable mixtures thereof.
- the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, and sodium chloride in the
- Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, aluminum
- Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum drying and freeze-drying, which yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile- filtered solution thereof.
- Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the purpose of oral therapeutic administration, the active compound can be incorporated with excipients and used in the form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed.
- compositions can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
- a binder such as microcrystalline cellulose, gum tragacanth or gelatin
- an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch
- a lubricant such as magnesium stearate or sterotes
- a glidant such as colloidal silicon dioxide
- a sweetening agent such as sucrose or saccharin
- the compounds are delivered in the form of an aerosol spray from a pressurized container or dispenser that contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
- a suitable propellant e.g., a gas such as carbon dioxide, or a nebulizer.
- Systemic administration can also be by transmucosal or transdermal means.
- penetrants appropriate to the barrier to be permeated are used in the formulation.
- penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives.
- Transmucosal administration can be accomplished through the use of nasal sprays or
- the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.
- the compounds can also be prepared in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
- suppositories e.g., with conventional suppository bases such as cocoa butter and other glycerides
- retention enemas for rectal delivery.
- the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems.
- a controlled release formulation including implants and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid.
- Dosage unit form refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.
- the pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration.
- the instructions for administration will specify use of the composition for neurological diseases, e.g., schizophrenia.
- the instructions for administration will specify use of the composition for other neurological diseases.
- a therapeutically effective dose refers to that amount of active ingredient that increases or decreases isoform 3.1 activity relative to isoform 3.1 activity that occurs in the absence of the therapeutically effective dose.
- the therapeutically effective dose can be estimated initially either in cell culture assays or in animal models, usually mice, rats, rabbits, or monkeys. The animal model also can be used to determine the appropriate concentration range and route of administration. Such information can then be used to determine useful doses and routes for administration in humans.
- Therapeutic efficacy and toxicity e.g., ED 50 (the dose therapeutically effective in 50% of the population) and LD 50 (the dose lethal to 50% of the population), can be determined by standard pharmaceutical procedures in cell cultures or experimental animals.
- the dose ratio of toxic to therapeutic effects is the therapeutic index, and it can be expressed as the ratio,
- compositions that exhibit large therapeutic indices are preferred.
- the data obtained from cell culture assays and animal studies is used in formulating a range of dosage for human use.
- the dosage contained in such compositions is preferably within a range of circulating concentrations that include the ED 50 with little or no toxicity.
- the dosage varies within this range depending upon the dosage form employed, sensitivity of the patient, and the route of administration. The exact dosage will be determined by the practitioner, in light of factors related to the subject that requires treatment. Dosage and administration are adjusted to provide sufficient levels of the active ingredient or to maintain the desired effect. Factors that can be taken into account include the severity of the disease state, general health of the subject, age, weight, and gender of the subject, diet, time and frequency of administration, drug
- compositions can be administered every 3 to 4 days, every week, or once every two weeks depending on the half-life and clearance rate of the particular formulation.
- Normal dosage amounts can vary from 0.1 micrograms to 100,000 micrograms, up to a total dose of about 1 gram, depending upon the route of administration.
- Guidance as to particular dosages and methods of delivery is provided in the literature and generally available to practitioners in the art.
- nucleotides Those skilled in the art will employ different formulations for nucleotides than for proteins or their inhibitors. Similarly, delivery of polynucleotides or polypeptides will be specific to particular cells, conditions, locations, etc. If the reagent is a single-chain antibody,
- polynucleotides encoding the antibody can be constructed and introduced into a cell either ex vivo or in vivo using well- established techniques including, but not limited to, transferrin- polycation-mediated DNA transfer, transfection with naked or encapsulated nucleic acids, liposome-mediated cellular fusion, intracellular transportation of DNA-coated latex beads, protoplast fusion, viral infection, electroporation, "gene gun", and DEAE- or calcium phosphate- mediated transfection.
- the reagent is preferably an antisense oligonucleotide or a ribozyme.
- Polynucleotides that express antisense oligonucleotides or ribozymes can be introduced into cells by a variety of methods, as described above.
- a reagent reduces expression of isoform 3.1 gene or the activity of isoform 3.1 by at least about 10, preferably about 50, more preferably about 75, 90, or 100% relative to the absence of the reagent.
- the effectiveness of the mechanism chosen to decrease the level of expression of isoform 3.1 gene or the activity of isoform 3.1 can be assessed using methods well known in the art, such as hybridization of nucleotide probes to isoform 3.1 -specific mRNA, quantitative RT-PCR, immunologic detection of isoform 3.1 , or measurement of isoform 3.1 activity.
- any of the pharmaceutical compositions of the invention can be administered in combination with other appropriate therapeutic agents.
- the combination of therapeutic agents can act synergistically to effect the treatment or prevention of the various disorders described above. Using this approach, one may be able to achieve therapeutic efficacy with lower dosages of each agent, thus reducing the potential for adverse side effects. Any of the therapeutic methods described above can be applied to any subject in need of such therapy, including, for example, humans.
- One embodiment of the invention relates to a method for predicting the likelihood that an individual will have a neuropsychiatric disorder, e.g., schizophrenia, or for aiding in the diagnosis of a neuropsychiatric disorder, e.g., schizophrenia, or a greater likelihood of having reduced symptomology associated with a neuropsychiatric disorder, e.g., schizophrenia, comprising the steps of obtaining a DNA sample from an individual to be assessed and determining the nucleotide present at a single nucleotide polymorphism (SNP) of the KCNH2 gene.
- SNP single nucleotide polymorphism
- the presence of a nucleotide from the protective allele at the SNP indicates that the individual has a lower likelihood of having a neuropsychiatric disorder, or a greater likelihood of having reduced symptomology associated with a neuropsychiatric disorder, than if that individual had a nucleotide from the risk allele at that SNP.
- the presence of a nucleotide from the risk allele at the SNP indicates that the individual has a greater likelihood of having a neuropsychiatric disorder, or a likelihood of having increased symptomology associated with a neuropsychiatric disorder, than if that individual had a nucleotide from the protective allele at that SNP.
- the neuropsychiatric disorder is schizophrenia.
- the individual is an individual at risk for development of schizophrenia.
- the individual exhibits clinical symptomatology associated with schizophrenia.
- the individual has been clinically diagnosed as having schizophrenia.
- the SNP is selected from Marker Ml, M2, M3, M4, M5, M6, M7, M8, M9, MIO, Ml 1 , M12, M13, M14, M15, M16, M17, M18, M19, M20, M21 , M22, M23, M24, M25, M26, M27, M28, M29, M30, M31, M32, M33, M34, M35, M36, M37, M38, M39, M40, M41 , M42, or M43.
- the genetic material to be assessed can be obtained from any nucleated cell from the individual.
- genomic DNA virtually any biological sample (other than pure red blood cells) is suitable.
- tissue samples include whole blood, semen, saliva, tears, urine, fecal material, sweat, skin and hair.
- cDNA or mRNA the tissue sample must be obtained from an organ in which the target nucleic acid is expressed.
- cells from the central nervous system such as cells of the hippocampus
- neural crest- derived cells skin, heart, lung and skeletal muscle are suitable sources for obtaining cDNA for the KCNH2 gene.
- Neural crest-derived cells include, for example, melanocytes and
- keratinocytes Many of the methods described herein require amplification of DNA from target samples. This can be accomplished by e.g., PCR. See generally: PCR Technology: Principles and
- Suitable amplification methods include the ligase chain reaction (LCR), transcription amplification, self- sustained sequence replication and nucleic acid based sequence amplification (NASBA).
- LCR ligase chain reaction
- NASBA nucleic acid based sequence amplification
- the latter two amplification methods involve isothermal reactions based on isothermal transcription, which produce both single stranded RNA (ssRNA) and double stranded DNA (dsDNA) as the amplification products in a ratio of about 30 or 100 to 1 , respectively.
- the nucleotide that occupies the polymorphic site of interest can be identified by a variety of methods, such as Southern analysis of genomic DNA; direct mutation analysis by restriction enzyme digestion; Northern analysis of RNA; denaturing high pressure liquid chromatography (DHPLC); gene isolation and sequencing; hybridization of an allele-specific oligonucleotide with amplified gene products; single base extension (SBE); or analysis of the KCNH2 protein.
- Southern analysis of genomic DNA direct mutation analysis by restriction enzyme digestion
- Northern analysis of RNA include denaturing high pressure liquid chromatography (DHPLC); gene isolation and sequencing; hybridization of an allele-specific oligonucleotide with amplified gene products; single base extension (SBE); or analysis of the KCNH2 protein.
- DPLC denaturing high pressure liquid chromatography
- SBE single base extension
- Allele-specific probes for analyzing polymorphisms is described by e.g., Saiki et al. 1986 Nature 324: 163-166. Allele-specific probes can be designed that hybridize to a segment of target DNA from one individual but do not hybridize to the corresponding segment from another individual due to the presence of different polymorphic forms in the respective segments from the two individuals.
- Hybridization conditions should be sufficiently stringent that there is a significant difference in hybridization intensity between alleles, and preferably an essentially binary response, whereby a probe hybridizes to only one of the alleles.
- Hybridizations are usually performed under stringent conditions, for example, at a salt concentration of no more than 1M and a temperature of at least 25°C.
- conditions of 5X SSPE 750 mM NaCl, 50 mM NaPhosphate, 5 mM EDTA, pH 7.4
- a temperature of 25- 30°C, or equivalent conditions are suitable for allele-specific probe hybridizations.
- Equivalent conditions can be determined by varying one or more of the parameters given as an example, as known in the art, while maintaining a similar degree of identity or similarity between the target nucleotide sequence and the primer or probe used.
- Some probes are designed to hybridize to a segment of target DNA such that the polymorphic site aligns with a central position (e.g., in a 15-mer at the 7 position; in a 16-mer, at either the 8 or 9 position) of the probe. This design of probe achieves good discrimination in hybridization between different allelic forms.
- Allele-specific probes are often used in pairs, one member of a pair showing a perfect match to a reference form of a target sequence and the other member showing a perfect match to a variant form. Several pairs of probes can then be immobilized on the same support for simultaneous analysis of multiple polymorphisms within the same target sequence.
- the polymorphisms can also be identified by hybridization to nucleic acid arrays, some examples of which are described in WO 95/1 1995.
- WO 95/1 1995 also describes subarrays that are optimized for detection of a variant form of a precharacterized polymorphism.
- Such a subarray contains probes designed to be complementary to a second reference sequence, which is an allelic variant of the first reference sequence.
- the second group of probes is designed by the same principles, except that the probes exhibit complementarity to the second reference sequence.
- a second group (or further groups) can be particularly useful for analyzing short subsequences of the primary reference sequence in which multiple mutations are expected to occur within a short distance commensurate with the length of the probes (e.g., two or more mutations within 9 to 21 bases).
- An allele-specific primer hybridizes to a site on target DNA overlapping a polymorphism and only primes amplification of an allelic form to which the primer exhibits perfect
- oligonucleotide aligned with the polymorphism because this position is most destabilizing to elongation from the primer.
- Direct-Sequencing The direct analysis of the sequence of polymorphisms of the present invention can be accomplished using either the dideoxy chain termination method or the Maxam Gilbert method (see Molecular Cloning: a Laboratory Manual, 3rd edition, Sambrook et al. 2001 Cold Spring Harbor Laboratory Press, New York).
- Amplification products generated using the polymerase chain reaction can be analyzed by the use of denaturing gradient gel electrophoresis. Different alleles can be identified based on the different sequence-dependent melting properties and electrophoretic migration of DNA in solution (Erlich, ed. 1992 PCR Technology, Principles and Applications for DNA Amplification, W.H. Freeman and Co, New York, Chapter 7).
- Alleles of target sequences can be differentiated using single-strand conformation polymorphism analysis, which identifies base differences by alteration in electrophoretic migration of single stranded PCR products, as described in Orita et al. 1989 PNAS USA
- Amplified PCR products can be generated as described above, and heated or otherwise denatured, to form single-stranded amplification products.
- Single-stranded nucleic acids may refold or form secondary structures that are partially dependent on the base sequence.
- the different electrophoretic mobilities of single-stranded amplification products can be related to base-sequence differences between alleles of target sequences.
- the polypeptide and polynucleotide markers of the isoform 3.1 of KCNH2 gene of the invention are useful in methods for diagnosing schizophrenia, determining the extent and/or severity of the disease, monitoring progression and neurological symptoms of the disease and/or response to therapy, and predicting the response of patients to therapy, including antipsychotic medications.
- the markers are also useful in methods for treating schizophrenia and for evaluating the efficacy of treatment for the disease.
- the markers may also be used to screen candidate drugs for treatment of schizophrenia. Such methods can be performed in human and non-human primate subjects.
- polypeptide markers of the isoform 3.1 of KCNH2 may be isolated by any suitable method known in the art.
- Native polypeptide markers can be purified from natural sources by standard methods known in the art (e.g., chromatography, centrifugation, differential solubility, immunoassay).
- polypeptide markers may be isolated from a serum sample using the chromatographic methods disclosed herein.
- polypeptide markers may be isolated from a sample by contacting the sample with substrate-bound antibodies or aptamers that specifically bind to the marker.
- the present invention also includes polynucleotide markers of isoform 3.1 of KCNH2 related to the polypeptide markers of the present invention.
- the invention provides polynucleotides that encode the polypeptides of the invention.
- the polynucleotide may be genomic DNA, cDNA, or mRNA transcripts that encode the polypeptides of the invention.
- the invention provides polynucleotide markers that are closely associated with expression of isoform 3.1 of KCNH2, including single nucleotide polymorphisms (SNPs).
- the invention includes polynucleotide markers of isoform 3.1 of KCNH2 that encode a polypeptide that is a fragment, precursor, successor or modified version of the isoform 3.1 of KCNH2.
- the invention includes polynucleotides that have substantial sequence similarity to a polynucleotide that encodes an isoform of a KCNH2 polypeptide or a fragment, precursor, successor or modified version of such polynucleotide, or a molecule that comprises such polypeptide.
- Two polynucleotides have "substantial sequence identity" when there is at least about 70% sequence identity, at least about 80% sequence identity, at least about 90% sequence identity, at least about 95% sequence identity or at least 99% sequence identity between their amino acid sequences or when the polynucleotides are capable of forming a stable duplex with each other under stringent hybridization conditions. Such conditions are described elsewhere herein.
- the invention includes polynucleotides that are allelic variants, the result of SNPs, or that in alternative codons to those present in the native materials as inherent in the degeneracy of the genetic code.
- the polynucleotides described may be used as surrogate markers of schizophrenia.
- an increase in the mRNA that encodes the polypeptide marker may be interrogated rather than the polypeptide marker (e.g., to diagnose schizophrenia in a subject).
- the present invention also provides methods of detecting the markers of isoform 3.1 of KCNH2 of the present invention.
- the practice of the present invention employs, unless otherwise indicated, conventional methods of analytical biochemistry, microbiology, molecular biology and recombinant DNA techniques within the skill of the art. Such techniques are explained fully in the literature. (See, e.g., Sambrook, J. et al. Molecular Cloning: A Laboratory Manual. 3rd, ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 2000; DNA Cloning: A Practical Approach, Vol. I & II (D. Glover, ed.); Oligonucleotide Synthesis (N.
- the markers of the invention may be detected by any method known to those of skill in the art, including without limitation LC-MS, GC-MS, immunoassays, hybridization and enzyme assays.
- the detection may be quantitative or qualitative.
- a wide variety of conventional techniques are available, including mass spectrometry, chromatographic separations, 2-D gel separations, binding assays ⁇ e.g., immunoassays), competitive inhibition assays, and so on.
- Any effective method in the art for measuring the presence/absence, level or activity of a polypeptide or polynucleotide is included in the invention. It is within the ability of one of ordinary skill in the art to determine which method would be most appropriate for measuring a specific marker.
- an ELISA assay may be best suited for use in a physician's office while a measurement requiring more sophisticated instrumentation may be best suited for use in a clinical laboratory. Regardless of the method selected, it is important that the measurements be reproducible.
- the markers of the invention can be measured by mass spectrometry, which allows direct measurements of analytes with high sensitivity and reproducibility.
- mass spectrometric methods are available.
- Electrospray ionization (ESI) allows quantification of differences in relative concentration of various species in one sample against another; absolute quantification is possible by normalization techniques ⁇ e.g., using an internal standard).
- Matrix-assisted laser desorption ionization (MALDI) or the related SELDI® technology (Ciphergen, Inc.) also could be used to make a determination of whether a marker was present, and the relative or absolute level of the marker.
- MALDI matrix-assisted laser desorption ionization
- SELDI® technology Cephergen, Inc.
- Mass spectrometers that allow time-of-flight (TOF) measurements have high accuracy and resolution and are able to measure low abundant species, even in complex matrices like serum or CSF.
- quantification can be based on derivatization in combination with isotopic labeling, referred to as isotope coded affinity tags ("ICAT").
- ICAT isotope coded affinity tags
- a specific amino acid in two samples is differentially and isotopically labeled and subsequently separated from peptide background by solid phase capture, wash and release.
- the intensities of the molecules from the two sources with different isotopic labels can then be accurately quantified with respect to one another.
- Quantification can also be based on the isotope dilution method by spiking in an isotopically labeled peptide or protein analogous to those being measured.
- quantification can also be determined without isotopic standards using the direct intensity of the analyte comparing with another measurement of a standard in a similar matrix.
- one- and two-dimensional gels have been used to separate proteins and quantify gels spots by silver staining, fluorescence or radioactive labeling. These differently stained spots have been detected using mass spectrometry, and identified by tandem mass spectrometry techniques.
- the markers are measured using mass spectrometry in connection with a separation technology, such as liquid chromatography-mass spectrometry or gas chromatography-mass spectrometry.
- a separation technology such as liquid chromatography-mass spectrometry or gas chromatography-mass spectrometry.
- ESI time-of-flight (TOF) mass spectroscopy allows spectral intensity measurement of a large number of biomolecules from a relatively small amount of any complex biological material. Analyzing a sample in this manner allows the marker (characterized by a specific RT and m/z) to be determined and quantified.
- separations may be performed using custom chromatographic surfaces (e.g., a bead on which a marker specific reagent has been
- Molecules retained on the media subsequently may be eluted for analysis by mass spectrometry.
- the mass spectrometer preferably provides high mass accuracy and high mass resolution. The mass accuracy of a well-calibrated Micromass TOF instrument, for example, is reported to be approximately 5 mDa, with resolution m/Am exceeding 5000.
- the level of the markers may be determined using a standard immunoassay, such as sandwiched ELISA using matched antibody pairs and chemiluminescent detection. Commercially available or custom monoclonal or polyclonal antibodies are typically used. However, the assay can be adapted for use with other reagents that specifically bind to the marker. Standard protocols and data analysis are used to determine the marker concentrations from the assay data.
- the binding molecules are antibodies or antibody fragments that specifically recognize the isoform 3.1 of KCNH2 or a fragment thereof.
- the binding molecules are non-antibody species, such as aptamers that specifically recognize the isoform 3.1 of KCNH2 or a fragment thereof.
- the binding molecule may be an enzyme for which the marker is a substrate. The binding molecules may recognize any epitope of the targeted markers.
- the binding molecules may be identified and produced by any method accepted in the art. Methods for identifying and producing antibodies and antibody fragments specific for an analyte are well known. Examples of other methods used to identify the binding molecules include binding assays with random peptide libraries (e.g., phage display) and design methods based on an analysis of the structure of the marker.
- the markers of the invention also may be detected or measured using a number of chemical derivatization or reaction techniques known in the art. Reagents for use in such techniques are known in the art, and are commercially available for certain classes of target molecules.
- the chromatographic separation techniques described above also may be coupled to an analytical technique other than mass spectrometry such as fluorescence detection of tagged molecules, NMR, capillary UV, evaporative light scattering or electrochemical detection.
- Measurement of the relative amount of an RNA or protein marker of the invention may be by any method known in the art (see, e.g., Sambrook, J., Fritsh, E. F., and Maniatis, T.
- RNA detection include RNA extraction from a cell or tissue sample, followed by hybridization of a labeled probe (e.g., a complementary polynucleotide) specific for the target RNA to the extracted RNA, and detection of the probe (e.g., Northern blotting).
- a labeled probe e.g., a complementary polynucleotide
- detection of the probe e.g., Northern blotting
- Typical methodologies for protein detection include protein extraction from a cell or tissue sample, followed by
- the labeled probe e.g., an antibody
- the label group can be a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor. Detection of specific protein and
- polynucleotides may also be assessed by gel electrophoresis, column chromatography, direct sequencing, or quantitative PCR (in the case of polynucleotides) among many other techniques well known to those skilled in the art.
- Detection of the presence or number of copies of all or a part of a marker of the isoform 3.1 of KCNH2 gene of the invention may be performed using any method known in the art. Typically, it is convenient to assess the presence and/or quantity of a DNA or cDNA by Southern analysis, in which total DNA from a cell or tissue sample is extracted, is hybridized with a labeled probe (e.g., a complementary DNA molecule), and the probe is detected.
- the label group can be a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor.
- Other useful methods of DNA detection and/or quantification include direct sequencing, gel electrophoresis, column chromatography, and quantitative PCR, as is known by one skilled in the art.
- High stringency hybridization and washing conditions refer to conditions which permit isolation of nucleic acid molecules having at least about 80% nucleic acid sequence identity with the nucleic acid molecule being used to probe in the hybridization reaction (i. e., conditions permitting about 20% or less mismatch of nucleotides).
- Very high stringency hybridization and washing conditions refer to conditions which permit isolation of nucleic acid molecules having at least about 90% nucleic acid sequence identity with the nucleic acid molecule being used to probe in the hybridization reaction (i.
- stringent hybridization conditions for DNA:DNA hybrids include hybridization at an ionic strength of 6X SSC (0.9 M Na+) at a temperature of between about 20°C and about 35°C (lower stringency), more preferably, between about 28°C and about 40°C (more stringent), and even more preferably, between about 35°C and about 45°C (even more stringent), with appropriate wash conditions.
- 6X SSC 0.9 M Na+
- stringent hybridization conditions for DNA:RNA hybrids include hybridization at an ionic strength of 6X SSC (0.9 M Na+) at a temperature of between about 30°C and about 45°C, more preferably, between about 38°C and about 50°C, and even more preferably, between about 45°C and about 55°C, with similarly stringent wash conditions.
- 6X SSC 0.9 M Na+
- Tm can be calculated empirically as set forth in Sambrook et al., supra, pages 9.31 to 9.62.
- the wash conditions should be as stringent as possible, and should be appropriate for the chosen hybridization conditions.
- hybridization conditions can include a combination of salt and temperature conditions that are approximately 20-25°C below the calculated Tm of a particular hybrid
- wash conditions typically include a combination of salt and temperature conditions that are approximately 12-20°C below the calculated Tm of the particular hybrid.
- hybridization conditions suitable for use with DNA:DNA hybrids includes a 2-24 hour hybridization in 6X SSC (50% formamide) at about 42°C, followed by washing steps that include one or more washes at room temperature in about 2X SSC, followed by additional washes at higher temperatures and lower ionic strength (e.g., at least one wash as about 37°C in about 0.1X-0.5X SSC, followed by at least one wash at about 68°C in about 0.1X-0.5X SSC).
- 6X SSC 50% formamide
- the present invention also includes methods of diagnosing schizophrenia and related methods.
- biomarkers described herein will be measured in combination with other signs, symptoms and clinical tests of schizophrenia, such as
- biomarkers of the present invention may be measured in combination.
- Markers appropriate for this embodiment include those that have been identified as increased or decreased in samples obtained from schizophrenia samples compared with samples from non- schizophrenia samples (e.g., any one of markers Ml , M2, M3, M4, M5, M6, M7, M8, M9, M10, Mi l , M12, M13, M14, M15, M16, M17, M18, M19, M20, M21 , M22, M23, M24, M25, M26, M27, M28, M29, M30, M31 , M32, M33, M34, M35, M36, M37, M38, M39, M40, M41 , M42, and M43).
- markers appropriate for this embodiment include fragments, precursors, successors and modified versions of such markers, polypeptides having substantial sequence identity to such markers, components having an m/z value and RT value of about the values set forth for these markers, and molecules comprising one of the foregoing.
- Other appropriate markers for this embodiment will be apparent to one of skill in the art in light of the disclosure herein.
- the present invention provides methods for determining whether a subject has schizophrenia. In another aspect, the invention provides methods for diagnosing schizophrenia in a subject. In another aspect, the invention provides methods for determining the likelihood of developing schizophrenia in a subject. In another aspect, the invention provides methods for determining the likelihood that an individual will have increased symptomology associated with schizophrenia. These methods comprise obtaining a biological sample from a subject suspected of having schizophrenia, or at risk for developing
- schizophrenia detecting the expression level or activity of one or more biomarkers of the 3.1 isoform of the KCNH2 gene in the sample, and comparing the result to the expression level or activity of the marker(s) in a sample obtained from a non-schizophrenia subject, or to a reference range or value established for non-schizophrenic individuals.
- the term "biological sample” includes a sample from any body fluid or tissue (e.g., serum, plasma, blood, cerebrospinal fluid, urine, brain tissue).
- the standard biomarker level or reference range is obtained by measuring the same marker or markers in a set of normal controls. Measurement of the standard biomarker level or reference range need not be made contemporaneously; it may be a historical measurement.
- the normal control is matched to the patient with respect to some attribute(s) (e.g., age). Depending upon the difference between the measured and standard level or reference range, the patient can be diagnosed as having schizophrenia or as not having schizophrenia.
- schizophrenia is diagnosed in the patient if the expression level of the biomarker or biomarkers in the patient sample is statistically more similar to the expression level of the biomarker or biomarkers that has been associated with schizophrenia than the expression level of the biomarker or biomarkers that has been associated with the normal controls.
- schizophrenia may turn out to be a number of related, but distinguishable conditions. Classifications may be made, and these types may be further distinguished into subtypes. Any and all of the various forms of schizophrenia are intended to be within the scope of the present invention. Indeed, by providing a method for subsetting patients based on biomarker measurement level, the compositions and methods of the present invention may be used to uncover and define various forms of the disease.
- the methods of the present invention may be used to make the diagnosis of
- the method may be used to determine whether a subject is more likely than not to have schizophrenia, or is more likely to have schizophrenia than to have another disease, based on the difference between the measured and standard level or reference range of the biomarkers of the 3.1 isoform of the KCNH2 gene.
- a patient with a putative diagnosis of schizophrenia e.g., suspected to be suffering from schizophrenia
- the biological sample may be of any tissue or fluid, including a serum or tissue sample, but other biological fluids or tissue may be used. Possible biological fluids include, but are not limited to, plasma, urine and brain tissue.
- the level of a marker may be compared to the level of another marker or some other component in a different tissue, fluid or biological "compartment.” Thus, a differential comparison may be made of a marker in brain tissue and serum. It is also within the scope of the invention to compare the level of a marker with the level of another marker or some other component within the same compartment.
- the above description is not limited to making an initial diagnosis of schizophrenia, but also is applicable to confirming a provisional diagnosis of schizophrenia or "ruling out” such a diagnosis. Furthermore, an increased or decreased level or activity of the marker(s) in a sample obtained from a subject suspected of having schizophrenia, or at risk for developing schizophrenia, is indicative that the subject has or is at risk for developing schizophrenia.
- the invention also provides a method for determining a subject's risk of developing schizophrenia, the method comprising obtaining a biological sample from a subject, detecting the level or activity of a marker in the sample, and comparing the result to the level or activity of the marker in a sample obtained from a non-schizophrenic subject, or to a reference range or value wherein an increase or decrease of the marker is correlated with the risk of developing schizophrenia.
- the assay system can also include a means for detecting a control marker that is characteristic of the cell type being sampled can generally be any type of reagent that can be used in a method of detecting the presence of a known marker (at the nucleic acid or protein level) in a sample, such as by a method for detecting the presence of a biomarker described previously herein.
- the means is characterized in that it identifies a specific marker of the cell type being analyzed that positively identifies the cell type. For example, in a brain tissue assay, it is desirable to screen brain tissue for the level of the biomarker of the 3.1 isoform of the KCNH2 gene expression and/or protein activity.
- the means for detecting a control marker identifies a marker that is characteristic of a brain cell, so that the cell is distinguished from other cell types, such as a connective tissue or inflammatory cell.
- Such a means increases the accuracy and specificity of the assay of the present invention.
- Such a means for detecting a control marker include, but are not limited to: a probe that hybridizes under stringent hybridization conditions to a nucleic acid molecule encoding a protein marker; PCR primers which amplify such a nucleic acid molecule; an aptamer that specifically binds to a conformationally-distinct site on the target molecule; and/or an antibody, antigen binding fragment thereof, or antigen binding peptide that selectively binds to the control marker in the sample.
- Nucleic acid and amino acid sequences for many cell markers are known in the art and can be used to produce such reagents for detection.
- the assay systems and methods of the present invention can be used not only to identify patients that are predicted to be responsive to an antipsychotic medication, but also to identify treatments that can improve the responsiveness of schizophrenic patients to antipsychotic medications by identifying patients likely to discontinue a prescribed regimen of antipsychotic medications, and to develop adjuvant treatments that enhance the response of patients to antipsychotic
- the present inventors have demonstrated that patients heterozygous for mutations associated with the 3.1 isoform of the KCNH2 gene have schizophrenia or are likely to develop schizophrenia, and are likely to benefit from the administration of an antipsychotic medication, and are much less likely to discontinue a prescribed regimen of an antipsychotic medication.
- one embodiment is a method for predicting the clinical response of a schizophrenic patient to an antipsychotic medication by detecting one or more markers of
- KCNH2 in a biological sample form a schizophrenia patient.
- the clinical response may include benefits to the schizophrenic patient, including a significant reduction in ratings of positive schizophrenic syndrome, significant improvement in general psychopathology, and significant decrease in thought disturbance.
- Another embodiment is a method of identifying a patient at risk for developing schizophrenia by detecting the presence of mutations in KCNH2 in a biological sample of a subject having or suspected of having a schizophrenia.
- another aspect of the present invention provides methods for predicting the clinical response of a patient having schizophrenia to an antipsychotic medication, including, for example one or more of olanzapine, perphenazine, quetiapine, risperidone, and ziprasidone.
- the method of identifying patients that will respond to antipsychotic therapies includes obtaining a biological sample from a schizophrenia patient, and detecting in the sample for the presence of a maker of the invention which is a marker of the expression of the 3.1 isoform of the KCNH2 gene.
- the presence of at least one mutation that is associated with the 3.1 isoform of the KCNH2 is indicative of whether or not the patient is likely to benefit from an antipsychotic medication.
- the absence of a biomarker of the invention that is associated with the 3.1 isoform of the KCNH2 protein or expression is indicative of an individual that is not likely to benefit from the administration of an antipsychotic medication. Any schizophrenic patient may be analyzed by these methods in order to assess the prognosis of the patient and assess the likely benefit of administering antipsychotic medications and therapies.
- Another aspect of the present invention provides methods that can be used to identify individuals at risk for developing schizophrenia, and/or for predicting the prognosis of a patient having schizophrenia.
- This aspect of the invention relates to the discovery that the biomarkers of the invention that are associated with the 3.1 isoform of KCNH2 are associated with an increased risk and incidence of schizophrenia. Therefore, one embodiment of this aspect of the invention provides a method of diagnosing or assessing the risk of developing schizophrenia in an individual including obtaining a biological sample from an individual, analyzing the sample for the presence of at least one biomarker of the invention associated with the 3.1 isoform of KCNH2.
- Elevated gene expression and/or protein function of the 3.1 isoform of KCNH2 indicates that the individual is at risk for developing schizophrenia or is suffering from schizophrenia and is likely to benefit from the administration of an antipsychotic therapy, including an antipsychotic medication, and is unlikely to prematurely discontinue a prescribed regimen of antipsychotic medication.
- very low or absent gene expression and/or protein function of the 3.1 isoform of KCNH2 indicates that the individual is at low risk for developing schizophrenia or is unlikely to be suffering from schizophrenia and is unlikely to benefit from the administration of an antipsychotic therapy, including an antipsychotic medication, and is more likely to prematurely discontinue a regimen of an antipsychotic medication prescribed to that patient.
- the individual being tested can be a human or non- human primate.
- the individual may or may not be suspected of having schizophrenia.
- the individual being tested has not been diagnosed as having schizophrenia.
- the individual has been diagnosed as having a schizophrenia.
- a mutation refers to an alteration in a sequence of nucleotides in an KCNH2 nucleic acid molecule, such that the sequence of nucleotides is no longer identical to the sequence of nucleotides at the corresponding location in a wild-type KCNH2 gene.
- Such alterations can be nucleotide insertions, substitutions, deletions or modifications.
- any method suitable for detecting mutations in nucleic acid molecules can be used to practice the present invention.
- KCNH2 nucleic acid molecule present in the sample is determined and compared to the corresponding sequence in the wild-type, KCNH2 gene.
- Any method that is capable of determining the sequence of a nucleic acid molecule can be used to determine the sequence of KCNH2 nucleic acid molecules in the sample. Such methods include, but are not limited to Sanger dideoxy sequencing, Pyrosequencing, RNA sequencing, next-generation sequencing technologies, single-strand conformation polymorphism, heteroduplex analysis, DNA microarray technology, denaturing gradient gel electrophoresis, allele-specific PCR, Scorpion Amplification Refractory Mutation System (SARMS) technology, SNaPshot analysis of PCR products, and mass spectrometry.
- SARMS Scorpion Amplification Refractory Mutation System
- the inventors have disclosed specific mutations in KCNH2 genes that were obtained from brain tissue, indicating that the presence of at least one of these mutations in a KCNH2 nucleic acid molecule correlates with the presence of the 3.1 isoform of KCNH2 and/or schizophrenia of symptomatology of schizophrenia.
- the step of analyzing comprises testing the nucleic acid molecules in the sample from a patient or individual for a mutation selected from the group consisting of Marker Ml , M2, M3, M4, M5, M6, M7, M8, M9, M10, Mi l , M12, M13, M14, M15, M16, M17, M18, M19, M20, M21 , M22, M23, M24, M25, M26, M27, M28, M29, M30, M31, M32, M33, M34, M35, M36, M37, M38, M39, M40, M41 , M42, and M43.
- a mutation selected from the group consisting of Marker Ml , M2, M3, M4, M5, M6, M7, M8, M9, M10, Mi l , M12, M13, M14, M15, M16, M17, M18, M19, M20, M21 , M22, M23, M24, M25, M26,
- the step of analyzing comprises testing the nucleic acid molecules in the sample from a patient or individual for a mutation selected from the group consisting of at least one single nucleotide polymorphism in the KCNH2 gene selected from rs3900779, rs748693 and rsl036145.
- the polymerase chain reaction is used to test for the presence of specific mutations.
- PCR polymerase chain reaction
- the step of analyzing comprises performing PCR using primers specific for a KCNH2 nucleic acid template.
- the PCR is performed using primers in which the 3' nucleotide of at least one primer that does not pair with the nucleotide at the complementary position in the template.
- Other methods of detecting specific mutations can also be used to practice the present invention including, for example, single stranded conformation
- the 3.1 isoform of KCNH2 may also be determined by the expression and/or the activity level of the corresponding protein. Methods of measuring these activities are disclosed herein, and are known to those skilled in the art.
- the 3.1 isoform of KCNH2 can be determined using protein-protein binding assays known to those skilled in the art.
- One example of such an assay is an imunoprecipitation assay.
- the proteins to be tested for binding are mixed together to allow binding, and then a precipitable capture molecule, such as a bead-bound antibody that binds to the 3.1 isoform of KCNH2, is added to the mixture.
- the capture molecule is then precipitated and the precipitate analyzed, for example using PAGE analysis and/or immunoblotting, to determine what proteins co-precipitate with the capture molecule.
- Such techniques are known to those skilled in the art.
- Another useful assay for measuring protein-protein interactions is an enzyme-linked immunosorbent assay (ELISA).
- ELISA enzyme-linked immunosorbent assay
- Such an assay comprises: a) contacting an ELISA plate, which is coated with a suitable amount of a first protein, with a solution containing a second protein being tested for its ability to bind the first protein; and b) determining if the first and second protein form a complex.
- the step of determining if a protein-protein complex is formed comprises assaying for the presence of a complex using an antibody to the second protein.
- the assay kit includes: (a) a means for detecting in a biological sample obtained from the patient a level of a biomarker of the invention, which is a marker of the expression of the 3.1 isoform of KCNH2.
- the kit also includes: (b) a control selected from: (i) a control sample for detecting expression of the 3.1 isoform of KCNH2; (ii) a control sample for detecting low or absent expression of the 3.1 isoform of KCNH2; (iii) information containing a predetermined control level of the expression of the 3.1 isoform of KCNH2; and/or (iv) information containing a predetermined control level of a biomarker of the expression of the 3.1 isoform of KCNH2.
- the kit can further include at least one means for detecting at least one mutation in a KCNH2 polynucleotide.
- Isoform 3.1 mRNA levels are comparable to KCNH2-1A in prefrontal cortex and hippocampus, but over 1000-fold lower in heart.
- Postmortem expression analysis shows a 2.5-fold increase in Isoform 3.1 relative to KCNH2-1 A in schizophrenic hippocampus and association with risk SNPs.
- Isoform 3.1 lacks most of the PAS domain critical for slow channel deactivation. Electrophysiological characterization in rodent cortical neurons reveals that overexpression of Isoform 3.1 results in a rapidly deactivating K+ current and a high-frequency, non-adapting firing pattern. These results reveal an unexpected role of a novel CNH2 channel in cortical physiology, cognition, and psychosis and provide a potential new target for psychotherapeutic drugs.
- KCNH2 also called hERGl
- Genbank accession No. U04270 a member of the ether-a-go-go related family of voltage gated potassium channels (J. W. Warmke and B.
- Neurophysiol 90:1817 a firing pattern necessary for sustained neuronal activity subserving numerous complex cognitive functions (Y. Wang et al. 2006 Nat Neurosci 9:534).
- Isoform 3.1 primate brain specific isoform
- Fig. 5 (top) is shown the inverse log of the p-value from family-based association results for the CBDB Sibling Study (GC, diamonds), NIMHGI-C (GI-C, squares), NIMHGI-AA (GI-AA, triangles) and for the German case-control study (G, circles) for single SNPs and 3-SNP sliding window haplotypes. Only markers and haplotypes with p-values less than 0.1 are shown. A physical map of the region is given and depicts known genes within the region. Referring to Fig. 5 (bottom), the LD structure of the genotyped markers is given for 370 unrelated healthy control Caucasians and depicted as D'. Graphics were created using the R package snp. plotter available from nicodemusk@mail.nih.gov (A. Luna and K. K. Nicodemus 2007 Bioinformatics 23:774-776).
- a haplotype block indicative of minimal historical recombination (S. B. Gabriel et al. 2002 Science 296:2225) containing parts of NOS3 and KCNH2 was observed in persons of Western European ancestry genotyped by the International HapMap Project (The International HapMap Project 2003 Nature 426:789).
- the haplotype block begins 1.2Kb downstream of the NO S 3 transcription start site (in the 5' UTR) and extends 21.3Kb upstream of this gene (Fig. 11).
- the initial 13.1 Kb of this upstream region are non-coding and intergenic, but the remainder overlaps with 6.9Kb of KCNH2.
- Fig. 12A depicts the FBAT three marker sliding windows in CBDB family sample (CBDB Sibling Study 3-SNP Sliding Window Haplotype Results (296 families).
- Fig. 12B depicts the FBAT three marker sliding windows in NIMH-C family sample (NIMHGI-C 3 SNP Sliding Window Haplotype Results (71 families).
- Fig. 12A depicts the FBAT three marker sliding windows in CBDB family sample (CBDB Sibling Study 3-SNP Sliding Window Haplotype Results (296 families).
- Fig. 12B depicts the FBAT three marker sliding windows in NIMH-C family sample (NIMHGI-C 3 SNP Sliding Window Haplotype Results (71 families).
- Fig. 12A depicts the FBAT three marker sliding windows in CBDB family sample (CBDB Sibling Study 3-SNP Sliding Window Haplotype Results (296 families).
- Fig. 12B depicts the FBAT three marker sliding windows in NIMH-C family sample (NIMHGI-C 3
- FIG. 12C depicts the FBAT three marker sliding windows in NIMH-AA family sample (NIMHGI-AA SNP Sliding Window Haplotype Results (51 families).
- Fig. 12D depicts the Haplo. stats three marker sliding windows in German case control sample (German Case-Control 3-SNP sliding window haplotype results).
- NIMHGI-C Caucasian families
- NIMHGI-AA African American families
- VBM Voxel-based morphometry
- genotype groups were matched for performance on cognitive tasks (accuracy and reaction time). This matching strategy allowed a test of the effect of genotype on how cognitive information is handled physiologically at the neural system level, independent of how well subjects perform on the task.
- fMRI was used to assess regional activation during incidental encoding of a temporal lobe memory task (A. R. Hariri et al.
- genotype effects of most significant family-based markers on cognitive performance measures are shown.
- P-values for the regression model are based on two- degree of freedom F-tests. Linear regression was used to assess differences between cognitive measures and heterozygote (G/A) and homozygote (A/ A) carriers with respect to G/G non-risk carriers. P-values for each genotype comparison are shown followed by ⁇ -coefficients for genotypes indicated. Significant main effects (p ⁇ 0.05) are shown in bold. Referring to Fig.
- VBM voxel based morphometry analysis
- genotype based differences in right hippocampal gray matter volume (MNl coordinates: 26, -12, -22 mm) for SNP M30 were derived using optimized VBM.
- the measures for hippocampal gray matter volume were mean centered and extracted from the most significant right anterior hippocampal cluster on ANCOVA analysis in SPM 2 using age, gender, and total gray matter volume as covariates of no interest.
- genotype based differences in right hippocampal gray matter volume (MNl coordinates: 26, -9, -24 mm) for SNP M31 were derived using optimized VBM.
- the measures for hippocampal gray matter volume were mean centered and extracted from the most significant right anterior hippocampal cluster on ANCOVA analysis in SPM 2 using age, gender, and total gray matter volume as covariates of no interest.
- genotype based differences in right hippocampal gray matter volume (MNl coordinates: 26, -9, -24 mm) for SNP M33 were derived using optimized VBM.
- the measures for hippocampal gray matter volume were mean centered and extracted from the most significant right anterior hippocampal cluster on ANCOVA analysis in SPM 2 using age, gender, and total gray matter volume as covariates of no interest.
- Thresholded p ⁇ 0.05 FWE corrected statistical t-maps are shown in Fig. 17B.
- Fig. 18A depicts mean ( ⁇ 1 SEM) percent
- Thresholded p ⁇ 0.05 FWE corrected statistical t-maps are shown in Fig. 18B.
- Fig. 7B depicts the association of marker 33 (M33) risk genotype (A carriers) with Isoform 3.1 expression within the hippocampus (data from A) with respect to rave and diagnosis.
- M33 marker 33
- a carriers risk genotype
- Isoform 3.1 expression within the hippocampus
- Main effect of genotype was determined following the same linear regression modeling as in A but within Caucasian and African American subsets separately and including M33 as a variable in the model.
- M33 A/G individuals were pooled due to the small number of A/A individuals. No significant differences were observed between A/G and G/G carriers as determined by multinomial logistic regression. All error bars represent one standard error of the mean.
- Fig. 19 8-10 rats per treatment group were treated with one of three doses of either Haloperidol (0.08, 0.6, and lmg/kg) or Clozapine (0.5, 5, 10 mg/kg) for 28 days (as compared to rats treated with vehicle alone).
- Frontal cortex expression levels of NOS3 (ABI assay Rn02132634_sl) and CNH2-1 A (ABI assay Rn01442523_ml) were normalized to the geometric mean of two housekeeping genes (GAPDH, B2M). Effects of antipsychotic treatment on gene expression were tested by linear regression with gene expression as the dependent variable.
- the combined detection of both isoforms might result in little to no 'net' difference. While this may indicate the presence of allelic heterogeneity (i.e., different SNPs confer risk to the illness in different populations), it may also suggest that the molecular effects of genetic risk do not impact on the expression of KCNH2-1 A, or they may relate to more complex aspects of gene processing, such as the splicing of transcripts or the expression of other isoforms.
- Isoform 3.1 In silico prediction (on the world-wide-web at ncbi.nlm.nih.gov) of the longest ORF of the novel isoform (referred to as Isoform 3.1) revealed that the majority of the 1.1Kb 5' extension of exon 3 would be untranslated and that the first methionine is in frame with the full- length protein. As such, Isoform 3.1 is expected to be missing the first 102 amino acids of the full-length KCNH2-1 A, replacing them with 6 amino acids unique to the isoform.
- the 102 amino acids encoded for by exons 1 and 2 of hERGla comprise a large portion of the PAS domain, a motif that slows the rate of channel deactivation (J. H. Morais Cabral et al. 1998 Cell 95:649).
- the translation of Isoform 3.1 and the predicted difference in protein size was confirmed using western blot in transfected HEK cells (Fig. 8C).
- Western blot in human hippocampus and frontal cortex following immunoprecipitation revealed a protein band of similar molecular weight to that in transfected HEK cells (Fig. 8C).
- neuroblastoma cells transfected with constructs encoding either or both KCNH2-1 A or Isoform 3.1 show overlapping expression of the protein isoforms on the plasma membrane (Fig. 8D).
- Isoform 3.1 is expressed primarily in brain
- known isoforms of KCNH2 and its homologues can co-assemble to create heteromeric potassium channels with unique electrophysiological properties (L. Guasti et al. 2005 J Comp Neurol 491 : 157) further modified by the ratio and arrangement of subunits (S. Wimmers et al. 2002 Pflugers Arch 445:423)
- Isoform 3.1 was over 1000-fold less abundant than KCNH2-1A within the heart, suggesting that the role of Isoform 3.1 may reside largely within the brain.
- PCR products were generated for CNH2-1 A and Isoform 3.1 using forward primers in exon 1 of KCNH2-1 A (Exl) and in the 5'-UTR of Isoform 3.1 (Isol), respectively, and the same reverse primers in exons 3 (Ex3) and 4 (Ex4) of KCNH2-IA (see Example 1).
- PCR was performed using cDNA prepared from commercially available total RNA (Ambion) isolated from human heart, hippocampus, and fetal brain.
- PCR products for KCNH2- 1A were expected at 373 and 463 bps, respectively, and for Isoform 3.1 at 388 and 478 bp, respectively.
- the band -1.5 kb in Isol-Ex4 lanes corresponds to small amounts of unspliced RNA or genomic DNA present in the samples.
- Quantitative PCR was performed using TaqMan assays (ABI) to measure relative mRNA expression of Isoform 3.1 (custom TaqMan assay designed to the 5'-UTR of Isoform 3.1) versus KCNH2-1A (HsOOl 65120_ml) ⁇ standard error of mean. Expression values were measured in cDNA made from DNAse treated (Invitrogen) commercially available total RNA (Ambion) from human hippocampus, prefrontal cortex, heart, and skeletal muscle. Referring to Fig.
- PCR of KCNH2-1A (full-length) and Isoform 3.1 was performed using 10 different tissue extractions of total RNA.
- Full-length PCR products were generated using Exl-F forward primer to Ex3-R and Ex4-R reverse primers (see Example 1).
- Isoform 3.1 PCR products were generated using Ex3.1-F forward primer and the same Ex3-R and Ex4-R reverse primers. Expected product sizes: 373, 463, 388, 478 bps respectively. Cloning and sequencing of the band at 1547 bps in PCR of Ex-3.1-F to Ex4-R of some samples corresponded to sequences without intron 3 spliced out suggesting that this represents DNA contamination in these samples.
- a multiple alignment is shown of the 250 bp region upstream of KCNH2-1A (hERG-lA) exon 3 splice site and 180 bps of exon 3 in human, rhesus, mouse, and rat.
- Genome sequences were obtained from UCSC and aligned using Clustal W (on the worldwide-web at ebi.ac.uk/clustalw).
- Exon 3 splice site (CAG) is boxed by a fine dashed line followed by exon 3 (heavy dashed-line box), both of which are highly conserved across species.
- In-frame start codons are shown with a closed box for human and rhesus sequences and equivalent ATG in mouse and rat are frameshifted (in frame codon is shown with a closed box).
- Fig. 21 B shows multiple alignments of the predicted ORF of this region in frame with exon 3 and the remainder of the KCNH2 coding sequence.
- human and rhesus sequences show starting methionines while mouse and rat sequences are devoid of upstream, in-frame methionines prior to stop codons.
- Isoform 3.1 Higher expression of Isoform 3.1 in schizophrenia and in subjects with risk genotype Primate-specific, brain enriched expression, and the location of risk SNPs in the 5' upstream of Isoform 3.1's first exon led us to hypothesize that the mechanism of genetic risk for schizophrenia would involve differential expression of the Isoform 3.1.
- Isoform 3.1 Structural analysis of Isoform 3.1 revealed some interesting properties that suggest potentially unique physiological effects.
- the PAS domain (aa 25-136) in the N-terminus ensures a slow deactivation of the KCNH2 channel, a unique feature of hERG (M. C. Sanguinetti and M. Tristani-Firouzi 2006 Nature 440:463).
- a few amino acids (aa 7-12) in the N-terminal of hERG channels facilitate the channel deactivation (H. Terlau et al. 1997 J Physiol 502:537).
- the Isoform 3.1 substitutes the first 102 amino acids at the N- terminus with 6 new amino acids (Fig.
- FIG. 9 A schematic diagrams of the domain structures of KCNH2-1A and
- Isoform 3.1 depict initial leader sequences, the PAS domain (or partial PAS domain in the case of Isoform 3.1), and amino acid sequences identical between KCNH2-1A and Isoform 3.1. The numbers above the bars are positions of amino acids.
- Fig. 9B depicts currents evoked by voltage steps (2 sec) from VH of -60 mV to potentials from -100 to +80 mV inlO-mV increments, followed by a voltage pulse to -120 mV.
- Upper panel voltage protocol.
- Middle and lower panels traces obtained from cells transfected with KCNH2-1A and Isoform 3.1 cDNAs, respectively. These traces are corrected for leak currents.
- Fig. 9B depict currents evoked by voltage steps (2 sec) from VH of -60 mV to potentials from -100 to +80 mV inlO-mV increments, followed by a voltage pulse to -120 mV.
- Upper panel voltage protocol.
- FIG. 9C shows the effects of E-4031 on tail currents evoked by a test pulse to -120 from holding potential of +80 mV, using the same protocol as in A. Traces recorded from the same cells before and after treatment with 10 ⁇ E- 4031 were superimposed. Upper and lower panels show KCNH2 currents recorded from cells transfected with KCNH2-1A and Isoform 3.1 cDNAs, respectively. Fig. 9D illustrates activation curves of KCNH2-1A and Isoform 3.1. Fig. 9E illustrates tail currents evoked by voltage steps from +60 mV to potentials between -120 mV and -70 mV in 10 mV increments.
- Fig. 9F illustrates deactivation time constants of KCNH2 currents at different re-polarizing voltages. Between -120 to -70 mV the decay phase of KCNH2 currents was fitted by a single-exponential function to calculate the deactivation constant. The data are presented as mean + SE. The numbers of cells recorded are indicated in the parentheses.
- Isoform 3.1 was transfected with or without GFP into the cultured cortical neurons on the day of plating, and whole-cell, voltage-clamp recording was performed on neurons cultured for 10 days following perfusion with a cocktail of inhibitors to block Na+ and Ca2+ currents. In neurons transfected with GFP alone, application of a voltage protocol similar to that in Fig.
- the spike frequencies induced by a 40-pA depolarizing step were 8.9 ⁇ 1.3 Hz in control and 16.6 ⁇ 0.5 Hz in Isoform 3.1 -transfected neurons, respectively (Fig. 10E).
- Further examination of the inter-spike intervals (ISIs) also revealed that expression of Isoform 3.1 converted an adapting (Fig. 10D, upper) to a non-adapting (Fig. 10D, lower) firing pattern. Indeed, the ratio of 1st and last ISIs increased from 0.57 ⁇ 0.05 in control neurons to 0.96 ⁇ 0.02 in isoform 3.1 -transfected neurons (Fig. 10F).
- cortical neurons were transfected with either GFP alone or GFP and Isoform 3.1 , and cultured for 10 days.
- KCNH2-mediated tail currents in GFP- and Isoform 3.1 -transfected neurons are shown, respectively.
- Tail currents evoked by voltage pulses (1 sec) from VH of +80 mV to potentials between -70 and -120 mV, in 10-mV increments.
- E-4031 -sensitive currents are obtained by subtracting currents recorded after E-4031 application from those from before E-4031 application.
- IOC illustrates a semilogarithmic plot of deactivation time constants of E-4031 -sensitive currents at different re-polarizing voltages. Between -120 and -100 mV decay of E-4031 -sensitive currents was fitted by double- exponential functions, whereas between -90 and -70 mV time course followed single-exponential functions. Deactivation constants in the neurons transfected with isoform 3.1 are consistently smaller than those in control neurons at different re-polarizing voltages.
- Fig. 10D illustrates the effect of over-expression of Isoform 3.1 on action potential discharge of cultured cortical neurons. Repetitive firing was evoked by long depolarizing pulse (40 pA, 1 sec).
- Fig. 10E illustrates spike frequencies induced by injecting different depolarizing currents. Spike frequency is defined as the number of spikes per 1 sec. Neurons expressing Isoform 3.1 consistently exhibit significantly higher spike frequencies starting from 30 pA of current injection.
- Fig. 10F illustrates the effect of Isoform 3.1 on spike frequency adaptation. The degree of non-adaptation, measured by the ratio of first to last interspike intervals evoked by a 40-pA depolarizing pulse, was significantly higher in neurons expressing Isoform 3.1 than that in control or GFP-expressing neurons. The data are presented as mean ⁇ SE. The numbers of cells recorded are indicated in the parentheses (D) or columns (E) and asterisk indicates a significant difference (ANOVA, p ⁇ 0.01).
- Summary information includes: minor allele frequency (MAF) in the CB chromosomal location, and SNP alleles (major/minor). Observed z-scores for transmission of the minor allele to affected offspring in 175 Caucasian families are r individual markers and the most significant combined haplotype as determined by FBAT (see Example 1). Reported p-values are simulated from the experimental 000 iterations and reported for individual SNPs, the global haplotypes, and the most significant haplotype. Haplotypes are reported as 1 (major allele) and 2 (min each included SNP and significantly associated (p ⁇ 0.05) SNPs or haplotypes are shown in bold.
- MAF minor allele frequency
- SNP alleles major/minor
- SNPs denoted novel were identified by resequencing DNA from 48 schizophrenia patients (see Example 1), The type of SNP (major allele listed first) and MAF (mi frequency) is given for each cohort.
- MAF mi frequency
- the odds ratio for the minor allele in cases vs. controls as w corresponding Chi-square p-value is given followed by the multinomial linear regression coefficient ( ⁇ ) for case vs. control 2/2 individuals and its simulated p-val iterations), p ⁇ 0.15 are italicized; p ⁇ 0.05 are bold.
- HNR Homozygous for the Non-Risk Allele
- H Heterozygous for the Risk Allele
- HR Homozygous for the Risk Allele
- HNR Homozygous for the Non-Risk Allele
- H Heterozygous for the Risk Allele
- HR Homozygous for the Risk Allele
- VBM Optimized voxel based morphometry
- A Demographic information for real-time q-PCR analysis of post-mortem human DLPFC.
- B Demographic information of samples used for real-time q-PCR analysis of human Hippocampus. Summary statistics of critical demographic variables are shown ( ⁇ 1 SD) by patient group. Differences between groups were assessed using either ANOVA followed by Least-Significant Difference post-hoc analysis (p-values denoted with '*') or using Fisher's Exact test (p-values denoted with '@').
- Quantitative RT-PCR was used to measure the relative quantity of Isoform 3.1 as compared to KCNH2-1A expression in 8 total RNA isolates. All samples were DNase treated prior to cDNA synthesis to prevent the effects of DNA contamination on the samples. All Ct values were determined at the same threshold value and all sample expression values were measured in triplicate.
- This "sustained" firing pattern might be important for cortical information processing underlying higher-order cognitive and memory tasks and suggests a role for Isoform 3.1 in normal human cognitive processing.
- the 2.5 -fold increase in Isoform 3.1 relative to KCNH2-1A in schizophrenic brain might serve to abnormally increase neuronal excitability and disrupt normal oscillatory rhythms.
- "Dysrhythmia" of such tonic firing would be expected to result in anomalous modulation of microcircuits resulting in poor regulation of signal-to-noise (G. Winterer and D. R. Weinberger 2004 Trends Neurosci 27:683).
- Isoform 3.1 has compelling therapeutic implications.
- the unique structure of isoform 3.1 its role in non-adaptive firing, its low expression in heart, and elevated expression in brains of schizophrenia patients and genetic risk carriers, lead to the conclusion that selective inhibition of Isoform 3.1 but not KCNH2 would correct the disorganized firing in schizophrenia brain without eliciting cardiac side effects.
- Isoform 3.1 is a promising novel therapeutic target for the treatment of schizophrenia.
- the CBDB Sibling Study consists of subjects collected as part of an ongoing
- the cohorts consisted of 51 African American families (GI-AA) and 71 Caucasian families (GI-C). Only nuclear families were included with DNA available from at least one sibling with a diagnosis of schizophrenia or schizoaffective disorder, and at least one parent.
- a fourth cohort was collected from the Kunststoff area in Germany consisting of 501 schizophrenia patients and 626 unrelated healthy controls (K. K. Nicodemus et al. 2007 Hum Genet 120:889-906). Further details regarding the collection, evaluation, and exclusion criteria of the German cohort have been described (K. K. Nicodemus et al. 2007 Hum Genet 120:889-906).
- FBAT family-based association test
- Genotypes were obtained for a total of 43 SNPs within a 65.2 Kb region of KCNH2 and NOS3 (chr7: 150280464 - 150345679). A total of 13.5Kb were re-sequenced in 48 schizophrenia patients by Polymorphic Inc. (Alameda, California) and also in house, including 10.4Kb flanking rs 1036145 (chr7: 150,299,575- 150,309,948) and 3.1Kb upstream of exon 3 (chr7: 150,287,750- 150,290) with high cross-species conservation in the UCSC genomes database
- SNPs were genotyped in all four cohorts using TaqMan SNP assays as before. Finally, SNP M33 was genotyped in 1 16 individuals (34 schizophrenia patients and 82 healthy controls) of the CBDB/NIMH Brain Collection (see below) for whom total RNA was also extracted from the DLPFC and
- HWE Hardy- Weinberg Equilibrium
- a custom TaqMan MGB assay was designed for Isoform 3.1 targeting the 5'-UTR region of the gene (F- primer: 5'- CATGAGAAAAGAATTATATACATTATGTGTATCACAACATC, SEQ ID NO: 18; R-Primer: 5'-GCCTCATTTTTTCCATCTATAAAATGGGAA, SEQ ID NO: 19; Probe: 5'- ACTGTGTACCCCATAAATATGTA, SEQ ID NO: 20).
- a pool of cDNA from 16 individuals was used to create an 8 -point, 1A serial dilution standard curve. All QPCR reactions were performed in triplicate.
- Subjects All the subjects who participated in the imaging aspects of this study were Caucasian (see Table 5 and 6 for demographics). They were cleared of neurological, psychiatric, or substance abuse problems and had no history of other medical problems or medical treatment relevant to cerebral metabolism and blood flow. There was no significant difference in age, sex, IQ score and education distribution across the genotype groups. All available scans of subjects with genotypes of interest were used in these analyses.
- Structural image processing Three-dimensional structural MRI scans were acquired on a 1.5-T GE scanner using a Tl-weighted SPGR sequence (TR/TE/NEX 24/5/1, flip angle 45°, matrix size 256 x 256, FOV 24 x 24 cm) with 124 sagittal slices (0.94 x 0.94 x 1.5 mm resolution) and pre-processed as previously described (L. Pezawas et al. 2004 J Neurosci
- Anatomical hippocampal ROIs were created using the WFU Pick atlas (on the world-wide-web at fmri.wfubmc.edu) software.
- VOI volume of interest
- IAPS International Affective Picture System
- images were realigned to the first image of the scan run, spatially normalized into a standard stereotactic space (MNI template) using an affine and nonlinear (4 x 5 4 basis- functions) transformation, smoothed with a 8-mm FWHM Gaussian filter and ratio normalized to the whole-brain global mean.
- MNI template standard stereotactic space
- affine and nonlinear (4 x 5 4 basis- functions) transformation smoothed with a 8-mm FWHM Gaussian filter and ratio normalized to the whole-brain global mean.
- linear contrasts were computed producing t statistical parameter maps at each voxel for encoding, and retrieval assuming the rest condition as a baseline.
- ANOVA second-level random effects model
- ROI region of interest
- 5'-RACE and Isoform 3.1 cloning 5'-RACE was performed using a 5'-RACE System (v2.0) as recommended (Invitrogen). Template cDNA was made from commercially available total RNA from 10 human cell lines and tissues (Stratagene). Reverse primers in exon 5 (5 - TGTGGGTTCGCTCCTTTATC) (SEQ ID NO: 21) were used as the first gene specific primer followed by primers in Exon 4 in the first PCR (5'-CATGGCCTCGATGTCGTC) (SEQ ID NO: 22). Nested PCR was performed using primers in Exon 3 (5'-ATGATGACAGCCCCATCCT) (SEQ ID NO: 23).
- Novel KCNH2 isoform3.1 cDNA was cloned by long PCR with specific primers (3. IF 5'-CATACGGGGAGGCAGAAGT, SEQ ID NO: 25; Exl 5-R
- transfected cells were lysed with 250 ul of T-PER protein extraction reagent (Pierce Chemical) with 1% proteinase inhibitor cocktail (Sigma) and phosphatase inhibitor (Sigma). Protein concentrations of homogenates were measured by the BCA protein assay reagent kit (Pierce Chemical, Rockford, IL). All samples were diluted with isolation solution to a specific concentration needed and denatured at 950C for 5 min in protein sample loading buffer (Invitrogen).
- Cortex protein extraction Human dorsolateral prefrontal cortex and hippocampal tissues were homogenized with tissue lysis buffer (Pierce Chemical). Protein concentrations of homogenates were measured by the BCA protein assay reagent kit (Pierce Chemical, Rockford, IL).
- the blot was rinsed in TBS- T, incubated in a peroxidase-conjugated goat anti-rabbit antibody (1 : 1 ,000 dilution, Santa Cruz) for 2 h in 5% normal goat serum in TBS-T and rinsed in TBS-T.
- the blot was developed in ECL Plus (Amersham) and was exposed to Kodak BioMax film. Films were digitized using a scanner, and the resulting images were analyzed using NIH image J.
- Cortex was dissected from embryonic day 18 rats, dissociated in Ca and Mg free HBSS containing 0.125% tyrosine for 15 min, triturated in DMEM/10% FBS, then plated on poly-D-lysine coated 12- well plates at 5,000 per coverslip. Cells were grown at 37°C, 5% C02 and 95% humidity, first in 10% FBS/DMEM, and 1 d later switched to serum- free medium Neurobasal plus B27. After 7 days, the cortical neurons were transfected with KCNH2, Isoform 3.1 in pcDNA3.0 vector or vector only. The transfected cells were then fixed with 4% paraformaldehyde.
- HEK293T cells were plated at 50% confluency in Dulbecco's Modified Eagle Medium (DMEM) supplemented with 10% fetal bovine serum (FBS). At the time of plating, HEK293T cells were transfected with the KCNH2-1A and Isoform 3.1 cDNA constructs, using Lipofectaniine 2000 (Invitrogen), using manufacturer's protocols. pEGFP-Cl (Clontech) DNA was cotransfected for visualization of transfected cells. Cells transfected for 2-4 days were used for electrophysiology.
- DMEM Dulbecco's Modified Eagle Medium
- FBS fetal bovine serum
- Cortical neurons dissociated from embryonic day 18 (El 8) rats were first nucleofected with Isoform 3.1 and EGFP cDNAs according to instruction provided by Amaxa. The cells were plated in DMEM containing 10% FBS at 1 million cells per 35 mm dish, and then transferred to Neurobasal medium supplemented with B27 (Invitrogen), glutamax I (Invitrogen) on the following day. Neurons grown for 1 1-15 days were used for electrophysiology.
- HEK293T cells were lysed 48 h after transfection with KCNH2-1A and Isoform 3.1 DNA constructs in RIPA buffer (50 mM Tris-HCl pH 7.4, 150 mM NaCl, 1% NP-40, 0.5% Sodium deoxycholate, 0.1% SDS) supplemented with a protease inhibitor cocktail (Sigma) and a phosphatase inhibitor cocktail (Calbiochem). Protein concentrations were determined by Bradford assay (Bio-Rad). Proteins were resolved by western blot as described above.
- Electrophysiological recordings Transfected HEK293T cells and cortical neurons on coverglass were transferred to a small cell bath mounted on the stage of an inverted microscope (Diaphot, Nikon), identified as GFP-positive under the fluorescence microscope, and superfused with extracellular saline solution containing (in mM): 137 Na-Isethionic acid, 4 K-gluconate, 1.8 CaCl 2 , 1 MgCl 2 , 10 HEPES, 10 glucose (pH 7.4 with NaOH). Standard whole-cell recordings were performed at room temperature.
- the recording pipette was filled with the internal pipette solution containing (in mM) 130 K-gluconate, 1 MgCl 2 , 5 EGTA, 5 MgATP, 10 HEPES and 0.4 Na 2 GTP (pH 7.2 with KOH), and had a resistance of 2-4 ⁇ .
- Data were collected by a patch clamp amplifier (Axopatch 200B) and analyzed by pClamp 9.0 software (Molecular Devices, Sunnyvale, California). After the whole-cell configuration was achieved, series resistance were compensated by 80-90% and monitored periodically. Most cultured cortical neurons had series resistance around 7-8 ⁇ (range, 4-13 ⁇ ).
- Antidopaminergic drugs the only evidence based medical treatments for schizophrenia, bind to HERG1 potassium channels encoded by KCNH2, accounting for their side effect of QT interval prolongation. Recently, risk for schizophrenia has been associated with genetic variation in KCNH2, which also impacts on cognitive function, physiologic engagement of hippocampus and prefrontal cortex during memory, and increased expression of a novel, brain selective isoform KCNH2-3.1 with unique physiologic properties.
- hERGl mediated effects of antipsychotics may not be limited to their potential cardiovascular side effects but also may involve therapeutic actions related to the brain- specific 3.1 isoform of KCNH2.
- Schizophrenia is a complex and heterogeneous psychiatric illness with significant interplay between environmental and genetic components.
- dopamine DA
- researchers and clinical studies support a role for this neurotransmitter in the pathophysiology of schizophrenia.
- Snyder SH Dopamine hypothesis of schizophrenia-Focus on dopamine receptor. Am. J. Psychiat. 1976;133(2): 197-202; Crow TJ, Johnstone EC, Longden AJ, Owen F. Dopaminergic mechanisms in schizophrenia-Antipsychotic effect and disease process.
- the hERGl channel is responsible for the delayed rectifier potassium current (IKr), a major component of cardiac repolarization ⁇ Schwarz JR, Bauer CK. Functions of erg K+ channels in excitable cells. Journal of Cellular and Molecular Medicine. Jan-Mar 2004;8(l):22-30; Wehrens X. Structural determinants of potassium channel blockade and drug-induced arrhythmias. Handb Exp Pharmacol.
- the hERGl channel displays a tetrameric structure with one a-subunit with six transmembrane spanning domains and one auxiliary beta subunit with one transmembrane spanning domain.
- Phartiyal P Jones EMC, Robertson GA. Heteromeric assembly of human ether-a-go-go-related gene (hERG) la/lb channels occurs cotranslationally via N-terminal interactions. J Biol Chem. Mar 2007;282(13):9874-9882.
- the assemblage of the different hERG channels gives rise to a supramolecular structure that serves as the voltage-gated K+ channel.
- Perry M, Sachse FB Sanguinetti MC. Structural basis of action for a human ether- a-go-go-related gene 1 potassium channel activator. P Natl Acad Sci USA. Aug
- the hERGl protein is encoded by the KCNH2 gene which contains 15 exons on chromosome 7q36.1 and produces at least three distinct isoforms by alternative splicing. Studies have identified over 300 genetic variants in KCNH2 that can either cause a congenital form of LQT syndrome or predispose to acquired LQT syndromes. ( Thomas D, Karle CA, Kiehn J. . The cardiac hERG/IKr potassium channel as pharmacological target: structure, function, regulation, and clinical applications. Curr Pharm Des. 2006;12(18):2271- 2283; Witchel H. The hERG potassium channel as a therapeutic target.
- Blockade of hERGl channels by antipsychotics may represent the most frequent cause of the acquired LQT syndrome.
- Huffaker et al. identified a brain- selective and primate-specific isoform (3.1) of the KCNH2 gene that regulates neuronal firing patterns.
- KCNH2-3.1 messenger RNA levels are similar in the brain but 3 -orders of magnitude lower in the heart.
- This novel isoform has a novel 5' exon extension and is lacking the PAS domain of the full length protein that is critical for slow channel deactivation and repolarization.
- KCNH2 pathophysiologic role of KCNH2 3.1 in the clinical state.
- This primate-specific isoform of KCNH2 was shown to have unique physiological properties in neuronal culture, mediating fast neuronal spiking.
- Two recent studies have further confirmed the association of the same SNPs in KCNH2 with schizophrenia.
- Atalar F Acuner TT, Cine N, et al.
- Two four-marker haplotypes on 7q36.1 region indicate that the potassium channel gene HERGl (KCNH2, Kvl 1.1) is related to schizophrenia: a case control study. Behav. Brain Funct. May 2010;6(27); Hashimoto R, Ohi K, Yasuda Y, et al.
- the KCNH2 gene is associated with neurocognition and the risk of
- the first cohort consisted of 54 partially treatment-resistant patients with schizophrenia admitted to the Clinical Brain Disorders Branch schizophrenia research inpatient unit at the NIMH Clinical Center between 1998 and 2010. All of these subjects were self- reported Caucasian of European ancestry and were diagnosed with chronic schizophrenia using DSM-IV criteria. (Task Force on DSM-IV. Diagnostic and Statistical Manual of Mental
- PANSS 16-item Positive and Negative Syndrome Scale
- Mah SR Fiszbein A, Opler LA.
- the positive and negative syndrome scale (PANSS) for schizophrenia. Schizophr. Bull. 1987;13(2):261-276) was performed independently by one of four trained research nurses. Two weeks prior to starting the double blind protocol and up to four weeks after completing the protocol, ratings were performed twice a week.
- the PANSS is a 7-point rating scale (1 -7), with one indicating the absence of a symptom or behavior and seven indicating greatest severity of illness.
- the PANSS items comprise three different scales, which include Positive Syndrome, Negative Syndrome and General Psychopathology, and five different clusters comprised of Anergia, Thought Disturbance, Activation, Paranoid/Belligerence and Depression.
- Mean PANSS baseline ratings in the NIMH study before entering the placebo- controlled protocol were: Positive Syndrome: 14.25+4.09, Negative Syndrome: 15.69+4.6, General Psychopathology: 29.58+5.81, Anergia: 8.48+2.23, Thought Disturbance: 8.36+3.61, Activation: 5.08+1.31 , Paranoid/Belligerence: 4.89+0.85 and Depression: 8.40+2.18.
- the second cohort consisted of patients randomly assigned to five medications during the Phase 1/1 A (first drug assigned) of the Clinical Antipsychotic Trials of Intervention
- Phase 2 Eligible patients were 18 to 65 years of age, had received a diagnosis of schizophrenia based on DSM-IV criteria26 and were able to take oral antipsychotic medication.
- the primary outcome measure in the CATIE sample was time to medication discontinuation, most often due to lack of efficacy or side-effects.
- Genotypes were determined using the 5'-exonuclease fluorescent Taqman assay (assay by design or assay on demand) and the allelic discrimination was read on an ABI 7900 SDS system (Applied Biosystems, Foster City, CA). (Livak KJ. Allelic discrimination using fluorogenic probes and the 5 ' nuclease assay. Genet. Anal.-Biomol. Eng. Feb 1999;14(5-6): 143-149.)
- Time to discontinuation in the CATIE trial is a problematic measure in a pharmacogenetic analysis of treatment response, because it was confounded by many issues, including side effects, patient preference and other subjective individual considerations. Patients in the CATIE trial were allowed to stop medication for literally any reason at any time.
- An illustration of the uncertainties inherent in time to discontinuation is that it was not predicted by drug clearance rate, which did predict symptom change during treatment (Bigos KL, Pollock BG, Coley KC, et al. Sex, race, and smoking impact olanzapine exposure. Journal of Clinical Pharmacology.
- the Cox proportional hazard model was used to analyze the time to
- Demographics of the NIMH sample are shown in Table 12 based on rs 1036145 genotype, a SNP showing effects on treatment in this sample. Age at admission (p ⁇ 0.032) and duration of illness (pO.001) were statistically different by genotype groups.
- genotype groups differed slightly in gender proportions and in frequency of smokers. None of these effects can account for the genotype effects on outcome variables, as described below. No significant differences by genotype groups were observed for IQ, years of education and prestudy antipsychotic dose in CPZ equivalents. Demographics of the CATIE sample by KCNH2 genotype of rs 1036145 are shown in Table 13. No significant differences were observed for mean CPZ equivalents, education, and age of onset or duration of illness. Smoking status did not differ by genotypes.
- Beta coefficient estimates
- SE standard error of coefficient estimate
- the ratio of effect size for TT compared with TC+CC genotypes was 1.65 (0.42/0.25) for the positive syndrome, 1.88 (0.339/0.180) for general psychopathology and 1.84 (0.458/0/249). There were no significant effects of the other two SNPs (rs3900779 and rs748693) on the change in PANSS scores in the NIMH cohort.
- Beta is mean difference in PANSS ratings based on least-square estimation
- KCNH2 genotype (rs 1036145) had a significant impact on the response to antipsychotic treatment in the NIMH cohort in two separate groups (i.e. those receiving placebo first, and those receiving active drug first).
- patients who were homozygous for the risk-associated allele showed a greater change in positive symptoms, thought disturbance and general psychopathology when compared with carriers of the C allele.
- This strong effect of genotype which remained significant after correction for multiple testing and covarying for age, sex and IQ, is remarkable considering the relatively small sample size of this cohort and the variation in the protocol sequence of the two groups.
- hERG channels are heterodimers of various hERG components and the combinations of full length and 3.1 isoform channels may be critical for understanding the action in brain of varying effects of KCNH2 active drugs.
- antipsychotic effect of drugs is selectively related to their modulation of channels containing 3.1 isoforms, then drugs that impact only 3.1 -lacking hERG channels might not be antipsychotic.
- KCNH2 genotype and antipsychotic drug response might also be considered. Since hERGl channels are expressed on DA neurons, it is conceivable that their relationship to antipsychotic drug action is via an indirect mechanism related to the firing characteristics of these neurons. If DA neurons are overactive in psychotic patients, as is implicated from in vivo imaging studies (Laruelle M, Abi-Dargham A, Gil R, Kegeles L, Innis R. Increased dopamine transmission in schizophrenia: Relationship to illness phases. Biological Psychiatry. Jul 1999;46(l):56-72; Abi-Dargham A, Gil R, Krystal J, et al.
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Wood Science & Technology (AREA)
- Analytical Chemistry (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Pathology (AREA)
- Immunology (AREA)
- Microbiology (AREA)
- Molecular Biology (AREA)
- Biotechnology (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Abstract
The invention is related to a novel primate specific brain isoform of the potassium channel KCNH2 and genetic association with risk for schizophrenia and response to therapy.
Description
SCHIZOPHRENIA-RELATED ISOFORM OF KCNH2 AND DEVELOPMENT OF
ANTIPSYCHOTIC DRUGS
FIELD OF THE INVENTION
The invention is related to a novel primate specific brain isoform of the potassium channel KCNH2 and genetic association with risk for schizophrenia.
DESCRIPTION OF THE RELATED ART
A major challenge in modern medicine is to understand cellular and molecular mechanisms underlying common mental illnesses such as schizophrenia, which involve complex genetic and environmental determinants. Recent evidence indicates that multiple genes, each accounting for relatively small effects across populations, contribute to risk for schizophrenia (P. J. Harrison and D. R. Weinberger 2005 Mol Psychiatry 10:40). Prevailing etiological hypotheses maintain that the interaction of such genetic factors with each other and the environment results in neurodevelopmental abnormalities predisposing to the illness later in life (D. A. Lewis and P. Levitt 2002 Annu Rev Neurosci 25:409). Given this complexity, together with likely genetic and allelic heterogeneity, epistatic effects, undetected population stratification, and imprecise and differing definitions of phenotype, it is not surprising that statistical association studies to identify putative risk genes for schizophrenia have not enjoyed unanimous replication. In light of these difficulties in the statistical evidence for causative genes, it has been argued that the end game in gene identification for complex polygenic disorders, such as schizophrenia, will require demonstration that risk variants impact on the biology of the gene in a manner that converges on important aspects of the biology of the illness ( . M. Weiss and J. D. Terwilliger 2000 Nat Genet. 26: 151). This has led to efforts to study the effects of potential schizophrenia
susceptibility genes on intermediate biologic phenotypes relevant to schizophrenia (A. Meyer- Lindenberg and D. R. Weinberger 2006 Nat Rev Neurosci 7:818; M. F. Egan et al. 2004 Proc Natl Acad Sci USA 101 : 12604).
Among the most promising intermediate phenotypes are prefrontal cortex (PFC) mediated executive functions, and hippocampal formation (HF) mediated memory functions, both of which are impaired in patients with schizophrenia and in their healthy relatives (D. R. Weinberger 1999 Biol Psychiatry 45:395). Biological abnormalities in hippocampal and prefrontal cortices also are frequently reported in patients with schizophrenia and are also found
with increased frequency in their healthy relatives, suggesting that they are heritable traits related to susceptibility genes. For example, schizophrenia patients and their healthy relatives show reductions in HF volumes (L. J. Seidman et al. 2003 Schizophr Bull 29:803; M. D. Nelson et al. 1998 Arch Gen Psychiatry 55:433), and in levels of N-acetylaspartate (NAA) (R. G. Steen et al. 2005 Neuropsychopharmacology 30: 1949), a measure of neuronal activity and synaptic abundance, possibly related to diminished neuropil observed on postmortem examination (P. J. Harrison 1999 Brain 122:593). Various physiologic investigations of cortical activity in patients with schizophrenia and in their healthy relatives reveal disorganized activation in HF and PFC (J. H. Callicott et al. 2003 Am J Psychiatry 160:709; C. S. Carter 2006 Biol Psychiatry 60: 1169; G. Winterer et al. 2004 Am J Psychiatry 161 :490; E. Bramon et al. 2004 Schizophr Res 70:315; S. Frangou et al. 1997 Schizophr Res 23:45; R. Freedman et al. 1991 Schizophr Res 4:233; S.
Heckers et al. 1998 Nat Neurosci 1 :318; A. M. Achim and M. Lepage 2005 Br J Psychiatry 187:500; D. Ongur et al. 2006 Arch Gen Psychiatry 63 :356). Studies in non-human primates and in other animal models indicate that abnormal activation and disorganized, high-frequency discharges in cortical networks may underlie impaired memory performance (P. S. Goldman- Rakic 1995 Neuron 14:477). However, the molecular and genetic factors that contribute to abnormal neuronal activity associated with schizophrenia have so far not been identified.
SUMMARY OF THE INVENTION
The invention is related to a novel primate specific brain isoform of the voltage-gated potassium channel KCNH2 and genetic association with risk for schizophrenia, and to related nucleic acid molecules, polypeptides, antibodies, screening assays, and diagnostics.
Some embodiments concern an isolated nucleic acid molecule comprising a
polynucleotide sequence that is at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to a nucleotide sequence encoding a polypeptide comprising the amino acid sequence of SEQ ID NO:5. More embodiments concern the isolated nucleic acid molecule above, wherein the first amino acid of said polypeptide is replaced with M S S H S A (SEQ ID NO: 16) or M F S H S T (SEQ ID NO: 17). Still more embodiments concern the nucleic acid molecule above comprising a polynucleotide sequence that is at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the cDNA having SEQ ID NO:3.
In desirable embodiments, the isolated nucleic acid molecule above is a nucleic acid that encodes the amino acid sequence of SEQ ID NO: 5. In some embodiments, the isolated nucleic acid molecule above is a nucleic acid that encodes the polypeptide of SEQ ID NO: 5, wherein the first amino acid of said polypeptide is replaced with M S S H S A (SEQ ID NO: 16) or M F S H S T (SEQ ID NO: 17). Still more embodiments concern an isolated nucleic acid molecule that hybridizes under stringent hybridization conditions to the nucleic acid molecule above, wherein said nucleic acid molecule that hybridizes does not hybridize under stringent hybridization conditions to a nucleic acid molecule having a nucleotide sequence consisting of only A residues or of only T residues.
More embodiments concern an isolated polypeptide comprising an amino acid sequence that is at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to a polypeptide comprising the amino acid sequence of SEQ ID NO: 5. In some aspects, the isolated polypeptide above is modified in that the first amino acid of said polypeptide is replaced with M S S H S A (SEQ ID NO: 16) or M F S H S T (SEQ ID NO: 17). In more embodiments, said polypeptide comprises the amino acid sequence of SEQ ID NO: 5 and, in yet more embodiments, the isolated polypeptide above is modified such that the first amino acid of said polypeptide is replaced with M S S H S A (SEQ ID NO: 16) or M F S H S T (SEQ ID NO: 17).
Some aspects of the invention also concern a method of making a recombinant vector comprising inserting any of the isolated nucleic acid molecules described above into a vector. Recombinant vectors produced by the method above and methods of making a recombinant host cell comprising introducing this vector into a host cell are also contemplated embodiments. Recombinant host cells produced by these methods are also embodiments. Additionally, some aspects of the invention concern a method of making a recombinant polypeptide comprising culturing the host cell above under conditions such that said recombinant polypeptide is expressed. An isolated antibody capable of specifically binding to any one of the polypeptides described above is also a contemplated embodiment.
More embodiments concern a method of screening for therapeutic agents useful in the treatment of a neurological disease in a human comprising contacting a test compound with any one of the polypeptides described above; and detecting binding of said test compound to said polypeptide.
Still more embodiments concern a method of screening for therapeutic agents useful in the treatment of a neurological disease in a human comprising (a) determining the activity of any one of the polypeptides described above, at a first concentration of a test compound or in the absence of said test compound, (b) determining the activity of said polypeptide at a second concentration of said test compound, and comparing the activity of said polypeptide under conditions (a) and (b) to the activity of the polypeptide in the presence of a known regulator. In some embodiments, the activity is current. Additional embodiments concern a method of screening for therapeutic agents useful in the treatment of a neurological disease in a human comprising contacting a test compound with a nucleic acid molecule comprising a
polynucleotide sequence that encodes any one of the polypeptides described above, and detecting binding of said test compound to said polynucleotide.
Further, some aspects of the invention concern a method for the preparation of a pharmaceutical composition useful for the treatment of a neurological disease in a human comprising identifying a regulator of any one of the polypeptides described above, determining whether said regulator ameliorates the symptoms of said neurological disease in a human, and combining said regulator with an acceptable pharmaceutical carrier. In some embodiments, the method above is practised, wherein said regulator is a small molecule, an R A molecule, an antisense oligonucleotide, a polypeptide, an antibody, or a ribozyme.
Still further embodiments concern a method for predicting the likelihood that an individual will have schizophrenia or will have increased symptomology associated with schizophrenia comprising obtaining a DNA sample from an individual to be assessed, and determining the nucleotide present at a single nucleotide polymorphism (SNP) selected from Marker Ml, M2, M3, M4, M5, M6, M7, M8, M9, MIO, Mi l , M12, M13, M14, M15, M16, M17, M18, M19, M20, M21 , M22, M23, M24, M25, M26, M27, M28, M29, M30, M31 , M32, M33, M34, M35, M36, M37, M38, M39, M40, M41, M42, or M43, wherein the presence of a nucleotide from the risk allele at the SNP indicates that the individual has a greater likelihood of having schizophrenia, or a likelihood of having increased symptomology associated with schizophrenia, than an individual having a nucleotide from the protective allele at that SNP.
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1. Membrane-spanning topology of HERG K+ Channels.
Figure 2. Sequence alignment of the eag domains of KCNH2 (top, SEQ ID NO: 6) and Photoactive Yellow Protein (bottom, SEQ ID NO: 7).
Figure 3. Protein and cDNA sequences for KCNH2-1A and Isoform 3.1 in human. KCNH2-1 A protein (SEQ ID NO: 2), KCNH2-1 A cDNA (SEQ ID NO: 1); Isoform 3.1 protein (SEQ ID NO: 4), Isoform 3.1 cDNA (SEQ ID NO: 3). HERG Δ2-102 is defined as a protein lacking amino acids 2-102 of HERG (SEQ ID NO: 2), thus making it SEQ ID NO: 5.
Figure 4. General Domain Layouts of KCNH2 and Novel Isoform 3.1.
Figure 5: Genetic association of 7q36.1 with risk for schizophrenia.
Figure 6: Association of risk SNPs with (A) cognitive measures, (B) brain structure volumes, and (C) regional brain activity during memory-based tasks.
Figure 7: (A) Regional gene expression and (B) association with risk genotype.
Figure 8: Detection and quantification of Isoform 3.1 mRNA and protein. (A) Tissue- specific PCR; (B) Tissue-specific QPCR; (C) Protein Expression; and (D) Transfection and Cellular localization.
Figure 9. Characterization of KCNH2 currents in HEK293T cells expressing KCNH2-1A and Isoform 3.1. (A) Diagram of domain structures; (B) Currents evoked by voltage steps; (C) Effects on tail currents; (D) Activation curves; (E) Tail currents evoked by voltage steps; and F) Deactivation time constants.
Figure 10. Effect of Isoform 3.1 on KCNH2 currents and firing patterns in cortical neurons. (A) Tail currents in GFP-transfected neurons; (B) Tail currents in Isoform 3.1- transfected neurons; (C) Deactivation time constants; (D) Action potential discharge; (E) Spike frequencies; and F) Effect of Isoform 3.1 on spike frequency adaptation.
Figure 11. Physical map of SNPs, transcripts, QPCR assays, PCR primers, and re- sequenced regions.
Figure 12. Single-marker and 3 -marker sliding- window results for (A) CBDB, (B) NIMHGI-C, (C) NIMHGI-AA, and (D) German DNA collections.
Figure 13. Pedigrees of 8 families with rare SNP M25 and association tables excluding these families.
Figure 14. Genotype based differences in right hippocampal gray matter volume (MNI coordinates: 26, -12, -22 mm) for SNP M30, derived using optimized VBM. A) Plot of gray matter volumes, B) Thresholded statistical t-maps.
Figure 15. Genotype based differences in right hippocampal gray matter volume (MNI coordinates: 26, -9, -24 mm) for SNP M31, derived using optimized VBM. A) Plot of gray matter volumes, B) Thresholded statistical t-maps.
Figure 16. Genotype based differences in right hippocampal gray matter volume (MNI coordinates: 26, -9, -24 mm) for SNP M33, derived using optimized VBM. A) Plot of gray matter volumes, B) Thresholded statistical t-maps.
Figure 17. Genotype based differences in hippocampal engagement during a declarative memory task for SNP M31. A) Percent blood oxygen level-dependent (BOLD) signal change during the encoding condition of the task in the left posterior hippocampus. B) Thresholded statistical t-maps.
Figure 18. Genotype based differences in hippocampal engagement during a declarative memory task for SNP M33. A) Percent blood oxygen level-dependent (BOLD) signal change during the encoding condition of the task in the left posterior hippocampus. B) Thresholded statistical t-maps.
Figure 19. NOS3 and KCNH2-1A expression in frontal cortex of neuroleptic treated rats.
Figure 20. Tissue differences in Isoform 3.1 and KCNH2-1A using PCR and QPCR. Figure 21. Alignment and conservation of Isoform 3.1 5'-UTR sequence in primate and non-primate species. (A) DNA Sequence alignment of upstream region of exon 3. Human, (SEQ ID NO: 8); Rhesus, (SEQ ID NO: 9); Mouse, (SEQ ID NO: 10); Rat, (SEQ ID NO: 1 1). (B) Predicted longest ORF upstream of hERG-la Exon 3. Human, (SEQ ID NO: 12); Rhesus, (SEQ ID NO: 13); Mouse, (SEQ ID NO: 14); Rat, (SEQ ID NO: 15).
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENT
Definitions
Unless defined otherwise, technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. See, e.g., Singleton P and Sainsbury D., in Dictionary of Microbiology and Molecular Biology 3rd ed., J. Wiley & Sons, Chichester, New York, 2001.
The transitional term "comprising" is synonymous with "including," "containing," or "characterized by," is inclusive or open-ended and does not exclude additional, unrecited elements or method steps.
The transitional phrase "consisting of excludes any element, step, or ingredient not specified in the claim, but does not exclude additional components or steps that are unrelated to the invention such as impurities ordinarily associated therewith.
The transitional phrase "consisting essentially of limits the scope of a claim to the specified materials or steps and those that do not materially affect the basic and novel characteristic(s) of the claimed invention.
Overview
As described herein, we report an extensive series of basic and clinical experiments leading to the discovery and characterization of a novel isoform of the voltage-gated potassium channel KCNH2, whose expression in human brain is markedly increased in schizophrenia, significantly correlated with schizophrenia-risk single nucleotide polymorphisms (SNPs), and whose expression in cell culture dramatically alters neuronal excitability.
An ultimate goal of modern medicine is to understand the basic mechanisms underlying common and complex human diseases, such as diabetes and mental illness. Conventional genetic linkage and association studies have been less than conclusive because these diseases involve multiple genes, and each gene elicits relatively small effects across populations. Moreover, because of the complexity of genetic factors and their interaction with the environment, it is often difficult to link genetic findings to important biological or mechanistic aspects of the illness. To overcome these obstacles, we have taken a powerful translational approach that dissects the complex phenomenology of schizophrenia into neural system and molecular components and maps genetic association onto these multiple levels of analysis. Using this approach in the present study, we identify a new class of schizophrenia susceptibility gene, the KCNH2 potassium channel, but more importantly, a novel isoform of this type of voltage-gated potassium channel that is primate and brain specific and increased 2.5 fold in schizophrenia. In addition, we characterize the electrophysiological properties of this novel isoform of KCNH2 and reveal that elevated expression in neurons leads to disorganized neuronal activation patterns, a physiological correlate of schizophrenia. These convergent findings provide dramatic new insights into the molecular mechanisms underlying schizophrenia and related disorders.
The main findings and the potential impact of the study are as follows. First, based on differential gene expression data from schizophrenic brain tissues, we identified a region on 7q36 containing KCNH2, where SNPs within a 3kb intronic region are significantly associated with schizophrenia. More importantly, we were able to replicate this genetic association in four independent clinical samples, including one of African- American origin, which suggests that this gene impacts on risk for schizophrenia throughout the world, albeit to varying degrees. The consistency of our genetic association study strongly implicates KCNH2 as a risk gene for schizophrenia.
Second, we have shown, in an independent set of healthy control individuals, significant association of the risk SNPs with schizophrenia-like shifts in several of the most consistently reported intermediate biologic phenotypes: impairments in memory and IQ/cognitive processing speed, reduced hippocampal volumes as measured by MRI, and inefficient physiological engagement of the hippocampus during memory tasks as measured by fJVlRI. These independent associations with variations in brain structure and function provide further links between the gene and well-established cognitive functions and neurobiological phenomena relevant to schizophrenia.
Third, we have extended the study beyond the clinic to elucidate the basic mechanisms that may underlie the genetic associations with KCNH2. We started with characterizing the expression of KCNH2 mRNA in postmortem human brain. Unexpectedly, we identified a novel isoform (3.1 ) of KCNH2 that is primate specific and highly abundant within the brain. Unlike the classic KCNH2-1A form, this novel Isoform 3.1 shows trace expression in heart. Remarkably, expression of this isoform is significantly increased within the hippocampus of patients with schizophrenia (2.5 fold increase relative to the full length form) and even in normal individuals who carry risk alleles. Thus, genetic association appears to relate to this novel isoform
specifically, relating largely to regulation of its expression. In addition, structural analysis reveals that the novel isoform lacks the major part of the PAS domain, which is known to be critical for the characteristic slow deactivation of KCNH2. We then overexpressed this novel isoform in rodent pyramidal neurons and found that it produced a rapidly deactivating K+ current and a high-frequency, non-adapting firing pattern. These results have important implications for normal higher order cognition and also for disordered cognition seen in schizophrenia. As a sustained, non-adapting discharge pattern has been considered to be important for cortical
information processing underlying higher-order cognitive and memory tasks in primates, normal physiological levels of the 3.1 Isoform may be an important evolutional development in primates to support this pattern of neuronal activity. However, elevated expression of this isoform, as is found in schizophrenia, might cause uncontrolled and desynchronized firings in cortical circuits, thus leading to anomalies in performance in complex cognitive functions seen in schizophrenia patients and even in normal subjects carrying risk alleles and abnormal patterns of cortical physiological activity. Indeed, disorganized physiologic activity is a hallmark of recent neurophysiologic studies of patients with schizophrenia.
Taken together, these convergent findings provide compelling evidence to implicate a novel KCNH2 isoform as playing a role in the etiology and pathophysiology of schizophrenia. Given that many available antipsychotic drugs also bind to KCNH2-1A (reference Kongsamut et al., Eur J Pharmacol. 2002 Aug 16;450(1):37-41), accounting for their cardiac side effects, and that Isoform 3.1 is relatively brain specific and plays a major role in controlling neuronal firing, our results also point to a promising new therapeutic target that could spare the cardiac side effects typically associated with other antipsychotic agents.
Description of HERG and PAS Domain
HERG (human eag-related gene) is a member of the eag (ether-a-go.go) K+ channel family (Warmke, J. W. et al. 1991 Science 252: 1560-1562; Warmke, J.W. and Ganetzky, B 1994 Proc Natl Acad Sci USA 91 :3438-3442). These channels, found in human heart and nervous system, underlie one form of the long QT syndrome, LQT2 (Curran, M.E. et al. 1995 Cell 80:795-803), a genetic condition causing familial cardiac arrhythmia and sudden death. In common with other voltage-dependent K+ channels, HERG has a subunit topology of six membrane-spanning stretches (Fig. 1). Four of these subunits form a tetramer with a central ion conduction pore. Voltage-dependent gating, or opening and closing of the pore, is conferred by the S4 "voltage sensor" (the arginine-rich fourth membrane-spanning stretch) present in all members of the voltage-dependent cation channel family (Sigworth, FJ. 1994 Rev Biophys 27: 1 - 40).
Referring to Fig. 1 , the HERG channel monomer has six transmembrane segments labeled SI to S6; S4 is the voltage sensor, and it contains six positively charged amino acids as indicated by the + symbols. The channel has a large C terminus and the characteristic N-terminal
eag domain, both cytosolic; the pore region is situated between S5 and S6. The functional channel is a tetramer with a central ion conduction pathway.
HERG exhibits two distinct and physiologically significant gating characteristics: rapid inactivation and slow deactivation (Trudeau, M. C. et al. 1995 Science 269:92-95; Smith, et al. 1996 Nature 379:833-836; Spector, P.S. et al. 1996 J Gen Physiol 107:611 -619). The presence of rapid inactivation means that when the channel is opened with cell membrane depolarization it very quickly enters a nonconducting (inactivated) state, passing very little current in the outward direction. When the membrane is returned to its normal resting potential near -80 mV, the channel apparently retraces its conformational steps and passes through the open state on the way back to its closed configuration. The return to the closed state, referred to as the process of deactivation, is very slow in the HERG channel, and consequently a large inward "tail" K+ current is observed during a voltage clamp experiment. This slow rate of HERG channel deactivation plays an important role in cardiac electrical excitability by governing the length of the action potential (Sanguinetti. M.C. et al. 1995 Cell 81 :299-307).
Deletion of the HERG cytoplasmic amino terminus has been shown to profoundly affect the rate of deactivation (Sch5nherr, R. and Heinemann, S.H. 1996 J Physiol 493:635-642;
Spector, P.S. et al., 1996 J Gen Physiol 107:61 1-619; Terlau et al. 1997 J Physiol 502:537-543). This finding is very interesting because the amino terminus of HERG contains a sequence of about 135 amino acids, which is not only highly conserved, but is sufficiently unique to be considered a defining feature of the eag K+ channel family (Warmke, J. W. and Ganetzky, B. 1994 Proc Natl Acad Sci USA 91 :3438-3442). The eag domain controls deactivation by tightly associating with the body of the K+ channel, presumably through a hydrophobic patch on its surface. Its three-dimensional structure defines the first eukaryotic member of the PAS domain family. PAS (acronym for the gene products of Per, Arnt, and Sim) (Reppert, S.M. 1998 Cell 21 : 1-4; Sassone-Corsi, P. 1998 Nature 392:871-874) domains are found in proteins involved in the circadian rhythm, the cyclic patterns of hormone secretion, breeding, and locomotor activity in mammals and the oscillation of photosynthesis in plants. In prokaryotic cells, PAS domains regulate a variety of biochemical processes by serving as light and chemical sensors.
Referring to Fig. 2, the eag domains of KCNH2 (top) and Photoactive Yellow Protein (PYP) (bottom) are aligned according to superimposed structural models. It is clear that the eag domain and PYP have highly similar three-dimensional structures. The dashed boxes mark stretches of
sequence where aligned residues occupy the same position in secondary structural elements that are common to both structures. Secondary structural elements are marked above and below the corresponding sequences: a helices as arrows, β strands as filled rectangles, 3io helix as open rectangle. The structural elements of the eag domain structure are labeled. The solid box marks residues that are disordered in the eag domain structure. Residue numbering is shown above and below the respective sequences. The eag domain is an α + β protein with a five-stranded antiparallel β sheet (βΑ to βΕ) packed against a long ordered "vine" composed of coil and a single turn of 3io helix (a'A). The sheet is decorated on two sides by a helices (aA to aC). The structure has its N and C termini positioned side by side forming two central strands of the β sheet.
The major difference between the two proteins occurs in the way the aC helix and associated "vine" pack against the β sheet. A structure-based sequence alignment of the eag domain and PYP shows that there is no significant sequence conservation. The relatedness of these proteins is apparent only through comparison of their three-dimensional structures.
HERG and other members of the eag K+ channel family contain a PAS domain on their cytoplasmic N terminus. Cabral et al. 1998 (Cabral et al. 1998 Cell 95:649-655) artificially created an N-terminally truncated protein (HERG Δ2-135) lacking amino acids 2-135 of HERG.
The investigators determined that removal of the PAS domain alters a physiologically important gating transition in HERG, and addition of isolated domain to the cytoplasm of cells expressing truncated HERG reconstitutes wild-type gating. In summary, Cabral et al. 1998 concluded that the eag domain is a member of the PAS domain family and its role is to modify K+ channel gating.
Nucleic Acid Molecules
The cDNA sequence (SEQ ID NO: 1) and deduced amino acid sequence (SEQ ID NO:2) of KCNH2 are shown in Fig. 3; the general domain layouts are illustrated in Fig. 4. The cDNA sequence (SEQ ID NO:3) and deduced amino acid sequence (SEQ ID NO:4) of Isoform 3.1 are shown in Fig. 3; the general domain layouts are illustrated in Fig. 4.
The present invention provides isolated nucleic acid molecules comprising
polynucleotide sequences that have been identified as encoding isoform 3.1 , here defined as HERG Δ2-102. HERG Δ2-102 means an N-terminally truncated polypeptide lacking amino acids 2-102 of HERG (SEQ ID NO: 2) thus missing much of the PAS domain but retaining secondary
structural elements βϋ and βΕ sheets and making it SEQ ID NO: 5, and, in some embodiments, replacing the first amino acid with 6 amino acids unique to the isoform in humans (M S S H S A; SEQ ID NO: 16), in monkeys (M F S H S T; SEQ ID NO: 17), or in other species. The invention further provides a nucleotide sequence determined from a mRNA molecule encoding isoform 3.1 , which comprises the cDNA encoding isoform 3.1, including the 1.1 Kb 5' untranslated region unique to isoform 3.1 (SEQ ID NO:3).
SEQ ID NO: 5
MGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEKDMVGSPAHDTNHRGPPTSWL APGRAKTFRLKLPALLALTAPVESSVRSGGAGGAGAPGAVVVDVDLTPAAPSSESLA LDEVTAMDNHVAGLGPAEERRALVGPGSPPRSAPGQLPSPRAHSLNPDASGSSCSL ARTRSRESCASVRRASSADDIEAMRAGVLPPPPRHASTGAMHPLRSGLLNSTSDSD LVRYRTISKIPQITLNFVDLKGDPFLASPTSDREIIAPKIKERTHNVTEKVTQVLSLGA DVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLKETEEGPP ATECGYACQPLAVVDLIVDIMFIVDILINFRTTYVN ANEEVVSHPGRIAVHYFKG WFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLL MCTFALIAHWLACIWYAIGNMEQPHMDSRIGWLHNLGDQIGKP YNSSGLGGPSIKD KYVTAL YFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVSAIIQRLYS GTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECL QADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTAL YFISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDD LLEVLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSTELEGGFSRQRKRKLSFRRR TDKDTEQPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSSS PLRLVPFSSPRPPGEPPGGEPLMEDCEKSSDTCNPLSGAFSGVSNIFSFWGDSRGRQ YQELPRCPAPTPSLLNIPLSSPGRRPRGDVESRLDALQRQLNRLETRLSADMATVLQ LLQRQMTLVPPAYSAVTTPGPGPTSTSPLLPVSPLPTLTLDSLSQVSQFMACEELPPG APELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS
The term "isolated" means that the material is removed from its original environment (e.g., the natural environment if it is naturally occurring). For example, a naturally-occurring nucleic acid molecule or polynucleotide present in a living organism is not isolated, but the same nucleic acid molecule or polynucleotide, separated from some or all of the coexisting materials in the natural environment, is isolated. Such nucleic acid molecule could be part of a vector
and/or such polynucleotide could be part of a composition, and still be isolated in that such vector or composition is not part of the natural environment of the nucleic acid molecule or polynucleotide.
By "nucleotide sequence" of a nucleic acid molecule or polynucleotide is intended, for a DNA molecule or polynucleotide, a sequence of deoxyribonucleotides, and for an RNA molecule or polynucleotide, the corresponding sequence of ribonucleotides (A, G, C and U), where each thymidine deoxyribonucleotide (T) in the specified deoxyribonucleotide sequence is replaced by the ribonucleotide uridine (U).
Using the information provided herein, such as a nucleotide sequence shown in the sequence listing, a nucleic acid molecule of the present invention encoding a polypeptide may be obtained using standard cloning and screening procedures, such as those for cloning cDNAs using mRNA as starting material. See, for example, Molecular Cloning: a Laboratory Manual, 3rd edition, Sambrook et al. 2001 Cold Spring Harbor Laboratory Press, New York and Current Protocols in Molecular Biology, Ausubel et al. eds., John Wiley & Sons, 1994.
Nucleic acid molecules of the present invention may be in the form of RNA, such as mRNA, or in the form of DNA, including, for instance, cDNA and genomic DNA obtained by cloning or produced synthetically. The DNA may be double-stranded or single-stranded. Single- stranded DNA or RNA may be the coding strand, also known as the sense strand, or it may be the non-coding strand, also referred to as the anti-sense strand.
In addition to nucleic acid molecules encoding isoform 3.1 , isolated nucleic acid molecules of the invention include DNA molecules that comprise a sequence substantially different from those described above but that, due to the degeneracy of the genetic code, still encode the proteins shown in the sequence listing. Of course, the genetic code and species- specific codon preferences are well known in the art. Thus, it would be routine for one skilled in the art to generate the degenerate variants described above, for instance, to optimize codon expression for a particular host (e.g., change codons in the human mRNA to those preferred by a bacterial host such as E. coli).
The invention further provides a nucleic acid molecule having a sequence complementary to one of the above sequences. Such isolated molecules, particularly DNA molecules, are useful as probes for gene mapping, by in situ hybridization with chromosomes, and for detecting expression of the corresponding gene(s) in human tissue, for instance, by Northern blot analysis.
The present invention is further directed to nucleic acid molecules encoding portions of the nucleotide sequences described herein as-well as to fragments of the isolated nucleic acid molecules described herein. By a "fragment" of an isolated nucleic acid molecule is intended fragments at least about 15 nt, and more preferably at least about 20 nt, still more preferably at least about 30 nt, and even more preferably, at least about 40 nt in length that are useful as diagnostic probes and primers. Of course, larger fragments 50-500 nt in length are also useful according to the present invention as are fragments corresponding to most, if not all, of the nucleic acid molecules encoding isoform 3.1. By a fragment "at least 20 nt in length," for example, is intended fragments that include 20 or more contiguous bases from the nucleic acid molecules encoding isoform 3.1. Some nucleic acid fragments of the present invention include the 1.1 Kb 5' untranslated region unique to isoform 3.1.
In another aspect, the invention provides an isolated nucleic acid molecule comprising a polynucleotide that hybridizes under stringent hybridization conditions to a portion of a nucleic acid molecule of the invention described above. By "stringent hybridization conditions" is intended overnight incubation at 42°C in a solution comprising: 50% formamide, 5x SSC (750 mM NaCl, 75 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5x Denhardt's solution, 10%) dextran sulfate, and 20 μg/ml denatured, sheared salmon sperm DNA, followed by washing the filters in O.lx SSC at about 650C.
By a polynucleotide that hybridizes to a "portion" of a polynucleotide is intended a polynucleotide (either DNA or RNA) hybridizing to at least about 15 nucleotides (nt), and more preferably at least about 20 nt, still more preferably at least about 30 nt, and even more preferably about 30-70 (e.g., 50) nt, or 50-500 nts in length or fragments corresponding to most, if not all, of the reference polynucleotide.
By a portion of a polynucleotide of "at least 20 nt in length," for example, is intended 20 or more contiguous nucleotides from the nucleotide sequence of the reference polynucleotide. Of course, a polynucleotide that hybridizes only to a poly A sequence (such as any 3' terminal poly(A) tract of a cDNA), or to a complementary stretch of T (or U) residues, would not be included in a polynucleotide of the invention used to hybridize to a portion of a nucleic acid of the invention, since such a polynucleotide would hybridize to any nucleic acid molecule containing a poly (A) stretch or the complement thereof (e.g., practically any double-stranded cDNA clone).
Also encoded by nucleic acids of the invention are the amino acid sequences of the invention together with additional, non-coding sequences, including for example, but not limited to introns and non-coding 5' and 3' sequences, such as the transcribed, non-translated sequences that play a role in transcription, mRNA processing, including splicing and polyadenylation signals, for example— ribosome binding and stability of mRNA; and additional coding sequence that codes for additional amino acids, such as those that provide additional functionalities.
Thus, the sequence encoding the polypeptide may be fused to a marker sequence, such as a sequence encoding a peptide that facilitates purification of the fused polypeptide. In certain preferred embodiments of this aspect of the invention, the marker amino acid sequence is a hexa- histidine peptide, such as the tag provided in a pQE vector (QIAGEN Inc., 28159 Avenue
Stanford, Valencia, California 91355), among others, many of which are commercially available. As described in Gentz et al. 1989 Proc Natl Acad USA 86:821- 824, for instance, hexa-histidine provides for convenient purification of the fusion protein. The "HA" tag is another peptide useful for purification that corresponds to an epitope derived from the influenza hemagglutinin protein, which has been described by Wilson et al. 1984 Cell 37:767-778.
Variant and Mutant Polynucleotides
The present invention further relates to variants of the nucleic acid molecules of the i 0 present invention, which encode portions, analogs or derivatives of the isoform. Variants may occur naturally, such as a natural allelic variant. By an "allelic variant" is intended one of several alternate forms of a gene occupying a given locus on a chromosome of an organism. Genes II, Lewin, B., ed., John Wiley & Sons, New York (1985). Non-naturally occurring variants may be produced using art-known mutagenesis techniques.
Such variants include those produced by nucleotide substitutions, deletions or additions. The substitutions, deletions or additions may involve one or more nucleotides. The variants may be altered in coding regions, non-coding regions, or both. Alterations in the coding regions may produce conservative or non-conservative amino acid substitutions, deletions or additions.
Especially preferred among these are silent substitutions, additions and deletions, which do not alter the properties and activities of the channel protein or portions thereof. Also especially preferred in this regard are conservative substitutions.
Most highly preferred are nucleic acid molecules encoding isoform 3.1 having the amino acid sequence of SEQ ID NO: 5 and the nucleotide sequence of the cDNA having SEQ ID NO:
3. Further embodiments include an isolated nucleic acid molecule comprising a polynucleotide having a nucleotide sequence at least 85% identical, more preferably at least 90% identical, and most preferably at least 95%, 96%, 97%, 98% or 99% identical to a polynucleotide of the invention, or a polynucleotide that hybridizes under stringent hybridization conditions to such a polynucleotide. This polynucleotide that hybridizes does not hybridize under stringent hybridization conditions to a polynucleotide 0 having a nucleotide sequence consisting of only A residues or of only T residues. An additional nucleic acid embodiment of the invention relates to an isolated nucleic acid molecule comprising a polynucleotide that includes the 1.1 Kb 5' untranslated region unique to isoform 3.1.
By a polynucleotide having a nucleotide sequence at least, for example, 95% "identical" to a reference nucleotide sequence is intended that the nucleotide sequence of the polynucleotide is identical to the reference sequence except that the polynucleotide sequence may include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence encoding the reference polypeptide. In other words, to obtain a polynucleotide having a nucleotide sequence at least 95% identical to a reference nucleotide sequence, up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence may be inserted into the reference sequence. These mutations of the reference sequence may occur at the 5' or 3' terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among nucleotides in the reference sequence or in one or more contiguous groups within the reference sequence.
As a practical matter, whether any particular nucleic acid molecule is at least 85%, 90%, 95%, 96%, 97%, 98%o or 99% identical to, for instance, the nucleotide sequence encoding isoform 3.1 having the amino acid sequence of SEQ ID NO: 5 and the nucleotide sequence of the cDNA having SEQ ID NO: 3 can be determined conventionally using known computer programs such as the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, Wis. 5371 1). Bestfit uses the local homology algorithm of Smith and Waterman 1981 Advances in Applied Mathematics 2:482-489, to find the best segment of homology between two sequences. When using Bestfit or any other sequence alignment program to determine whether a particular sequence is, for instance, 95% identical to a reference sequence according to the present
invention, the parameters are set, of course, such that the percentage of identity is calculated over the full length of the reference nucleotide sequence and that gaps in homology of up to 5% of the total number of nucleotides in the reference sequence are allowed.
Vectors, Host Cells and Protein Production
The present invention also relates to vectors that include the isolated DNA molecules of the present invention, host cells that are genetically engineered with the recombinant vectors, and the production of polypeptides or fragments thereof by recombinant techniques. The vector may be, for example, a phage, plasmid, viral or retroviral vector. Retroviral vectors may be
replication competent or replication defective. In the latter case, viral propagation generally will occur only in complementing host cells.
The polynucleotides may be joined to a vector containing a selectable marker for propagation in a host. Generally, a plasmid vector is introduced in a precipitate, such as a calcium phosphate precipitate, or in a complex with a charged lipid. If the vector is a virus, it may be packaged in vitro using an appropriate packaging cell line and then transduced into host cells.
The DNA insert should be operatively linked to an appropriate promoter, such as the phage lambda PL promoter, the E. coli lac, tip, phoA and tac promoters, the SV40 early and late promoters and promoters of retroviral LTRs, to name a few. Other suitable promoters will be known to the skilled artisan. The expression constructs will further contain sites for transcription initiation, termination and, in the transcribed region, a ribosome binding site for translation. The coding portion of the transcripts expressed by the constructs will preferably include a translation initiating codon at the beginning and a termination codon (UAA, UGA or UAG) appropriately positioned at the end of the polypeptide to be translated.
As indicated, the expression vectors will preferably include at least one selectable marker. Such markers include dihydrofolate reductase, G418 or neomycin resistance for eukaryotic cell culture and tetracycline, kanamycin or ampicillin resistance genes for culturing in E. coli and other bacteria. Representative examples of appropriate hosts include, but are not limited to, bacterial cells, such as E. coli, Streptomyces and Salmonella typhimurium cells; fungal cells, such as yeast cells; insect cells such as Drosophila S2 and Spodoptera Sf9 cells; animal cells such as CHO, COS, and 293 cells; and plant cells. Appropriate culture mediums and conditions for the above-described host cells are known in the art.
Among vectors available for use in bacteria include pQE70, pQE60 and pQE-9, available from QIAGEN, Inc., supra; pBluescript vectors, Phagescript vectors, pNH8A, pNH16a, pNH18A, pNH46A, available from Stratagene Cloning Systems, Inc.; and ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5 available from Pharmacia Biotech, Inc. Among suitable eukaryotic vectors are pWLNEO, pSV2CAT, pOG44, pXTl and pSG available from Stratagene; and pSVK3, pBPV, pMSG and pSVL available from Pharmacia. Other suitable vectors will be readily apparent to the skilled artisan.
Introduction of the construct into the host cell can be effected by calcium phosphate transfection, DEAE-dextran mediated transfection, cationic lipid-mediated transfection, electroporation, transduction, infection or other methods. Such methods are described in many standard laboratory manuals, such as Davis et al., Basic Methods In Molecular Biology (1986).
The polypeptide may be expressed in a modified form, such as a fusion protein, and may include not only secretion signals, but also additional heterologous functional regions. For instance, a region of additional amino acids, particularly charged amino acids, may be added to the N-terminus of the polypeptide to improve stability and persistence in the host cell, during purification, or during subsequent handling and storage. Also, peptide moieties may be added to the polypeptide to facilitate purification. Such regions may be removed prior to final preparation of the polypeptide. The addition of peptide moieties to polypeptides to engender secretion or excretion, to improve stability and to facilitate purification, among others, are familiar and routine techniques in the art. A representative fusion protein comprises a heterologous region from immunoglobulin that is useful to stabilize and purify proteins.
A protein of this invention can be recovered and purified from recombinant cell cultures by well-known methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. Most preferably, high performance liquid chromatography ("HPLC") is employed for purification. Polypeptides of the present invention include: products purified from natural sources, including bodily fluids, tissues and cells, whether directly isolated or cultured; products of chemical synthetic procedures; and products produced by recombinant techniques from a prokaryotic or eukaryotic host, including, for example, bacterial, yeast, higher plant, insect and mammalian cells. Depending upon the host employed in a recombinant production
procedure, the polypeptides of the present invention may be glycosylated or may be non- glycosylated. In addition, polypeptides of the invention may also include an initial modified methionine residue, in some cases as a result of host-mediated processes. Thus, it is well known in the art that the N-terminal methionine encoded by the translation initiation codon generally is removed with high efficiency from any protein after translation in all eukaryotic cells. While the N-terminal methionine on most proteins also is efficiently removed in most prokaryotes, for some proteins this prokaryotic removal process is inefficient, depending on the nature of the amino acid to which the N-terminal methionine is covalently linked.
Polypeptides and Fragments
The invention further provides isolated polypeptides having an amino acid sequence encoded by isoform 3.1 nucleic acid molecules, or a peptide or polypeptide comprising a portion of the above polypeptides. At the simplest level, the amino acid sequence can be synthesized using commercially available peptide synthesizers. This is particularly useful in producing small peptides and fragments of larger polypeptides. Such fragments are useful, for example, in generating antibodies against the native polypeptide.
Variant and Mutant Polypeptides
To improve or alter the characteristics of the polypeptides of the invention, protein engineering may be employed. Recombinant DNA technology known to those skilled in the art can be used to create novel mutant proteins or "muteins" including single or multiple amino acid substitutions, deletions, additions or fusion proteins. Such modified polypeptides can show, e.g., enhanced activity or increased stability. In addition, they may be purified in higher yields and show better solubility than the corresponding natural polypeptide, at least under certain purification and storage conditions.
In addition, it also will be recognized by one of ordinary skill in the art that some amino acid sequences of a polypeptide can be varied without significant effect on the structure or function of the protein. If such differences in sequence are contemplated, it should be remembered that there will be critical areas on the protein that determine activity.
Thus, the invention further includes variants of a polypeptide that show substantial biological activity or that include regions of the protein such as the portions discussed below. Such mutants include deletions, insertions, inversions, repeats, and type substitutions selected according to general rules known in the art so as have little effect on activity. For example,
guidance concerning how to make phenotypically silent amino acid substitutions is provided in Bowie, J. U. et al., 1990 Science 247: 1306-1310, wherein the authors indicate that there are two main approaches for studying the tolerance of an amino acid sequence to change. The first method relies on the process of evolution, in which mutations are either accepted or rejected by natural selection. The second approach uses genetic engineering to introduce amino acid changes at specific positions of a cloned gene and selections or screens to identify sequences that maintain functionality.
As the authors state, these studies have revealed that proteins are surprisingly tolerant of amino acid substitutions. The authors further indicate which amino acid changes are likely to be permissive at a certain position of the protein. For example, most buried amino acid residues require nonpolar side chains, whereas few features of surface side chains are generally conserved. Other such phenotypically silent substitutions are described in Bowie, J. U. et al., supra, and the references cited therein. Typically seen as conservative substitutions are the replacements, one for another, among the aliphatic amino acids Ala, Val, Leu and He;
interchange of the hydroxyl residues Ser and Thr, exchange of the acidic residues Asp and GIu, substitution between the amide residues Asn and Gin, exchange of the basic residues Lys and Arg and replacements among the aromatic residues Phe, Tyr.
Thus, the fragment, derivative or analog of a polypeptide of the invention may be (i) one in which one or more of the amino acid residues are substituted with a conserved or non- conserved amino acid residue (preferably a conserved amino acid residue) and such substituted amino acid residue may or may not be one encoded by the genetic code, or (ii) one in which one or more of the amino acid residues includes a substituent group, or (iii) one in which the mature polypeptide is fused with another compound, such as a compound to increase the half-life of the polypeptide (for example, polyethylene glycol), or (iv) one in which the additional amino acids are fused to the above form of the polypeptide, such as an IgG Fc fusion region peptide or leader or secretory sequence or a sequence that is employed for purification of the above form of the polypeptide or a proprotein sequence. Such fragments, derivatives and analogs are deemed to be within the scope of those skilled in the art from the teachings herein.
Thus, the polypeptides of the present invention may include one or more amino acid substitutions, deletions or additions, either from natural mutations or human manipulation. As indicated, changes are preferably of a minor nature, such as conservative amino acid
substitutions that do not significantly affect the folding or activity of the protein (refer to Table !)■
Table 1. Conservative Amino Acid Substitutions
Amino acids in the protein of the present invention that are essential for function can be identified by methods known in the art, such as site-directed mutagenesis or alanine-scanning mutagenesis (Cunningham and Wells 1989 Science 244: 1081-1085). The latter procedure introduces single alanine mutations at every residue in the molecule. The resulting mutant molecules are then tested for biological activity such as binding characteristics or in vitro or in vivo channel activity.
The polypeptides of the present invention are preferably provided in an isolated form. A recombinantly produced version of a polypeptide of the invention can be substantially purified by the one-step method described in Smith and Johnson, 1988 Gene 67:31-40. Polypeptides of the invention also can be purified from natural or recombinant sources using antibodies of the invention raised against the protein in methods that are well known in the art of protein purification.
Further polypeptides of the present invention include polypeptides that have at least 90% similarity, more preferably at least 95% similarity, and still more preferably at least 96%>, 97%», 98%o or 99% similarity to those described above. The polypeptides of the invention also comprise
those that are at least 85% identical, more preferably at least 90% or 95% identical, still more preferably at least 96%, 97%, 98% or 99% identical to the polypeptide encoded by isoform 3.1 nucleic acid molecules, and also include portions of such polypeptides with at least 30 amino acids and more preferably at least 50 amino acids.
By "% similarity" for two polypeptides is intended a similarity score produced by comparing the amino acid sequences of the two polypeptides using the Bestfit program
(Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, Wis. 53711) and the default settings for determining similarity. Bestfit uses the local homology algorithm of Smith and Waterman 1981 Advances in Applied Mathematics 2:482-489, to find the best segment of similarity between two sequences.
By a polypeptide having an amino acid sequence at least, for example, 95% "identical" to a reference amino acid sequence of a polypeptide described herein is intended that the amino acid sequence of the polypeptide is identical to the reference sequence except that the polypeptide sequence may include up to five amino acid alterations per each 100 amino acids of the reference amino acid of the polypeptide of the invention. In other words, to obtain a polypeptide having an amino acid sequence at least 95% identical to a reference amino acid sequence, up to 5% of the amino acid residues in the reference sequence may be deleted or substituted with another amino acid, or a number of amino acids up to 5% of the total amino acid residues in the reference sequence may be inserted into the reference sequence. These alterations of the reference sequence may occur at the amino or carboxy terminal positions of the reference amino acid sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence or in one or more contiguous groups within the reference sequence.
As a practical matter, whether any particular polypeptide is at least 90%, 95%, 96%,
97%o, 98% or 99% identical to, for instance, an amino acid sequence encoded by the isoform 3.1 nucleic acid molecules can be determined conventionally using known computer programs such the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, Wis. 5371 1). When using Bestfit or any other sequence alignment program to determine whether a particular sequence is, for instance, 95% identical to a reference sequence according to the present
invention, the parameters are set, of course, such that the percentage of identity is calculated over the full length of the reference amino acid sequence and that gaps in homology of up to 5% of the total number of amino acid residues in the reference sequence are allowed.
Antibodies
"Antibody" as used herein includes intact immunoglobulin molecules, as well as fragments thereof, such as Fab, F(ab')2, and Fv, which are capable of binding an epitope of isoform 3.1. Typically, at least 6, 8, 10, or 12 contiguous amino acids are required to form an epitope. However, epitopes that involve non-contiguous amino acids may require more, e.g., at least 15, 25, or 50 amino acid. An antibody that specifically binds to an epitope of isoform 3.1 can be used therapeutically, as well as in immunochemical assays, such as Western blots, ELISAs, radio immunoassays, immunohistochemical assays, immunoprecipitations, or other immunochemical assays known in the art. Various immunoassays can be used to identify antibodies having the desired specificity. Numerous protocols for competitive binding or immunoradiometric assays are well known in the art. Such immunoassays typically involve the measurement of complex formation between an immunogen and an antibody that specifically binds to the isoform 3.1 immunogen.
Typically, an antibody that specifically binds to isoform 3.1 provides a detection signal at least 5-, 10-, or 20-fold higher than a detection signal provided with other proteins when used in an immunochemical assay. Preferably, antibodies that specifically bind to isoform 3.1 do not detect other proteins, especially KCNH2, in immunochemical assays and can immunoprecipitate isoform 3.1 from solution.
Isoform 3.1 can be used to immunize a mammal, such as a mouse, rat or rabbit to produce polyclonal antibodies. If desired, isoform 3.1 can be conjugated to a carrier protein, such as bovine serum albumin, thyroglobulin, and keyhole limpet hemocyanin. Depending on the host species, various adjuvants can be used to increase the immunological response. Such adjuvants include, but are not limited to, Freund's adjuvant, mineral gels (e.g., aluminum hydroxide), and surface active substances (e.g., lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, and dinitrophenol). Among adjuvants used in humans, BCG (bacilli Calmette-Guerin) and Corynebacterium parvum are especially useful.
Monoclonal antibodies that specifically bind to isoform 3.1 can be prepared using any technique that provides for the production of antibody molecules by continuous cell lines in
culture. These techniques include, but are not limited to, the hybridoma technique, the human B- cell hybridoma technique, and the EBV-hybridoma technique.
In addition, techniques developed for the production of "chimeric antibodies", the splicing of mouse antibody genes to human antibody genes to obtain a molecule with appropriate antigen specificity and biological activity, can be used. Monoclonal and other antibodies also can be "humanized" to prevent a patient from mounting an immune response against the antibody when it is used therapeutically. Such antibodies may be sufficiently similar in sequence to human antibodies to be used directly in therapy or may require alteration of a few key residues.
Sequence differences between rodent antibodies and human sequences can be minimized by replacing residues that differ from those in the human sequences by site directed mutagenesis of individual residues or by grafting of entire complementarily determining regions. Antibodies that specifically bind to isoform 3.1 can contain antigen binding sites that are either partially or fully humanized.
Alternatively, techniques described for the production of single chain antibodies can be adapted using methods known in the art to produce single chain antibodies that specifically bind to isoform 3.1. Antibodies with related specificity, but of distinct idiotypic composition, can be generated by chain shuffling from random combinatorial immunoglobin libraries. Single-chain antibodies also can be constructed using a DNA amplification method, such as PCR, using hybridoma cDNA as a template. Single-chain antibodies can be mono- or bispecific, and can be bivalent or tetravalent. Construction of tetravalent, bispecific single-chain antibodies is taught. A nucleotide sequence encoding a single-chain antibody can be constructed using manual or automated nucleotide synthesis, cloned into an expression construct using standard recombinant DNA methods, and introduced into a cell to express the coding sequence. Alternatively, single- chain antibodies can be produced directly using, for example, filamentous phage technology.
Antibodies that specifically bind to isoform 3.1 also can be produced by inducing in vivo production in the lymphocyte population or by screening immunoglobulin libraries or panels of highly specific binding reagents. Other types of antibodies can be constructed and used therapeutically in methods of the invention. Binding proteins that are derived from
immunoglobulins and that are multivalent and multispecific, such as the "diabodies" described in WO 94/13804, also can be prepared.
Antibodies according to the invention can be purified by methods well known in the art. For example, antibodies can be affinity purified by passage over a column to which isoform 3.1 is bound. The bound antibodies can then be eluted from the column using a buffer with a high salt concentration.
Antisense Oligonucleotides
Antisense oligonucleotides are nucleotide sequences that are complementary to a specific DNA or RNA sequence. Once introduced into a cell, the complementary nucleotides combine with natural sequences produced by the cell to form complexes and block either transcription or translation. Preferably, an antisense oligonucleotide is at least 1 1 nucleotides in length, but can be at least 12, 15, 20, 25, 30, 35, 40, 45, or 50 or more nucleotides long. Longer sequences also can be used. Antisense oligonucleotide molecules can be provided in a DNA construct and introduced into a cell as described above to decrease the level of isoform 3.1 gene products in the cell.
Antisense oligonucleotides can be deoxyribonucleotides, ribonucleotides, or a combination of both. Oligonucleotides can be synthesized manually or by an automated synthesizer, by covalently linking the 5' end of one nucleotide with the 3' end of another nucleotide with non-phosphodiester internucleotide linkages such alkylphosphonates, phosphorothioates, phosphorodithioates, alkylphosphonothioates, alkylphosphonates, phosphoramidates, phosphate esters, carbamates, acetamidate, carboxymethyl esters, carbonates, and phosphate triesters.
Modifications of isoform 3.1 gene expression can be obtained by designing antisense oligonucleotides that will form duplexes to the control, 5', or regulatory regions of the isoform 3.1 gene. Oligonucleotides derived from the transcription initiation site, e.g., between positions -10 and +10 from the start site, are preferred. Similarly, inhibition can be achieved using "triple helix" base- pairing methodology. Triple helix pairing is useful because it causes inhibition of the ability of the double helix to open sufficiently for the binding of polymerases, transcription factors, or chaperons. Therapeutic advances using triplex DNA have been described in the literature. An antisense oligonucleotide also can be designed to block translation of mRNA by preventing the transcript from binding to ribosomes.
Precise complementarity is not required for successful complex formation between an antisense oligonucleotide and the complementary sequence of an isoform 3.1 polynucleotide.
Antisense oligo nucleotides that comprise, for example, 2, 3, 4, or 5 or more stretches of contiguous nucleotides that are precisely complementary to an isoform 3.1 polynucleotide, each separated by a stretch of contiguous nucleotides that are not complementary to adjacent isoform 3.1 nucleotides, can provide sufficient targeting specificity for isoform 3.1 mRNA. Preferably, each stretch of complementary contiguous nucleotides is at least 4, 5, 6, 7, or 8 or more nucleotides in length. Non- complementary intervening sequences are preferably 1 , 2, 3, or 4 nucleotides in length. One skilled in the art can easily use the calculated melting point of an antisense-sense pair to determine the degree of mismatching that will be tolerated between a particular antisense oligonucleotide and a particular isoform 3.1 polynucleotide sequence.
Antisense oligonucleotides can be modified without affecting their ability to hybridize to an isoform 3.1 polynucleotide. These modifications can be internal or at one or both ends of the antisense molecule. For example, internucleoside phosphate linkages can be modified by adding cholesteryl or diamine moieties with varying numbers of carbon residues between the amino groups and terminal ribose. Modified bases and/or sugars, such as arabinose instead of ribose, or a 3', 5 '-substituted oligonucleotide in which the 3' hydroxyl group or the 5' phosphate group are substituted, also can be employed in a modified antisense oligonucleotide. These modified oligonucleotides can be prepared by methods well known in the art.
Ribozymes
Ribozymes are RNA molecules with catalytic activity. Ribozymes can be used to inhibit gene function by cleaving an RNA sequence, as is known in the art. The mechanism of ribozyme action involves sequence-specific hybridization of the ribozyme molecule to complementary target RNA, followed by endonucleolytic cleavage. Examples include engineered hammerhead motif ribozyme molecules that can specifically and efficiently catalyze endonucleolytic cleavage of specific nucleotide sequences. The coding sequence of an isoform 3.1 polynucleotide can be used to generate ribozymes that will specifically bind to mRNA transcribed from an isoform 3.1 polynucleotide. Methods of designing and constructing ribozymes that can cleave other RNA molecules in trans in a highly sequence specific manner have been developed and described in the art. For example, the cleavage activity of ribozymes can be targeted to specific RNAs by engineering a discrete "hybridization" region into the ribozyme. The hybridization region contains a sequence complementary to the target RNA and thus specifically hybridizes with the target RNA.
Specific ribozyme cleavage sites within an isoform 3.1 RNA target can be identified by scanning the target molecule for ribozyme cleavage sites that include the following sequences: GUA, GUU, and GUC. Once identified, short RNA sequences of between 15 and 20
ribonucleotides corresponding to the region of the target RNA containing the cleavage site can be evaluated for secondary structural features that may render the target inoperable. Suitability of candidate isoform 3.1 RNA targets also can be evaluated by testing accessibility to hybridization with complementary oligonucleotides using ribonuclease protection assays. The nucleotide sequences shown in SEQ ID NO: 3 and its complement provide sources of suitable hybridization region sequences. Longer complementary sequences can be used to increase the affinity of the hybridization sequence for the target. The hybridizing and cleavage regions of the ribozyme can be integrally related such that upon hybridizing to the target RNA through the complementary regions, the catalytic region of the ribozyme can cleave the target.
Ribozymes can be introduced into cells as part of a DNA construct. Mechanical methods, such as microinjection, liposome-mediated transfection, electroporation, or calcium phosphate precipitation, can be used to introduce a ribozyme-containing DNA construct into cells in which it is desired to decrease isoform 3.1 expression. Alternatively, if it is desired that the cells stably retain the DNA construct, the construct can be supplied on a plasmid and maintained as a separate element or integrated into the genome of the cells, as is known in the art. A ribozyme- encoding DNA construct can include transcriptional regulatory elements, such as a promoter element, an enhancer or UAS element, and a transcriptional terminator signal, for controlling transcription of ribozymes in the cells. Ribozymes also can be engineered to provide an additional level of regulation, so that destruction of mRNA occurs only when both a ribozyme and a target gene are induced in the cells.
Screening/Screening Assays
Regulators
Regulators as used herein, refer to compounds that affect the functional activity of an isoform 3.1 in vitro and/or in vivo. Regulators can be agonists and antagonists of an isoform 3.1 polypeptide and can be compounds that exert their effect on the isoform 3.1 activity via the expression, via post-translational modifications, by direct interaction with the channel protein or by other means. Agonists of isoform 3.1 are molecules that, when bound to isoform 3.1, increase or prolong the functional activity of isoform 3.1. Agonists of isoform 3.1 include proteins,
nucleic acids, carbohydrates, small molecules, or any other molecule that activate isoform 3.1. Antagonists of isoform 3.1 are molecules that, when bound to isoform 3.1 , decrease the amount or the duration of the functional activity of isoform 3.1 . Antagonists include proteins, nucleic acids, carbohydrates, antibodies, small molecules, or any other molecule that decrease the activity of isoform 3.1.
The term "modulate", as it appears herein, refers to a change in the activity of isoform 3.1 polypeptide. For example, modulation may cause an increase or a decrease in functional activity, binding characteristics, or any other biological, functional, or immunological properties of isoform 3.1 .
As used herein, the terms "specific binding" or "specifically binding" refer to that interaction between a protein or peptide and an agonist, an antibody, or an antagonist. The interaction is dependent upon the presence of a particular structure of the protein recognized by the binding molecule (i. e., the antigenic determinant or epitope). For example, if an antibody is specific for epitope "A" the presence of a polypeptide containing the epitope A, or the presence of free unlabeled A, in a reaction containing free labeled A and the antibody will reduce the amount of labeled A that binds to the antibody.
The invention provides methods (also referred to herein as "screening assays") for identifying compounds that can be used for the treatment of neurological diseases, e.g., schizophrenia. The methods entail the identification of candidate or test compounds or agents (e.g., peptides, peptidomimetics, small molecules or other molecules) that bind to isoform 3.1 and/or have a stimulatory or inhibitory effect on the biological functional activity of isoform 3.1 or its expression and then determining which of these compounds have an effect on symptoms or diseases regarding neurological diseases, e.g., schizophrenia, in an in vivo assay.
Candidate or test compounds or agents that bind to isoform 3.1 and/or have a stimulatory or inhibitory effect on the functional activity or the expression of isoform 3.1 are identified either in assays that employ cells that express isoform 3.1 on the cell surface (cell-based assays) or in assays with isolated isoform 3.1 (cell-free assays). The various assays can employ a variety of variants of isoform 3.1 (e.g., full-length isoform 3.1 , a biologically active fragment of isoform 3.1 , or a fusion protein that includes all or a portion of isoform 3.1). Moreover, isoform 3.1 can be derived from any suitable mammalian species (e.g., human or monkey isoform 3.1). The assay can be a binding assay entailing direct or indirect measurement of the binding of a test
compound or a known isoform 3.1 ligand to isoform 3.1. The assay can also be an activity assay entailing direct or indirect measurement of the activity of isoform 3.1. The assay can also be an expression assay entailing direct or indirect measurement of the expression of isoform 3.1 mRNA or isoform 3.1 protein. The various screening assays are combined with an in vivo assay entailing measuring the effect of the test compound on the symptoms of neurological diseases, e.g., schizophrenia.
In one embodiment, the invention provides assays for screening candidate or test compounds that bind to or modulate the functional activity of a membrane-bound (cell surface expressed) form of isoform 3.1. Such assays can employ full-length isoform 3.1, a biologically active fragment of isoform 3.1 , or a fusion protein that includes all or a portion of isoform 3.1. As described in greater detail below, the test compound can be obtained by any suitable means, e.g., from conventional compound libraries. Determining the ability of the test compound to bind to a membrane-bound form of isoform 3.1 can be accomplished, for example, by coupling the test compound with a radioisotope or enzymatic label such that binding of the test compound to the isoform 3.1 -expressing cell can be measured by detecting the labeled compound in a complex. For example, the test compound can be labelled with 1251 , 35S, 1 C, or 3H, either directly or indirectly, and the radioisotope detected by direct counting of radioemmission or by scintillation counting. Alternatively, the test compound can be enzymatically labelled with, for example, horseradish peroxidase, alkaline phosphatase, or luciferase, and the enzymatic label detected by determination of conversion of an appropriate substrate to product.
In a competitive binding format, the assay comprises contacting an isoform 3.1 expressing cell with a known compound that carries a detectable label and that binds to isoform 3.1 to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with the isoform 3.1 expressing cell, wherein determining the ability of the test compound to interact with the isoform 3.1 expressing cell comprises determining the ability of the test compound to preferentially bind the isoform 3.1 expressing cell as compared to the known compound.
In another embodiment, the assay is a cell-based assay comprising contacting a cell expressing a membrane-bound form of isoform 3.1 (e.g., full-length isoform 3.1 , a biologically active fragment of isoform 3.1 , or a fusion protein that includes all or a portion of isoform 3.1) expressed on the cell surface with a test compound and determining the ability of the test
compound to modulate (e.g., stimulate or inhibit) the functional activity of the membrane-bound form of isoform 3.1. Determining the ability of the test compound to modulate the functional activity of the membrane-bound form of isoform 3.1 can be accomplished by any method suitable for measuring the functional activity of isoform 3.1 , e.g., any method suitable for measuring the activity of any ion channel or other electrogenic target protein (described in greater detail below). The activity of an electrogenic target can be measured in a number of ways, not all of which are suitable for any given target protein. Among the measures of activity are: alteration in ion concentrations, measuring alterations in microphysiometric conditions, measuring alterations in voltage or measuring alterations in currents.
The present invention also includes cell-free assays. Such assays involve contacting a form of isoform 3.1 (e.g., full-length isoform 3.1 , a biologically active fragment of isoform 3.1 , or a fusion protein comprising all or a portion of isoform 3.1) with a test compound and determining the ability of the test compound to bind to isoform 3.1 . Binding of the test compound to isoform 3.1 can be determined either directly or indirectly as described above. In one embodiment, the assay includes contacting isoform 3.1 with a known compound that carries a detectable label and that binds isoform 3.1 to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with isoform 3.1 , wherein determining the ability of the test compound to interact with isoform 3.1 comprises determining the ability of the test compound to preferentially bind to isoform 3.1 as compared to the known compound.
The cell-free assays of the present invention are amenable to use of either a membrane- bound form of isoform 3.1 or a soluble fragment thereof. In the case of cell-free assays comprising the membrane bound form of the polypeptide, it may be desirable to utilize a solubilizing agent such that the membrane-bound form of the polypeptide is maintained in solution. Examples of such solubilizing agents include but are not limited to non-ionic detergents such as n-octylglucoside, n-dodecylglucoside, n-dodecylmaltoside, octanoyl-N- methylglucamide, decanoyl-N-methyl- glucamide, Triton X-100, Triton X- l 14, Thesit,
Isotridecypoly(ethylene glycol ether)n, 3-[(3-cholamidopropyl) dimethylamminio]-l -propane sulfonate (CHAPS), 3-[(3-cholamidopropyl)dimethylamminio]-2-hydroxy-l-propane sulfonate (CHAPSO), or N-dodecyl=N,N-dimethyl-3 ammonio-1 -propane sulfonate.
In various embodiments of the above assay methods of the present invention, it may be
desirable to immobilize isoform 3.1 (or an isoform 3.1 target molecule) to facilitate separation of complexed from uncomplexed forms of one or both of the proteins, as well as to accommodate automation of the assay. Binding of a test compound to isoform 3.1 , or interaction of isoform 3.1 with a target molecule in the presence and absence of a candidate compound, can be
accomplished in any vessel suitable for containing the reactants.
Examples of such vessels include microtiter plates, test tubes, and micro- centrifuge tubes. In one embodiment, a fusion protein can be provided that adds a domain that allows one or both of the proteins to be bound to a matrix. For example, glutathione-S-transferase (GST) fusion proteins can be adsorbed onto glutathione sepharose beads (Sigma Chemical; St. Louis, Mo.) or glutathione derivatized microtiter plates, which are then combined with the test compound or the test compound and either the non-adsorbed target protein or isoform 3.1 , and the mixture incubated under conditions conducive to complex formation (e.g., at physiological conditions for salt and pH). Following incubation, the beads or microtitre plate wells are washed to remove any unbound components and complex formation is measured either directly or indirectly, for example, as described above. Alternatively, the complexes can be dissociated from the matrix, and the level of binding or activity of isoform 3.1 can be determined using standard techniques.
Other techniques for immobilizing proteins on matrices can also be used in the screening assays of the invention. For example, either isoform 3.1 or its target molecule can be
immobilized utilizing conjugation of biotin and streptavidin. Biotinylated polypeptide of the invention or target molecules can be prepared from biotin-NHS (N-hydroxy-succinimide) using techniques well known in the art (e.g., biotinylation kit, Pierce Chemicals; Rockford, IU.), and immobilized in the wells of streptavidin- coated plates (Pierce Chemical). Alternatively, antibodies reactive with isoform 3.1 or target molecules but that do not interfere with binding of the polypeptide of the invention to its target molecule can be derivatized to the wells of the plate, and unbound target or polypeptide of the invention trapped in the wells by antibody conjugation. Methods for detecting such complexes, in addition to those described above for the GST- immobilized complexes, include immunodetection of complexes using antibodies reactive with isoform 3.1 or target molecule, as well as enzyme-linked assays that rely on detecting an enzymatic activity associated with isoform 3.1 or target molecule.
The screening assay can also involve monitoring the expression of isoform 3.1. For example, regulators of expression of isoform 3.1 can be identified in a method in which a cell is
contacted with a candidate compound and the expression of isoform 3.1 protein or mRNA in the cell is determined. The level of expression of isoform 3.1 protein or mRNA the presence of the candidate compound is compared to the level of expression of isoform 3. 1 protein or mRNA in the absence of the candidate compound. The candidate compound can then be identified as a regulator of expression of isoform 3.1 based on this comparison.
For example, when expression of isoform 3.1 protein or mRNA protein is greater
(statistically significantly greater) in the presence of the candidate compound than in its absence, the candidate compound is identified as a stimulator of isoform 3.1 protein or mRNA expression. Alternatively, when expression of isoform 3.1 protein or mRNA is less (statistically significantly less) in the presence of the candidate compound than in its absence, the candidate compound is identified as an inhibitor of isoform 3.1 protein or mRNA expression. The level of isoform 3.1 protein or mRNA expression in the cells can be determined by methods described below.
Binding Assays
For binding assays, the test compound is preferably a small molecule that potentially binds to a regulatory channel site or nearby the channel pore of isoform 3.1 , thereby competing with physiological modulators for said regulatory site, blocking the channel pore, or holding it in its open or closed state such that normal biological activity is prevented, enhanced or otherwise modified. Examples of such small molecules include, but are not limited to, small peptides or peptide-like molecules as well as small compounds.
Potential ligands that bind to a polypeptide of the invention include, but are not limited to, the natural ligands of known isoform 3.1 ion channels and analogues or derivatives thereof. In binding assays, either the test compound or the isoform 3.1 polypeptide can comprise a detectable label, such as a fluorescent, radioisotopic, chemiluminescent, or enzymatic label, such as horseradish peroxidase, alkaline phosphatase, or luciferase. Detection of a test compound that is bound to isoform 3.1 polypeptide can then be accomplished, for example, by direct counting of radioemmission, by scintillation counting, or by determining conversion of an appropriate substrate to a detectable product. Alternatively, binding of a test compound to an isoform 3.1 polypeptide can be determined without labeling either of the interactants. For example, a microphysiometer can be used to detect binding of a test compound with a isoform 3.1 polypeptide. A microphysio- meter (e.g., Cytosensor™) is an analytical instrument that measures the rate at which a cell acidifies its environment using a light-addressable potentiometric sensor
(LAPS). Changes in this acidification rate can be used as an indicator of the interaction between a test compound and isoform 3.1.
Determining the ability of a test compound to bind to isoform 3.1 also can be
accomplished using a technology such as real-time Biomolecular Interaction Analysis (BIA). BIA is a technology for studying biospecific interactions in real time, without labeling any of the interactants (e.g., BIAcore™). Changes in the optical phenomenon surface plasmon resonance (SPR) can be used as an indication of real-time reactions between biological molecules.
In a competitive binding format, the assay includes contacting isoform 3.1 with a known compound that carries a detectable label and that is coupled to a detectable label and that binds isoform 3.1 to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with isoform 3.1 , wherein determining the ability of the test compound to interact with isoform 3.1 comprises determining the ability of the test compound to preferentially bind to isoform 3.1 as compared to the known compound. In yet another aspect of the invention, an isoform 3.1 -like polypeptide can be used as a "bait protein" in a two-hybrid assay or three-hybrid assay to identify other proteins that bind to or interact with isoform 3.1 and modulate its activity.
The two-hybrid system is based on the modular nature of most transcription factors, which consist of separable DNA-binding and activation domains. Briefly, the assay utilizes two different DNA constructs. For example, in one construct, polynucleotide encoding isoform 3.1 can be fused to a polynucleotide encoding the DNA binding domain of a known transcription factor (e.g., GAL-4). In the other construct a DNA sequence that encodes an unidentified protein ("prey" or "sample") can be fused to a polynucleotide that codes for the activation domain of the known transcription factor. If the "bait" and the "prey" proteins are able to interact in vivo to form a protein-dependent complex, the DNA-binding and activation domains of the transcription factor are brought into close proximity. This proximity allows transcription of a reporter gene (e.g., LacZ), which is operably linked to a transcriptional regulatory site responsive to the transcription factor. Expression of the reporter gene can be detected, and cell colonies containing the functional transcription factor can be isolated and used to obtain the DNA sequence encoding the protein that interacts with isoform 3.1.
It may be desirable to immobilize either the isoform 3.1 (or polynucleotide) or the test compound to facilitate separation of the bound form from unbound forms of one or both of the
interactants, as well as to accommodate automation of the assay. Thus, either the isoform 3.1 - like polypeptide (or polynucleotide) or the test compound can be bound to a solid support.
Suitable solid supports include, but are not limited to, glass or plastic slides, tissue culture plates, microtiter wells, tubes, silicon chips, or particles such as beads (including, but not limited to, latex, polystyrene, or glass beads). Any method known in the art can be used to attach isoform 3.1 -like polypeptide (or polynucleotide) or test compound to a solid support, including use of covalent and non-covalent linkages, passive absorption, or pairs of binding moieties attached respectively to the polypeptide (or polynucleotide) or test compound and the solid support. Test compounds are preferably bound to the solid support in an array, so that the location of individual test compounds can be tracked. Binding of a test compound to isoform 3.1 (or a polynucleotide encoding for isoform 3.1) can be accomplished in any vessel suitable for containing the reactants. Examples of such vessels include microtiter plates, test tubes, and microcentrifuge tubes.
In one embodiment, isoform 3.1 is a fusion protein comprising a domain that allows binding of isoform 3.1 to a solid support. For example, glutathione- S- transferase fusion proteins can be adsorbed onto glutathione sepharose beads (Sigma Chemical, St. Louis, Mo.) or glutathione derivatized microtiter plates, which are then combined with the test compound or the test compound and the non-adsorbed isoform 3.1 ; the mixture is then incubated under conditions conducive to complex formation {e.g., at physiological conditions for salt and pH). Following incubation, the beads or microtiter plate wells are washed to remove any unbound components. Binding of the interactants can be determined either directly or indirectly, as described above. Alternatively, the complexes can be dissociated from the solid support before binding is determined.
Other techniques for immobilizing proteins or polynucleotides on a solid support also can be used in the screening assays of the invention. For example, either isoform 3.1 (or a polynucleotide encoding isoform 3.1) or a test compound can be immobilized utilizing conjugation of biotin and streptavidin. Biotinylated isoform 3.1 (or a polynucleotide encoding biotinylated isoform 3.1) or test compounds can be prepared from biotin-NHS (N- hydroxysuccinimide) using techniques well known in the art {e.g., biotinylation kit, Pierce Chemicals, Rockford, 1 1 1.) and immobilized in the wells of streptavidin-coated plates (Pierce Chemical). Alternatively, antibodies that specifically bind to isoform 3.1, polynucleotide, or a
test compound, but that do not interfere with a desired binding site, such as the active site of isoform 3.1, can be derivatized to the wells of the plate. Unbound target or protein can be trapped in the wells by antibody conjugation.
Methods for detecting such complexes, in addition to those described above for the GST- immobilized complexes, include immunodetection of complexes using antibodies that specifically bind to isoform 3.1 polypeptide or test compound, enzyme-linked assays that rely on detecting an activity of isoform 3.1 polypeptide, and SDS gel electrophoresis under non- reducing conditions.
Screening for test compounds that bind to an isoform 3.1 polypeptide or polynucleotide also can be carried out in an intact cell. Any cell that comprises an isoform 3.1 polypeptide or polynucleotide can be used in a cell- based assay system. An isoform 3.1 polynucleotide can be naturally occurring in the cell or can be introduced using techniques such as those described above. Binding of the test compound to isoform 3.1 or a polynucleotide encoding isoform 3.1 is determined as described above.
Functional Assays
Test compounds can be tested for the ability to increase or decrease isoform 3.1 functional activity of an isoform 3.1 polypeptide. The isoform 3.1 activity can be measured, for example, using methods described in the specific examples, below. Isoform 3.1 functional activity can be measured after contacting an intact cell having functional ion channel activity with a test compound. A test compound that decreases isoform 3.1 activity by at least about 10, preferably about 50, more preferably about 75, 90, or 100% is identified as a potential agent for decreasing isoform 3.1 activity. A test compound that increases isoform 3.1 activity by at least about 10, preferably about 50, more preferably about 75, 90, or 100% is identified as a potential agent for increasing isoform 3.1 activity.
Other screening techniques include the use of cells that express isoform 3.1 (for example, transfected CHO cells) in a system that measures extracellular pH changes caused by channel activation. For example, compounds may be contacted with a cell that expresses the channel polypeptide of the present invention and a second messenger response, e.g., signal transduction or pH changes, can be measured to determine whether the potential compound activates or inhibits the channel. Another such screening technique involves introducing R A or DNA encoding isoform 3.1 into Xenopus oocytes to transiently express the channel. The receptor
oocytes can then be contacted with the channel ligand or activated otherwise and a compound to be screened, followed by detection of modulation of the observed control signal. Other screening techniques include the use of cells that express isoform 3.1 (for example, transfected CHO cells) in a system that measures voltage changes caused by channel activation. For example, compounds may be contacted with a cell that expresses the channel polypeptide of the present invention and voltage changes can be measured to determine whether the potential compound activates or inhibits the channel.
Another screening technique involves expressing isoform 3.1 in cells in which the channel is linked to a phospholipase C or D. Such cells include endothelial cells, smooth muscle cells, embryonic kidney cells, etc. The screening may be accomplished as described above by quantifying the degree of activation of the channel from changes in the phospholipase activity. Gene Expression
In another embodiment, test compounds that increase or decrease isoform 3.1 gene expression are identified. As used herein, the term "correlates with expression of a
polynucleotide" indicates that the detection of the presence of nucleic acids, the same or related to a nucleic acid sequence encoding isoform 3.1, by northern analysis or real-time PCR is indicative of the presence of nucleic acids encoding isoform 3.1 in a sample, and thereby correlates with expression of the transcript from the polynucleotide encoding isoform 3.1. The term "microarray", as used herein, refers to an array of distinct polynucleotides or
oligonucleotides arrayed on a substrate, such as paper, nylon or any other type of membrane, filter, chip, glass slide, or any other suitable solid support. An isoform 3.1 polynucleotide is contacted with a test compound, and the expression of an R A or polypeptide product of isoform 3.1 polynucleotide is determined. The level of expression of appropriate mRNA or polypeptide in the presence of the test compound is compared to the level of expression of mRNA or polypeptide in the absence of the test compound. The test compound can then be identified as a regulator of expression based on this comparison. For example, when expression of mRNA or polypeptide is greater in the presence of the test compound than in its absence, the test compound is identified as a stimulator or enhancer of the mRNA or polypeptide expression. Alternatively, when expression of the mRNA or polypeptide is less in the presence of the test compound than in its absence, the test compound is identified as an inhibitor of the rnRNA or polypeptide expression.
The level of isoform 3.1 mRNA or polypeptide expression in the cells can be determined by methods well known in the art for detecting mRNA or polypeptide. Either qualitative or quantitative methods can be used. The presence of polypeptide products of isoform 3.1 polynucleotide can be determined, for example, using a variety of techniques known in the art, including immuno chemical methods such as radioimmunoassay, Western blotting, and immunohistochemistry. Alternatively, polypeptide synthesis can be determined in vivo, in a cell culture, or in an in vitro translation system by detecting incorporation of labelled amino acids into isoform 3.1.
Such screening can be carried out either in a cell-free assay system or in an intact cell. Any cell that expresses isoform 3.1 polynucleotide can be used in a cell-based assay system. The isoform 3.1 polynucleotide can be naturally occurring in the cell or can be introduced using techniques such as those described above. Either a primary culture or an established cell line can be used.
Test Compounds
Suitable test compounds for use in the screening assays of the invention can be obtained from any suitable source, e.g., conventional compound libraries. The test compounds can also be obtained using any of the numerous approaches in combinatorial library methods known in the art, including: biological libraries; spatially addressable parallel solid phase or solution phase libraries; synthetic library methods requiring deconvolution; the "one-bead one-compound" library method; and synthetic library methods using affinity chromatography selection. The biological library approach is limited to peptide libraries, while the other four approaches are applicable to peptide, non-peptide oligomer or small molecule libraries of compounds. Examples of methods for the synthesis of molecular libraries can be found in the art. Libraries of compounds may be presented in solution or on beads, bacteria, spores, plasmids or phage.
Modeling of Regulators
Computer modeling and searching technologies permit identification of compounds, or the improvement of already identified compounds, that can modulate isoform 3.1 expression or activity. Having identified such a compound or composition, the active sites or regions are identified. Such active sites might typically be ligand binding sites, such as the interaction domain of the ligand with isoform 3.1. The active site can be identified using methods known in the art including, for example, from the amino acid sequences of peptides, from the nucleotide
sequences of nucleic acids, or from study of complexes of the relevant compound or composition with its natural ligand. In the latter case, chemical or X-ray crystallographic methods can be used to find the active site by finding where on the factor the complexed ligand is found.
Next, the three dimensional geometric structure of the active site is determined. This can be done by known methods, including X-ray crystallography, which can determine a complete molecular structure. On the other hand, solid or liquid phase NMR can be used to determine certain intramolecular distances. Any other experimental method of structure determination can be used to obtain partial or complete geometric structures. The geometric structures may be measured with a complexed ligand, natural or artificial, which may increase the accuracy of the active site structure determined.
If an incomplete or insufficiently accurate structure is determined, the methods of computer based numerical modeling can be used to complete the structure or improve its accuracy. Any recognized modeling method may be used, including parameterized models specific to particular biopolymers such as proteins or nucleic acids, molecular dynamics models based on computing molecular motions, statistical mechanics models based on thermal ensembles, or combined models.
For most types of models, standard molecular force fields, representing the forces between constituent atoms and groups, are necessary, and can be selected from force fields known in physical chemistry. The incomplete or less accurate experimental structures can serve as constraints on the complete and more accurate structures computed by these modeling methods.
Finally, having determined the structure of the active site, either experimentally, by modeling, or by a combination, candidate modulating compounds can be identified by searching databases containing compounds along with information on their molecular structure. Such a search seeks compounds having structures that match the determined active site structure and that interact with the groups defining the active site. Such a search can be manual, but is preferably computer-assisted. These compounds found from this search are potential isoform 3.1 modulating compounds.
Alternatively, these methods can be used to identify improved modulating compounds from an already known modulating compound or ligand. The composition of the known compound can be modified and the structural effects of modification can be determined using the
experimental and computer modeling methods described above applied to the new composition. The altered structure is then compared to the active site structure of the compound to determine if an improved fit or interaction results. In this manner systematic variations in composition, such as by varying side groups, can be quickly evaluated to obtain modified modulating compounds or ligands of improved specificity or activity.
Applications
The present invention provides for both prophylactic and therapeutic methods for neurological diseases, e.g., schizophrenia.
The regulatory method of the invention involves contacting a cell with an agent that modulates one or more of the activities of isoform 3.1. An agent that modulates activity can be an agent as described herein, such as a nucleic acid or a protein, a naturally-occurring cognate ligand of the polypeptide, a peptide, a peptidomimetic, or any small molecule. In one
embodiment, the agent stimulates one or more of the biological activities of isoform 3.1. In another embodiment, the agent inhibits one or more of the biological activities of isoform 3.1. As such, the present invention provides methods of treating an individual afflicted with a disease or disorder characterized by unwanted expression or activity of isoform 3.1 or a protein in the isoform 3.1 signaling pathway. In one embodiment, the method involves administering an agent like any agent identified or being identifiable by a screening assay as described herein, or combination of such agents that may upregulate or downregulate the expression or activity of isoform 3.1 or of any protein in the isoform 3.1 signaling pathway. In another embodiment, the method involves administering a regulator of isoform 3.1 as therapy to compensate for increased or undesirably high expression or activity, or, alternatively, reduced or undesirably low expression or activity of isoform 3.1 or a protein in the isoform 3.1 signaling pathway.
Stimulation of activity or expression of isoform 3.1 is desirable in situations in which activity or expression is abnormally low and in which increased activity is likely to have a beneficial effect. Conversely, inhibition of activity or expression of isoform 3.1 is desirable in situations in which activity or expression of isoform 3.1 is abnormally high and in which decreasing its activity is likely to have a beneficial effect.
Pharmaceutical Compositions
This invention further pertains to novel agents identified by the above-described screening assays and uses thereof for treatments as described herein.
The active agents (also referred to herein as "active compounds") of the invention can be incorporated into pharmaceutical compositions suitable for administration. Such compositions typically comprise the active agents and a pharmaceutically acceptable carrier. As used herein the language "pharmaceutically acceptable carrier" is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
The invention includes pharmaceutical compositions comprising a regulator of isoform 3.1 expression or activity (and/or a regulator of the activity or expression of a protein in the isoform 3.1 signaling pathway) as well as methods for preparing such compositions by combining one or more such regulators and a pharmaceutically acceptable carrier. Also within the invention are pharmaceutical compositions comprising a regulator identified using the screening assays of the invention packaged with instructions for use. For regulators that are antagonists of isoform 3.1 activity or that reduce isoform 3.1 expression, the instructions would specify use of the pharmaceutical composition for treatment of neurological diseases, e.g., schizophrenia. For regulators that are agonists of isoform 3.1 activity or increase isoform 3.1 expression, the instructions would specify use of the pharmaceutical composition for treatment of other neurological diseases.
An antagonist of isoform 3.1 may be produced using methods that are generally known in the art. In particular, purified isoform 3.1 may be used to produce antibodies or to screen libraries of pharmaceutical agents to identify those that specifically bind isoform 3.1. Antibodies to isoform 3.1 may also be generated using methods that are well known in the art. Such antibodies may include, but are not limited to, polyclonal, monoclonal, chimeric, single chain antibodies, Fab fragments, and fragments produced by a Fab expression library.
In another embodiment of the invention, the polynucleotides encoding isoform 3.1 , or any fragment or complement thereof, may be used for therapeutic purposes. In one aspect, the complement of the polynucleotide encoding isoform 3.1 may be used in situations in which it would be desirable to block the transcription of the mRNA. In particular, cells may be
transformed with sequences complementary to polynucleotides encoding isoform 3.1. Thus, complementary molecules or fragments may be used to modulate isoform 3.1 activity, or to achieve regulation of gene function. Such technology is now well known in the art, and sense or antisense oligonucleotides or larger fragments can be designed from various locations along the coding or control regions of sequences encoding isoform 3.1.
Expression vectors derived from lentiviruses, may be used for delivery of nucleotide sequences to the targeted organ, tissue, or cell population. Methods that are well known to those skilled in the art can be used to construct vectors that will express nucleic acid sequence complementary to the polynucleotides of the gene encoding isoform 3.1. These techniques are described, for example, in the scientific literature.
Any of the therapeutic methods described above may be applied to any subject in need of such therapy, including, preferably, humans.
An additional embodiment of the invention relates to the administration of a
pharmaceutical composition containing isoform 3.1 in conjunction with a pharmaceutically acceptable carrier, for any of the therapeutic effects discussed above. Such pharmaceutical compositions may constitute isoform 3.1 , antibodies to isoform 3.1 , and mimetics, agonists, antagonists, or inhibitors of isoform 3.1. The compositions may be administered alone or in combination with at least one other agent, such as a stabilizing compound, which may be administered in any sterile, biocompatible pharmaceutical carrier including, but not limited to, saline, buffered saline, dextrose, and water. The compositions may be administered to a patient alone, or in combination with other agents, drugs or hormones.
A pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration. Examples of routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (topical), transmucosal, and rectal administration. Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. pH can be adjusted with acids or
bases, such as hydrochloric acid or sodium hydroxide. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
Pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, a pharmaceutically acceptable polyol like glycerol, propylene glycol, liquid polyetheylene glycol, and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, and sodium chloride in the
composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, aluminum
monostearate and gelatin. Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying, which yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile- filtered solution thereof.
Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the purpose of oral therapeutic administration, the active compound can be incorporated with excipients and used in the form of
tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed.
Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition. The tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
For administration by inhalation, the compounds are delivered in the form of an aerosol spray from a pressurized container or dispenser that contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
Systemic administration can also be by transmucosal or transdermal means. For transmucosal or transdermal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives. Transmucosal administration can be accomplished through the use of nasal sprays or
suppositories. For transdermal administration, the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.
The compounds can also be prepared in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
In one embodiment, the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid.
It is especially advantageous to formulate oral or parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit
containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.
The pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration. For pharmaceutical compositions that include an antagonist of isoform 3.1 activity, a compound that reduces expression or activity of isoform 3.1, or a compound that reduces expression or activity of a protein in the isoform 3.1 signaling pathway or any combination thereof, the instructions for administration will specify use of the composition for neurological diseases, e.g., schizophrenia. For pharmaceutical compositions that include an agonist of isoform 3.1 activity, a compound that increases expression of isoform 3.1 , or a compound that increases expression or activity of a protein in the isoform 3.1 signaling pathway or any combination thereof, the instructions for administration will specify use of the composition for other neurological diseases.
Determination of a Therapeutically Effective Dose
The determination of a therapeutically effective dose is well within the capability of those skilled in the art. A therapeutically effective dose refers to that amount of active ingredient that increases or decreases isoform 3.1 activity relative to isoform 3.1 activity that occurs in the absence of the therapeutically effective dose. For any compound, the therapeutically effective dose can be estimated initially either in cell culture assays or in animal models, usually mice, rats, rabbits, or monkeys. The animal model also can be used to determine the appropriate concentration range and route of administration. Such information can then be used to determine useful doses and routes for administration in humans.
Therapeutic efficacy and toxicity, e.g., ED50 (the dose therapeutically effective in 50% of the population) and LD50 (the dose lethal to 50% of the population), can be determined by standard pharmaceutical procedures in cell cultures or experimental animals. The dose ratio of toxic to therapeutic effects is the therapeutic index, and it can be expressed as the ratio,
LD50/ED50. Pharmaceutical compositions that exhibit large therapeutic indices are preferred. The data obtained from cell culture assays and animal studies is used in formulating a range of
dosage for human use. The dosage contained in such compositions is preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage varies within this range depending upon the dosage form employed, sensitivity of the patient, and the route of administration. The exact dosage will be determined by the practitioner, in light of factors related to the subject that requires treatment. Dosage and administration are adjusted to provide sufficient levels of the active ingredient or to maintain the desired effect. Factors that can be taken into account include the severity of the disease state, general health of the subject, age, weight, and gender of the subject, diet, time and frequency of administration, drug
combination(s), reaction sensitivities, and tolerance/response to therapy. Long-acting
pharmaceutical compositions can be administered every 3 to 4 days, every week, or once every two weeks depending on the half-life and clearance rate of the particular formulation.
Normal dosage amounts can vary from 0.1 micrograms to 100,000 micrograms, up to a total dose of about 1 gram, depending upon the route of administration. Guidance as to particular dosages and methods of delivery is provided in the literature and generally available to practitioners in the art.
Those skilled in the art will employ different formulations for nucleotides than for proteins or their inhibitors. Similarly, delivery of polynucleotides or polypeptides will be specific to particular cells, conditions, locations, etc. If the reagent is a single-chain antibody,
polynucleotides encoding the antibody can be constructed and introduced into a cell either ex vivo or in vivo using well- established techniques including, but not limited to, transferrin- polycation-mediated DNA transfer, transfection with naked or encapsulated nucleic acids, liposome-mediated cellular fusion, intracellular transportation of DNA-coated latex beads, protoplast fusion, viral infection, electroporation, "gene gun", and DEAE- or calcium phosphate- mediated transfection.
If the expression product is mRNA, the reagent is preferably an antisense oligonucleotide or a ribozyme. Polynucleotides that express antisense oligonucleotides or ribozymes can be introduced into cells by a variety of methods, as described above. Preferably, a reagent reduces expression of isoform 3.1 gene or the activity of isoform 3.1 by at least about 10, preferably about 50, more preferably about 75, 90, or 100% relative to the absence of the reagent. The effectiveness of the mechanism chosen to decrease the level of expression of isoform 3.1 gene or the activity of isoform 3.1 can be assessed using methods well known in the art, such as
hybridization of nucleotide probes to isoform 3.1 -specific mRNA, quantitative RT-PCR, immunologic detection of isoform 3.1 , or measurement of isoform 3.1 activity.
In any of the embodiments described above, any of the pharmaceutical compositions of the invention can be administered in combination with other appropriate therapeutic agents.
Selection of the appropriate agents for use in combination therapy can be made by one of ordinary skill in the art, according to conventional pharmaceutical principles. The combination of therapeutic agents can act synergistically to effect the treatment or prevention of the various disorders described above. Using this approach, one may be able to achieve therapeutic efficacy with lower dosages of each agent, thus reducing the potential for adverse side effects. Any of the therapeutic methods described above can be applied to any subject in need of such therapy, including, for example, humans.
Diagnostics
One embodiment of the invention relates to a method for predicting the likelihood that an individual will have a neuropsychiatric disorder, e.g., schizophrenia, or for aiding in the diagnosis of a neuropsychiatric disorder, e.g., schizophrenia, or a greater likelihood of having reduced symptomology associated with a neuropsychiatric disorder, e.g., schizophrenia, comprising the steps of obtaining a DNA sample from an individual to be assessed and determining the nucleotide present at a single nucleotide polymorphism (SNP) of the KCNH2 gene. The presence of a nucleotide from the protective allele at the SNP indicates that the individual has a lower likelihood of having a neuropsychiatric disorder, or a greater likelihood of having reduced symptomology associated with a neuropsychiatric disorder, than if that individual had a nucleotide from the risk allele at that SNP. Conversely, the presence of a nucleotide from the risk allele at the SNP indicates that the individual has a greater likelihood of having a neuropsychiatric disorder, or a likelihood of having increased symptomology associated with a neuropsychiatric disorder, than if that individual had a nucleotide from the protective allele at that SNP. In a preferred embodiment, the neuropsychiatric disorder is schizophrenia. In a particular embodiment, the individual is an individual at risk for development of schizophrenia. In another embodiment the individual exhibits clinical symptomatology associated with schizophrenia. In one embodiment, the individual has been clinically diagnosed as having schizophrenia.
The SNP is selected from Marker Ml, M2, M3, M4, M5, M6, M7, M8, M9, MIO, Ml 1 , M12, M13, M14, M15, M16, M17, M18, M19, M20, M21 , M22, M23, M24, M25, M26, M27, M28, M29, M30, M31, M32, M33, M34, M35, M36, M37, M38, M39, M40, M41 , M42, or M43.
M25 C/T Allele 2 T C
M26 C/T Allele 1 C T
M27 T/G Allele 1 T G
M28 C/T Allele 1 C T
M29 C/T Allele 1 C T
M30 G/T Allele 2 T G
M31 A/G Allele 2 G A
M32 C/T Allele 1 C T
M33 G/A Allele 2 A G
M34 G/A Allele 1 G A
M35 A/G Allele 1 A G
M36 G/T Allele 1 G T
M37 A/G Allele 1 A G
M38 T/A Allele 1 T A
M39 A/G Allele 2 G A
M40 C/G Allele 1 C G
M41 A/G Allele 2 G A
M42 G/A Allele 2 A G
M43 C/G Allele 2 G C
The genetic material to be assessed can be obtained from any nucleated cell from the individual. For assay of genomic DNA, virtually any biological sample (other than pure red blood cells) is suitable. For example, convenient tissue samples include whole blood, semen, saliva, tears, urine, fecal material, sweat, skin and hair. For assay of cDNA or mRNA, the tissue sample must be obtained from an organ in which the target nucleic acid is expressed. For example, cells from the central nervous system (such as cells of the hippocampus), neural crest- derived cells, skin, heart, lung and skeletal muscle are suitable sources for obtaining cDNA for the KCNH2 gene. Neural crest-derived cells include, for example, melanocytes and
keratinocytes.
Many of the methods described herein require amplification of DNA from target samples. This can be accomplished by e.g., PCR. See generally: PCR Technology: Principles and
Applications for DNA Amplification ed. H.A. Erlich, Freeman Press, NY, NY, 1992.
Other suitable amplification methods include the ligase chain reaction (LCR), transcription amplification, self- sustained sequence replication and nucleic acid based sequence amplification (NASBA). The latter two amplification methods involve isothermal reactions based on isothermal transcription, which produce both single stranded RNA (ssRNA) and double stranded DNA (dsDNA) as the amplification products in a ratio of about 30 or 100 to 1 , respectively. The nucleotide that occupies the polymorphic site of interest can be identified by a variety of methods, such as Southern analysis of genomic DNA; direct mutation analysis by restriction enzyme digestion; Northern analysis of RNA; denaturing high pressure liquid chromatography (DHPLC); gene isolation and sequencing; hybridization of an allele-specific oligonucleotide with amplified gene products; single base extension (SBE); or analysis of the KCNH2 protein. A sampling of suitable procedures are discussed below in turn.
Allele-Specific Probes
The design and use of allele-specific probes for analyzing polymorphisms is described by e.g., Saiki et al. 1986 Nature 324: 163-166. Allele-specific probes can be designed that hybridize to a segment of target DNA from one individual but do not hybridize to the corresponding segment from another individual due to the presence of different polymorphic forms in the respective segments from the two individuals. Hybridization conditions should be sufficiently stringent that there is a significant difference in hybridization intensity between alleles, and preferably an essentially binary response, whereby a probe hybridizes to only one of the alleles. Hybridizations are usually performed under stringent conditions, for example, at a salt concentration of no more than 1M and a temperature of at least 25°C. For example, conditions of 5X SSPE (750 mM NaCl, 50 mM NaPhosphate, 5 mM EDTA, pH 7.4) and a temperature of 25- 30°C, or equivalent conditions, are suitable for allele-specific probe hybridizations. Equivalent conditions can be determined by varying one or more of the parameters given as an example, as known in the art, while maintaining a similar degree of identity or similarity between the target nucleotide sequence and the primer or probe used.
Some probes are designed to hybridize to a segment of target DNA such that the polymorphic site aligns with a central position (e.g., in a 15-mer at the 7 position; in a 16-mer, at
either the 8 or 9 position) of the probe. This design of probe achieves good discrimination in hybridization between different allelic forms.
Allele-specific probes are often used in pairs, one member of a pair showing a perfect match to a reference form of a target sequence and the other member showing a perfect match to a variant form. Several pairs of probes can then be immobilized on the same support for simultaneous analysis of multiple polymorphisms within the same target sequence.
Tiling Arrays
The polymorphisms can also be identified by hybridization to nucleic acid arrays, some examples of which are described in WO 95/1 1995. WO 95/1 1995 also describes subarrays that are optimized for detection of a variant form of a precharacterized polymorphism. Such a subarray contains probes designed to be complementary to a second reference sequence, which is an allelic variant of the first reference sequence. The second group of probes is designed by the same principles, except that the probes exhibit complementarity to the second reference sequence. The inclusion of a second group (or further groups) can be particularly useful for analyzing short subsequences of the primary reference sequence in which multiple mutations are expected to occur within a short distance commensurate with the length of the probes (e.g., two or more mutations within 9 to 21 bases).
AUele-Specific Primers
An allele-specific primer hybridizes to a site on target DNA overlapping a polymorphism and only primes amplification of an allelic form to which the primer exhibits perfect
complementarity. See, Gibbs 1989 Nucleic Acid Res 17:2427-2448. This primer is used in conjunction with a second primer that hybridizes at a distal site. Amplification proceeds from the two primers, resulting in a detectable product that indicates the particular allelic form is present. A control is usually performed with a second pair of primers, one of which shows a single base mismatch at the polymorphic site and the other of which exhibits perfect complementarity to a distal site. The single-base mismatch prevents amplification and no detectable product is formed. The method works best when the mismatch is included in the 3 '-most position of the
oligonucleotide aligned with the polymorphism because this position is most destabilizing to elongation from the primer.
Direct-Sequencing
The direct analysis of the sequence of polymorphisms of the present invention can be accomplished using either the dideoxy chain termination method or the Maxam Gilbert method (see Molecular Cloning: a Laboratory Manual, 3rd edition, Sambrook et al. 2001 Cold Spring Harbor Laboratory Press, New York).
Denaturing Gradient Gel Electrophoresis
Amplification products generated using the polymerase chain reaction can be analyzed by the use of denaturing gradient gel electrophoresis. Different alleles can be identified based on the different sequence-dependent melting properties and electrophoretic migration of DNA in solution (Erlich, ed. 1992 PCR Technology, Principles and Applications for DNA Amplification, W.H. Freeman and Co, New York, Chapter 7).
Single-Strand Conformation Polymorphism Analysis
Alleles of target sequences can be differentiated using single-strand conformation polymorphism analysis, which identifies base differences by alteration in electrophoretic migration of single stranded PCR products, as described in Orita et al. 1989 PNAS USA
86:2766-2770. Amplified PCR products can be generated as described above, and heated or otherwise denatured, to form single-stranded amplification products. Single-stranded nucleic acids may refold or form secondary structures that are partially dependent on the base sequence. The different electrophoretic mobilities of single-stranded amplification products can be related to base-sequence differences between alleles of target sequences.
The polypeptide and polynucleotide markers of the isoform 3.1 of KCNH2 gene of the invention are useful in methods for diagnosing schizophrenia, determining the extent and/or severity of the disease, monitoring progression and neurological symptoms of the disease and/or response to therapy, and predicting the response of patients to therapy, including antipsychotic medications. The markers are also useful in methods for treating schizophrenia and for evaluating the efficacy of treatment for the disease. The markers may also be used to screen candidate drugs for treatment of schizophrenia. Such methods can be performed in human and non-human primate subjects.
The polypeptide markers of the isoform 3.1 of KCNH2 may be isolated by any suitable method known in the art. Native polypeptide markers can be purified from natural sources by standard methods known in the art (e.g., chromatography, centrifugation, differential solubility, immunoassay). In one embodiment, polypeptide markers may be isolated from a serum sample
using the chromatographic methods disclosed herein. In another embodiment, polypeptide markers may be isolated from a sample by contacting the sample with substrate-bound antibodies or aptamers that specifically bind to the marker.
The present invention also includes polynucleotide markers of isoform 3.1 of KCNH2 related to the polypeptide markers of the present invention. In one aspect, the invention provides polynucleotides that encode the polypeptides of the invention. The polynucleotide may be genomic DNA, cDNA, or mRNA transcripts that encode the polypeptides of the invention. In one embodiment, the invention provides polynucleotide markers that are closely associated with expression of isoform 3.1 of KCNH2, including single nucleotide polymorphisms (SNPs).
In one embodiment, the invention includes polynucleotide markers of isoform 3.1 of KCNH2 that encode a polypeptide that is a fragment, precursor, successor or modified version of the isoform 3.1 of KCNH2.
In another embodiment, the invention includes polynucleotides that have substantial sequence similarity to a polynucleotide that encodes an isoform of a KCNH2 polypeptide or a fragment, precursor, successor or modified version of such polynucleotide, or a molecule that comprises such polypeptide. Two polynucleotides have "substantial sequence identity" when there is at least about 70% sequence identity, at least about 80% sequence identity, at least about 90% sequence identity, at least about 95% sequence identity or at least 99% sequence identity between their amino acid sequences or when the polynucleotides are capable of forming a stable duplex with each other under stringent hybridization conditions. Such conditions are described elsewhere herein. As described above with respect to polypeptides, the invention includes polynucleotides that are allelic variants, the result of SNPs, or that in alternative codons to those present in the native materials as inherent in the degeneracy of the genetic code.
In some embodiments, the polynucleotides described may be used as surrogate markers of schizophrenia. Thus, for example, if the level of a polypeptide marker is increased in schizophrenic patients, an increase in the mRNA that encodes the polypeptide marker may be interrogated rather than the polypeptide marker (e.g., to diagnose schizophrenia in a subject).
The present invention also provides methods of detecting the markers of isoform 3.1 of KCNH2 of the present invention. The practice of the present invention employs, unless otherwise indicated, conventional methods of analytical biochemistry, microbiology, molecular biology and recombinant DNA techniques within the skill of the art. Such techniques are
explained fully in the literature. (See, e.g., Sambrook, J. et al. Molecular Cloning: A Laboratory Manual. 3rd, ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 2000; DNA Cloning: A Practical Approach, Vol. I & II (D. Glover, ed.); Oligonucleotide Synthesis (N. Gait, ed., Current Edition); Nucleic Acid Hybridization (B. Hames & S. Higgins, eds., Current Edition); Transcription and Translation (B. Hames & S. Higgins, eds., Current Edition); CRC Handbook of Parvoviruses, Vol. I & II (P. Tijessen, ed.);
Fundamental Virology, 2nd Edition, Vol. I & II (B. N. Fields and D. M. Knipe, eds.)).
The markers of the invention may be detected by any method known to those of skill in the art, including without limitation LC-MS, GC-MS, immunoassays, hybridization and enzyme assays. The detection may be quantitative or qualitative. A wide variety of conventional techniques are available, including mass spectrometry, chromatographic separations, 2-D gel separations, binding assays {e.g., immunoassays), competitive inhibition assays, and so on. Any effective method in the art for measuring the presence/absence, level or activity of a polypeptide or polynucleotide is included in the invention. It is within the ability of one of ordinary skill in the art to determine which method would be most appropriate for measuring a specific marker. Thus, for example, an ELISA assay may be best suited for use in a physician's office while a measurement requiring more sophisticated instrumentation may be best suited for use in a clinical laboratory. Regardless of the method selected, it is important that the measurements be reproducible.
The markers of the invention can be measured by mass spectrometry, which allows direct measurements of analytes with high sensitivity and reproducibility. A number of mass spectrometric methods are available. Electrospray ionization (ESI), for example, allows quantification of differences in relative concentration of various species in one sample against another; absolute quantification is possible by normalization techniques {e.g., using an internal standard). Matrix-assisted laser desorption ionization (MALDI) or the related SELDI® technology (Ciphergen, Inc.) also could be used to make a determination of whether a marker was present, and the relative or absolute level of the marker. Mass spectrometers that allow time-of-flight (TOF) measurements have high accuracy and resolution and are able to measure low abundant species, even in complex matrices like serum or CSF.
For protein markers, quantification can be based on derivatization in combination with isotopic labeling, referred to as isotope coded affinity tags ("ICAT"). In this and other related
methods, a specific amino acid in two samples is differentially and isotopically labeled and subsequently separated from peptide background by solid phase capture, wash and release. The intensities of the molecules from the two sources with different isotopic labels can then be accurately quantified with respect to one another. Quantification can also be based on the isotope dilution method by spiking in an isotopically labeled peptide or protein analogous to those being measured. Furthermore, quantification can also be determined without isotopic standards using the direct intensity of the analyte comparing with another measurement of a standard in a similar matrix.
In addition, one- and two-dimensional gels have been used to separate proteins and quantify gels spots by silver staining, fluorescence or radioactive labeling. These differently stained spots have been detected using mass spectrometry, and identified by tandem mass spectrometry techniques.
In one embodiment, the markers are measured using mass spectrometry in connection with a separation technology, such as liquid chromatography-mass spectrometry or gas chromatography-mass spectrometry. In particular, coupling reverse-phase liquid
chromatography to high resolution, high mass accuracy ESI time-of-flight (TOF) mass spectroscopy allows spectral intensity measurement of a large number of biomolecules from a relatively small amount of any complex biological material. Analyzing a sample in this manner allows the marker (characterized by a specific RT and m/z) to be determined and quantified.
As will be appreciated by one of skill in the art, many other separation technologies may be used in connection with mass spectrometry. For example, a wide selection of separation columns is commercially available. In addition, separations may be performed using custom chromatographic surfaces (e.g., a bead on which a marker specific reagent has been
immobilized). Molecules retained on the media subsequently may be eluted for analysis by mass spectrometry.
Analysis by liquid chromatography-mass spectrometry produces a mass intensity spectrum, the peaks of which represent various components of the sample, each component having a characteristic mass-to-charge ratio (m/z) and retention time (RT). The presence of a peak with the m/z and RT of a marker indicates that the marker is present. The peak
representing a marker may be compared to a corresponding peak from another spectrum (e.g., from a control sample) to obtain a relative measurement. Any normalization technique in the art
(e.g., an internal standard) may be used when a quantitative measurement is desired. "Deconvoluting" software is available to separate overlapping peaks. The retention time depends to some degree on the conditions employed in performing the liquid chromatography separation. The preferred conditions, those used to obtain the retention times that appear in the Tables, are set forth in the Example. The mass spectrometer preferably provides high mass accuracy and high mass resolution. The mass accuracy of a well-calibrated Micromass TOF instrument, for example, is reported to be approximately 5 mDa, with resolution m/Am exceeding 5000.
In other preferred embodiments, the level of the markers may be determined using a standard immunoassay, such as sandwiched ELISA using matched antibody pairs and chemiluminescent detection. Commercially available or custom monoclonal or polyclonal antibodies are typically used. However, the assay can be adapted for use with other reagents that specifically bind to the marker. Standard protocols and data analysis are used to determine the marker concentrations from the assay data.
A number of the assays discussed above employ a reagent that specifically binds to the marker. Any molecule that is capable of specifically binding to a marker is included within the invention. In some embodiments, the binding molecules are antibodies or antibody fragments that specifically recognize the isoform 3.1 of KCNH2 or a fragment thereof. In other embodiments, the binding molecules are non-antibody species, such as aptamers that specifically recognize the isoform 3.1 of KCNH2 or a fragment thereof. Thus, for example, the binding molecule may be an enzyme for which the marker is a substrate. The binding molecules may recognize any epitope of the targeted markers.
As described above, the binding molecules may be identified and produced by any method accepted in the art. Methods for identifying and producing antibodies and antibody fragments specific for an analyte are well known. Examples of other methods used to identify the binding molecules include binding assays with random peptide libraries (e.g., phage display) and design methods based on an analysis of the structure of the marker.
The markers of the invention also may be detected or measured using a number of chemical derivatization or reaction techniques known in the art. Reagents for use in such techniques are known in the art, and are commercially available for certain classes of target molecules.
Finally, the chromatographic separation techniques described above also may be coupled to an analytical technique other than mass spectrometry such as fluorescence detection of tagged molecules, NMR, capillary UV, evaporative light scattering or electrochemical detection.
Measurement of the relative amount of an RNA or protein marker of the invention may be by any method known in the art (see, e.g., Sambrook, J., Fritsh, E. F., and Maniatis, T.
Molecular Cloning: A Laboratory Manual. 2nd, ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989; and Current Protocols in Molecular Biology, eds. Ausubel et al. John Wiley & Sons: 1992). Typical methodologies for RNA detection include RNA extraction from a cell or tissue sample, followed by hybridization of a labeled probe (e.g., a complementary polynucleotide) specific for the target RNA to the extracted RNA, and detection of the probe (e.g., Northern blotting). Typical methodologies for protein detection include protein extraction from a cell or tissue sample, followed by
hybridization of a labeled probe (e.g., an antibody) specific for the target protein to the protein sample, and detection of the probe. The label group can be a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor. Detection of specific protein and
polynucleotides may also be assessed by gel electrophoresis, column chromatography, direct sequencing, or quantitative PCR (in the case of polynucleotides) among many other techniques well known to those skilled in the art.
Detection of the presence or number of copies of all or a part of a marker of the isoform 3.1 of KCNH2 gene of the invention may be performed using any method known in the art. Typically, it is convenient to assess the presence and/or quantity of a DNA or cDNA by Southern analysis, in which total DNA from a cell or tissue sample is extracted, is hybridized with a labeled probe (e.g., a complementary DNA molecule), and the probe is detected. The label group can be a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor. Other useful methods of DNA detection and/or quantification include direct sequencing, gel electrophoresis, column chromatography, and quantitative PCR, as is known by one skilled in the art.
Polynucleotide similarity can be evaluated by hybridization between single stranded nucleic acids with complementary or partially complementary sequences. Such experiments are well known in the art. High stringency hybridization and washing conditions, as referred to herein, refer to conditions which permit isolation of nucleic acid molecules having at least about
80% nucleic acid sequence identity with the nucleic acid molecule being used to probe in the hybridization reaction (i. e., conditions permitting about 20% or less mismatch of nucleotides). Very high stringency hybridization and washing conditions, as referred to herein, refer to conditions which permit isolation of nucleic acid molecules having at least about 90% nucleic acid sequence identity with the nucleic acid molecule being used to probe in the hybridization reaction (i. e., conditions permitting about 10% or less mismatch of nucleotides). As discussed above, one of skill in the art can use the formulae in Meinkoth et al., ibid, to calculate the appropriate hybridization and wash conditions to achieve these particular levels of nucleotide mismatch. Such conditions will vary, depending on whether DNA:RNA or DNA:DNA hybrids are being formed. Calculated melting temperatures for DNA:DNA hybrids are 10°C less than for DNA:RNA hybrids. In particular embodiments, stringent hybridization conditions for DNA:DNA hybrids include hybridization at an ionic strength of 6X SSC (0.9 M Na+) at a temperature of between about 20°C and about 35°C (lower stringency), more preferably, between about 28°C and about 40°C (more stringent), and even more preferably, between about 35°C and about 45°C (even more stringent), with appropriate wash conditions. In particular embodiments, stringent hybridization conditions for DNA:RNA hybrids include hybridization at an ionic strength of 6X SSC (0.9 M Na+) at a temperature of between about 30°C and about 45°C, more preferably, between about 38°C and about 50°C, and even more preferably, between about 45°C and about 55°C, with similarly stringent wash conditions. These values are based on calculations of a melting temperature for molecules larger than about 100 nucleotides, 0% formamide and a G + C content of about 40%. Alternatively, Tm can be calculated empirically as set forth in Sambrook et al., supra, pages 9.31 to 9.62. In general, the wash conditions should be as stringent as possible, and should be appropriate for the chosen hybridization conditions. For example, hybridization conditions can include a combination of salt and temperature conditions that are approximately 20-25°C below the calculated Tm of a particular hybrid, and wash conditions typically include a combination of salt and temperature conditions that are approximately 12-20°C below the calculated Tm of the particular hybrid. One example of hybridization conditions suitable for use with DNA:DNA hybrids includes a 2-24 hour hybridization in 6X SSC (50% formamide) at about 42°C, followed by washing steps that include one or more washes at room temperature in about 2X SSC, followed by additional washes at higher temperatures and lower ionic strength (e.g., at least one wash as about 37°C in
about 0.1X-0.5X SSC, followed by at least one wash at about 68°C in about 0.1X-0.5X SSC). Other hybridization conditions, and for example, those most useful with nucleic acid arrays, will be known to those of skill in the art.
The present invention also includes methods of diagnosing schizophrenia and related methods. In general, it is expected that the biomarkers described herein will be measured in combination with other signs, symptoms and clinical tests of schizophrenia, such as
psychological evaluation, or schizophrenia biomarkers reported in the literature. Likewise, more than one of the biomarkers of the present invention may be measured in combination.
Measurement of the biomarkers of the invention along with any other markers known in the art, including those not specifically listed herein, falls within the scope of the present invention.
Markers appropriate for this embodiment include those that have been identified as increased or decreased in samples obtained from schizophrenia samples compared with samples from non- schizophrenia samples (e.g., any one of markers Ml , M2, M3, M4, M5, M6, M7, M8, M9, M10, Mi l , M12, M13, M14, M15, M16, M17, M18, M19, M20, M21 , M22, M23, M24, M25, M26, M27, M28, M29, M30, M31 , M32, M33, M34, M35, M36, M37, M38, M39, M40, M41 , M42, and M43). Other markers appropriate for this embodiment include fragments, precursors, successors and modified versions of such markers, polypeptides having substantial sequence identity to such markers, components having an m/z value and RT value of about the values set forth for these markers, and molecules comprising one of the foregoing. Other appropriate markers for this embodiment will be apparent to one of skill in the art in light of the disclosure herein.
In specific embodiments, the present invention provides methods for determining whether a subject has schizophrenia. In another aspect, the invention provides methods for diagnosing schizophrenia in a subject. In another aspect, the invention provides methods for determining the likelihood of developing schizophrenia in a subject. In another aspect, the invention provides methods for determining the likelihood that an individual will have increased symptomology associated with schizophrenia. These methods comprise obtaining a biological sample from a subject suspected of having schizophrenia, or at risk for developing
schizophrenia, detecting the expression level or activity of one or more biomarkers of the 3.1 isoform of the KCNH2 gene in the sample, and comparing the result to the expression level or
activity of the marker(s) in a sample obtained from a non-schizophrenia subject, or to a reference range or value established for non-schizophrenic individuals.
As used herein, the term "biological sample" includes a sample from any body fluid or tissue (e.g., serum, plasma, blood, cerebrospinal fluid, urine, brain tissue). Typically, the standard biomarker level or reference range is obtained by measuring the same marker or markers in a set of normal controls. Measurement of the standard biomarker level or reference range need not be made contemporaneously; it may be a historical measurement. Preferably the normal control is matched to the patient with respect to some attribute(s) (e.g., age). Depending upon the difference between the measured and standard level or reference range, the patient can be diagnosed as having schizophrenia or as not having schizophrenia. In some embodiments, schizophrenia is diagnosed in the patient if the expression level of the biomarker or biomarkers in the patient sample is statistically more similar to the expression level of the biomarker or biomarkers that has been associated with schizophrenia than the expression level of the biomarker or biomarkers that has been associated with the normal controls.
What is presently referred to as schizophrenia may turn out to be a number of related, but distinguishable conditions. Classifications may be made, and these types may be further distinguished into subtypes. Any and all of the various forms of schizophrenia are intended to be within the scope of the present invention. Indeed, by providing a method for subsetting patients based on biomarker measurement level, the compositions and methods of the present invention may be used to uncover and define various forms of the disease.
The methods of the present invention may be used to make the diagnosis of
schizophrenia, independently from other information such as the patient's symptoms or the results of other clinical or paraclinical tests. However, the methods of the present invention may be used in conjunction with such other data points.
Because a diagnosis is rarely based exclusively on the results of a single test, the method may be used to determine whether a subject is more likely than not to have schizophrenia, or is more likely to have schizophrenia than to have another disease, based on the difference between the measured and standard level or reference range of the biomarkers of the 3.1 isoform of the KCNH2 gene. Thus, for example, a patient with a putative diagnosis of schizophrenia (e.g., suspected to be suffering from schizophrenia) may be diagnosed as being "more likely" or "less likely" to have schizophrenia in light of the information provided by a method of the present
invention. If a plurality of biomarkers are measured, at least one and up to all of the measured biomarkers must differ, in the appropriate direction, for the subject to be diagnosed as having (or being more likely to have) schizophrenia. In some embodiments, such difference is statistically significant.
The biological sample may be of any tissue or fluid, including a serum or tissue sample, but other biological fluids or tissue may be used. Possible biological fluids include, but are not limited to, plasma, urine and brain tissue. In some embodiments, the level of a marker may be compared to the level of another marker or some other component in a different tissue, fluid or biological "compartment." Thus, a differential comparison may be made of a marker in brain tissue and serum. It is also within the scope of the invention to compare the level of a marker with the level of another marker or some other component within the same compartment.
As will be apparent to those of ordinary skill in the art, the above description is not limited to making an initial diagnosis of schizophrenia, but also is applicable to confirming a provisional diagnosis of schizophrenia or "ruling out" such a diagnosis. Furthermore, an increased or decreased level or activity of the marker(s) in a sample obtained from a subject suspected of having schizophrenia, or at risk for developing schizophrenia, is indicative that the subject has or is at risk for developing schizophrenia.
The invention also provides a method for determining a subject's risk of developing schizophrenia, the method comprising obtaining a biological sample from a subject, detecting the level or activity of a marker in the sample, and comparing the result to the level or activity of the marker in a sample obtained from a non-schizophrenic subject, or to a reference range or value wherein an increase or decrease of the marker is correlated with the risk of developing schizophrenia.
The assay system can also include a means for detecting a control marker that is characteristic of the cell type being sampled can generally be any type of reagent that can be used in a method of detecting the presence of a known marker (at the nucleic acid or protein level) in a sample, such as by a method for detecting the presence of a biomarker described previously herein. Specifically, the means is characterized in that it identifies a specific marker of the cell type being analyzed that positively identifies the cell type. For example, in a brain tissue assay, it is desirable to screen brain tissue for the level of the biomarker of the 3.1 isoform of the KCNH2 gene expression and/or protein activity. Therefore, the means for detecting a
control marker identifies a marker that is characteristic of a brain cell, so that the cell is distinguished from other cell types, such as a connective tissue or inflammatory cell. Such a means increases the accuracy and specificity of the assay of the present invention. Such a means for detecting a control marker include, but are not limited to: a probe that hybridizes under stringent hybridization conditions to a nucleic acid molecule encoding a protein marker; PCR primers which amplify such a nucleic acid molecule; an aptamer that specifically binds to a conformationally-distinct site on the target molecule; and/or an antibody, antigen binding fragment thereof, or antigen binding peptide that selectively binds to the control marker in the sample. Nucleic acid and amino acid sequences for many cell markers are known in the art and can be used to produce such reagents for detection.
The assay systems and methods of the present invention can be used not only to identify patients that are predicted to be responsive to an antipsychotic medication, but also to identify treatments that can improve the responsiveness of schizophrenic patients to antipsychotic medications by identifying patients likely to discontinue a prescribed regimen of antipsychotic medications, and to develop adjuvant treatments that enhance the response of patients to antipsychotic
medications.
The present inventors have demonstrated that patients heterozygous for mutations associated with the 3.1 isoform of the KCNH2 gene have schizophrenia or are likely to develop schizophrenia, and are likely to benefit from the administration of an antipsychotic medication, and are much less likely to discontinue a prescribed regimen of an antipsychotic medication.
Taken together, these data provide the first evidence to indicate that the primate-specific isoform 3. 1 of KCNH2 is strongly associated with schizophrenia and may play a causative roll in development and/or presentation of the clinical disease.
Therefore, one embodiment is a method for predicting the clinical response of a schizophrenic patient to an antipsychotic medication by detecting one or more markers of
KCNH2 in a biological sample form a schizophrenia patient. The clinical response may include benefits to the schizophrenic patient, including a significant reduction in ratings of positive schizophrenic syndrome, significant improvement in general psychopathology, and significant decrease in thought disturbance.
Another embodiment is a method of identifying a patient at risk for developing schizophrenia by detecting the presence of mutations in KCNH2 in a biological sample of a subject having or suspected of having a schizophrenia.
Thus, another aspect of the present invention provides methods for predicting the clinical response of a patient having schizophrenia to an antipsychotic medication, including, for example one or more of olanzapine, perphenazine, quetiapine, risperidone, and ziprasidone. In one embodiment of this aspect of the invention the method of identifying patients that will respond to antipsychotic therapies includes obtaining a biological sample from a schizophrenia patient, and detecting in the sample for the presence of a maker of the invention which is a marker of the expression of the 3.1 isoform of the KCNH2 gene.
The presence of at least one mutation that is associated with the 3.1 isoform of the KCNH2 is indicative of whether or not the patient is likely to benefit from an antipsychotic medication. Alternatively, the absence of a biomarker of the invention that is associated with the 3.1 isoform of the KCNH2 protein or expression is indicative of an individual that is not likely to benefit from the administration of an antipsychotic medication. Any schizophrenic patient may be analyzed by these methods in order to assess the prognosis of the patient and assess the likely benefit of administering antipsychotic medications and therapies.
Another aspect of the present invention provides methods that can be used to identify individuals at risk for developing schizophrenia, and/or for predicting the prognosis of a patient having schizophrenia. This aspect of the invention relates to the discovery that the biomarkers of the invention that are associated with the 3.1 isoform of KCNH2 are associated with an increased risk and incidence of schizophrenia. Therefore, one embodiment of this aspect of the invention provides a method of diagnosing or assessing the risk of developing schizophrenia in an individual including obtaining a biological sample from an individual, analyzing the sample for the presence of at least one biomarker of the invention associated with the 3.1 isoform of KCNH2. Elevated gene expression and/or protein function of the 3.1 isoform of KCNH2 indicates that the individual is at risk for developing schizophrenia or is suffering from schizophrenia and is likely to benefit from the administration of an antipsychotic therapy, including an antipsychotic medication, and is unlikely to prematurely discontinue a prescribed regimen of antipsychotic medication. Alternatively, very low or absent gene expression and/or protein function of the 3.1 isoform of KCNH2 indicates that the individual is at low risk for
developing schizophrenia or is unlikely to be suffering from schizophrenia and is unlikely to benefit from the administration of an antipsychotic therapy, including an antipsychotic medication, and is more likely to prematurely discontinue a regimen of an antipsychotic medication prescribed to that patient.
According to the present invention, the individual being tested can be a human or non- human primate. The individual may or may not be suspected of having schizophrenia. In one embodiment, the individual being tested has not been diagnosed as having schizophrenia. In another embodiment, the individual has been diagnosed as having a schizophrenia.
As used herein, a mutation refers to an alteration in a sequence of nucleotides in an KCNH2 nucleic acid molecule, such that the sequence of nucleotides is no longer identical to the sequence of nucleotides at the corresponding location in a wild-type KCNH2 gene. Such alterations can be nucleotide insertions, substitutions, deletions or modifications.
Any method suitable for detecting mutations in nucleic acid molecules can be used to practice the present invention. In one embodiment, at least a portion of the sequence of a
KCNH2 nucleic acid molecule present in the sample is determined and compared to the corresponding sequence in the wild-type, KCNH2 gene. Any method that is capable of determining the sequence of a nucleic acid molecule can be used to determine the sequence of KCNH2 nucleic acid molecules in the sample. Such methods include, but are not limited to Sanger dideoxy sequencing, Pyrosequencing, RNA sequencing, next-generation sequencing technologies, single-strand conformation polymorphism, heteroduplex analysis, DNA microarray technology, denaturing gradient gel electrophoresis, allele-specific PCR, Scorpion Amplification Refractory Mutation System (SARMS) technology, SNaPshot analysis of PCR products, and mass spectrometry.
The inventors have disclosed specific mutations in KCNH2 genes that were obtained from brain tissue, indicating that the presence of at least one of these mutations in a KCNH2 nucleic acid molecule correlates with the presence of the 3.1 isoform of KCNH2 and/or schizophrenia of symptomatology of schizophrenia. Thus, in one embodiment, the step of analyzing comprises testing the nucleic acid molecules in the sample from a patient or individual for a mutation selected from the group consisting of Marker Ml , M2, M3, M4, M5, M6, M7, M8, M9, M10, Mi l , M12, M13, M14, M15, M16, M17, M18, M19, M20, M21 , M22, M23, M24, M25, M26, M27, M28, M29, M30, M31, M32, M33, M34, M35, M36, M37, M38, M39,
M40, M41 , M42, and M43. The In another embodiment, the step of analyzing comprises testing the nucleic acid molecules in the sample from a patient or individual for a mutation selected from the group consisting of at least one single nucleotide polymorphism in the KCNH2 gene selected from rs3900779, rs748693 and rsl036145.
It will be appreciated by those skilled in the art that such nomenclature (i. e., M10) refers to a specific position in the KCNH2 transcript. However, it is equally understood that such mutations correspond to mutations in the genomic DNA (e.g. rsl036145), and the mutations could also be referred to by nomenclature signifying their genomic location. Methods of detecting specific mutations in nucleic acid molecules are known in the art and can be utilized in the present invention. For example, as noted above, the full sequence of a KCNH2 nucleic acid molecule present in the sample could be determined and compared to the wild-type KCNH2 gene sequence.
In one embodiment, the polymerase chain reaction (PCR) is used to test for the presence of specific mutations. With regard to this embodiment, it is known that PCR relies on
hybridization of nucleic acid primers to the nucleic acid molecule being amplified (i.e. the template nucleic acid molecule). It is also known in the art that mismatches in the hybridization between the nucleic acid primers and the template nucleic acid molecule can result in polymerase failing to extend the primers. In particular, if the 3' nucleotide in the primer does not pair with the nucleotide at the complementary position in the template, the polymerase fails to extend the primer and the template DNA is not amplified. Thus, in one embodiment of the present invention, the step of analyzing comprises performing PCR using primers specific for a KCNH2 nucleic acid template. In a further embodiment, the PCR is performed using primers in which the 3' nucleotide of at least one primer that does not pair with the nucleotide at the complementary position in the template. Other methods of detecting specific mutations can also be used to practice the present invention including, for example, single stranded conformation
polymorphism analysis, loss/gain of restriction site analysis, heteroduplex analysis.
The 3.1 isoform of KCNH2 may also be determined by the expression and/or the activity level of the corresponding protein. Methods of measuring these activities are disclosed herein, and are known to those skilled in the art. For example, the 3.1 isoform of KCNH2 can be determined using protein-protein binding assays known to those skilled in the art. One example of such an assay is an imunoprecipitation assay. In such an assay, the proteins to be tested for
binding are mixed together to allow binding, and then a precipitable capture molecule, such as a bead-bound antibody that binds to the 3.1 isoform of KCNH2, is added to the mixture. The capture molecule is then precipitated and the precipitate analyzed, for example using PAGE analysis and/or immunoblotting, to determine what proteins co-precipitate with the capture molecule. Such techniques are known to those skilled in the art.
Another useful assay for measuring protein-protein interactions is an enzyme-linked immunosorbent assay (ELISA). Such an assay comprises: a) contacting an ELISA plate, which is coated with a suitable amount of a first protein, with a solution containing a second protein being tested for its ability to bind the first protein; and b) determining if the first and second protein form a complex. The step of determining if a protein-protein complex is formed comprises assaying for the presence of a complex using an antibody to the second protein. The above description is a general description of an ELISA assay, and variations of such an assay are known to those skilled in the art.
Another embodiment of the invention relates to an assay kit for selecting a schizophrenic patient who is predicted to benefit or not to benefit from therapeutic administration of an antipsychotic medication. The assay kit includes: (a) a means for detecting in a biological sample obtained from the patient a level of a biomarker of the invention, which is a marker of the expression of the 3.1 isoform of KCNH2. The kit also includes: (b) a control selected from: (i) a control sample for detecting expression of the 3.1 isoform of KCNH2; (ii) a control sample for detecting low or absent expression of the 3.1 isoform of KCNH2; (iii) information containing a predetermined control level of the expression of the 3.1 isoform of KCNH2; and/or (iv) information containing a predetermined control level of a biomarker of the expression of the 3.1 isoform of KCNH2. In one aspect, the kit can further include at least one means for detecting at least one mutation in a KCNH2 polynucleotide.
A Novel, Primate-Specific Brain Isoform of CNH2: Role in Cognition, Hippocampal Biology and Association with Schizophrenia
Organized neuronal activity is critical for cortical information processing and is disrupted in schizophrenia. We have identified a primate-specific isoform (3.1) of the potassium channel KCNH2 that controls neuronal firing. Several SNPs in a 3kb upstream region are associated with schizophrenia in four independent datasets. The risk-SNPs affect memory, IQ and speed of
cognitive processing as well as hippocampal structure and physiology. Isoform 3.1 mRNA levels are comparable to KCNH2-1A in prefrontal cortex and hippocampus, but over 1000-fold lower in heart. Postmortem expression analysis shows a 2.5-fold increase in Isoform 3.1 relative to KCNH2-1 A in schizophrenic hippocampus and association with risk SNPs. Structurally, Isoform 3.1 lacks most of the PAS domain critical for slow channel deactivation. Electrophysiological characterization in rodent cortical neurons reveals that overexpression of Isoform 3.1 results in a rapidly deactivating K+ current and a high-frequency, non-adapting firing pattern. These results reveal an unexpected role of a novel CNH2 channel in cortical physiology, cognition, and psychosis and provide a potential new target for psychotherapeutic drugs.
Introduction
Using a combination of genetic, brain imaging, and behavioral analyses in the present study, we have identified a novel schizophrenia susceptibility gene - the KCNH2 potassium channel - in four independent clinical samples, and we have also found association with several intermediate phenotypes, including impaired cognition and imaging measures of HF structure and function in a sample of normal individuals who carry risk alleles. KCNH2 (also called hERGl), Genbank accession No. U04270, a member of the ether-a-go-go related family of voltage gated potassium channels (J. W. Warmke and B. Ganetzky 1994 Proc Natl Acad Sci U S A 91 :3438), is best known for its role in slow repolarization of the membrane potential during the myocardial action potential, thereby regulating the QT interval (M. C. Sanguinetti and M. Tristani-Firouzi 2006 Nature 440:463). Despite extensive characterization of CNH2 in myocardial cells, surprisingly few studies have been carried out in neurons, let alone in human or non-human primate neurons. However, KCNH2 is expressed abundantly in many brain regions including hippocampus and frontal cortex (L. Guasti et al. 2005 J Comp Neurol 491 : 157; M. J. Saganich et al. 2001 J Neurosci 21 :4609). Its distinct physiological features, namely slow activation, fast inactivation, and slow and voltage-dependent deactivation (J. W. Warmke and B. Ganetzky 1994 Proc Natl Acad Sci U S A 91 :3438, M. C. Trudeau et al. 1995 Science 269:92; P. L. Smith et al. 1996 Nature 379:833; J. H. Morais Cabral et al. 1998 Cell 95:649), make KCNH2 an excellent candidate in controlling neuronal firing patterns and network oscillation in PFC and HF. Modeling work predicts that KCNH2 is critical for spike-frequency adaptation, or a gradual termination of a train of evoked action potentials, a common firing pattern seen in excitatory neurons in the brain (N. Chiesa et al. 1997 J Physiol 501 :313). Several studies have shown that
inhibition of KCNH2 converts low-frequency, adapting to high-frequency, non-adapting neuronal discharges (N. Chiesa et al. 1997 J Physiol 501 :313; T. Sacco et al. 2003 J
Neurophysiol 90:1817), a firing pattern necessary for sustained neuronal activity subserving numerous complex cognitive functions (Y. Wang et al. 2006 Nat Neurosci 9:534).
To unravel the molecular mechanisms of our clinical associations with KCNH2, we have characterized the expression of KCNH2 mRNA in postmortem human brain. This led to the unexpected identification of a novel, primate brain specific isoform (Isoform 3.1) with its transcription start site near the risk sequence variants. Remarkably, the expression of Isoform 3.1 is increased in the hippocampus of schizophrenia patients and even in normal individuals who carry risk alleles of KCNH2. These results prompted us to introduce the gene into rodent cortical neurons, which do not express endogenous Isoform 3.1. Expression of Isoform 3.1 significantly alters hERG channel's deactivation rate, resulting in high-frequency, non-adapting firing patterns. Such changes in spike frequency could lead to desynchronization of neuronal assemblies thought to be a critical aspect of cortical dysfunction in schizophrenia (G. Winterer and D. R. Weinberger 2004 Trends Neurosci 27:683). Together, these convergent results implicate a role of a novel KCNH2 isoform in the etiology and pathophysiology of schizophrenia and make it a promising new target for antipsychotic therapy.
Identification of the NOS3 KCNH2 region associated with schizophrenia
It has become increasingly apparent that genetic risk for schizophrenia and many other complex illnesses will not relate to major amino acid changes and highly detrimental protein mutations, though these may still occur in rare forms of the illness (R. E. Straub and D. R.
Weinberger 2006 Biol Psychiatry 60:81). Instead, the molecular effects of susceptibility genes are more likely to be subtle, relating to the regulation and splicing of transcripts or proteins. Thus, the gene expression profiles of patient tissue may provide clues to the identification of candidate risk genes. Preliminary support for this possibility has emerged from the association of RGS4 (M. E. Talkowski et al. 2006 Schizophr Bull 32:203) and CNP (T. R. Peirce et al. 2006 Arch Gen Psychiatry 63: 18) with schizophrenia, which were originally identified as candidate genes from microarray expression profile analyses in postmortem brain of patients with schizophrenia (K. Mimics et al. 2001 Mol Psychiatry 6:293). Consequently, we selected 10 genes recently reported as differentially expressed in a large number of schizophrenia patients as determined by microarray (S. Prabakaran et al. 2004 Mol Psychiatry 9:684) and genotyped
haplotype tagging SNPs (htSNPs) taken from HapMap (release #15) in 170 Caucasian families with an offspring with schizophrenia. Family-based association analysis was performed (N. M. Laird et al. 2000 Genet Epidemiol 19 (Suppl 1) S36) and nominally significant signals were observed in 5 of the 10 genes (Table 2). In particular, SNPs located in the genomic region of NOS3 (7q36.1) demonstrated the highest linkage disequilibrium (LD) with the illness. The positive SNPs in this region, however, mapped upstream of NOS3, within a neighboring gene, KCNH2, which is transcribed in the opposite direction (Fig. 5; Fig. 1 1). A survey of comparative genomic databases indicates that the genomic contiguity and orientation of NOS3 and KCNH2 is highly conserved among mammalian species.
Referring to Fig. 5 (top) is shown the inverse log of the p-value from family-based association results for the CBDB Sibling Study (GC, diamonds), NIMHGI-C (GI-C, squares), NIMHGI-AA (GI-AA, triangles) and for the German case-control study (G, circles) for single SNPs and 3-SNP sliding window haplotypes. Only markers and haplotypes with p-values less than 0.1 are shown. A physical map of the region is given and depicts known genes within the region. Referring to Fig. 5 (bottom), the LD structure of the genotyped markers is given for 370 unrelated healthy control Caucasians and depicted as D'. Graphics were created using the R package snp. plotter available from nicodemusk@mail.nih.gov (A. Luna and K. K. Nicodemus 2007 Bioinformatics 23:774-776).
KCNH2 as a risk gene for schizophrenia
A haplotype block indicative of minimal historical recombination (S. B. Gabriel et al. 2002 Science 296:2225) containing parts of NOS3 and KCNH2 was observed in persons of Western European ancestry genotyped by the International HapMap Project (The International HapMap Project 2003 Nature 426:789). The haplotype block begins 1.2Kb downstream of the NO S 3 transcription start site (in the 5' UTR) and extends 21.3Kb upstream of this gene (Fig. 11). The initial 13.1 Kb of this upstream region are non-coding and intergenic, but the remainder overlaps with 6.9Kb of KCNH2. Of the 3 htSNPs required to tag this region (S. B. Gabriel et al. 2002 Science 296:2225), rsl036145 (M33) was over-transmitted (p = 0.0032) to schizophrenia patients in a cohort of 295 Caucasian families (CBDB cohort) as was the entire haplotype block (global p = 0.005).
Based on these data it was expected that M33 is in strong LD with causative SNP(s) and/or responsible for the association signal itself. Consequently, additional dbSNPs were
genotyped across a region stretching from the 3'-end of KCNH2 to the 3'-end of NOS3, with highest coverage focused around M33. A 7.2 Kb region flanking M33 was re-sequenced in 48 schizophrenia patients to detect rare or unreported SNPs. We also re-sequenced exons 1-3 of KCNH2 and their intronic borders (total sequence 10.4 kb) and no coding polymorphisms were discovered. A total of 43 SNPs were genotyped in the CBDB cohort including 11 novel SNPs. Six SNPs were significantly associated with schizophrenia (5 with p < 0.01) as were many of the 3-marker haplotypes containing them (Fig. 5; Fig. 12, Table 3). The majority of these
significantly associated SNPs map to a small 3 kb segment of intron two of KCNH2.
Referring to Fig. 12, single-marker and 3-marker sliding-window results are shown for CBDB, NIMHGI-C, NIMHGI-AA, and RU cohorts. SNPs denoted novel were identified by re- sequencing DNA from 48 schizophrenia patients (see Example 1). Fig. 12A depicts the FBAT three marker sliding windows in CBDB family sample (CBDB Sibling Study 3-SNP Sliding Window Haplotype Results (296 families). Fig. 12B depicts the FBAT three marker sliding windows in NIMH-C family sample (NIMHGI-C 3 SNP Sliding Window Haplotype Results (71 families). Fig. 12C depicts the FBAT three marker sliding windows in NIMH-AA family sample (NIMHGI-AA SNP Sliding Window Haplotype Results (51 families). Fig. 12D depicts the Haplo. stats three marker sliding windows in German case control sample (German Case-Control 3-SNP sliding window haplotype results).
Forty of these markers were then genotyped in the two additional family-based cohorts derived from the NIMH Genetics Initiative project (C. R. Cloninger et al. 1998 Am J Med Genet 81 :275), consisting of 71 Caucasian families (NIMHGI-C) and 51 African American families (NIMHGI-AA). Though substantially limited in power due to the small number of families, SNPs and/or haplotypes in the same small region were significantly associated with
schizophrenia in both datasets (Fig. 5; Fig. 12, Table 3). In particular, in all 3 populations the association signal was localized to intron 2 of KCNH2, though significantly associated SNPs were not identical in all cohorts, as has been found in association with a number of other putative schizophrenia genes (R. E. Straub and D. R. Weinberger 2006 Biol Psychiatry 60:81). However, two common overlapping haplotypes containing A-G at M9 and MIO and C-G at M21 and M22 were associated with risk in both Caucasian family datasets: in the NIMHGI-C (M9-M10 global p = 0.079, haplotype p = 0.076; M21 -M22 global p = 0.092, haplotype p = 0.082) and CDBD (M9-M10 global p = 0.048, haplotype p = 0.083; M21-M22 global p = 0.098, haplotype p =
0.10). Also, consistent with single SNP analyses, haplotypes containing M30 major allele G were negatively associated with schizophrenia in both the CBDB sample (global p = 0.023, haplotype p = 0.01) and NIMHGI-C (global p = 0.10, haplotype p = 0.028), even though no association between M30 and schizophrenia was observed in the single SNP analyses of NIMHGI-C.
Haplotype C-A-G at M32-M33-M34 was significantly positively associated in both the CBDB and NIMH-GI AA samples (CBDB haplotype p = 0.008; NIMHGI-AA haplotype p = 0.044). Interestingly, one rare SNP (Caucasian MAF = 0.007) was found in eight families across all study cohorts, and all of the nine affected offspring in these families inherited the same rare allele from a heterozygous parent (see Fig. 13). Referring to Fig. 13, all families found to contain at least one individual with the rare allele (T) are depicted. Plots follow standard pedigree methods (black = affected/schizophrenic, etc.). All individuals with "-/-" genotypes were unavailable for DNA collection. Note that all affected offspring inherit rare allele and all individuals were Caucasian.
Finally, given the positive family-based association signals, we tested for association in a fourth sample, a Caucasian case-control dataset collected in Germany consisting of 501 patients and 626 controls, typing the 6 significantly associated SNPs found in the CBDB cohort and also the novel SNPs that were found by resequencing. Using logistic regression for the single SNPs, significant association was observed in SNPs M20 and M30 corresponding to odds ratios of 2.99 (CI = 1.26, 7.1 1) and 1.58 (CI = 1.05, 2.38), respectively (Fig. 5; Table 3). Thus, in our two reasonably powered Caucasian samples, we confirm association for the same two SNPs and for the same alleles, and show evidence for association to varying haplotypes in two other small family samples, including one of AA origin. Taken together, these results identify the region of CNH2 as a susceptibility locus for schizophrenia and suggest that KCNH2 is the gene responsible for this association.
Impact of KCNH2 SNPs on cognition, hippocampal structure and function
If inheriting variations of SNPs within this region increases risk for schizophrenia by altering brain function, then such genetic variations should be associated with schizophrenia intermediate brain phenotypes in individuals who carry risk alleles even if they do not manifest the entire diagnostic syndrome (A. Meyer-Lindenberg and D. R. Weinberger 2006 Nat Rev Neurosci 7:818). A variety of cognitive deficits, related to attention, memory, and IQ/processing speed have been prominently implicated as intermediate phenotypes related to schizophrenia and
are associated with increased relative risk in unaffected relatives of patients (T. D. Cannon et al. 2000 Am J Hum Genet 67:369; M. F. Egan et al. 2000 Am J Psychiatry 157:1309; M. F. Egan et al. 2001 Biol Psychiatry 50:98; T. E. Goldberg et al. 2003 Arch Gen Psychiatry 60:889). Given the high expression of KCNH2 within the prefrontal cortex (PFC) and HF, two regions subserving these cognitive processes and consistently implicated in the neuropathology of schizophrenia (P. J. Harrison 1999 Brain 122:593, D. R. Weinberger et al. 2001 Biol Psychiatry 50:825), it is reasonable to expect that if risk SNPs impact on the biology of these brain regions, such cognitive deficits would also be associated with risk genotypes, regardless of disease status. Accordingly, the most significantly associated SNPs from the CBDB study (M30, M31 , M33) were assessed for their effects on seven independent summary measures of cognitive function (Genderson, M.R. et al. Schiz Res (in press)) (Table 4) in an independent sample of healthy, unrelated controls who were screened to exclude individuals with a history of psychiatric disorders. Using linear regression adjusting for age in models assessing speed of processing (correlation coefficient p-value for test of processing speed and age = 0.0062; t-test p-value for differences in means by sex = 0.57) and no covariates in models assessing visual memory (t-test p-value for differences in means by sex = 0.26; correlation coefficient for visual memory by age = 0.75), significant association was observed between risk genotypes and performance on IQ/processing speed and visual memory tasks (Fig. 6A; Table 4). Thus, even in healthy controls, individuals carrying the same alleles observed more frequently in schizophrenia patients performed significantly worse on tasks measuring IQ, visual reasoning and memory, and timed sequencing than subjects without risk alleles.
The genetic associations with cognition suggest that variation in KCNH2 impacts on the biology of the neural systems that subserve these functions. Declarative memory is strongly dependent on hippocampal function, where at least in rodents, KCNH2 is most abundantly expressed (M. J. Saganich et al. 2001 J Neurosci 21 :4609). Thus, these associations could reflect genetic modulation of the physiology of memory processing within the HF, and they might also represent more fundamental changes at the level of structural development of the hippocampus. Therefore, we hypothesized that the same SNPs significantly associated with schizophrenia in the CBDB family sample and the case control sample from Germany would relate to changes in hippocampal structure and physiology, and again, if such changes are manifestations of the biology of gene effects in brain, then healthy controls carrying risk alleles would be predicted to
show evidence of such changes. We have argued for the use of healthy controls for genetic associations at the level of brain morphometry and information processing in order to avoid potential confounders related to chronic illness and medical treatment (A. R. Hariri and D. R. Weinberger 2003 Br Med Bull 65 :259). Voxel-based morphometry (VBM) was used to assess regional brain volumes, focusing on the HF, of a sample of healthy control subjects.
Following FDR correction (a = 0.05), significant volume decreases in hippocampal structures were observed in individuals carrying the minor alleles (risk alleles) of SNPs M30, M31 , and M33 using both whole brain and region of interest (ROI) analyses, and additive allele load effects were observed (Fig. 6B; Figs. 14-18; Tables 5-8). Control analyses based on non- risk SNPs were consistently negative for association with VBM changes (Figs. 14-18, Tables 5- 8).
Because abnormal cognitive function reflects physiologic dysfunction, we predicted that the same SNPs would impact on the physiology of memory processing subserved by the HF, again in healthy control risk allele carriers. In order to control for the effects of task performance on the fMRI response and thus to isolate the effect of genotype on the physiology of information processing, genotype groups were matched for performance on cognitive tasks (accuracy and reaction time). This matching strategy allowed a test of the effect of genotype on how cognitive information is handled physiologically at the neural system level, independent of how well subjects perform on the task. fMRI was used to assess regional activation during incidental encoding of a temporal lobe memory task (A. R. Hariri et al. 2003 J Neurosci 23 :6690), again within healthy control subjects. We observed significantly greater activation (FWE correction a = 0.05) of the HF within normal risk carriers (Fig. 6C; Figs. 14-18, Tables 5-8). This pattern of inefficient (i.e., excessive activity for a fixed level of performance) processing of memory information suggests that the tuning of the cortical microcircuits subserving memory processing in the HF is relatively disordered in individuals with risk genotypes. Similar patterns of inefficient processing of memory in HF have been reported for other genes impacting on episodic memory (e.g., S. Y. Bookheimer et al. 2000 N Engl J Med 343 :450 and G. Egan et al. 2003 Proc Natl Acad Sci USA 100: 15241).
Referring to Fig. 6A, genotype effects of most significant family-based markers on cognitive performance measures are shown. P-values for the regression model are based on two- degree of freedom F-tests. Linear regression was used to assess differences between cognitive
measures and heterozygote (G/A) and homozygote (A/ A) carriers with respect to G/G non-risk carriers. P-values for each genotype comparison are shown followed by β-coefficients for genotypes indicated. Significant main effects (p<0.05) are shown in bold. Referring to Fig. 6B, optimized voxel based morphometry analysis (VBM) of a different cohort of healthy control carriers was performed using an analysis of covariance model with gray matter volume (GM), age, and gender as covariates of no interest. Thresholded (p=0.05 FDR corrected) statistical maps show a relative linear decrease in HF GM from subjects homozygous for the risk allele (n = 17) to heterozygote carriers (n = 59) to non carriers (n= 63). Referring to Fig. 6C, thresholded (p< 0.05 FWE corrected) statistical t-maps and mean (±1 SEM) percent blood oxygen level- dependent (BOLD) signal change during the encoding conditions of a declarative memory task in the left posterior hippocampus (MNl coordinates of peak cluster: -34 -25 -15 mm) showing a significant linear increase of activation in homozygote carriers (n= 14) relative to heterozygote carriers (n=37), and to non carriers (n=28) of the risk allele of the M30 SNP.
Referring to Fig. 14, genotype based differences in right hippocampal gray matter volume (MNl coordinates: 26, -12, -22 mm) for SNP M30 were derived using optimized VBM. This plot (Fig. 14A) and the thresholded (p=0.05 FDR corrected) statistical t-maps (Fig. 14B) show a linear decrease in gray matter volume from homozygotes (n=17) for the risk allele, to
heterozygote carriers (n=59) to non carriers (n=63). For illustrative purposes, the measures for hippocampal gray matter volume were mean centered and extracted from the most significant right anterior hippocampal cluster on ANCOVA analysis in SPM 2 using age, gender, and total gray matter volume as covariates of no interest.
Referring to Fig. 15, genotype based differences in right hippocampal gray matter volume (MNl coordinates: 26, -9, -24 mm) for SNP M31 were derived using optimized VBM. This plot (Fig. 15 A) and the thresholded (p=0.05 FDR corrected) statistical t-maps (Fig. 15B) show a linear decrease in gray matter volume from homozygotes (n=16) for the risk allele, to
heterozygote carriers (n=59) to non carriers (n=66). For illustrative purposes, the measures for hippocampal gray matter volume were mean centered and extracted from the most significant right anterior hippocampal cluster on ANCOVA analysis in SPM 2 using age, gender, and total gray matter volume as covariates of no interest.
Referring to Fig. 16, genotype based differences in right hippocampal gray matter volume (MNl coordinates: 26, -9, -24 mm) for SNP M33 were derived using optimized VBM. This plot
(Fig. 16A) and the (p=0.07 FDR corrected) statistical t-maps (Fig. 16B) show a linear decrease in gray matter volume from homozygotes (n=16) for the risk allele, to heterozygote carriers (n=61), to non carriers (n=64). For illustrative purposes, the measures for hippocampal gray matter volume were mean centered and extracted from the most significant right anterior hippocampal cluster on ANCOVA analysis in SPM 2 using age, gender, and total gray matter volume as covariates of no interest.
Referring to Fig. 17, genotype based differences in hippocampal engagement during a declarative memory task for SNP M31 are shown. Fig. 17A depicts mean (±1 SEM) percent BOLD signal change during the encoding condition of the task in the left posterior hippocampus (MNI coordinates of peak cluster: -34 -22 -15 mm) showing a significant linear increase of activation in homozygote carriers (n= 12) relative to heterozygote carriers (n=35) and non carriers (n=30) of the risk allele. Thresholded (p< 0.05 FWE corrected) statistical t-maps are shown in Fig. 17B.
Referring to Fig. 18, genotype based differences in hippocampal engagement during a declarative memory task for SNP M33 are shown. Fig. 18A depicts mean (±1 SEM) percent
BOLD signal change during the encoding condition of the task in the left posterior hippocampus (MNI coordinates of peak cluster: -34 -22 -15 mm) showing a significant linear increase of activation in homozygote carriers (n=l 1) relative to heterozygote carriers (n=37) and non carriers (n=27) of the risk allele. Thresholded (p< 0.05 FWE corrected) statistical t-maps are shown in Fig. 18B.
Effects of schizophrenia and risk genotypes on KCNH2 mRNA expression
The association of genetic markers with schizophrenia and with related brain phenotypes in 5 independent data sets including samples of European and non-European ancestry and in healthy controls screened for psychiatric disorders lends strong support to the involvement of this genomic region in manifestations of the illness, including its neural system biology.
However, these findings do not identify the underlying molecular mechanisms of risk. To begin addressing this issue, we investigated gene expression in human brain and its relationship to our evidence of genetic association. Indeed, using quantitative RT-PCR in a sample of postmortem brains from 31 schizophrenia and 69 healthy control subjects, we found KCNH2-1A expression levels to be significantly lower in the DLPFC of schizophrenia patients (p = 0.008; Fig, 7A). We also replicated the increase in NOS3 expression (p = 0.019; Fig. 6A) in DLPFC reported earlier
in another set of postmortem schizophrenic brains (S. Prabakaran et al. 2004 Mol Psychiatry 9:684) (Table 9). Furthermore, given the enrichment of both genes within the HF, we also measured their expression in this region in a largely overlapping cohort of 29 schizophrenia and 59 healthy control subjects. KCNH2-1A was again significantly reduced in schizophrenia patients (p = 0.005; Fig. 7A).
Most patients with schizophrenia receive antipsychotic drugs, which may bind to KCNH2 and affect its expression (S. Kongsamut et al. 2002 Eur J Pharmacol 450:37). In order to assess the possibility that the observed changes in either gene might be a consequence of antipsychotic medication, 63 rats (8-10 per treatment group) were administered one of three doses of clozapine or haloperidol for 28 days. Neither clozapine nor haloperidol showed significant effects on the expression of either gene measured within the frontal cortex (Fig. 19). However, a slight decrease in CNH2-1 A was observed in rats treated with 0.08 and 0.6 mg/kg/day of haloperidol though this did not reach significance (p=0.082 and 0.119, respectively). Thus, the effects of medication on the observed decrease in KCNH2-1 A cannot be excluded.
Referring to Fig. 7 A, differences in mRNA expression within the hippocampus of 30 schizophrenia patients/62 healthy control subjects, and within the DLPFC of a largely
overlapping set of 31 schizophrenia patients/69 healthy control subjects are shown. All expression values were normalized to the geometric mean of three housekeeping genes (B2M, GUSB, and PBGD) (J. Vandesompele et al. 2002 Genome Biol 3.-RESEARCH0034) and are expressed as fold difference versus the mean of healthy controls. Data were tested for main effects using backwards stepwise linear regression using age, pH, RIN, and diagnosis as independent variables, p-values represent main effect of diagnosis in the final regression model.
Fig. 7B depicts the association of marker 33 (M33) risk genotype (A carriers) with Isoform 3.1 expression within the hippocampus (data from A) with respect to rave and diagnosis. Main effect of genotype was determined following the same linear regression modeling as in A but within Caucasian and African American subsets separately and including M33 as a variable in the model. M33 A/G individuals were pooled due to the small number of A/A individuals. No significant differences were observed between A/G and G/G carriers as determined by multinomial logistic regression. All error bars represent one standard error of the mean.
Referring to Fig. 19, 8-10 rats per treatment group were treated with one of three doses of either Haloperidol (0.08, 0.6, and lmg/kg) or Clozapine (0.5, 5, 10 mg/kg) for 28 days (as
compared to rats treated with vehicle alone). Frontal cortex expression levels of NOS3 (ABI assay Rn02132634_sl) and CNH2-1 A (ABI assay Rn01442523_ml) were normalized to the geometric mean of two housekeeping genes (GAPDH, B2M). Effects of antipsychotic treatment on gene expression were tested by linear regression with gene expression as the dependent variable. Differences between vehicle alone and the two therapeutic range equivalent dosages (0.08 and 0.6 mg/kg/day of Haloperidol; 0.5 and 5 mg/kg/day of Clozapine) were tested using post-hoc LSD. No significant differences were observed between any neuroleptic treatment group and vehicle only treated rats, p-values for the treatment with the greatest difference as compared to vehicle alone are shown for Haloperidol.
Given the physical proximity of KCNH2-1 A to the genetic association signals in the clinical samples and its differential expression in schizophrenia patients, it seemed plausible that the molecular mechanism of association might involve transcriptional regulation. By the same logic applied to the cognition and imaging analyses, if genetic risk affects the transcription of KCNH2-1A, then individuals with risk alleles, even if normal controls, should have expression profiles of these genes similar to those of schizophrenia patients (i.e., reduced levels).
Accordingly, we tested for differences in the expression of KCNH2-1 A between healthy controls who were carriers of risk alleles versus those who were not. No significant effect of risk genotype was observed (KCNH2-1A: p = 0.52; Table 10). NOS3 expression also showed no association with risk SNPs (Table 10). It is important to note that differential expression of KCNH2 was not detected in the original microarray study though an increase in NOS3 was (Prabakaran, S. et al. 2004 Mol Psychiatry 9:684-697; Huffaker, A et al. 2006 Proc Natl Acad Sci U S A 103:10098-10103). Though this may reflect the overall greater average PMI of the sample set used in the microarray study, it more likely relates to the regions of KCNH2 probed by the microarrays. The 2 probe sets for KCNH2 included on the HG-U1 33 A (Asymetrix) microarrays are located in the 3'-UTR of the gene (Figure 1 1). These probe sets would therefore be unable to distinguish the different isoforms particularly given the highly conserved 3'-UTR structure in KCNH2-1A and Isoform 3.1. Moreover, here, using isoform specific RT-QPCR, we report significant reductions in the expression of KCNH2-IA with concomitant increases in the expression of Isoform 3.1. Thus, the combined detection of both isoforms might result in little to no 'net' difference. While this may indicate the presence of allelic heterogeneity (i.e., different SNPs confer risk to the illness in different populations), it may also suggest that the molecular
effects of genetic risk do not impact on the expression of KCNH2-1 A, or they may relate to more complex aspects of gene processing, such as the splicing of transcripts or the expression of other isoforms.
Identification of a novel KCNH2 isoform in human brain
Due to the large size of KCNH2 intron 2 and the presence of several regions highly conserved across species (genome.ucsc.edu), the effects of the risk SNPs may relate to the splicing of an, as yet, unidentified exon or the expression of a novel isoform in this intronic region. Using 5'-RACE on total RNA pooled from the DLPFC of 10 schizophrenia patients and beginning from exon 4 of the full-length KCNH2 transcript (KCNH2-1 A; NM_00023) we identified a novel 5' extension of exon 3 producing an isoform that originates 1.1 b upstream of the known start of exon3 (Fig. 5; Fig. 1 1). Further cloning from a human cDNA library
(Stratagene) found that the isoform is expressed endogenously and contains all of the downstream exons of the full-length form of the gene (through exon 15 of KCNH2-1A; Fig. 20, Table 1 1). In silico prediction (on the world-wide-web at ncbi.nlm.nih.gov) of the longest ORF of the novel isoform (referred to as Isoform 3.1) revealed that the majority of the 1.1Kb 5' extension of exon 3 would be untranslated and that the first methionine is in frame with the full- length protein. As such, Isoform 3.1 is expected to be missing the first 102 amino acids of the full-length KCNH2-1 A, replacing them with 6 amino acids unique to the isoform. Interestingly, the 102 amino acids encoded for by exons 1 and 2 of hERGla comprise a large portion of the PAS domain, a motif that slows the rate of channel deactivation (J. H. Morais Cabral et al. 1998 Cell 95:649). The translation of Isoform 3.1 and the predicted difference in protein size was confirmed using western blot in transfected HEK cells (Fig. 8C). Western blot in human hippocampus and frontal cortex following immunoprecipitation revealed a protein band of similar molecular weight to that in transfected HEK cells (Fig. 8C). Furthermore, neuroblastoma cells transfected with constructs encoding either or both KCNH2-1 A or Isoform 3.1 show overlapping expression of the protein isoforms on the plasma membrane (Fig. 8D).
To address the possibility that Isoform 3.1 is expressed primarily in brain, we measured the quantity of KCNH2-1A and Isoform 3.1 across several tissues, including heart and three different brain regions, using quantitative RT-PCR. Furthermore, since known isoforms of KCNH2 and its homologues can co-assemble to create heteromeric potassium channels with unique electrophysiological properties (L. Guasti et al. 2005 J Comp Neurol 491 : 157) further
modified by the ratio and arrangement of subunits (S. Wimmers et al. 2002 Pflugers Arch 445:423), we measured the ratio of Isoform 3.1 to KCNH2-1 A and found the two forms comparable in expression within several brain regions (Fig. 8B; Fig. 20, Table 1 1). However, Isoform 3.1 was over 1000-fold less abundant than KCNH2-1A within the heart, suggesting that the role of Isoform 3.1 may reside largely within the brain.
Referring to Fig. 8 A, PCR products were generated for CNH2-1 A and Isoform 3.1 using forward primers in exon 1 of KCNH2-1 A (Exl) and in the 5'-UTR of Isoform 3.1 (Isol), respectively, and the same reverse primers in exons 3 (Ex3) and 4 (Ex4) of KCNH2-IA (see Example 1). PCR was performed using cDNA prepared from commercially available total RNA (Ambion) isolated from human heart, hippocampus, and fetal brain. PCR products for KCNH2- 1A were expected at 373 and 463 bps, respectively, and for Isoform 3.1 at 388 and 478 bp, respectively. The band -1.5 kb in Isol-Ex4 lanes corresponds to small amounts of unspliced RNA or genomic DNA present in the samples. Referring to Fig. 8B, Quantitative PCR was performed using TaqMan assays (ABI) to measure relative mRNA expression of Isoform 3.1 (custom TaqMan assay designed to the 5'-UTR of Isoform 3.1) versus KCNH2-1A (HsOOl 65120_ml) ± standard error of mean. Expression values were measured in cDNA made from DNAse treated (Invitrogen) commercially available total RNA (Ambion) from human hippocampus, prefrontal cortex, heart, and skeletal muscle. Referring to Fig. 8C, Western blots were prepared using protein extracted from post-mortem human hippocampus and frontal cortex. As positive controls, HEK cells were tranfsected with vectors encoding KCNH2-1A or Isoform 3.1 under the control of a CMV promoter. Westerns were probed with an antibody raised against the pore portions of KCNH2 (Santa Cruz, N-20) and thus predicted to detect isoform 3.1 and KCNH2-1 A. Proteins extracted from human brain regions showed two distinct bands, one at the same size as Isoform 3.1 transfected HEK cells. However, the larger, more dominant band in human brain was not obsevered at the size of KCNH2-1A transfected HEK proteins. Instead, the larger band occurs at -160 kDa, which is the reported size of KCNH2-1 A from in vivo protein extracts suggesting post-translational modifications (E. M. Jones et al. 2004 J Biol Chem 279:44690). Referring to Fig. 8D, Primary rat neurons transfected with KCNH2-1A or Isoform 3.1 containing vectors.
Referring to Fig. 20, PCR of KCNH2-1A (full-length) and Isoform 3.1 was performed using 10 different tissue extractions of total RNA. Full-length PCR products were generated using Exl-F forward primer to Ex3-R and Ex4-R reverse primers (see Example 1). Isoform 3.1
PCR products were generated using Ex3.1-F forward primer and the same Ex3-R and Ex4-R reverse primers. Expected product sizes: 373, 463, 388, 478 bps respectively. Cloning and sequencing of the band at 1547 bps in PCR of Ex-3.1-F to Ex4-R of some samples corresponded to sequences without intron 3 spliced out suggesting that this represents DNA contamination in these samples.
In Table 11 , quantitative RT-PCR was used to measure the relative quantity of Isoform 3.1 as compared to KCNH2-1A expression in 8 total RNA isolates. All samples were DNase treated prior to cDNA synthesis to prevent the effects of DNA contamination on the samples. All Ct values were determined at the same threshold value and all sample expression values were measured in triplicate.
Finally, as ERG family genes are moderately conserved in sequence across several species (J. W. Warmke and B. Ganetzky 1994 Proc Natl Acad Sci U S A 91 :3438), we expected Isoform 3.1 to be present within other mammals. However, again using 5'-RACE, we were unable to detect Isoform 3.1 homologues in mouse brain. Moreover, in silico analysis revealed that the 1.1Kb region unique to Isoform 3.1 was highly degenerate outside of primates (Fig. 21). In particular, in mouse, rat, canine, and zebrafish, no promoter-like sequences were observed within 3 Kb upstream of exon 3 and the longest ORF in frame with exon 3 lacks a starting methionine (Fig. 21).
Referring to Fig. 21 A, a multiple alignment is shown of the 250 bp region upstream of KCNH2-1A (hERG-lA) exon 3 splice site and 180 bps of exon 3 in human, rhesus, mouse, and rat. Genome sequences were obtained from UCSC and aligned using Clustal W (on the worldwide-web at ebi.ac.uk/clustalw). Exon 3 splice site (CAG) is boxed by a fine dashed line followed by exon 3 (heavy dashed-line box), both of which are highly conserved across species. In-frame start codons (ATG) are shown with a closed box for human and rhesus sequences and equivalent ATG in mouse and rat are frameshifted (in frame codon is shown with a closed box). Fig. 21 B shows multiple alignments of the predicted ORF of this region in frame with exon 3 and the remainder of the KCNH2 coding sequence. Again, human and rhesus sequences show starting methionines while mouse and rat sequences are devoid of upstream, in-frame methionines prior to stop codons.
Higher expression of Isoform 3.1 in schizophrenia and in subjects with risk genotype
Primate-specific, brain enriched expression, and the location of risk SNPs in the 5' upstream of Isoform 3.1's first exon led us to hypothesize that the mechanism of genetic risk for schizophrenia would involve differential expression of the Isoform 3.1. Using quantitative RT- PCR we found Isoform 3.1 expression significantly increased within the HF of patients versus healthy control subjects (p = 0.012, Fig. 7A). The ratio of Isoform 3.1 to KCNH2-1A showed a dramatic, 2.5 fold increase in the patients (p = 0.003). Additionally, higher expression levels of Isoform 3.1 were significantly associated with risk alleles even within healthy control subjects (Fig. 7B). This trend was observed irrespective of race or diagnosis eliminating the potential confounders of medication or genetic background stratification. These results converge on the conclusions that the genetic mechanism of association with schizophrenia involves regulation of Isoform 3.1 transcription and that overexpression of this isoform and its potential physiologic effects are related to the pathogenesis of the disorder.
Functional role of Isoform 3.1 revealed by electrophysiology
Structural analysis of Isoform 3.1 revealed some interesting properties that suggest potentially unique physiological effects. The PAS domain (aa 25-136) in the N-terminus ensures a slow deactivation of the KCNH2 channel, a unique feature of hERG (M. C. Sanguinetti and M. Tristani-Firouzi 2006 Nature 440:463). In contrast, a few amino acids (aa 7-12) in the N-terminal of hERG channels facilitate the channel deactivation (H. Terlau et al. 1997 J Physiol 502:537). Compared with CNH2-1A, the Isoform 3.1 substitutes the first 102 amino acids at the N- terminus with 6 new amino acids (Fig. 9A), removing all the facilitating signals and deleting the majority of the PAS domain. To determine the biophysical properties of this new channel isoform, we performed whole-cell recording on HEK cells transfected with either KCNH2-1A or Isoform 3.1. Holding at -60mV, the channels were activated by various depolarizing steps (Fig. 9B, top). As reported previously, KCNH2-1A exhibited a typical slow activation (Fig. 9B, middle). Isoform 3.1 was also activated slowly (Fig. 9B, bottom). Quantitative analysis revealed no difference in the activation kinetics of KCNH2-1A and Isoform 3.1 (Fig. 9D). When the membrane potential was hyperpolarized to -120mV, the channel quickly recovered from the inactive state, resulting in a big "tail current" that deactivated slowly (Fig. 9C, top). Treatment of the cells with the hERG channel inhibitor E-4031 completely blocked the current (Fig. 9C, top), suggesting that this current is solely mediated by the hERG channel. In contrast, the cells transfected with Isoform 3.1 exhibited a dramatically reduced tail current (Fig. 9C, bottom).
Treatment with E-4031 also blocked the current, confirming the nature of the channel. To better compare the deactivation kinetics of the two isoforms, membrane potential was first depolarized to +60mV for 1 sec, followed by hyperpolarizing steps at various potentials (Fig. 9E, top). The large inward currents mediated by Isoform 3.1 decayed towards baseline much faster than those by KCNH2-1 A (Fig. 9E, middle and bottom). The deactivation phase of the currents was fitted by a single exponential curve, generating a deactivation constant (τ) that is voltage-dependent (Fig. 9F). In all voltage steps tested (-70mV- 120mV), τ is greatly reduced in Isoform 3.1, as compared to that of KCNH2-1 A. Taken together, Isoform 3.1 mediates an inward rectified K+ current with dramatically faster deactivation kinetics.
Referring to Fig. 9 A, schematic diagrams of the domain structures of KCNH2-1A and
Isoform 3.1 depict initial leader sequences, the PAS domain (or partial PAS domain in the case of Isoform 3.1), and amino acid sequences identical between KCNH2-1A and Isoform 3.1. The numbers above the bars are positions of amino acids. Fig. 9B depicts currents evoked by voltage steps (2 sec) from VH of -60 mV to potentials from -100 to +80 mV inlO-mV increments, followed by a voltage pulse to -120 mV. Upper panel: voltage protocol. Middle and lower panels: traces obtained from cells transfected with KCNH2-1A and Isoform 3.1 cDNAs, respectively. These traces are corrected for leak currents. Fig. 9C shows the effects of E-4031 on tail currents evoked by a test pulse to -120 from holding potential of +80 mV, using the same protocol as in A. Traces recorded from the same cells before and after treatment with 10 μΜ E- 4031 were superimposed. Upper and lower panels show KCNH2 currents recorded from cells transfected with KCNH2-1A and Isoform 3.1 cDNAs, respectively. Fig. 9D illustrates activation curves of KCNH2-1A and Isoform 3.1. Fig. 9E illustrates tail currents evoked by voltage steps from +60 mV to potentials between -120 mV and -70 mV in 10 mV increments. Traces in upper and lower panels represent tail currents of KCNH2-1 A and Isoform 3.1 , respectively. Fig. 9F illustrates deactivation time constants of KCNH2 currents at different re-polarizing voltages. Between -120 to -70 mV the decay phase of KCNH2 currents was fitted by a single-exponential function to calculate the deactivation constant. The data are presented as mean + SE. The numbers of cells recorded are indicated in the parentheses.
We next examined the functional role of Isoform 3.1 in cortical neurons. Given that rodent CNS neurons express KCNH2-1A, but not Isoform 3.1 , Isoform 3.1 introduced into these neurons would presumably complex with the endogenous KCNH2-1 A, thereby markedly
changing the deactivation kinetics of the K+ current. Isoform 3.1 was transfected with or without GFP into the cultured cortical neurons on the day of plating, and whole-cell, voltage-clamp recording was performed on neurons cultured for 10 days following perfusion with a cocktail of inhibitors to block Na+ and Ca2+ currents. In neurons transfected with GFP alone, application of a voltage protocol similar to that in Fig. 9E elicited a series of tail currents that were blocked by E-4031 (Fig. 10A). Subtraction of the currents after E-4031 treatment (middle) from control currents (upper) generated pure "KCNH2-lA-mediated" current (lower) that exhibited a typical, slow deactivation kinetics (Fig. 1 OA). In contrast, application of the same protocol to neurons transfected with Isoform 3.1 elicited a dramatically reduced tail current with much faster deactivation (Fig. 10B). Quantitative analysis indicated that τ reduced by 5.88 (fast component) and 7.43 (slow component) folds at -100 mV of command potential, respectively (Fig. IOC). These results suggest that by complexing with the endogenous KCNH2-1 A, Isoform 3.1 may alter the membrane repolarization kinetics, leading to an increase in neuronal excitability. To test this possibility, we examined action potentials induced by a step depolarization under the current-clamp conditions. In control neurons (non-transfected) as well as neurons transfected with GFP, a 1-sec depolarization elicited about 11 action potentials (Fig. 10D, upper and middle). In neurons transfected with Isoform 3.1, the same depolarization step induced significantly more spikes compared with control and GFP -transfected neurons (Fig. 10D, lower). On average, the spike frequencies induced by a 40-pA depolarizing step were 8.9 ± 1.3 Hz in control and 16.6 ± 0.5 Hz in Isoform 3.1 -transfected neurons, respectively (Fig. 10E). Further examination of the inter-spike intervals (ISIs) also revealed that expression of Isoform 3.1 converted an adapting (Fig. 10D, upper) to a non-adapting (Fig. 10D, lower) firing pattern. Indeed, the ratio of 1st and last ISIs increased from 0.57 ± 0.05 in control neurons to 0.96 ± 0.02 in isoform 3.1 -transfected neurons (Fig. 10F). This result is interesting, since the non-adapting discharge pattern has been implicated in persistent firing of neurons in PFC during working memory tasks (Y. Wang et al. 2006 Nat Neurosci 9:534). Taken together, these results suggest that expression of Isoform 3.1 in human PFC significantly increases neuronal excitability and offers a potential mechanism for persistent neuronal activity.
Referring to Fig. 10, cortical neurons were transfected with either GFP alone or GFP and Isoform 3.1 , and cultured for 10 days. In Fig. 10A and 10B, KCNH2-mediated tail currents in GFP- and Isoform 3.1 -transfected neurons are shown, respectively. Tail currents evoked by
voltage pulses (1 sec) from VH of +80 mV to potentials between -70 and -120 mV, in 10-mV increments. E-4031 -sensitive currents are obtained by subtracting currents recorded after E-4031 application from those from before E-4031 application. Fig. IOC illustrates a semilogarithmic plot of deactivation time constants of E-4031 -sensitive currents at different re-polarizing voltages. Between -120 and -100 mV decay of E-4031 -sensitive currents was fitted by double- exponential functions, whereas between -90 and -70 mV time course followed single-exponential functions. Deactivation constants in the neurons transfected with isoform 3.1 are consistently smaller than those in control neurons at different re-polarizing voltages. Fig. 10D illustrates the effect of over-expression of Isoform 3.1 on action potential discharge of cultured cortical neurons. Repetitive firing was evoked by long depolarizing pulse (40 pA, 1 sec). Strong spike frequency adaptation is seen in control neurons and those transfected with GFP, whereas neurons transfected with Isoform 3.1 exhibit non-adaptation discharge behavior. Fig. 10E illustrates spike frequencies induced by injecting different depolarizing currents. Spike frequency is defined as the number of spikes per 1 sec. Neurons expressing Isoform 3.1 consistently exhibit significantly higher spike frequencies starting from 30 pA of current injection. Fig. 10F illustrates the effect of Isoform 3.1 on spike frequency adaptation. The degree of non-adaptation, measured by the ratio of first to last interspike intervals evoked by a 40-pA depolarizing pulse, was significantly higher in neurons expressing Isoform 3.1 than that in control or GFP-expressing neurons. The data are presented as mean ± SE. The numbers of cells recorded are indicated in the parentheses (D) or columns (E) and asterisk indicates a significant difference (ANOVA, p<0.01).
TABLE 2
Microarray Candidate Gene Screen
Gene SNP rs# Location MAF Alleles Z-score Empirical p-val Global p- Most Significant val Haplotype rs2819370 198646712 ' 0.45 c 1.90 0.0700 1 0.17 Frequency
TIMM17A
rs2819376
(1q32.1) illKRies 0 17 0.19 0.8586" 0.125 1 0,05 p-value rs7513 198670652 0.49 G.A 0.08 0.9270 2 . -1.94 Z-score rs1878505 63578241 0.28 A G -1.20 0.2215 1 0.44 Frequency
MDH1
rs11689644 63621359 0.12 T/G -0.41- 0.6494 0.707 1 0,45 p-value (2p13.3)
rs'262534 63818026 0.28 T/A ' -0.14 ' 0.8973 1 0.75 z-Score rs2l 38349 172368904 0.32 T/C -0.94 0.3676 T 0.33 Frequency
SLC25A12 rs6757773 172375137 3 i- -¾-- 0¾1 1.00. 0.3466 1 0.38 p-value
0.939
(2q24) rs312917 172396665 0.07" A G 0.24 0.8249 1 -0,87 Z-score rs10165126 0 30 C T ' , 0.29 < 0.8706 - - 1
CFLAR rs10931929 201673392 0.29 C/G -2.56 0.0180 1 0.04 Frequency
(2q33-q34) tune -0 51 0.521 0.16 p-value rs3900115* 201876183 0.47 A.'G ' -0¾7 0.5141 1 1.29 Z-score
N0S3 rs1036145 150112078 0.30 G/A 3.24 0.0032 0.33 Frequency (7q36.1) rs2373685 150¾¾¾| n OR s
A G 2 03 iBllllo 0.005
1 0.00 p-vafue
3.01 Z-score rs2513910 103886282 0.43 A G -1.73 0.0590 1 0.34 Frequency rs2436854 103895213 0.28 C/T -0.52 0.5747 1 0.16 p-value
OAZIN
rs2513921 103899571 0.42 T/C -1.76 0.0720 0.433 1 1.43 Z-score (8q22.3)
rs2916558 103916575 0.38 C/A 0.98 0.2747 2
rs1055376 103946610 0.33 C/T -1.09 0.3136
Gene SNP rs# Location MAF Alleles Z-score Empirical p-val Global p- Most Significant
val Haplotype
rs2076022 119338510 0.45 C/T -1.37 0.1730 1 0.29 Frequency rs968474 " 119341250. . · 0.34 0 28 ■- Q-.7540 0.02 p-value
C0X6A1 rs2235218 119351339 6.30 A/C -1.92 0.0370 1 2.21 Z-score
0.266
(12q24.2) rs606443 119373350 0,36 T/G 0.47 0.6569 2
rs7964008 119381117 0.15 C/T -1.46 0,2075 1
rs7963543 119386668 0.15 A/C · -0.13 0 8992 1 rs6993 57298868 0.38 C/T 1.47 0.1030 0.05 Frequency
GOT2 Γ830842 57300955 0 25 1.00 0.3252 1 0.30 p-value
* 0.643
(16q21) rs30638 57302918 0.35 G/A 2.08 0.0260 1 0.92 Z-score
Shown is summary information for htSNPs genotyped in the regions of 10 candidate genes. Summary information includes: minor allele frequency (MAF) in the CB chromosomal location, and SNP alleles (major/minor). Observed z-scores for transmission of the minor allele to affected offspring in 175 Caucasian families are r individual markers and the most significant combined haplotype as determined by FBAT (see Example 1). Reported p-values are simulated from the experimental 000 iterations and reported for individual SNPs, the global haplotypes, and the most significant haplotype. Haplotypes are reported as 1 (major allele) and 2 (min each included SNP and significantly associated (p <0.05) SNPs or haplotypes are shown in bold.
TABLE 3■ SNPs Genotyped in Four Clinical Samples and FBAT Statistical Results
no transmissions were observed
observed transmission exactly equal to expected
not genotyped
SNPs denoted novel were identified by resequencing DNA from 48 schizophrenia patients (see Example 1), The type of SNP (major allele listed first) and MAF (mi frequency) is given for each cohort. For SNPs genotyped In the family-based cohorts, the Z-score of transmission for the minor allele to affected offspring is given fo the simulated p-value (Max = 100,000 iterations). For SNPs genotyped in the German cohort, the odds ratio for the minor allele in cases vs. controls as w corresponding Chi-square p-value is given followed by the multinomial linear regression coefficient (β) for case vs. control 2/2 individuals and its simulated p-val iterations), p < 0.15 are italicized; p < 0.05 are bold.
TABLE 4 - COGNITIVE PERFORMANCE FACTOR SUMMARY TABLE
TABLE 5— Demographic and Genetic Data of Normal Volunteers Included in VBM Analysis
HNR = Homozygous for the Non-Risk Allele; H=Heterozygous for the Risk Allele; HR=Homozygous for the Risk Allele
TABLE 6— Demographic and Genetic Data of Normal Volunteers Included in fMRI
HNR = Homozygous for the Non-Risk Allele; H=Heterozygous for the Risk Allele; HR=Homozygous for the Risk Allele
TABLE 7
Optimized voxel based morphometry (VBM) data for the KCNH2 SNPs. Brain hippocampal areas that show a significant linear decrease in gre matter volume (GM) from subjects homozygous for the risk allele (HR) to heterozygote carriers (H) to non carriers (HNR). VBM analysis wa performed using an analysis of covariance model with GM, age, and gender as covariates of no interest.
M30 (n=63,59,17) Z X y z
3.34*,† 26 -12 -22
3.02* -27 -21 -17
2.84* 33 -26 -15
2.79* -23 -10 -24
M31 (n=66,59,16) Z X y z
3.16*,† 26 -9 -24
2.68* 28 -37 -2 33 (n=64,61,16) Z X y z
3.08§ 26 -9 -24
Ail the results are thresholded with a p < 0.005 and small-volume corrected for the hippocampus; *significant with a threshold of pFDR=0.05; § pFDR=0.07 and pFWE=0.06;†, significant with a threshold of pFWE=0.05. Peak cluster coordinates are expressed in mm in MNf system. n=sample size of HNR, H, HR, respectively.
TABLE 8
Genotyped based differential engagement of the hippocampus during incidental encoding of declarative memory task for the KCNH2 SNPs, This data shows a linear increase of activation in homozygous for the risk allele (HR) relative to heterozygote carriers (H) and non carriers (HNR). 30 (n=28,37,14) Z X y z
3.48* -34 -25 -15
M31 (η=30,35,12) 2 X y z
3.11† -34 -22 -15
M33 (n=27,37,11) Z X y z
3.24* -34 -22 -15
All the results are thresholded with a p < 0.001 and small-volume corrected for the hippocampus;
*sigmficant with a threshold of pFWE=0.05;†, pFWE=0.06. Peak cluster coordinates are expressed in mm in MNI system. n=sample size of HNR, H, HR, respectively.
TABLE 9— Demographic and Sample Details of Brain Collection Chart
(A) Demographic information for real-time q-PCR analysis of post-mortem human DLPFC. (B) Demographic information of samples used for real-time q-PCR analysis of human Hippocampus. Summary statistics of critical demographic variables are shown (± 1 SD) by patient group. Differences between groups were assessed using either ANOVA followed by Least-Significant Difference post-hoc analysis (p-values denoted with '*') or using Fisher's Exact test (p-values denoted with '@').
©Fisher's exact test
*ANOVA Tested
©Fisher's exact test
TABLE 10■ NOS3 and KCNH2 mRNA Expression Statistics in Human Brain
(A) Expression within hippocampus and DLPFC of KCNH2-1A (ABl assay: Hs00165120_m1) and NOS3 (ABI assay: Hs_00167166_m1) was normalized to the geometric mean of 3 housekeeping genes (B2M, GUSB, PBGD) and then tested for potential effects of several demographic variables using backward stepwise linear regression. Tested variables included: RNA Integrity Number (RIN), agonal sate, post-mortem pH, post-mortem interval (PMI), and age. Isoform 3.1 (Custom ABI assay) was only measured in hippocampus due to the exhaustion of DLPFC total RNA. Variables found to have significant main effects in the final regression model were included as covariates within an ANCOVA model testing for the main effect of diagnosis (Dx) on expression. (B) After ANCOVA testing for case-control differences, the effects of race and M33 genotype were included into the ANCOVA model in order to test for the association between M33 and gene expression. All analyses were performed using SPSS 12.0.
A - Case Control Expression Differences Hippocampus
B - Gene Expression vs. Genotype and Race Hippocampus
-J
DLPFC
TABLE 11
Quantitative RT-PCR was used to measure the relative quantity of Isoform 3.1 as compared to KCNH2-1A expression in 8 total RNA isolates. All samples were DNase treated prior to cDNA synthesis to prevent the effects of DNA contamination on the samples. All Ct values were determined at the same threshold value and all sample expression values were measured in triplicate.
Quantitative RT-PCR
DNase Treated Sample Detector Average CT CT Stdev Fold difference vs. Full length (+ SEM)
Discussion
The findings described here provide compelling evidence for a novel genetic association with risk for schizophrenia at 7q36.1, in the region of KCNH2, which was observed in four independent genetic cohorts of European and African American ancestry, including three family- based and one case-control dataset. Our results satisfy a proposed "3 -cohort replication rule" for preliminary evidence that a gene conveys risk to a genetically complex illness (K. E. Lohmueller et al. 2003 Nat Genet 33: 177). All samples showed association to SNPs within a small segment of intron 2 of KCNH2. Similar circumstances have been reported with other genes that appear to be compelling candidate susceptibility genes for schizophrenia (P. J. Harrison and D. R.
Weinberger 2005 Mol Psychiatry 10:40; P. J. Harrison and A. J. Law 2006 Biol Psychiatry 60: 132; D. J. Porteous et al. 2006 Biol Psychiatry 60: 123; N. M. Williams et al. 2005 Schizophr Bull 31 :800). Interestingly, the resequencing in 48 schizophrenia patients found a novel but rare (-1% MAF) SNP, M25. Investigation of these pedigrees found that every proband inherited the M25 minor allele from a heterozygote parent, which may indicate evidence for the contribution of a rare allele/rare variant hypothesis of genetic association at KCNH2. Though risk alleles may vary, affecting a variety of transcriptional and other regulatory domains, they appear to converge on similar downstream molecular changes.
All clinical samples showed association to a small region (<3kb) and much of the genetic risk of the region appears to be sufficiently tagged by M30, M31 , and M33. Accordingly, these markers also demonstrated the strongest independent associations with a priori predicted schizophrenia-associated intermediate phenotypes including cognitive impairments, brain volume reductions, brain activity changes, and also with increases in Isoform 3.1 expression, all in healthy unrelated individuals of various genetic backgrounds who carry the risk alleles yet have no history of mental illness. In sum, we show association of genetic variation in this small ~3kb region with clinical phenomena strongly linked to schizophrenia and with selective expression of a specific novel transcript whose start site is only ~1 1 kb downstream of this risk region. We propose that these results identify a new schizophrenia susceptibility gene and that the mechanism of this association involves anomalous processing of a novel brain selective transcript of KCNH2 that leads to alterations in cortical development and function militating towards the clinical phenomenology of schizophrenia.
The control of membrane repolarization and spike frequency in neurons by KCNH2 isoforms has intriguing implications for cortical function and the pathophysiology of
schizophrenia. Cortical information processing is critically dependent on organized neuronal oscillations within cortical circuits (R. T. Canolty et al. 2006 Science 313: 1626). For example, neurons in the prefrontal cortex (PFC) exhibit sustained firing of high frequency activity during the delayed period that is thought to be critical for working memory (Y. Wang et al. 2006 Nat Neurosci 9:534). We found that expression of Isoform 3.1 in rat cultured cortical neurons results in a much faster deactivation of the hERG channels, leading to a marked increase in spike frequency and a conversion from adapting to non-adapting firing patterns. This "sustained" firing pattern might be important for cortical information processing underlying higher-order cognitive and memory tasks and suggests a role for Isoform 3.1 in normal human cognitive processing. However, the 2.5 -fold increase in Isoform 3.1 relative to KCNH2-1A in schizophrenic brain might serve to abnormally increase neuronal excitability and disrupt normal oscillatory rhythms. "Dysrhythmia" of such tonic firing would be expected to result in anomalous modulation of microcircuits resulting in poor regulation of signal-to-noise (G. Winterer and D. R. Weinberger 2004 Trends Neurosci 27:683). Thus, the over-expression of Isoform 3.1 within the
schizophrenia brain and its functional effects on neuronal firing is congruous with current hypotheses of a disease related alteration in cortical signal-to-noise processing within
schizophrenia (G. Winterer and D. R. Weinberger 2004 Trends Neurosci 27:683).
The discovery of Isoform 3.1 has compelling therapeutic implications. The unique structure of isoform 3.1 , its role in non-adaptive firing, its low expression in heart, and elevated expression in brains of schizophrenia patients and genetic risk carriers, lead to the conclusion that selective inhibition of Isoform 3.1 but not KCNH2 would correct the disorganized firing in schizophrenia brain without eliciting cardiac side effects. Thus, Isoform 3.1 is a promising novel therapeutic target for the treatment of schizophrenia.
In conclusion, we have identified and characterized a novel, primate specific brain potassium channel, localized a novel genetic association with risk for schizophrenia to within a small region of KCNH2 (7q36.1), and have confirmed this finding in four independent clinical- based samples. Three SNPs in particular (M30, M31 , and M33) showed evidence of association in all tested populations. We report the observation that polymorphisms in a specific 3 Kb region of KCNH2 consistently occur with higher frequency within schizophrenia patients and that,
regardless of allelic heterogeneity, that healthy control carriers of risk SNPs within this region demonstrate a schizophrenia-like shift in cognitive traits (processing speed and visual memory) and in hippocampal volume and physiologic engagement during memory processing. The mechanism of these associations appears to be related to genetic regulation of a novel Isoform 3.1 of KCNH2, which has unique electrophysiological properties, primate and brain specificity, and expressional dependence on risk genotypes. Our results represent a first step towards discovery of a novel therapeutic target for schizophrenia and related conditions.
Example 1
Genetic Association Cohorts
The CBDB Sibling Study consists of subjects collected as part of an ongoing
investigation into neurobiological traits related to genetic risk for schizophrenia (M. F. Egan et al. 2000 Am J Psychiatry 157: 1309). Participants were between the ages of 18 and 60 and only Caucasians of self-identified European decent were analyzed in this study to reduce genetic heterogeneity. DNA was available from 252 probands, 311 of their siblings (mostly unaffected), 268 parents, and 383 unrelated healthy controls. Further information about the collection, screening, and exclusion criteria has been previously described (M. F. Egan et al. 2000 Am J Psychiatry 157: 1309). Two additional family-based cohorts were included from the National Institutes of Mental Health Genetics Initiative on schizophrenia (NIMHGI) (S. V. Faraone et al. 1998 Am J Med Genet 81 :290). The cohorts consisted of 51 African American families (GI-AA) and 71 Caucasian families (GI-C). Only nuclear families were included with DNA available from at least one sibling with a diagnosis of schizophrenia or schizoaffective disorder, and at least one parent. A fourth cohort was collected from the Munich area in Germany consisting of 501 schizophrenia patients and 626 unrelated healthy controls (K. K. Nicodemus et al. 2007 Hum Genet 120:889-906). Further details regarding the collection, evaluation, and exclusion criteria of the German cohort have been described (K. K. Nicodemus et al. 2007 Hum Genet 120:889-906).
Candidate gene screening
Ten candidate genes were selected from those previously reported as differentially expressed between schizophrenia patients and healthy controls (S. Prabakaran et al. 2004 Mol Psychiatry 9:684). htSNPs tagging haplotype blocks overlapping with part or all of the gene of interest and which had predesigned TaqMan SNP assays (Applied Biosystems, Inc) were
genotyped on a screening sample of 175 families (698 Caucasian subjects) of the CBDB Sibling Study. All SNPs were genotyped using 5'-exonuclease TaqMan SNP assays as previously described (K. J. Livak 1999 Genet Anal 14:143). Single marker and whole haplotype association testing was performed using family-based association test (FBAT) (S. Horvath et al. 2001 Eur J Hum Genet 9:301) and evaluated at a = 0.05.
KCNH2 genotyping and re-sequencing
Genotypes were obtained for a total of 43 SNPs within a 65.2 Kb region of KCNH2 and NOS3 (chr7: 150280464 - 150345679). A total of 13.5Kb were re-sequenced in 48 schizophrenia patients by Polymorphic Inc. (Alameda, California) and also in house, including 10.4Kb flanking rs 1036145 (chr7: 150,299,575- 150,309,948) and 3.1Kb upstream of exon 3 (chr7: 150,287,750- 150,290) with high cross-species conservation in the UCSC genomes database
(genome.ucsc.edu). Re-sequencing found 11 novel SNPs. SNPs were genotyped in all four cohorts using TaqMan SNP assays as before. Finally, SNP M33 was genotyped in 1 16 individuals (34 schizophrenia patients and 82 healthy controls) of the CBDB/NIMH Brain Collection (see below) for whom total RNA was also extracted from the DLPFC and
hippocampus for QPCR (see below).
Cognitive Testing
Depending on the cognitive test, data were available for between 230 and 330 of the individuals included in the CBDB family-based cohort. The tests included tasks aimed at assessing a wide range of features shown to be significantly affected in patients with
schizophrenia including IQ, visual and learning memory, attention span, etc. (M. F. Egan et al. 2001 Biol Psychiatry 50:98). Factor analysis of 24 performance scores from nine
neuropsychological tests shown to be associated with increased genetic risk for schizophrenia (M. F. Egan et al. 2004 Proc Natl Acad Sci USA 101 :12604; T. E. Goldberg et al. 2006
Neuropsychopharmacology 31 :2022; J. H. Callicott et al. 2005 Proc Natl Acad Sci U S A 102:8627) identified seven factors that explained 68% of the variance on these measures (Genderson, M.R. et al. Schiz Res (in press)). These 7 factors were used to assess genotype effects on cognitive task performance (see below) and are labeled as follows: Verbal Memory, Nback, Visual Memory, Processing Speed/IQ, Card Sorting, Attention, and Digit Span. Further information regarding the test measures included in each factor is provided in Table 4.
Statistical genetics analysis
Hardy- Weinberg Equilibrium (HWE) was tested using F-exact tests Analyses of single SNPs were conducted using the Family Based Association Test (FBAT) in nuclear families (S. Horvath et al. 2001 Eur J Hum Genet 9:301) and logistic regression in comparisons of unrelated cases and controls using STATA, version 8.2 (College Park, TX, USA). Haplotype analysis was performed using FBAT for families and the R package haplo. stats (D. J. Schaid et al. 2002 Am J Hum Genet 70:425) in unrelated case-control tests. All tests were run with simulation and represent p-values following 1000 iterations. Cognitive intermediate phenotypes were tested in control subjects only using linear regression and were based on the seven normalized derived factor scores.
Quantitative real-time PCR (rt-PCR)
Human brain tissue was collected as part of the CBDB NIMH Brain Collection. Details about the collection, screening, and dissection processes have been described (B. K. Lipska et al. 2006 Hum Mol Genet 15: 1245). Predesigned TaqMan MGB Assays (Applied Biosystems, Inc.) for the major transcripts of NOS3 (HsOOl 67166_ml) and KCNH2 (KCNH2-1A; HsOOl
65120_ml) along with 3 housekeeping genes (GUSB, B2M, and PBGD) were used to measure expression in 100 ng of cDNA equivalents isolated from the DLPFC (69 controls; 31
schizophrenia) or the hippocampus (59 controls; 29 schizophrenia) of HBS subjects. A custom TaqMan MGB assay was designed for Isoform 3.1 targeting the 5'-UTR region of the gene (F- primer: 5'- CATGAGAAAAGAATTATATACATTATGTGTATCACAACATC, SEQ ID NO: 18; R-Primer: 5'-GCCTCATTTTTTCCATCTATAAAATGGGAA, SEQ ID NO: 19; Probe: 5'- ACTGTGTACCCCATAAATATGTA, SEQ ID NO: 20). A pool of cDNA from 16 individuals (randomly selected) was used to create an 8 -point, 1A serial dilution standard curve. All QPCR reactions were performed in triplicate.
Expression levels of NOS3, KCNH2-1A, and Isoform 3.1 assays were normalized to the geometric mean of GUSB (Hs99999908_ml), B2M (Hs99999907_ml), and PBGD
(Hs00609297_ml) (J. Vandesompele et al. 2002 Genome Biol 3:RESEARCH0034). Data was tested for normality using Shapiro-Wilk W test. NOS3 qPCR data were non-normally distributed and were consequently Iog2 transformed while KCNH2-1A and Isoform 3.1 qPCR data were normally distributed. All normalized expression values were tested for the main effects of various demographic and sample factors using reverse-stepwise linear regression. Tested factors included: RNA integrity number (RIN), postmortem brain pH, postmortem interval (PMI), age at
death, agonal state, manner of death. Variables with significant regression model coefficients were included in the final ANCOVA model for diagnosis (evaluated at a = 0.05) (see Table 10). The effects of genotype and race were tested using a second ANCOVA model including race and M33.
Imaging Methods
Subjects: All the subjects who participated in the imaging aspects of this study were Caucasian (see Table 5 and 6 for demographics). They were cleared of neurological, psychiatric, or substance abuse problems and had no history of other medical problems or medical treatment relevant to cerebral metabolism and blood flow. There was no significant difference in age, sex, IQ score and education distribution across the genotype groups. All available scans of subjects with genotypes of interest were used in these analyses.
Structural image processing: Three-dimensional structural MRI scans were acquired on a 1.5-T GE scanner using a Tl-weighted SPGR sequence (TR/TE/NEX 24/5/1, flip angle 45°, matrix size 256 x 256, FOV 24 x 24 cm) with 124 sagittal slices (0.94 x 0.94 x 1.5 mm resolution) and pre-processed as previously described (L. Pezawas et al. 2004 J Neurosci
24: 10099) followed by an optimized VBM protocol using customized templates (J. Ashburner and K. J. Friston 2000 Neuroimage 1 1 :805; C. D. Good et al. 2001 Neuroimage 14:21).
Resulting gray matter images were smoothed with a 12-mm Gaussian kernel prior to statistics. Analysis was performed on Linux workstations (RedHat) using MATLAB 7.02 (Math Works) within the General Linear Model in SPM2 (K. J. Friston et al. 1994 Hum Brain Mapp 2: 189-210) (on the world-wide-web at fil.ion.ucl.ac.uk/spm). The specification of a design matrix identical to the one used in this study was described in detail elsewhere (L. Pezawas et al. 2004 J Neurosci 24: 10099). Briefly, effects of the KCNH2 SNPs on gray matter volume were examined by using an analysis of covariance model including the following covariates of no interest: total gray matter volume, orthogonalized first- and second-order polynomials of age, and gender. A hypothesis-driven region of interest (ROI) approach was used to investigate genotype related alterations in structure within the hippocampal formation. Gray-matter volume changes were assessed statistically using one-tailed t-contrasts after small-volume correction for the hippocampus. False discovery rate estimations were used to correct for multiple comparisons, and a probability of 0.05 was considered to be significant. Anatomical hippocampal ROIs were created using the WFU Pick atlas (on the world-wide-web at fmri.wfubmc.edu) software. We
used the volume of interest (VOI) SPM2 toolbox to extract the adjusted gray matter volumetric data from the peak of most significant hippocampal clusters.
Functional task: During fMRI scanning, subjects performed a declarative memory task previously described to robustly engage the hippocampal formation (A. R. Hariri et al. 2003 J Neurosci 23:6690). The paradigm consisted of the encoding and subsequent retrieval of novel, complex scenes. Four encoding blocks were followed by four retrieval blocks in an interleaved design with a passive cross-hair fixation rest condition, resulting in a total of 17 blocks. During encoding blocks, subjects viewed six images, presented serially for 3 sec each, and determined whether each image represented an "indoor" or "outdoor" scene. All scenes were of neutral emotional valence and were derived from a standardized set (P. Lang, B.M., B. Cuthbert,
International Affective Picture System (IAPS): technical manual and affective ratings, (NIMH Center for the Study of Emotion and Attention, University of Florida, Gainesville, FL, 1997)).
During subsequent retrieval blocks, subjects again viewed six images, presented serially for 3 sec each, and determined whether each scene was "new" or "old." In each retrieval block, half the scenes were "old" {i.e., presented during the encoding blocks) and half were "new" {i.e., not presented during the encoding blocks). The order of presentation of the images was counterbalanced across the subjects. During scanning, all subjects responded by button presses with their dominant hand, allowing for the determination of accuracy and reaction time.
Functional image processing: BOLD fMRI was performed on a GE Signa 3 -T scanner using gradient echo EPI (24 axial slices, 4 mm thickness, 1 mm gap, TR/TE = 2000/28 ms, FOV = 24 cm, matrix = 64 x 64). Images were processed as described previously (A. R. Hariri et al. 2003 J Neurosci 23:6690) using SPM99 (on the world- wide-web at fil.ion.ucl.ac.uk/spm).
Briefly, images were realigned to the first image of the scan run, spatially normalized into a standard stereotactic space (MNI template) using an affine and nonlinear (4 x 5 4 basis- functions) transformation, smoothed with a 8-mm FWHM Gaussian filter and ratio normalized to the whole-brain global mean. In the first level analyses, linear contrasts were computed producing t statistical parameter maps at each voxel for encoding, and retrieval assuming the rest condition as a baseline. These statistical images were entered in a second-level random effects model (ANOVA) to identify significant activations within and between genotype groups. A hypothesis-driven region of interest (ROI) approach was used to investigate genotype related alterations in functional activity within the hippocampal formation (P < 0.05, corrected for the
small volume and the multiple comparisons, FWE within the hippocampal VOI). Mean percent BOLD signal change was extracted with the MarsBar toolbox within SPM2 (M. Brett et al. in 8th International Conference on Functional Mapping of the Human Brain. (Neuroimage, 16, abstract 497, Sendai, Japan, 2002)) in significant clusters.
Behavioral results: There were no behavioral differences between the three groups in the accuracy and reaction times for each of the SNPs during either the encoding or the retrieval part of the task.
Isoform 3.1 Cloning and Expression
5'-RACE and Isoform 3.1 cloning: 5'-RACE was performed using a 5'-RACE System (v2.0) as recommended (Invitrogen). Template cDNA was made from commercially available total RNA from 10 human cell lines and tissues (Stratagene). Reverse primers in exon 5 (5 - TGTGGGTTCGCTCCTTTATC) (SEQ ID NO: 21) were used as the first gene specific primer followed by primers in Exon 4 in the first PCR (5'-CATGGCCTCGATGTCGTC) (SEQ ID NO: 22). Nested PCR was performed using primers in Exon 3 (5'-ATGATGACAGCCCCATCCT) (SEQ ID NO: 23). 3 products were gel purified, cloned, and sequenced corresponding to hERG- 1A (NM_000238), BCOOl 914, and Isoform 3.1. Products were reproduced using total RNA isolated and pooled from the prefrontal cortex of 10 schizophrenia control patients (B. K. Lipska et al. 2006 Hum Mol Genet 15: 1245).
To determine the 3 '-end of Isoform 3.1, forward primers in the unique region of Isoform 3.1 (5 ' -CAT AC GGGG AGGC AG A AGT) (SEQ ID NO: 24) were used to produce PCR products spanning to exons 3 through 15. All products were confirmed by cloning and sequencing.
Cloning and Transfection: Novel KCNH2 isoform3.1 cDNA was cloned by long PCR with specific primers (3. IF 5'-CATACGGGGAGGCAGAAGT, SEQ ID NO: 25; Exl 5-R
CTTCTTGGGGAAGCTCTGG, SEQ ID NO: 26) and high fidelity DNA polymerase in the vector pZero-Blunt (Invitrogen), and then subcloned into the vector pcDNA3 (Invitrogen). Human KCNH2 cDNA in pCDNA3 is a gift from Dr. Gail A. Robertson. Isoform 3.1 cDNA, with deletion of exons 1 and 2 and addition of a Kozak consensus sequence, was generated by long PCR with high fidelity DNA polymerase Pfx (Invitrogen), and cloned into pcDNA3. HEK293 cells were transfected with the KCNH2, Isoform 3.1, and pCDNA3 vector, respectively. The transfected cells were lysed with 250 ul of T-PER protein extraction reagent (Pierce Chemical) with 1% proteinase inhibitor cocktail (Sigma) and phosphatase inhibitor
(Sigma). Protein concentrations of homogenates were measured by the BCA protein assay reagent kit (Pierce Chemical, Rockford, IL). All samples were diluted with isolation solution to a specific concentration needed and denatured at 950C for 5 min in protein sample loading buffer (Invitrogen).
Cortex protein extraction: Human dorsolateral prefrontal cortex and hippocampal tissues were homogenized with tissue lysis buffer (Pierce Chemical). Protein concentrations of homogenates were measured by the BCA protein assay reagent kit (Pierce Chemical, Rockford, IL).
Immunoprecipitation: Two μg of anti-HERG (N-20) antibody (Santa Cruz
Biotechnology, Inc) was mixed with 500 μg of human cortical or hippocampal proteins, and incubated at 40C on a rotator overnight. After the incubation, 20 μΐ of gamma protein G beads (Invitrogen) were added, and the mixture was incubated at 4°C on a rotator for 1 hour. The antigen-antibody-protein G bead complex was precipitated by spinning at 10,000x g, 40C for 30 seconds. The pellet was rinsed five times with washing buffer. 50 μΐ of IX sample buffer was added to the pellet and heated at 95°C for 10 minutes to release the bound hERG proteins. The free hERG proteins were separated from the beads by spinning at 10,000x g for 5 minutes. The supernatant containing the hERG proteins was loaded to a 4-12% gradient polyacrylamide gel for Western blotting with the same antibody.
Western blot analysis: Protein samples were loaded to 4-12% gradient precast mini gel (Invitrogen) and run at 200V for 3 hours in the Tris NuPAGE running buffer. The proteins in the gel were transferred into nitrocellulose membrane in NuPAGE transfer buffer with 10% methanol at 100 V for 1.5 hours. The membrane was blocked with 5% dry milk in Tris-buffered saline (TBS) with 0.1% Tween-20 (TBS-T) and then was incubated with the polyclonal rabbit anti-hergl antibody (1 : 1 ,000 dilution, Chemicon) at 4°C overnight. The blot was rinsed in TBS- T, incubated in a peroxidase-conjugated goat anti-rabbit antibody (1 : 1 ,000 dilution, Santa Cruz) for 2 h in 5% normal goat serum in TBS-T and rinsed in TBS-T. The blot was developed in ECL Plus (Amersham) and was exposed to Kodak BioMax film. Films were digitized using a scanner, and the resulting images were analyzed using NIH image J.
Immunohistochemistry: Cortex was dissected from embryonic day 18 rats, dissociated in Ca and Mg free HBSS containing 0.125% tyrosine for 15 min, triturated in DMEM/10% FBS, then plated on poly-D-lysine coated 12- well plates at 5,000 per coverslip. Cells were grown at
37°C, 5% C02 and 95% humidity, first in 10% FBS/DMEM, and 1 d later switched to serum- free medium Neurobasal plus B27. After 7 days, the cortical neurons were transfected with KCNH2, Isoform 3.1 in pcDNA3.0 vector or vector only. The transfected cells were then fixed with 4% paraformaldehyde. Slices were double labeled with anti-KCNH2 (hERG) rabbit antibody at 1 :200 (Chemicon International). The primary antibodies were applied overnight (4°C), and then tissues were rinsed in HSPBS. The secondary antibody used was Alexa-488 goat-anti-rabbit IgG applied 1 h at room temperature. Tissues were then rinsed again then mounted with antifad mounting medium. Confocal images were obtained using a Zeiss confocal microscope (LSM 510).
Electrophysiology
Cell culture and transient transfection; cDNA for CNH2-1A and Isoform 3.1 were cloned and subcloned as described above. HEK293T cells were plated at 50% confluency in Dulbecco's Modified Eagle Medium (DMEM) supplemented with 10% fetal bovine serum (FBS). At the time of plating, HEK293T cells were transfected with the KCNH2-1A and Isoform 3.1 cDNA constructs, using Lipofectaniine 2000 (Invitrogen), using manufacturer's protocols. pEGFP-Cl (Clontech) DNA was cotransfected for visualization of transfected cells. Cells transfected for 2-4 days were used for electrophysiology. Cortical neurons dissociated from embryonic day 18 (El 8) rats were first nucleofected with Isoform 3.1 and EGFP cDNAs according to instruction provided by Amaxa. The cells were plated in DMEM containing 10% FBS at 1 million cells per 35 mm dish, and then transferred to Neurobasal medium supplemented with B27 (Invitrogen), glutamax I (Invitrogen) on the following day. Neurons grown for 1 1-15 days were used for electrophysiology.
Cell culture protein extraction: HEK293T cells were lysed 48 h after transfection with KCNH2-1A and Isoform 3.1 DNA constructs in RIPA buffer (50 mM Tris-HCl pH 7.4, 150 mM NaCl, 1% NP-40, 0.5% Sodium deoxycholate, 0.1% SDS) supplemented with a protease inhibitor cocktail (Sigma) and a phosphatase inhibitor cocktail (Calbiochem). Protein concentrations were determined by Bradford assay (Bio-Rad). Proteins were resolved by western blot as described above.
Electrophysiological recordings: Transfected HEK293T cells and cortical neurons on coverglass were transferred to a small cell bath mounted on the stage of an inverted microscope (Diaphot, Nikon), identified as GFP-positive under the fluorescence microscope, and superfused
with extracellular saline solution containing (in mM): 137 Na-Isethionic acid, 4 K-gluconate, 1.8 CaCl2, 1 MgCl2, 10 HEPES, 10 glucose (pH 7.4 with NaOH). Standard whole-cell recordings were performed at room temperature. The recording pipette was filled with the internal pipette solution containing (in mM) 130 K-gluconate, 1 MgCl2, 5 EGTA, 5 MgATP, 10 HEPES and 0.4 Na2GTP (pH 7.2 with KOH), and had a resistance of 2-4 ΜΩ. Data were collected by a patch clamp amplifier (Axopatch 200B) and analyzed by pClamp 9.0 software (Molecular Devices, Sunnyvale, California). After the whole-cell configuration was achieved, series resistance were compensated by 80-90% and monitored periodically. Most cultured cortical neurons had series resistance around 7-8 ΜΩ (range, 4-13 ΜΩ). A small percentage of cortical neurons with a resting membrane potential of less than -50 mV, or gradual changes in membrane potential, input resistance or action potential amplitudes, were considered as unhealthy and discarded. Voltage protocols given by pClamp were delivered to the HEK293T cells under voltage-clamp conditions through the patch pipette. The decay of the "tail" currents in HEK cells, attributed to channel deactivation, was fitted by a mono-exponential equation I(t) = Ii [exp(-t/t)] + 10, where I(t) is the total current at time t, I] is the initial amplitude, τ is the deactivation time constant, and I0 is the non-inactivating residual current. For cortical neurons, a double-exponential equation was used to generate τΐ and τ2. Current-clamp recordings were also performed. A depolarizing current step was injected to induce multiple action potentials. Both spike frequency (number of spikes/sec depolarization) and degree of adaptation (ratio of 1 st to last interspike intervals) were calculated. Example 2
Genetic Variation in KCNH2 Associated with Expression in Brain of a unique hERG Isoform Modulates Treatment Response in Patients with Schizophrenia
Context
Antidopaminergic drugs, the only evidence based medical treatments for schizophrenia, bind to HERG1 potassium channels encoded by KCNH2, accounting for their side effect of QT interval prolongation. Recently, risk for schizophrenia has been associated with genetic variation in KCNH2, which also impacts on cognitive function, physiologic engagement of hippocampus and prefrontal cortex during memory, and increased expression of a novel, brain selective isoform KCNH2-3.1 with unique physiologic properties.
Objective
To assess the possibility that genetic variation associated with KCNH2 3.1 may impact the therapeutic effects of antipsychotic drugs.
Design, Setting, and Participants
We evaluated the therapeutic effects of antipsychotic drugs in a pharmacogenetic study of patients with schizophrenia in two independent studies: 1) an NIMH inpatient double blind, placebo-controlled, crossover trial (N=54), and 2) the multicenter, nationwide, outpatient CATIE study (N=364). KCNH2 genotype associated with increased expression of KNCH2 3.1 in brain was treated as a predictor variable.
Main Outcome Measure
Treatment associated changes in PANSS symptom ratings were evaluated in both groups.
Time to discontinuation of olanzapine was also considered in the CATIE trial.
Results
In the first study, individuals who were homozygote for the KCNH2 3.1 expression- associated T allele of rsl 036145 had highly significant improvement of positive symptoms, general psychopathology and thought disturbance, while patients with other genotypes showed little change. In the second larger study, analogous genotypic effects were observed for positive symptoms and total psychopathology ratings. Analysis of medication discontinuation in the CATIE study showed that individuals who are homozygote for the T allele at rsl036145 were 5- times less likely to discontinue medication.
Conclusion
These consistent findings in two markedly different studies of patients with schizophrenia support the hypothesis that hERGl mediated effects of antipsychotics may not be limited to their potential cardiovascular side effects but also may involve therapeutic actions related to the brain- specific 3.1 isoform of KCNH2.
Schizophrenia is a complex and heterogeneous psychiatric illness with significant interplay between environmental and genetic components. Among the neurotransmitter systems implicated in this illness, dopamine (DA) has been at the forefront of research for almost fifty years. Both experimental and clinical studies support a role for this neurotransmitter in the pathophysiology of schizophrenia. ( Snyder SH. Dopamine hypothesis of schizophrenia-Focus on dopamine receptor. Am. J. Psychiat. 1976;133(2): 197-202; Crow TJ, Johnstone EC, Longden AJ, Owen F. Dopaminergic mechanisms in schizophrenia-Antipsychotic effect and disease process.
Ill
Life Sci. 1978;23(6):563; Grace AA. Phasic versus tonic dopamine release and the modulation of dopamine system responsivity- A hypothesis for the etiology of schizophrenia. Neuroscience. 1991 ;41 ( 1 ) : 1 -24.) In this context, initial studies on the relationship between the potency of antipsychotic medications to block DA receptors and their clinical efficacy represented a milestone in the formulation of the DA hypothesis of schizophrenia and its treatment. (Creese I, Burt DR, Snyder SH. Dopamine receptor-binding predicts clinical and pharmacological potencies of anti-schizophrenic drugs Science. 1976;192(4238):481-483.) Over the last 60 years, the singular approach for the treatment of schizophrenia is the use of DA receptor (D2 subtype) inhibitors. (Bennett MR. Monoaminergic synapses and schizophrenia: 45 years of neuroleptics. J Psychopharmacol. 1998; 12(3):289-304; Delay J, Deniker P, Ropert R Four years of experience with chlorpromazine in therapy of psychoses. Presse Med. 1956;64(22):493-496; urland AA. Chlorpromazine in the treatment of schizophrenia; a study of 75 cases. J Nerv Ment Dis. 1955 121(4):321 -329.) More recently, the development of so-called atypical antipsychotics with additional serotonin receptor (5-HT2 subtype) blocking properties provided modified therapeutic tools with less motor side effects but with more metabolic effects. (Costall B, Naylor, RJ. .
Detection of the neuroleptic properties of clozapine, sulpiride and thioridazine.
Psychopharmacologia. 1975;43(l):69-74; Komossa K, C. Rummel-Kluge, et al. Risperidone versus other atypical antipsychotics for schizophrenia. Cochrane Database of Systematic Reviews. 201 1 ;1 ; Newcomer JW. Second-generation (atypical) antipsychotics and metabolic effects - A comprehensive literature review. CNS Drugs. 2005;19: 1-93.) While the newer drugs are better tolerated and effectively reduce positive symptoms, they rarely induce recovery. This unfortunate reality is not different from the older typical antipsychotics, indicating that neither the old nor the new antipsychotic medications are specific enough to address the complex pathophysiology of the disease.
One of the variable limitations of antipsychotic medications is prolongation of the QT interval (long QT syndrome [LQT]) and increased rates of sudden death, potentially related to this side effect.( Recanatini M, Poluzzi E, Masetti M, Cavalli A, De Ponti F. QT prolongation through hERG K+ channel blockade: Current knowledge and strategies for the early prediction during drug development. Med. Res. Rev. Mar 2005;25(2): 133-166.) The QT prolongation associated with antipsychotic drugs results from the blockade of the human ether-a-go-go-related potassium channel (hERGl) in the heart.( Kongsamut S, Kang JS, Chen XL, Roehr J, Rampe D.
A comparison of the receptor binding and HERG channel affinities for a series of antipsychotic drugs. Eur J Pharmacol. Aug 2002;450(1):37-41 ; Shepard PD, Canavier CC, Levitan ES. Ether- a-go-go-Related gene potassium channels: What's all the buzz about? Schizophr. Bull. Nov 2007;33(6): 1263-1269.) hERGl, along with hERG2 and hERG3 (Gutman G, Chandy KG, Grissmer S, Lazdunski M, McKinnon D, Pardo LA, Robertson GA, Rudy B, Sanguinetti MC, Stiihmer W, Wang X. International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels. Pharmacol Rev. 2005 2005;12(91):473-508), belong to a subfamily of voltage-gated K+ channels (Warmke JW, Ganetzky B. A family of potassium channel genes related to EAG in drosophila and mammals. P Natl Acad Sci USA. Apr 1994;91(8):3438-3442) that plays a critical role in regulating excitability and repolarization in cardiac and smooth muscle, as well as in neurons. ( Schwarz JR, Bauer CK. Functions of erg K+ channels in excitable cells. Journal of Cellular and Molecular Medicine. Jan-Mar 2004;8(1):22- 30.) The hERGl channel is responsible for the delayed rectifier potassium current (IKr), a major component of cardiac repolarization^ Schwarz JR, Bauer CK. Functions of erg K+ channels in excitable cells. Journal of Cellular and Molecular Medicine. Jan-Mar 2004;8(l):22-30; Wehrens X. Structural determinants of potassium channel blockade and drug-induced arrhythmias. Handb Exp Pharmacol. 2006;171 : 123-157.) The hERGl channel displays a tetrameric structure with one a-subunit with six transmembrane spanning domains and one auxiliary beta subunit with one transmembrane spanning domain.( Phartiyal P, Jones EMC, Robertson GA. Heteromeric assembly of human ether-a-go-go-related gene (hERG) la/lb channels occurs cotranslationally via N-terminal interactions. J Biol Chem. Mar 2007;282(13):9874-9882.) The assemblage of the different hERG channels gives rise to a supramolecular structure that serves as the voltage-gated K+ channel. ( Perry M, Sachse FB, Sanguinetti MC. Structural basis of action for a human ether- a-go-go-related gene 1 potassium channel activator. P Natl Acad Sci USA. Aug
2007;104(34): 13827-13832.) The hERGl protein is encoded by the KCNH2 gene which contains 15 exons on chromosome 7q36.1 and produces at least three distinct isoforms by alternative splicing. Studies have identified over 300 genetic variants in KCNH2 that can either cause a congenital form of LQT syndrome or predispose to acquired LQT syndromes. ( Thomas D, Karle CA, Kiehn J. . The cardiac hERG/IKr potassium channel as pharmacological target: structure, function, regulation, and clinical applications. Curr Pharm Des. 2006;12(18):2271- 2283; Witchel H. The hERG potassium channel as a therapeutic target. Expert Opin Ther
Targets. 2007;1 1(3):321-336.) Blockade of hERGl channels by antipsychotics may represent the most frequent cause of the acquired LQT syndrome. ( Perrin M, Subbiah RN, Vandenberg JI, Hill AP. Human ether-a-go-go related gene (hERG) K+ channels: function and dysfunction. Prog Biophys Mol Biol. 2008;98(2-3): 137-148.)
Using mRNA characterization techniques in human postmortem brain samples, Huffaker et al. identified a brain- selective and primate-specific isoform (3.1) of the KCNH2 gene that regulates neuronal firing patterns. When compared with the full-length KCNH2 (1A) isoform, KCNH2-3.1 messenger RNA levels are similar in the brain but 3 -orders of magnitude lower in the heart. This novel isoform has a novel 5' exon extension and is lacking the PAS domain of the full length protein that is critical for slow channel deactivation and repolarization. Metaanalysis of five independent clinical data sets showed an association of single nucleotide polymorphisms (SNPs) in KCNH2 with schizophrenia and the risk associated alleles predicted lower intelligence quotient (IQ) scores and reduced speed of cognitive processing in living human subjects. (Huffaker SJ, Chen JS, Nicodemus K , et al. A primate-specific, brain isoform of KCNH2 affects cortical physiology, cognition, neuronal repolarization and risk of
schizophrenia. Nat. Med. May 2009;15(5):509-518.) The same risk-associated alleles also predicted increased KCNH2.3.1 mRNA expression in postmortem hippocampus of both patients and healthy subjects, implicating a molecular mechanism of the clinical associations. Moreover, in postmortem brain of patients with schizophrenia, the relative expression of the novel 3.1 isoform was increased 2.5 fold compared with normal brain, suggesting a potential
pathophysiologic role of KCNH2 3.1 in the clinical state. This primate-specific isoform of KCNH2 was shown to have unique physiological properties in neuronal culture, mediating fast neuronal spiking. Two recent studies have further confirmed the association of the same SNPs in KCNH2 with schizophrenia. ( Atalar F, Acuner TT, Cine N, et al. Two four-marker haplotypes on 7q36.1 region indicate that the potassium channel gene HERGl (KCNH2, Kvl 1.1) is related to schizophrenia: a case control study. Behav. Brain Funct. May 2010;6(27); Hashimoto R, Ohi K, Yasuda Y, et al. The KCNH2 gene is associated with neurocognition and the risk of
schizophrenia. The World Journal of Biological Psychiatry. 201 l ;In Press.) While it is not known whether antipsychotic drugs affect the brain-specific KCNH2 3.1 channel as they do the full-length channel, the fact that antipsychotic drugs have hERGl effects and KCNH2 3.1 is genetically associated with schizophrenia at both the clinical and molecular level, raises the
possibility that the therapeutic effects of antipsychotic drugs may at least in part relate to changes in KCNH2 3.1 activity.
In this study we have evaluated the impact of genetic variation in KCNH2, which was previously associated with risk for schizophrenia and with increased expression of the 3.1 isoform in postmortem brain, in two independent clinical trials of antipsychotic medications in patients with schizophrenia: 1) a group of patients admitted to NIMH to participate in a double blind, placebo-controlled, crossover study, and b) a sample of patients with schizophrenia who participated in the NIMH sponsored multi-center CATIE trial. The hypothesis of this
pharmacogenetic study is that KCNH2 genotype related to risk for schizophrenia and expression of the brain-selective and primate-specific isoform 3.1 of KCNH2 impacts treatment response to antipsychotic drugs. The results of both independent trials support this hypothesis.
METHODS
Patients
Two independent cohorts of patients undergoing antipsychotic treatment trials were included in this study. The first cohort consisted of 54 partially treatment-resistant patients with schizophrenia admitted to the Clinical Brain Disorders Branch schizophrenia research inpatient unit at the NIMH Clinical Center between 1998 and 2010. All of these subjects were self- reported Caucasian of European ancestry and were diagnosed with chronic schizophrenia using DSM-IV criteria. (Task Force on DSM-IV. Diagnostic and Statistical Manual of Mental
Disorders. Fourth ed. Washington, DC: American Psychiatric Association; 2005.) They volunteered to participate in a double-blind, placebo-controlled, crossover study with standard doses of atypical antipsychotics, including olanzapine, perphenazine, quetiapine, risperidone, or ziprasidone. All patients, and a family member if necessary, provided informed consent for participation in the study, which was approved by the NIH Institutional Review Board. The program typically enrolled patients who already had adequate trials of standard antipsychotic medication interventions but were only partially effective in decreasing their symptoms. Upon admission, all patients underwent medical, neurological, and psychiatric evaluation lasting four to twelve weeks. If it was then concluded that the patient had significant medical problems, a history of violence or suicidal behavior not identified during the pre-hospitalization screening, or if the patient decided to withdraw his/her consent, he/she could leave the hospital or participate
in other protocols not involving placebo studies. The demographic characteristics of the patients are shown in Table 12.
All patients included in this study were on atypical antipsychotic medications prior to their admission. After the initial evaluation period, patients were maintained on a standard dose of one atypical antipsychotic and all other medications were discontinued. The decision about which antipsychotic medication would be used in the coded study was based on best prior response, patient preference, and side effect profile. The patients then remained on the single antipsychotic medication in an open-label fashion for several weeks before transitioning to coded medication and were tapered from their medication over a period of four to seven days.
Subgroup 1 (N=35) received sequentially four weeks of coded placebo followed by four weeks of coded standard atypical antipsychotics. Subgroup 2 (N=19) received the inverse sequence, i.e. after a similar open medication and taper period they received standard antipsychotic treatment for four weeks followed by placebo for four weeks. Because of the highly supervised and structured nature of the NIMH inpatient environment, most patients tolerated the four weeks of placebo well. At the end of the coded double-blind protocol, the patients were restarted on an active medication for six or more weeks before starting another experimental protocol, or until they were well enough to be discharged.
Weekly rating on the 16-item Positive and Negative Syndrome Scale (PANSS) (Kay SR, Fiszbein A, Opler LA. The positive and negative syndrome scale (PANSS) for schizophrenia. Schizophr. Bull. 1987;13(2):261-276) was performed independently by one of four trained research nurses. Two weeks prior to starting the double blind protocol and up to four weeks after completing the protocol, ratings were performed twice a week. The PANSS is a 7-point rating scale (1 -7), with one indicating the absence of a symptom or behavior and seven indicating greatest severity of illness. The PANSS items comprise three different scales, which include Positive Syndrome, Negative Syndrome and General Psychopathology, and five different clusters comprised of Anergia, Thought Disturbance, Activation, Paranoid/Belligerence and Depression. Mean PANSS baseline ratings in the NIMH study before entering the placebo- controlled protocol were: Positive Syndrome: 14.25+4.09, Negative Syndrome: 15.69+4.6, General Psychopathology: 29.58+5.81, Anergia: 8.48+2.23, Thought Disturbance: 8.36+3.61, Activation: 5.08+1.31 , Paranoid/Belligerence: 4.89+0.85 and Depression: 8.40+2.18.
The second cohort consisted of patients randomly assigned to five medications during the Phase 1/1 A (first drug assigned) of the Clinical Antipsychotic Trials of Intervention
Effectiveness (CATIE),( Stroup TS, McEvoy JP, Swartz MS, et al. The National Institute of Mental Health Clinical Antipsychotic Trials of Intervention Effectiveness (CATIE) project:
Schizophrenia trial design and protocol development. Schizophr. Bull. 2003;29(1): 15-31) a clinical trial to compare the effectiveness of antipsychotic drugs. The demographic
characteristics of the patients in the CATIE cohort are shown in Table 13. Patients were initially randomly assigned to receive olanzapine, perphenazine, quetiapine, risperidone or ziprasidone under double-blind conditions and followed up for 18 months or until treatment was
discontinued or switched to another antipsychotic (i.e. Phase 2). Eligible patients were 18 to 65 years of age, had received a diagnosis of schizophrenia based on DSM-IV criteria26 and were able to take oral antipsychotic medication. The primary outcome measure in the CATIE sample was time to medication discontinuation, most often due to lack of efficacy or side-effects.
PANSS ratings were included as a secondary efficacy outcome. Details on the CATIE trial methods have been previously published.( Stroup TS, McEvoy JP, Swartz MS, et al. The
National Institute of Mental Health Clinical Antipsychotic Trials of Intervention Effectiveness (CATIE) project: Schizophrenia trial design and protocol development. Schizophr. Bull.
2003;29(1): 15-31.) For consistency with the NIMH inpatient study and to reduce effects of genetic heterogeneity, only Caucasian subjects were included for analysis. Because of the outpatient and parallel design of this study, information about compliance based on drug clearance is an important factor determining symptom change during the CATIE trial. ( Bigos KL, Pollock BG, Coley KC, et al. Sex, race, and smoking impact olanzapine exposure. Journal of Clinical Pharmacology. 2008;48(2): 157-165; Bigos KL, Bies RR, Pollock BG, Lowy JJ, Zhang F, Weinberger DR. Genetic Variation in CYP3A43 Explains Racial Difference in Olanzapine Clearance. Molecular Psychiatry. In Press.) Thus, we only analyzed treatment response from subjects on whom we had drug clearance data (N=364) (Bigos KL, Pollock BG, Coley KC, et al. Sex, race, and smoking impact olanzapine exposure. Journal of Clinical Pharmacology.
2008;48(2): 157-165). Drug clearance was estimated using population pharmacokinetic modeling of drug concentrations and used in the statistical analysis of treatment response as previously described. ( Bigos KL, Pollock BG, Coley KC, et al. Sex, race, and smoking impact olanzapine exposure. Journal of Clinical Pharmacology. 2008;48(2): 157-165. Bigos KL, Bies RR, Pollock
BG, Lowy JJ, Zhang F, Weinberger DR. Genetic Variation in CYP3A43 Explains Racial
Difference in Olanzapine Clearance. Molecular Psychiatry. In Press.)
Genotyping
We genotyped three SNPs rs3900779, rs748693 and rsl036145 in KCNH2 which have been associated with schizophrenia and with expression of the novel KCNH2 3.1 isoform in human post-mortem brain. ( Huffaker SJ, Chen JS, Nicodemus KK, et al. A primate-specific, brain isoform of KCNH2 affects cortical physiology, cognition, neuronal repolarization and risk of schizophrenia. Nat. Med. May 2009;15(5):509-518.) Genotypes were determined using the 5'-exonuclease fluorescent Taqman assay (assay by design or assay on demand) and the allelic discrimination was read on an ABI 7900 SDS system (Applied Biosystems, Foster City, CA). (Livak KJ. Allelic discrimination using fluorogenic probes and the 5 ' nuclease assay. Genet. Anal.-Biomol. Eng. Feb 1999;14(5-6): 143-149.)
Statistical Analysis
Several statistical analyses were performed based on the specifics of study design and measurement of outcomes. In the NIMH inpatient study (cohort 1), which is a within-subject crossover design with repeated measures, with some discontinuation due to clinical
decompensation, we employed a linear mixed-effect model to examine the effects of treatment, genotype, and their interaction on PANSS ratings. In the CATIE sample (cohort 2), a general linear model was used to examine the association of KCNH2 genotype with change (first -last evaluation) in PANSS ratings while controlling for covariates such as age, sex, drug clearance, medications, time from the first evaluation to the last evaluation. Because the mean and variations of drug clearance measure varied with drugs, we assigned an ordinal measure of 1 to 4 according to the quartile distribution of each drug clearance to make the measurement of clearance comparable between drugs.
We also attempted to examine time to discontinuation of medication, which was a primary outcome measure of the CATIE trial. Time to discontinuation in the CATIE trial, however, is a problematic measure in a pharmacogenetic analysis of treatment response, because it was confounded by many issues, including side effects, patient preference and other subjective individual considerations. Patients in the CATIE trial were allowed to stop medication for literally any reason at any time. An illustration of the uncertainties inherent in time to discontinuation is that it was not predicted by drug clearance rate, which did predict symptom
change during treatment (Bigos KL, Pollock BG, Coley KC, et al. Sex, race, and smoking impact olanzapine exposure. Journal of Clinical Pharmacology. 2008;48(2): 157-165; Bigos K, Bies RR, Pollock BG, Lowy JJ, Zhang F, Weinberger DR. Molecular Psychiatry. Genetic Variation in CYP3A43 Explains Racial Difference in Olanzapine Clearance. In Press. 2011). In addition, the various drug arms differed substantially in reasons for discontinuation and time to
discontinuation for whatever reason. Nevertheless, we assessed genotype effect on time to discontinuation in the olanzapine response data. Olanzapine had the longest time to
discontinuation in the study and the least number of discontinuations for reasons other than efficacy; thus, time to discontinuation of olanzapine may better reflect variable efficacy, per se. Furthermore, we had previously meticulously curated the olanzapine data to exclude
noncompliant subjects and subjects receiving other medications as part of the clearance determinations. The Cox proportional hazard model was used to analyze the time to
discontinuation data while controlling for age, sex, and drug clearance.
RESULTS
Demographics of the NIMH sample are shown in Table 12 based on rs 1036145 genotype, a SNP showing effects on treatment in this sample. Age at admission (p<0.032) and duration of illness (pO.001) were statistically different by genotype groups.
Table 12. Demographics of patients in the NIMH cohort by KCNH2 genotype at rs1036145
Genotype p value
N (M/F)# 16 (15/1 ) 28 (16/12) 10 (9/1 ) 0.014*
Age, years 26.6 ± 5.45 26.6 ± 6.01 32.8 ± 9.07 0.032*
FSIQ 88.1 ± 13.91 95.6 ± 13.45 89.5 ±12.52 0.175
Education, years 13.75 ± 2.41 13.79 ± 1.71 13.60 ± 1.58 0.966
Age of onset, years 22.1 ± 4.95 20.7 ± 4.83 19.7 ± 2.54 0.390
Duration of illness, years 4.8 ± 3.54 6.5 ± 5.00 13.5 ± 9.16 0.001 *
Smokers/Nonsmokers# 8/8 12/16 7/3 0.051
Values represent the mean ± standard deviation.
# Fisher extact test p value
The genotype groups differed slightly in gender proportions and in frequency of smokers. None of these effects can account for the genotype effects on outcome variables, as described below. No significant differences by genotype groups were observed for IQ, years of education
and prestudy antipsychotic dose in CPZ equivalents. Demographics of the CATIE sample by KCNH2 genotype of rs 1036145 are shown in Table 13. No significant differences were observed for mean CPZ equivalents, education, and age of onset or duration of illness. Smoking status did not differ by genotypes.
[insert table 13 here]
In the NIMH inpatient study, a significant effect of antipsychotic treatment on psychopathology ratings was observed in different scales and clusters of the PANSS (Table 14). Overall, medications had a significant impact on alleviation of positive symptoms (Beta=-1.356, p=0.0007) and general psychopathology (Beta=-2.285, p=0.0093), and a trend towards decreased negative symptoms was also observed (Beta=-1.084, p=0.0124) that did not survive correction for multiple testing. Analysis of the PANSS clusters also revealed significant changes in thought disturbance (Beta=-0.893, p=0.0004) and activation (Beta=-0.684, p=0.0018).
Table 14. Treatment Effect on Neuropsychiatric Symptoms from general linear
mixed model (coded ARM 1 and ARM2)
Effect Beta SE t P
Negative syndrome -1.0836 0.4204 -2.58 0.0124
Positive syndrome -1.3565 0.3798 -3.57 0.0007 **
Composite index -0.2667 0.3806 -0.7 0.4861
General -2.2851 0.8507 -2.69 0.0093
Psychopathology **
Anergia -0.3037 0.2398 -1.27 0.2102
Thought disturbance -0.8928 0.2383 -3.75 0.0004 **
Activation -0.6841 0.21 -3.26 0.0018 **
Paranoid belligerence -0.268 0.1474 -1.82 0.0742
Depression -0.4189 0.3173 -1.32 0.1918
Note: Beta: coefficient estimates; SE: standard error of coefficient estimate. rsl 036145 genotype showed a significant effect on treatment outcome (Table 15).
Individuals with the TT genotype had a better response to antipsychotic treatment. Specifically, individuals who were homozygote of the risk and isoform 3.1 expression associated T allele (i.e. genotype TT) had a significant reduction in ratings of positive syndrome (Beta=-2.84, p=0.0078), general psychopathology (Beta=-6.23, p=0.022) and thought disturbance (Beta=- 2.08, p=0.0041) when they were on medications; whereas individuals carrying other genotypes (CC+TC) had relatively little change in the same PANSS ratings (Table 15). The effect size of TT genotype on treatment was much larger than for genotypes CC+TC. The ratio of effect size for TT compared with TC+CC genotypes was 1.65 (0.42/0.25) for the positive syndrome, 1.88 (0.339/0.180) for general psychopathology and 1.84 (0.458/0/249). There were no significant
effects of the other two SNPs (rs3900779 and rs748693) on the change in PANSS scores in the NIMH cohort.
Table 15. Mean differences in antipsychotic treatment response by genotypes of rsl 036145
Group 1 Group2
Effect Symptoms Treatment Genotype Treatment Genotype Beta SE P size
Positive symptom
Medication CC+TC Placebo CC+TC -0.73 0.44 0.1042 0.254
Medication TT Placebo TT -2.84 1.02 0.0078 *** 0.420
General
psychopathology
Medication CC+TC Placebo CC+TC -1 .39 1.15 0.2336 0.1 80
Medication TT Placebo TT -6.23 2.63 0.022 ** 0.339
Thought disturbance
Medication CC+TC Placebo CC+TC -0.48 0.3 0.1 1 17 0.249
Medication TT Placebo TT -2.08 0.69 0.0041 *** 0.458 Note: Beta is mean difference in PANSS ratings based on least-square estimation
Similar genotypic effects on PANSS ratings were also observed in the larger CATIE cohort for each of the genotyped SNPs (Table 16). The change in total PANSS score was associated with all three SNPs: rs390079 (p=0.0236), rs748693 (p=0.0213) and rsl 036145 (p=0.012). Compared with homozygotes of the risk allele, the change in total PANSS score was less for genotype GT (Beta=-5,335, p=0.0173) and GG (Beta=-1.884, p=0.3908) at rs390079; for AG (Beta--4.813, p=0.0286) and AA (Beta=-1.033, p=0.645) at rs748693 ; and for CT (Beta=- 5,186, p=0.0192) and CC(Beta=-1.082, p =0.6266) at rsl036145 (Table 16). The change in PANSS positive symptoms also significantly varied with rs390079 (p=0.0327), rs748693
(p=0.0223) and rsl 036145 (p=0.0046) genotypes; and similarly, the change in PANSS rating was greater for individuals homozygote for the risk associated alleles at all three SNPs compared with other genotypes. We did not observe significant associations of the change in negative symptoms with any SNP.
Table 16. Effect of SNPs in KCNH2 on the change in PANSS rating in the CATIE trial
Positive symptom Negative symptom Total PANSS score
Beta t p*
P Beta t P P Beta t P p* rs3900779 0.03 0.2365 0.0236
GG -0.394 -0.54 0.5901 -0.05 -0.06 0.9495 -1.884 -0.86 0.3908
GT -1.59 -2.13 0.0336 -0.92 -1.19 0.2359 -5.335 -2.39 0.0173
TT 0 0 0
rs748693 0.02 0.3082 0.0213
AA 0.053 0.07 0.9434 0.08 0.1 0.9221 - 1.033 -0.46 0.6425
AG -1.334 -1.82 0.0696 -0.73 -0.96 0.3382 -4.813 -2.2 0.0286
GG 0 0 0
rsl036145 0 0.1747 0.012 cc 0.294 0.4 0.689 -0.05 -0.07 0.9475 -1.082 -0.49 0.6266
CT -1.402 -1.92 0.0559 -1.01 -1.31 0.1916 -5.186 -2.35 0.0192
TT 0 0 0
Note: P* is p value from testing for association of genotype with change in PANSS rating; Beta is
estimate of genotype effect (0 for reference group) Analysis of the time to discontinuation of olanzapine in the CATIE sample (n=89) also indicated that SNPs in KCNH2 affected this measure of response to antipsychotic treatment
(Table 17). While we observed trends for genotypic variation in overall time to discontinuation of medication at rs748693 (p=0.0781) and rsl036145 (p=0.0633), compared with non-risk allele homozygote individuals, individuals with GG genotype at rs748693 were nearly 4 times
(HR=0.254, p=0.031), and TT genotypes at rsl 036145 were nearly 5 times (HR=0.208, p=0.033) less likely to have discontinued medication.
Table 17. Hazard ratio estimates of three SNPs in KCNH2 from the COX proportional hazard model (Olanzapine; n=89, event=46)
Chi- P HR DF Chi-Square P
Est Se square rs3900779 0 1 2 2.4947 0.2873
-0.431 0.344 1.567 0.21 1 0.65
-0.688 0.536 1.646 0.2 0.503
rs748693 0 1 2 5.0986 0.0781
-0.1 19 0.352 0.1 15 0.735 0.888
-1.371 0.634 4.683 0.031 * 0.254
rsl036145 0 1 2 5.5206 0.0633
-0.06 0.397 0.023 0.88 0.942
-1.569 0.736 4.546 0.033 * 0.208
This study provides strong and consistent evidence of an association between variation in KCNH2 and short- and long-term clinical response to antipsychotic drugs in patients with schizophrenia. In fact, in two different treatment cohorts ascertained and examined with notably differing approaches, KCNH2 genotype previously associated with schizophrenia and with expression of a brain-selective isoform of this potassium channel modulated the therapeutic effects of antipsychotic drugs.
KCNH2 genotype (rs 1036145) had a significant impact on the response to antipsychotic treatment in the NIMH cohort in two separate groups (i.e. those receiving placebo first, and those receiving active drug first). Interestingly, patients who were homozygous for the risk-associated allele (TT genotype) showed a greater change in positive symptoms, thought disturbance and general psychopathology when compared with carriers of the C allele. This strong effect of genotype, which remained significant after correction for multiple testing and covarying for age, sex and IQ, is remarkable considering the relatively small sample size of this cohort and the variation in the protocol sequence of the two groups.
The pharmaco genetic associations and their directionality were confirmed and further extended in the analysis of the larger CATIE trial cohort. Interestingly, the significant changes in positive symptoms and general psychopathology were observed in the homozygous risk associated alleles at all three SNPs: rs3900779-TT, rs748693-GG and rsl036145-TT, the latter showing the strongest statistical significance in line with the results obtained in the smaller NIMH cohort. The impact of this replication in two independent cohorts is underscored by the fact that these trials were performed with two different clinical and experimental models, one that involved an outpatient, parallel cohort design while the other was a double blind, placebo- controlled, in-patient crossover, as well as different outcome measures. The effect size of the association also is noteworthy. In the placebo controlled NIMH inpatient study, individuals homozygote for the risk allele showed almost twice the effect size of response change compared with the other genotype groups. In the CATIE trial, individuals with the risk genotypes showed a four to five times lesser likelihood of discontinuing olanzapine, a primary outcome measure of the trial.
In both the NIMH and the CATIE samples, individuals with risk-associated genotypes, which predict increased expression of the novel, brain- and primate-specific isoform of KCNH2,
responded better to antipsychotic drug therapy. In other words, the greater the putative expression of the novel isoform, the larger the therapeutic response. It is tempting to conclude that our pharmacogenetic results reflect the ability of typical and atypical antipsychotics to bind to this novel KNCH2 potassium channel and that their therapeutic effects are at least in part related to this effect. ( Kongsamut S, Kang JS, Chen XL, Roehr J, Rampe D. A comparison of the receptor binding and HERG channel affinities for a series of antipsychotic drugs. Eur J
Pharmacol. Aug 2002;450(1):37-41 ; Shepard PD, Canavier CC, Levitan ES. Ether-a-go-go- Related gene potassium channels: What's all the buzz about? Schizophr. Bull. Nov
2007;33(6): 1263-1269.) This conclusion, however, must be viewed with caution. Clearly, many drugs bind to hERG channels, and only few of them are antipsychotic. hERG channels are heterodimers of various hERG components and the combinations of full length and 3.1 isoform channels may be critical for understanding the action in brain of varying effects of KCNH2 active drugs. Moreover, if the antipsychotic effect of drugs is selectively related to their modulation of channels containing 3.1 isoforms, then drugs that impact only 3.1 -lacking hERG channels might not be antipsychotic. It is also worth noting that the physiological effect of the 3.1 isoform as described in Huffaker et al (2009) suggests that the optimum therapeutic effect would not be channel blockade per se, but restoration of normal KCNH2 potassium conductance kinetics. Whether antipsychotic drugs act in part by this mechanism is also not known.
An alternative, indirect mechanism for the relationship of KCNH2 genotype and antipsychotic drug response might also be considered. Since hERGl channels are expressed on DA neurons, it is conceivable that their relationship to antipsychotic drug action is via an indirect mechanism related to the firing characteristics of these neurons. If DA neurons are overactive in psychotic patients, as is implicated from in vivo imaging studies (Laruelle M, Abi-Dargham A, Gil R, Kegeles L, Innis R. Increased dopamine transmission in schizophrenia: Relationship to illness phases. Biological Psychiatry. Jul 1999;46(l):56-72; Abi-Dargham A, Gil R, Krystal J, et al. Increased striatal dopamine transmission in schizophrenia: Confirmation in a second cohort. Am. J. Psychiat. Jun 1998;155(6):761-767), increased KCNH2.3.1 expression may at least in part drive this over activity, which is compensated by postsynaptic blockade of D2 receptors. By either mechanism, our results raise intriguing questions for further work and for the potential of KCNH2 3.1 selective drugs to be novel antipsychotic therapies.
Each of the clinical trials in this report has limitations. The NIMH study involved a relatively small number of patients. However, it was a double-blind, placebo-controlled, crossover design in a stable, inpatient population with chronic, unremitting schizophrenia in which medication intake is strictly monitored by experienced nursing staff in a highly structured research environment. A limitation of the CATIE cohort is the relatively uncontrolled outpatient nature of the study in which no stringent control existed for medication compliance. This problem was addressed by determination of antipsychotic medication levels and only those individuals in whom drug level was sufficient to determine plasma clearance rates were included in this analysis.
One of the main concerns related to the pharmacological action of antipsychotic drugs has been the inconsistent therapeutic response observed between individuals. This may represent one of the reasons why some individuals discontinue medications earlier than others due to the limited efficacy of the drugs. ( Lieberman JA, Stroup TS, McEvoy JP, et al. Effectiveness of antipsychotic drugs in patients with chronic schizophrenia. N. Engl. J. Med. Sep
2005 ;353(12): 1209-1223.) While there are likely many factors relating to this variable treatment response, our data suggest that KCNH2 genotype is one important factor. Moreover, our findings support the hypothesis that KCNH2 activity of antipsychotics may be connected not only with their potential cardiovascular side effects 36 but also with their therapeutic actions involving the brain-selective 3.1 isoform of KCNH2. (Huffaker SJ, Chen JS, Nicodemus KK, et al. A primate-specific, brain isoform of KCNH2 affects cortical physiology, cognition, neuronal repolarization and risk of schizophrenia. Nat. Med. May 2009; 15(5):509-518; Atalar F, Acuner TT, Cine N, et al. Two four-marker haplotypes on 7q36.1 region indicate that the potassium channel gene HERG1 (KCNH2, Kvl 1.1) is related to schizophrenia: a case control study. Behav. Brain Funct. May 2010;6(27)).
While the present invention has been described in some detail for purposes of clarity and understanding, one skilled in the art will appreciate that various changes in form and detail can be made without departing from the true scope of the invention. All figures, tables, and appendices, as well as patents, applications, and publications, referred to above, are hereby incorporated by reference.
Claims
1. A method for predicting the clinical response of a schizophrenic patient to an
antipsychotic medication comprising:
a) obtaining a biological sample from a patient diagnosed with schizophrenia;
b) detecting in the biological sample the presence of at least one marker selected from: i) at least one mutation in a KCNH2 nucleic acid molecule that is associated with expression of the 3.1 isoform of the KCNH2 gene;
ii) a single nucleotide polymorphism in the KCNH2 gene;
iii) a marker selected from the group consisting of Marker Ml, M2, M3, M4, M5, M6, M7, M8, M9, M10, Ml 1 , M12, M13, M14, M15, M16, M17, M18, M19, M20, M21 , M22, M23, M24, M25, M26, M27, M28, M29, M30, M31 , M32, M33, M34, M35, M36, M37, M38, M39, M40, M41, M42, and M43; and,
iv) at least one single nucleotide polymorphism in the KCNH2 gene selected from rs3900779, rs748693 and rsl036145;
wherein the presence of the at least one marker is indicative of a schizophrenic patient who will benefit from an antipsychotic medication.
2. The method of Claim 1, wherein the antipsychotic medication is an atypical antipsychotic medication selected from the group consisting of olanzapine, perphenazine, quetiapine, risperidone, and ziprasidone.
3. The method of Claim 1, wherein the benefit is selected from a significant reduction in ratings of positive syndrome, significant improvement in general psychopathology, and significant decrease in thought disturbance.
4. The method of claim 1 , wherein the biological sample is a sample of biological fluid or a tissue sample.
5. The method of Claim 4, wherein the sample is selected from the group consisting of blood, tears, urine, saliva, skin, muscle and lymph tissue.
6. The method of Claim 1, wherein the step of detecting comprises determining the
sequence of KCNH2 nucleic acid molecules in the sample.
7. The method of Claim 1 , wherein the step of detecting comprises detecting the presence of the at least one marker in both alleles of a KCNH2 gene in the patient.
8. The method of Claim 7, wherein the at least one marker is rs 1036145.
9. The method of Claim 1, wherein the KCNH2 nucleic acid molecule hybridizes under stringent hybridization conditions to a polynucleotide consisting of SEQ ID NO: 3 or SEQ ID NO: 4, or SEQ ID NO: 5.
10. The method of Claim 1 , wherein the step of detecting comprises performing at least one technique selected from the group consisting of Sanger dideoxy sequencing,
Pyrosequencing, RNA sequencing, next-generation sequencing technologies, single- strand conformation polymorphism, heteroduplex analysis, DNA microarray technology, denaturing gradient gel electrophoresis, allele-specific PCR, Scorpion Amplification Refractory Mutation System (SARMS) technology, SNaPshot analysis of PCR products, and mass spectrometry.
1 1. A method for determining if a schizophrenic patient is predicted to respond to the
administration of an antipsychotic medication, comprising detecting in a biological sample from a patient diagnosed with schizophrenia, a level of expression of the 3.1 isoform of the KCNH2 gene,
wherein the level of expression of the KCNH2 gene is indicative of whether the patient will benefit from treatment with an antipsychotic medication.
12. The method of claim 11 , wherein a level of expression of the 3.1 isoform of the KCNH2 gene is determined and compared to a level or reference range of expression of the 3.1 isoform of the KCNH2 gene from subjects not diagnosed with schizophrenia.
13. The method of claim 11, wherein the presence of the marker is determined by detecting the presence of a polypeptide encoded by the 3.1 isoform of the KCNH2 gene.
14. The method of Claim 13, wherein the step of detecting comprises performing at least one technique selected from the group consisting of an ELISA, immunoprecipitation assay, and direct measurement of an isoform 3.1 of KCNH2 protein activity.
15. The method of claim 13, wherein the method comprises detecting the presence of the polypeptide using a reagent that specifically binds to the polypeptide or a fragment thereof.
16. The method of claim 15, wherein the reagent is selected from the group consisting of an antibody, an antibody derivative, and an antibody fragment.
17. The method of claim 11 , wherein the presence of the marker is determined by obtaining RNA from the biological sample; generating cDNA from the RNA; amplifying the cDNA with probes or primers for marker genes; and obtaining from the amplified cDNA the expression levels of the genes or gene expression products in the sample.
18. The method of claim 11 , wherein the biological sample comprises brain tissue.
19. The method of claim 1 1, wherein the antipsychotic medication is an atypical
antipsychotic medication selected from the group consisting of olanzapine, perphenazine, quetiapine, risperidone, and ziprasidone.
20. The method of Claim 11, further comprising:
a) comparing the expression level of the 3.1 isoform of the KCNH2 gene in the
biological sample to a control level of the 3.1 isoform of the KCNH2 gene selected from the group consisting of:
i) a control level of the 3.1 isoform of the KCNH2 gene that has been correlated with beneficial response to the administration of an antipsychotic medication; and
ii) a control level of the 3.1 isoform of the KCNH2 gene that has been correlated with lack of beneficial response to the administration of an antipsychotic medication; and,
b) selecting the patient as being predicted to benefit from the administration of an antipsychotic medication, if the expression level of the 3.1 isoform of the KCNH2 gene in the biological sample is greater than the control level of expression of the 3.1 isoform of the KCNH2 gene that has been correlated with beneficial response to an antipsychotic medication, or
c) selecting the patient as being predicted to not benefit from the administration of an antipsychotic medication, if the level of the 3.1 isoform of the KCNH2 gene in the biological sample is statistically less than or equal to the control level of the 3.1 isoform of the KCNH2 gene that has been correlated with beneficial response to the
administration of an antipsychotic medication.
21. A method of identifying a schizophrenic patient predicted to respond to the
administration of an antipsychotic medication comprising:
a) detecting in a biological sample from a patient diagnosed with schizophrenia, a marker of the level of gene expression of the 3.1 isoform of the KCNH2 gene selected from the group consisting of: i) the expression level of marker genes having at least 95% sequence identity with the 3.1 isoform of the KCNH2 gene, or homologs or variants thereof;
ii) homologs of the 3.1 isoform of the KCNH2 gene, wherein the genes detected share 100% sequence identity with the 3.1 isoform of the KCNH2 gene;
iii) polypeptides encoded by the 3.1 isoform of the KCNH2 gene;
iv) fragments of polypeptides of the 3.1 isoform of the KCNH2 gene;
v) a polynucleotide which is fully complementary to the marker genes of i); vi) SEQ ID NO:3; and,
vii) SEQ ID NO:4;
b) selecting the patient as being predicted to benefit from the administration of an antipsychotic medication, if the expression level of the marker in the biological sample is greater than the control level of expression of the marker that has been correlated with beneficial response to an antipsychotic medication by a schizophrenic medication, or c) selecting the patient as being predicted to not benefit from the administration of an antipsychotic medication, if the level of the marker in the biological sample is statistically less than or equal to the control level of the marker gene that has been beneficial response to an antipsychotic medication by a schizophrenic medication.
A method for predicting the likelihood of a schizophrenic patient to discontinue a prescribed antipsychotic medication regimen comprising:
a) obtaining a biological sample from a patient diagnosed with schizophrenia;
b) detecting in the biological sample the presence of at least one marker selected from: i) at least one mutation in a KCNH2 nucleic acid molecule that is associated with expression of the 3.1 isoform of the KCNH2 gene;
ii) a single nucleotide polymorphism in the KCNH2 gene;
iii) a marker selected from the group consisting of Marker Ml, M2, M3, M4, M5, M6, M7, M8, M9, M10, Ml 1, M12, M13, M14, M15, M16, M17, M18, M19, M20, M21 , M22, M23, M24, M25, M26, M27, M28, M29, M30, M31 , M32, M33, M34, M35, M36, M37, M38, M39, M40, M41, M42, and M43; and,
iv) at least one single nucleotide polymorphism in the KCNH2 gene selected from rs3900779, rs748693 and rsl036145; wherein the presence of the at least one marker is indicative of a schizophrenic patient who will likely discontinue a prescribed antipsychotic medication regimen.
A method for predicting the likelihood of a schizophrenic patient to discontinue a prescribed antipsychotic medication regimen comprising detecting in a biological sample from a patient diagnosed with schizophrenia, a level of expression of the 3.1 isoform of the KCNH2 gene,
wherein the level of expression of the KCNH2 gene is indicative of a
schizophrenic patient who will likely discontinue a prescribed antipsychotic medication regimen.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US13/357,416 US8871443B2 (en) | 2007-03-26 | 2012-01-24 | Schizophrenia-related isoform of KCNH2 and development of antipsychotic drugs |
| PCT/US2013/022878 WO2013112676A1 (en) | 2012-01-24 | 2013-01-24 | Schizophrenia-related isoform of knch2 and development of antipsycotic drugs |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP2807275A1 true EP2807275A1 (en) | 2014-12-03 |
Family
ID=47633590
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP13702565.6A Withdrawn EP2807275A1 (en) | 2012-01-24 | 2013-01-24 | Schizophrenia-related isoform of knch2 and development of antipsycotic drugs |
Country Status (2)
| Country | Link |
|---|---|
| EP (1) | EP2807275A1 (en) |
| WO (1) | WO2013112676A1 (en) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2022530390A (en) * | 2019-04-24 | 2022-06-29 | アンスティチュ ナショナル ドゥ ラ サンテ エ ドゥ ラ ルシェルシュ メディカル | Methods for Predicting Antipsychotic Responses |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ES2156149T3 (en) | 1992-12-04 | 2001-06-16 | Medical Res Council | MULTIVALENT AND MULTI-SPECIFIC UNION PROTEINS, ITS MANUFACTURE AND USE. |
| WO1995011995A1 (en) | 1993-10-26 | 1995-05-04 | Affymax Technologies N.V. | Arrays of nucleic acid probes on biological chips |
| US7985551B2 (en) * | 2009-11-04 | 2011-07-26 | Suregene, Llc | Methods and compositions for the treatment of psychotic disorders through the identification of the SULT4A1-1 haplotype |
-
2013
- 2013-01-24 WO PCT/US2013/022878 patent/WO2013112676A1/en not_active Ceased
- 2013-01-24 EP EP13702565.6A patent/EP2807275A1/en not_active Withdrawn
Non-Patent Citations (1)
| Title |
|---|
| See references of WO2013112676A1 * |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2013112676A8 (en) | 2014-01-23 |
| WO2013112676A1 (en) | 2013-08-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8101380B2 (en) | Schizophrenia-related isoform of KCNH2 and development of antipsychotic drugs | |
| EP1469072B1 (en) | Means and methods for diagnosing and treating affective disorders | |
| US8871443B2 (en) | Schizophrenia-related isoform of KCNH2 and development of antipsychotic drugs | |
| EP1252329A2 (en) | Hypocretin and hypocretin receptors in regulation of sleep and related disorders | |
| WO2006054277A2 (en) | Treatment of neurodegenerative disease with angiogenin and its mutants | |
| WO2012107580A1 (en) | In vitro diagnosis method for predicting a predisposition to cardiomyopathy | |
| WO2008058399A1 (en) | Methods for diagnosis, prognosis or treatment of migraine and related disorders | |
| EP2305837A1 (en) | Method for diagnosis and treatment of a mental disease | |
| JP2007503210A (en) | Human autism susceptibility genes and uses thereof | |
| WO2013112676A1 (en) | Schizophrenia-related isoform of knch2 and development of antipsycotic drugs | |
| US20050196784A1 (en) | Human Type II diabetes gene - Kv channel-interacting protein (KChIP1) located on chromosome 5 | |
| JP5840124B2 (en) | How to detect schizophrenia | |
| US8067158B2 (en) | Methods and compositions for the diagnosis and treatment of schizophrenia | |
| US20150031569A1 (en) | Mutations of the GPR179 Gene in Congenital Stationary Night Blindness | |
| US20090246269A1 (en) | Identification and use of gprc variants in the treatment and diagnosis of parkinson's disease | |
| Class et al. | Patent application title: Mutations of the GPR179 Gene in Congenital Stationary Night Blindness Inventors: Christina Zeitz (Paris, FR) Isabelle Audo (Paris, FR) Elise Orhan (Paris, FR) Kinga Jakowska (Paris, FR) Jose Alain Sahel (Paris, FR) | |
| US20140187593A1 (en) | Diagnostic test and treatment for a neurological disorder | |
| Class et al. | Patent application title: FAM26C POLYMORPHISMS AND USE THEREOF FOR THE DIAGNOSTIC AND TREATMENT OF LATE ONSET ALZHEIMER'S DISEASE Inventors: Philippe Marambaud (Astoria, NY, US) Fabien Campagne (Astoria, NY, US) | |
| EP1551856A2 (en) | Novel therapeutic target for treating vascular diseases, dyslipidemias and related disorders | |
| WO2015083685A1 (en) | Dlg1/SAP97 GENE SPLICING VARIANT, AND DETECTION OF SCHIZOPHRENIA USING SPLICING VARIANT | |
| CA2852631A1 (en) | A gene and mutations thereof associated with seizure and movement disorders |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20140821 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| DAX | Request for extension of the european patent (deleted) | ||
| 17Q | First examination report despatched |
Effective date: 20150707 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20151118 |