EP2654804A1 - Her2 binding peptides labeled with aluminium-[18]fluoride complexed by nota - Google Patents
Her2 binding peptides labeled with aluminium-[18]fluoride complexed by notaInfo
- Publication number
- EP2654804A1 EP2654804A1 EP11804897.4A EP11804897A EP2654804A1 EP 2654804 A1 EP2654804 A1 EP 2654804A1 EP 11804897 A EP11804897 A EP 11804897A EP 2654804 A1 EP2654804 A1 EP 2654804A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- nota
- polypeptide
- seq
- chelator
- hplc
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 201
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 191
- 230000027455 binding Effects 0.000 title description 16
- 101150029707 ERBB2 gene Proteins 0.000 title description 5
- KRHYYFGTRYWZRS-UHFFFAOYSA-M Fluoride anion Chemical compound [F-] KRHYYFGTRYWZRS-UHFFFAOYSA-M 0.000 title description 5
- 229920001184 polypeptide Polymers 0.000 claims abstract description 195
- 239000002738 chelating agent Substances 0.000 claims abstract description 61
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 claims abstract description 50
- 239000012216 imaging agent Substances 0.000 claims abstract description 48
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 claims abstract description 47
- 238000000034 method Methods 0.000 claims abstract description 36
- 239000000203 mixture Substances 0.000 claims description 66
- JHALWMSZGCVVEM-UHFFFAOYSA-N 2-[4,7-bis(carboxymethyl)-1,4,7-triazonan-1-yl]acetic acid Chemical compound OC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CC1 JHALWMSZGCVVEM-UHFFFAOYSA-N 0.000 claims description 45
- 239000013522 chelant Substances 0.000 claims description 8
- 239000008194 pharmaceutical composition Substances 0.000 claims description 7
- 239000003937 drug carrier Substances 0.000 claims description 2
- 238000004519 manufacturing process Methods 0.000 claims 2
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 114
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 109
- 229910052796 boron Inorganic materials 0.000 description 82
- 206010028980 Neoplasm Diseases 0.000 description 78
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 75
- 229910001868 water Inorganic materials 0.000 description 74
- 239000000243 solution Substances 0.000 description 63
- 239000002904 solvent Substances 0.000 description 59
- 239000000047 product Substances 0.000 description 56
- 210000004027 cell Anatomy 0.000 description 46
- 241000699670 Mus sp. Species 0.000 description 42
- 238000002360 preparation method Methods 0.000 description 37
- 239000011541 reaction mixture Substances 0.000 description 37
- 238000000746 purification Methods 0.000 description 36
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 33
- 239000002953 phosphate buffered saline Substances 0.000 description 28
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 27
- 238000011894 semi-preparative HPLC Methods 0.000 description 27
- 239000008280 blood Substances 0.000 description 26
- 210000004369 blood Anatomy 0.000 description 26
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 24
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 24
- 239000000872 buffer Substances 0.000 description 22
- 150000001875 compounds Chemical class 0.000 description 22
- 238000002347 injection Methods 0.000 description 22
- 239000007924 injection Substances 0.000 description 22
- 210000001519 tissue Anatomy 0.000 description 21
- 238000003384 imaging method Methods 0.000 description 19
- 239000011780 sodium chloride Substances 0.000 description 19
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 18
- 241001465754 Metazoa Species 0.000 description 18
- IJGRMHOSHXDMSA-UHFFFAOYSA-N nitrogen Substances N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 18
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 16
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical class CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 16
- BWHMMNNQKKPAPP-UHFFFAOYSA-L potassium carbonate Chemical compound [K+].[K+].[O-]C([O-])=O BWHMMNNQKKPAPP-UHFFFAOYSA-L 0.000 description 16
- 238000004007 reversed phase HPLC Methods 0.000 description 16
- 239000007974 sodium acetate buffer Substances 0.000 description 16
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 15
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 15
- 230000015572 biosynthetic process Effects 0.000 description 15
- 238000006243 chemical reaction Methods 0.000 description 15
- 210000003734 kidney Anatomy 0.000 description 15
- 238000003786 synthesis reaction Methods 0.000 description 15
- 210000004185 liver Anatomy 0.000 description 14
- 229910052757 nitrogen Inorganic materials 0.000 description 14
- 239000003795 chemical substances by application Substances 0.000 description 13
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 13
- -1 Boc Chemical class 0.000 description 12
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 12
- SECXISVLQFMRJM-UHFFFAOYSA-N N-Methylpyrrolidone Chemical compound CN1CCCC1=O SECXISVLQFMRJM-UHFFFAOYSA-N 0.000 description 12
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 12
- 238000004458 analytical method Methods 0.000 description 12
- 238000000684 flow cytometry Methods 0.000 description 12
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 12
- 101001024703 Homo sapiens Nck-associated protein 5 Proteins 0.000 description 11
- 102100036946 Nck-associated protein 5 Human genes 0.000 description 11
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 11
- 125000002344 aminooxy group Chemical group [H]N([H])O[*] 0.000 description 11
- 210000000056 organ Anatomy 0.000 description 11
- 238000002600 positron emission tomography Methods 0.000 description 11
- 210000000952 spleen Anatomy 0.000 description 11
- 238000000825 ultraviolet detection Methods 0.000 description 11
- XKRFYHLGVUSROY-UHFFFAOYSA-N Argon Chemical compound [Ar] XKRFYHLGVUSROY-UHFFFAOYSA-N 0.000 description 10
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 10
- 241000699666 Mus <mouse, genus> Species 0.000 description 10
- 239000002253 acid Substances 0.000 description 10
- 238000010828 elution Methods 0.000 description 10
- 238000001727 in vivo Methods 0.000 description 10
- 239000013014 purified material Substances 0.000 description 10
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 9
- 239000003153 chemical reaction reagent Substances 0.000 description 9
- 230000000694 effects Effects 0.000 description 9
- 229910052731 fluorine Inorganic materials 0.000 description 9
- 239000011737 fluorine Substances 0.000 description 9
- 229910000027 potassium carbonate Inorganic materials 0.000 description 9
- 210000002700 urine Anatomy 0.000 description 9
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 8
- 235000001014 amino acid Nutrition 0.000 description 8
- 229940024606 amino acid Drugs 0.000 description 8
- 150000001413 amino acids Chemical class 0.000 description 8
- 239000012071 phase Substances 0.000 description 8
- 239000002243 precursor Substances 0.000 description 8
- 235000018102 proteins Nutrition 0.000 description 8
- 102000004169 proteins and genes Human genes 0.000 description 8
- 108090000623 proteins and genes Proteins 0.000 description 8
- 238000002603 single-photon emission computed tomography Methods 0.000 description 8
- 239000007787 solid Substances 0.000 description 8
- 239000000126 substance Substances 0.000 description 8
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 8
- USFZMSVCRYTOJT-UHFFFAOYSA-N Ammonium acetate Chemical compound N.CC(O)=O USFZMSVCRYTOJT-UHFFFAOYSA-N 0.000 description 7
- 239000005695 Ammonium acetate Substances 0.000 description 7
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 7
- 238000005481 NMR spectroscopy Methods 0.000 description 7
- 235000019257 ammonium acetate Nutrition 0.000 description 7
- 229940043376 ammonium acetate Drugs 0.000 description 7
- 230000001588 bifunctional effect Effects 0.000 description 7
- 238000004587 chromatography analysis Methods 0.000 description 7
- 239000012043 crude product Substances 0.000 description 7
- 230000009977 dual effect Effects 0.000 description 7
- 239000012467 final product Substances 0.000 description 7
- 238000004128 high performance liquid chromatography Methods 0.000 description 7
- 238000002953 preparative HPLC Methods 0.000 description 7
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 6
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 6
- SJRJJKPEHAURKC-UHFFFAOYSA-N N-Methylmorpholine Chemical compound CN1CCOCC1 SJRJJKPEHAURKC-UHFFFAOYSA-N 0.000 description 6
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 6
- 125000002355 alkine group Chemical group 0.000 description 6
- 239000011230 binding agent Substances 0.000 description 6
- 229940125782 compound 2 Drugs 0.000 description 6
- 230000021615 conjugation Effects 0.000 description 6
- 238000000132 electrospray ionisation Methods 0.000 description 6
- 238000002330 electrospray ionisation mass spectrometry Methods 0.000 description 6
- 125000001153 fluoro group Chemical group F* 0.000 description 6
- 235000019253 formic acid Nutrition 0.000 description 6
- ABTOQLMXBSRXSM-UHFFFAOYSA-N silicon tetrafluoride Chemical compound F[Si](F)(F)F ABTOQLMXBSRXSM-UHFFFAOYSA-N 0.000 description 6
- 238000003998 size exclusion chromatography high performance liquid chromatography Methods 0.000 description 6
- 238000003756 stirring Methods 0.000 description 6
- ZGYICYBLPGRURT-UHFFFAOYSA-N tri(propan-2-yl)silicon Chemical compound CC(C)[Si](C(C)C)C(C)C ZGYICYBLPGRURT-UHFFFAOYSA-N 0.000 description 6
- LMDZBCPBFSXMTL-UHFFFAOYSA-N 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide Chemical compound CCN=C=NCCCN(C)C LMDZBCPBFSXMTL-UHFFFAOYSA-N 0.000 description 5
- 239000004743 Polypropylene Substances 0.000 description 5
- 229920005654 Sephadex Polymers 0.000 description 5
- 239000012507 Sephadex™ Substances 0.000 description 5
- 229910052786 argon Inorganic materials 0.000 description 5
- 235000018417 cysteine Nutrition 0.000 description 5
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 5
- 238000001514 detection method Methods 0.000 description 5
- 239000006185 dispersion Substances 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 238000010438 heat treatment Methods 0.000 description 5
- 238000002513 implantation Methods 0.000 description 5
- 238000002372 labelling Methods 0.000 description 5
- 230000014759 maintenance of location Effects 0.000 description 5
- 125000005439 maleimidyl group Chemical group C1(C=CC(N1*)=O)=O 0.000 description 5
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 5
- 239000003643 water by type Substances 0.000 description 5
- ALYNCZNDIQEVRV-UHFFFAOYSA-N 4-aminobenzoic acid Chemical compound NC1=CC=C(C(O)=O)C=C1 ALYNCZNDIQEVRV-UHFFFAOYSA-N 0.000 description 4
- ATRRKUHOCOJYRX-UHFFFAOYSA-N Ammonium bicarbonate Chemical compound [NH4+].OC([O-])=O ATRRKUHOCOJYRX-UHFFFAOYSA-N 0.000 description 4
- 229910000013 Ammonium bicarbonate Inorganic materials 0.000 description 4
- 206010002091 Anaesthesia Diseases 0.000 description 4
- IAZDPXIOMUYVGZ-WFGJKAKNSA-N Dimethyl sulfoxide Chemical compound [2H]C([2H])([2H])S(=O)C([2H])([2H])[2H] IAZDPXIOMUYVGZ-WFGJKAKNSA-N 0.000 description 4
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 4
- PIWKPBJCKXDKJR-UHFFFAOYSA-N Isoflurane Chemical compound FC(F)OC(Cl)C(F)(F)F PIWKPBJCKXDKJR-UHFFFAOYSA-N 0.000 description 4
- 241000699660 Mus musculus Species 0.000 description 4
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 4
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical compound C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 description 4
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 4
- 150000001299 aldehydes Chemical class 0.000 description 4
- 150000001345 alkine derivatives Chemical class 0.000 description 4
- VSCWAEJMTAWNJL-UHFFFAOYSA-K aluminium trichloride Chemical compound Cl[Al](Cl)Cl VSCWAEJMTAWNJL-UHFFFAOYSA-K 0.000 description 4
- 125000000539 amino acid group Chemical group 0.000 description 4
- 235000012538 ammonium bicarbonate Nutrition 0.000 description 4
- 239000001099 ammonium carbonate Substances 0.000 description 4
- 230000037005 anaesthesia Effects 0.000 description 4
- 125000000852 azido group Chemical group *N=[N+]=[N-] 0.000 description 4
- 239000006227 byproduct Substances 0.000 description 4
- 230000008878 coupling Effects 0.000 description 4
- 238000010168 coupling process Methods 0.000 description 4
- 238000005859 coupling reaction Methods 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 238000001914 filtration Methods 0.000 description 4
- 235000013305 food Nutrition 0.000 description 4
- 238000004108 freeze drying Methods 0.000 description 4
- 238000010348 incorporation Methods 0.000 description 4
- 229960002725 isoflurane Drugs 0.000 description 4
- 230000001404 mediated effect Effects 0.000 description 4
- 238000011580 nude mouse model Methods 0.000 description 4
- 229920001155 polypropylene Polymers 0.000 description 4
- 239000000843 powder Substances 0.000 description 4
- 239000000377 silicon dioxide Substances 0.000 description 4
- 238000001542 size-exclusion chromatography Methods 0.000 description 4
- 239000000725 suspension Substances 0.000 description 4
- YNHKVOGCDPODMT-UHFFFAOYSA-N 1-(2-aminoethyl)pyrrole-2,5-dione;2,2,2-trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.NCCN1C(=O)C=CC1=O YNHKVOGCDPODMT-UHFFFAOYSA-N 0.000 description 3
- QBXODCKYUZNZCY-UHFFFAOYSA-N 2-[(2-methylpropan-2-yl)oxycarbonylamino]oxyacetic acid Chemical compound CC(C)(C)OC(=O)NOCC(O)=O QBXODCKYUZNZCY-UHFFFAOYSA-N 0.000 description 3
- UOQXIWFBQSVDPP-COJKEBBMSA-N 4-fluoranylbenzaldehyde Chemical compound [18F]C1=CC=C(C=O)C=C1 UOQXIWFBQSVDPP-COJKEBBMSA-N 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- VHUUQVKOLVNVRT-UHFFFAOYSA-N Ammonium hydroxide Chemical compound [NH4+].[OH-] VHUUQVKOLVNVRT-UHFFFAOYSA-N 0.000 description 3
- 102000012192 Cystatin C Human genes 0.000 description 3
- 108010061642 Cystatin C Proteins 0.000 description 3
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 206010015548 Euthanasia Diseases 0.000 description 3
- YCKRFDGAMUMZLT-UHFFFAOYSA-N Fluorine atom Chemical compound [F] YCKRFDGAMUMZLT-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 101000851181 Homo sapiens Epidermal growth factor receptor Proteins 0.000 description 3
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 3
- KDLHZDBZIXYQEI-UHFFFAOYSA-N Palladium Chemical compound [Pd] KDLHZDBZIXYQEI-UHFFFAOYSA-N 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 3
- WDLRUFUQRNWCPK-UHFFFAOYSA-N Tetraxetan Chemical compound OC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CCN(CC(O)=O)CC1 WDLRUFUQRNWCPK-UHFFFAOYSA-N 0.000 description 3
- 230000002776 aggregation Effects 0.000 description 3
- 238000004220 aggregation Methods 0.000 description 3
- 229910021529 ammonia Inorganic materials 0.000 description 3
- 235000011114 ammonium hydroxide Nutrition 0.000 description 3
- 239000012491 analyte Substances 0.000 description 3
- 239000007864 aqueous solution Substances 0.000 description 3
- 229940090047 auto-injector Drugs 0.000 description 3
- IVRMZWNICZWHMI-UHFFFAOYSA-N azide group Chemical group [N-]=[N+]=[N-] IVRMZWNICZWHMI-UHFFFAOYSA-N 0.000 description 3
- 150000001540 azides Chemical class 0.000 description 3
- 210000000988 bone and bone Anatomy 0.000 description 3
- 239000012267 brine Substances 0.000 description 3
- 238000003776 cleavage reaction Methods 0.000 description 3
- 230000001143 conditioned effect Effects 0.000 description 3
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 3
- 238000010586 diagram Methods 0.000 description 3
- 239000000539 dimer Substances 0.000 description 3
- KRHYYFGTRYWZRS-BJUDXGSMSA-M fluorine-18(1-) Chemical compound [18F-] KRHYYFGTRYWZRS-BJUDXGSMSA-M 0.000 description 3
- 102000051957 human ERBB2 Human genes 0.000 description 3
- 239000012535 impurity Substances 0.000 description 3
- 239000006166 lysate Substances 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 239000012074 organic phase Substances 0.000 description 3
- BZQFBWGGLXLEPQ-REOHCLBHSA-N phosphoserine Chemical compound OC(=O)[C@@H](N)COP(O)(O)=O BZQFBWGGLXLEPQ-REOHCLBHSA-N 0.000 description 3
- 239000002244 precipitate Substances 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 125000006239 protecting group Chemical group 0.000 description 3
- 239000012264 purified product Substances 0.000 description 3
- 230000007017 scission Effects 0.000 description 3
- 238000000926 separation method Methods 0.000 description 3
- HPALAKNZSZLMCH-UHFFFAOYSA-M sodium;chloride;hydrate Chemical compound O.[Na+].[Cl-] HPALAKNZSZLMCH-UHFFFAOYSA-M 0.000 description 3
- WROMPOXWARCANT-UHFFFAOYSA-N tfa trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F.OC(=O)C(F)(F)F WROMPOXWARCANT-UHFFFAOYSA-N 0.000 description 3
- 230000004614 tumor growth Effects 0.000 description 3
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 2
- CNOFIVDNISFXKD-UHFFFAOYSA-N 1-azidopyrrole-2,5-dione Chemical group [N-]=[N+]=NN1C(=O)C=CC1=O CNOFIVDNISFXKD-UHFFFAOYSA-N 0.000 description 2
- 238000005160 1H NMR spectroscopy Methods 0.000 description 2
- DGPBVJWCIDNDPN-UHFFFAOYSA-N 2-(dimethylamino)benzaldehyde Chemical compound CN(C)C1=CC=CC=C1C=O DGPBVJWCIDNDPN-UHFFFAOYSA-N 0.000 description 2
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 2
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 2
- ZJSQZQMVXKZAGW-UHFFFAOYSA-N 2H-benzotriazol-4-ol hydrate Chemical compound O.OC1=CC=CC2=C1N=NN2 ZJSQZQMVXKZAGW-UHFFFAOYSA-N 0.000 description 2
- DJVUUNAPIIORNL-UHFFFAOYSA-N 4-[ditert-butyl(fluoro)silyl]benzaldehyde Chemical compound CC(C)(C)[Si](F)(C(C)(C)C)C1=CC=C(C=O)C=C1 DJVUUNAPIIORNL-UHFFFAOYSA-N 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 206010006187 Breast cancer Diseases 0.000 description 2
- 208000026310 Breast neoplasm Diseases 0.000 description 2
- 150000008574 D-amino acids Chemical class 0.000 description 2
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- 239000007995 HEPES buffer Substances 0.000 description 2
- 206010065042 Immune reconstitution inflammatory syndrome Diseases 0.000 description 2
- 108060003951 Immunoglobulin Proteins 0.000 description 2
- 150000008575 L-amino acids Chemical class 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- MZRVEZGGRBJDDB-UHFFFAOYSA-N N-Butyllithium Chemical compound [Li]CCCC MZRVEZGGRBJDDB-UHFFFAOYSA-N 0.000 description 2
- 101800001442 Peptide pr Proteins 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- GLUUGHFHXGJENI-UHFFFAOYSA-N Piperazine Chemical compound C1CNCCN1 GLUUGHFHXGJENI-UHFFFAOYSA-N 0.000 description 2
- 101710132632 Protein C4 Proteins 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 125000004183 alkoxy alkyl group Chemical group 0.000 description 2
- 150000003973 alkyl amines Chemical class 0.000 description 2
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 2
- 229960004050 aminobenzoic acid Drugs 0.000 description 2
- MMCPOSDMTGQNKG-UJZMCJRSSA-N aniline;hydrochloride Chemical compound Cl.N[14C]1=[14CH][14CH]=[14CH][14CH]=[14CH]1 MMCPOSDMTGQNKG-UJZMCJRSSA-N 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 238000005349 anion exchange Methods 0.000 description 2
- 239000000427 antigen Substances 0.000 description 2
- 102000036639 antigens Human genes 0.000 description 2
- 108091007433 antigens Proteins 0.000 description 2
- 125000004429 atom Chemical group 0.000 description 2
- WGQKYBSKWIADBV-UHFFFAOYSA-N benzylamine Chemical compound NCC1=CC=CC=C1 WGQKYBSKWIADBV-UHFFFAOYSA-N 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 239000003054 catalyst Substances 0.000 description 2
- 239000007810 chemical reaction solvent Substances 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 229940126214 compound 3 Drugs 0.000 description 2
- 239000013058 crude material Substances 0.000 description 2
- 239000008367 deionised water Substances 0.000 description 2
- 229910021641 deionized water Inorganic materials 0.000 description 2
- 238000007865 diluting Methods 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 239000003480 eluent Substances 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 150000002148 esters Chemical class 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 230000007717 exclusion Effects 0.000 description 2
- 239000000706 filtrate Substances 0.000 description 2
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 2
- 125000003709 fluoroalkyl group Chemical group 0.000 description 2
- 229910052733 gallium Inorganic materials 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 125000002768 hydroxyalkyl group Chemical group 0.000 description 2
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 2
- 102000018358 immunoglobulin Human genes 0.000 description 2
- 238000003364 immunohistochemistry Methods 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 238000011081 inoculation Methods 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 230000000155 isotopic effect Effects 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- WXEHBUMAEPOYKP-UHFFFAOYSA-N methylsulfanylethane Chemical compound CCSC WXEHBUMAEPOYKP-UHFFFAOYSA-N 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 238000010172 mouse model Methods 0.000 description 2
- 239000012299 nitrogen atmosphere Substances 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- UMJSCPRVCHMLSP-UHFFFAOYSA-N pyridine Natural products COC1=CC=CN=C1 UMJSCPRVCHMLSP-UHFFFAOYSA-N 0.000 description 2
- 230000002285 radioactive effect Effects 0.000 description 2
- 238000000163 radioactive labelling Methods 0.000 description 2
- 230000035484 reaction time Effects 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 238000011084 recovery Methods 0.000 description 2
- 239000011347 resin Substances 0.000 description 2
- 229920005989 resin Polymers 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 239000011734 sodium Substances 0.000 description 2
- PPASLZSBLFJQEF-RKJRWTFHSA-M sodium ascorbate Substances [Na+].OC[C@@H](O)[C@H]1OC(=O)C(O)=C1[O-] PPASLZSBLFJQEF-RKJRWTFHSA-M 0.000 description 2
- 235000010378 sodium ascorbate Nutrition 0.000 description 2
- 229960005055 sodium ascorbate Drugs 0.000 description 2
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 2
- JHJLBTNAGRQEKS-UHFFFAOYSA-M sodium bromide Chemical compound [Na+].[Br-] JHJLBTNAGRQEKS-UHFFFAOYSA-M 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L sodium carbonate Substances [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- 229910000029 sodium carbonate Inorganic materials 0.000 description 2
- LPXPTNMVRIOKMN-UHFFFAOYSA-M sodium nitrite Chemical compound [Na+].[O-]N=O LPXPTNMVRIOKMN-UHFFFAOYSA-M 0.000 description 2
- 229910052938 sodium sulfate Inorganic materials 0.000 description 2
- 235000011152 sodium sulphate Nutrition 0.000 description 2
- PPASLZSBLFJQEF-RXSVEWSESA-M sodium-L-ascorbate Chemical compound [Na+].OC[C@H](O)[C@H]1OC(=O)C(O)=C1[O-] PPASLZSBLFJQEF-RXSVEWSESA-M 0.000 description 2
- 239000012265 solid product Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 239000001117 sulphuric acid Substances 0.000 description 2
- 235000011149 sulphuric acid Nutrition 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 150000003573 thiols Chemical class 0.000 description 2
- 238000001196 time-of-flight mass spectrum Methods 0.000 description 2
- ITMCEJHCFYSIIV-UHFFFAOYSA-M triflate Chemical compound [O-]S(=O)(=O)C(F)(F)F ITMCEJHCFYSIIV-UHFFFAOYSA-M 0.000 description 2
- 239000011800 void material Substances 0.000 description 2
- TXUICONDJPYNPY-UHFFFAOYSA-N (1,10,13-trimethyl-3-oxo-4,5,6,7,8,9,11,12,14,15,16,17-dodecahydrocyclopenta[a]phenanthren-17-yl) heptanoate Chemical compound C1CC2CC(=O)C=C(C)C2(C)C2C1C1CCC(OC(=O)CCCCCC)C1(C)CC2 TXUICONDJPYNPY-UHFFFAOYSA-N 0.000 description 1
- VZQHRKZCAZCACO-PYJNHQTQSA-N (2s)-2-[[(2s)-2-[2-[[(2s)-2-[[(2s)-2-amino-5-(diaminomethylideneamino)pentanoyl]amino]propanoyl]amino]prop-2-enoylamino]-3-methylbutanoyl]amino]propanoic acid Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C(C)C)NC(=O)C(=C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCNC(N)=N VZQHRKZCAZCACO-PYJNHQTQSA-N 0.000 description 1
- BGGHCRNCRWQABU-JTQLQIEISA-N (2s)-2-amino-5-oxo-5-phenylmethoxypentanoic acid Chemical compound OC(=O)[C@@H](N)CCC(=O)OCC1=CC=CC=C1 BGGHCRNCRWQABU-JTQLQIEISA-N 0.000 description 1
- KFWHPKSKBQSSBW-UHFFFAOYSA-M (4-formylphenyl)-trimethylazanium;trifluoromethanesulfonate Chemical compound [O-]S(=O)(=O)C(F)(F)F.C[N+](C)(C)C1=CC=C(C=O)C=C1 KFWHPKSKBQSSBW-UHFFFAOYSA-M 0.000 description 1
- 125000000008 (C1-C10) alkyl group Chemical group 0.000 description 1
- VYMPLPIFKRHAAC-UHFFFAOYSA-N 1,2-ethanedithiol Chemical compound SCCS VYMPLPIFKRHAAC-UHFFFAOYSA-N 0.000 description 1
- WNXJIVFYUVYPPR-UHFFFAOYSA-N 1,3-dioxolane Chemical group C1COCO1 WNXJIVFYUVYPPR-UHFFFAOYSA-N 0.000 description 1
- ITWBWJFEJCHKSN-UHFFFAOYSA-N 1,4,7-triazonane Chemical compound C1CNCCNCCN1 ITWBWJFEJCHKSN-UHFFFAOYSA-N 0.000 description 1
- FPIRBHDGWMWJEP-UHFFFAOYSA-N 1-hydroxy-7-azabenzotriazole Chemical compound C1=CN=C2N(O)N=NC2=C1 FPIRBHDGWMWJEP-UHFFFAOYSA-N 0.000 description 1
- PJUPKRYGDFTMTM-UHFFFAOYSA-N 1-hydroxybenzotriazole;hydrate Chemical compound O.C1=CC=C2N(O)N=NC2=C1 PJUPKRYGDFTMTM-UHFFFAOYSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- WFIYPADYPQQLNN-UHFFFAOYSA-N 2-[2-(4-bromopyrazol-1-yl)ethyl]isoindole-1,3-dione Chemical compound C1=C(Br)C=NN1CCN1C(=O)C2=CC=CC=C2C1=O WFIYPADYPQQLNN-UHFFFAOYSA-N 0.000 description 1
- BGCNYRPLYOBWJM-UHFFFAOYSA-N 2-aminooxy-n-[2-(2,5-dioxopyrrol-1-yl)ethyl]acetamide;hydrochloride Chemical compound Cl.NOCC(=O)NCCN1C(=O)C=CC1=O BGCNYRPLYOBWJM-UHFFFAOYSA-N 0.000 description 1
- ZWDVQMVZZYIAHO-COJKEBBMSA-N 2-fluoranylbenzaldehyde Chemical compound [18F]C1=CC=CC=C1C=O ZWDVQMVZZYIAHO-COJKEBBMSA-N 0.000 description 1
- WWKKTHALZAYYAI-UHFFFAOYSA-N 2-iodobenzaldehyde Chemical compound IC1=CC=CC=C1C=O WWKKTHALZAYYAI-UHFFFAOYSA-N 0.000 description 1
- AUFVJZSDSXXFOI-UHFFFAOYSA-N 2.2.2-cryptand Chemical compound C1COCCOCCN2CCOCCOCCN1CCOCCOCC2 AUFVJZSDSXXFOI-UHFFFAOYSA-N 0.000 description 1
- BMYNFMYTOJXKLE-UHFFFAOYSA-N 3-azaniumyl-2-hydroxypropanoate Chemical compound NCC(O)C(O)=O BMYNFMYTOJXKLE-UHFFFAOYSA-N 0.000 description 1
- XKTYXVDYIKIYJP-UHFFFAOYSA-N 3h-dioxole Chemical compound C1OOC=C1 XKTYXVDYIKIYJP-UHFFFAOYSA-N 0.000 description 1
- BGNGWHSBYQYVRX-UHFFFAOYSA-N 4-(dimethylamino)benzaldehyde Chemical compound CN(C)C1=CC=C(C=O)C=C1 BGNGWHSBYQYVRX-UHFFFAOYSA-N 0.000 description 1
- FZTIWOBQQYPTCJ-UHFFFAOYSA-N 4-[4-(4-carboxyphenyl)phenyl]benzoic acid Chemical compound C1=CC(C(=O)O)=CC=C1C1=CC=C(C=2C=CC(=CC=2)C(O)=O)C=C1 FZTIWOBQQYPTCJ-UHFFFAOYSA-N 0.000 description 1
- ALYNCZNDIQEVRV-UHFFFAOYSA-M 4-aminobenzoate Chemical compound NC1=CC=C(C([O-])=O)C=C1 ALYNCZNDIQEVRV-UHFFFAOYSA-M 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-N 4-hydroxybenzoic acid Chemical compound OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 1
- NIEBHDXUIJSHSL-VYJFISKDSA-N 4-iodanylbenzaldehyde Chemical compound [123I]C1=CC=C(C=O)C=C1 NIEBHDXUIJSHSL-VYJFISKDSA-N 0.000 description 1
- YYROPELSRYBVMQ-UHFFFAOYSA-N 4-toluenesulfonyl chloride Chemical compound CC1=CC=C(S(Cl)(=O)=O)C=C1 YYROPELSRYBVMQ-UHFFFAOYSA-N 0.000 description 1
- NLXLAEXVIDQMFP-UHFFFAOYSA-N Ammonium chloride Substances [NH4+].[Cl-] NLXLAEXVIDQMFP-UHFFFAOYSA-N 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DWBZEJHQQIURML-IMJSIDKUSA-N Asp-Ser Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CO)C(O)=O DWBZEJHQQIURML-IMJSIDKUSA-N 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 238000009020 BCA Protein Assay Kit Methods 0.000 description 1
- 229910015900 BF3 Inorganic materials 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 101100398112 Caenorhabditis elegans ketn-1 gene Proteins 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- XDTMQSROBMDMFD-UHFFFAOYSA-N Cyclohexane Chemical compound C1CCCCC1 XDTMQSROBMDMFD-UHFFFAOYSA-N 0.000 description 1
- 108010016626 Dipeptides Proteins 0.000 description 1
- 239000012591 Dulbecco’s Phosphate Buffered Saline Substances 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 229940123457 Free radical scavenger Drugs 0.000 description 1
- 229910005267 GaCl3 Inorganic materials 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 1
- 206010061598 Immunodeficiency Diseases 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- XGDCYUQSFDQISZ-BQBZGAKWSA-N Leu-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(O)=O XGDCYUQSFDQISZ-BQBZGAKWSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 208000003445 Mouth Neoplasms Diseases 0.000 description 1
- SXRCKKZKXAHZJY-UHFFFAOYSA-N OC(=O)C(F)(F)F.FC(C(=O)O)(F)F.NCCN1C(C=CC1=O)=O Chemical compound OC(=O)C(F)(F)F.FC(C(=O)O)(F)F.NCCN1C(C=CC1=O)=O SXRCKKZKXAHZJY-UHFFFAOYSA-N 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 238000012879 PET imaging Methods 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 101000781681 Protobothrops flavoviridis Disintegrin triflavin Proteins 0.000 description 1
- 239000012083 RIPA buffer Substances 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 108010088160 Staphylococcal Protein A Proteins 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 239000012505 Superdex™ Substances 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 229910021626 Tin(II) chloride Inorganic materials 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- KRHYYFGTRYWZRS-BJUDXGSMSA-N ac1l2y5h Chemical compound [18FH] KRHYYFGTRYWZRS-BJUDXGSMSA-N 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 230000001464 adherent effect Effects 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- MMCPOSDMTGQNKG-UHFFFAOYSA-N anilinium chloride Chemical compound Cl.NC1=CC=CC=C1 MMCPOSDMTGQNKG-UHFFFAOYSA-N 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000000118 anti-neoplastic effect Effects 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 229940072107 ascorbate Drugs 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 230000006399 behavior Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- 230000036765 blood level Effects 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- WTEOIRVLGSZEPR-UHFFFAOYSA-N boron trifluoride Substances FB(F)F WTEOIRVLGSZEPR-UHFFFAOYSA-N 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- KDPAWGWELVVRCH-UHFFFAOYSA-M bromoacetate Chemical compound [O-]C(=O)CBr KDPAWGWELVVRCH-UHFFFAOYSA-M 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 125000002837 carbocyclic group Chemical group 0.000 description 1
- 229960004424 carbon dioxide Drugs 0.000 description 1
- 235000011089 carbon dioxide Nutrition 0.000 description 1
- UHBYWPGGCSDKFX-UHFFFAOYSA-N carboxyglutamic acid Chemical compound OC(=O)C(N)CC(C(O)=O)C(O)=O UHBYWPGGCSDKFX-UHFFFAOYSA-N 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 238000005341 cation exchange Methods 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- PBAYDYUZOSNJGU-UHFFFAOYSA-N chelidonic acid Natural products OC(=O)C1=CC(=O)C=C(C(O)=O)O1 PBAYDYUZOSNJGU-UHFFFAOYSA-N 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 238000004440 column chromatography Methods 0.000 description 1
- 230000009918 complex formation Effects 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 238000010908 decantation Methods 0.000 description 1
- 238000000354 decomposition reaction Methods 0.000 description 1
- 238000006115 defluorination reaction Methods 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 238000002059 diagnostic imaging Methods 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- 229910001873 dinitrogen Inorganic materials 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 238000002224 dissection Methods 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- WGAZDTADWBWCGU-UHFFFAOYSA-N ditert-butyl(difluoro)silane Chemical compound CC(C)(C)[Si](F)(F)C(C)(C)C WGAZDTADWBWCGU-UHFFFAOYSA-N 0.000 description 1
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 229920001971 elastomer Polymers 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- WBJINCZRORDGAQ-UHFFFAOYSA-N ethyl formate Chemical compound CCOC=O WBJINCZRORDGAQ-UHFFFAOYSA-N 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 238000003682 fluorination reaction Methods 0.000 description 1
- 238000011010 flushing procedure Methods 0.000 description 1
- 238000012948 formulation analysis Methods 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 125000000623 heterocyclic group Chemical group 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 229960002591 hydroxyproline Drugs 0.000 description 1
- 238000003125 immunofluorescent labeling Methods 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000011503 in vivo imaging Methods 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 238000010829 isocratic elution Methods 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 238000004811 liquid chromatography Methods 0.000 description 1
- 238000002514 liquid chromatography mass spectrum Methods 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 238000002595 magnetic resonance imaging Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 108010082117 matrigel Proteins 0.000 description 1
- MBKDYNNUVRNNRF-UHFFFAOYSA-N medronic acid Chemical compound OP(O)(=O)CP(O)(O)=O MBKDYNNUVRNNRF-UHFFFAOYSA-N 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 210000003097 mucus Anatomy 0.000 description 1
- 238000007040 multi-step synthesis reaction Methods 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 229910000069 nitrogen hydride Inorganic materials 0.000 description 1
- 239000012457 nonaqueous media Substances 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 238000002414 normal-phase solid-phase extraction Methods 0.000 description 1
- 230000000269 nucleophilic effect Effects 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 238000012014 optical coherence tomography Methods 0.000 description 1
- 238000012634 optical imaging Methods 0.000 description 1
- 150000002895 organic esters Chemical class 0.000 description 1
- 239000012044 organic layer Substances 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- USRGIUJOYOXOQJ-GBXIJSLDSA-N phosphothreonine Chemical compound OP(=O)(O)O[C@H](C)[C@H](N)C(O)=O USRGIUJOYOXOQJ-GBXIJSLDSA-N 0.000 description 1
- DCWXELXMIBXGTH-UHFFFAOYSA-N phosphotyrosine Chemical compound OC(=O)C(N)CC1=CC=C(OP(O)(O)=O)C=C1 DCWXELXMIBXGTH-UHFFFAOYSA-N 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 238000012636 positron electron tomography Methods 0.000 description 1
- 231100000683 possible toxicity Toxicity 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 239000008213 purified water Substances 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 238000004445 quantitative analysis Methods 0.000 description 1
- 239000002516 radical scavenger Substances 0.000 description 1
- 239000000700 radioactive tracer Substances 0.000 description 1
- 102000027426 receptor tyrosine kinases Human genes 0.000 description 1
- 108091008598 receptor tyrosine kinases Proteins 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 229920006395 saturated elastomer Chemical group 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 239000000741 silica gel Substances 0.000 description 1
- 229910002027 silica gel Inorganic materials 0.000 description 1
- 239000002002 slurry Substances 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 235000017557 sodium bicarbonate Nutrition 0.000 description 1
- 235000010288 sodium nitrite Nutrition 0.000 description 1
- XETSAYZRDCRPJY-UHFFFAOYSA-M sodium;4-aminobenzoate Chemical compound [Na+].NC1=CC=C(C([O-])=O)C=C1 XETSAYZRDCRPJY-UHFFFAOYSA-M 0.000 description 1
- 238000010532 solid phase synthesis reaction Methods 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 239000001119 stannous chloride Substances 0.000 description 1
- 235000011150 stannous chloride Nutrition 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 229910052713 technetium Inorganic materials 0.000 description 1
- GKLVYJBZJHMRIY-UHFFFAOYSA-N technetium atom Chemical compound [Tc] GKLVYJBZJHMRIY-UHFFFAOYSA-N 0.000 description 1
- CQXDYHPBXDZWBA-UHFFFAOYSA-N tert-butyl 2,2,2-trichloroethanimidate Chemical compound CC(C)(C)OC(=N)C(Cl)(Cl)Cl CQXDYHPBXDZWBA-UHFFFAOYSA-N 0.000 description 1
- BNWCETAHAJSBFG-UHFFFAOYSA-N tert-butyl 2-bromoacetate Chemical compound CC(C)(C)OC(=O)CBr BNWCETAHAJSBFG-UHFFFAOYSA-N 0.000 description 1
- RUAACUSMGYNKKI-UHFFFAOYSA-N tert-butyl n-[2-[2-(2,5-dioxopyrrol-1-yl)ethylamino]-2-oxoethoxy]carbamate Chemical compound CC(C)(C)OC(=O)NOCC(=O)NCCN1C(=O)C=CC1=O RUAACUSMGYNKKI-UHFFFAOYSA-N 0.000 description 1
- 125000005931 tert-butyloxycarbonyl group Chemical group [H]C([H])([H])C(OC(*)=O)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- HPGGPRDJHPYFRM-UHFFFAOYSA-J tin(iv) chloride Chemical compound Cl[Sn](Cl)(Cl)Cl HPGGPRDJHPYFRM-UHFFFAOYSA-J 0.000 description 1
- 238000003325 tomography Methods 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- FGMPLJWBKKVCDB-UHFFFAOYSA-N trans-L-hydroxy-proline Natural products ON1CCCC1C(O)=O FGMPLJWBKKVCDB-UHFFFAOYSA-N 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 229960000575 trastuzumab Drugs 0.000 description 1
- ZNEOHLHCKGUAEB-UHFFFAOYSA-N trimethylphenylammonium Chemical compound C[N+](C)(C)C1=CC=CC=C1 ZNEOHLHCKGUAEB-UHFFFAOYSA-N 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 239000000107 tumor biomarker Substances 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 231100000588 tumorigenic Toxicity 0.000 description 1
- 230000000381 tumorigenic effect Effects 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 239000013598 vector Substances 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K51/00—Preparations containing radioactive substances for use in therapy or testing in vivo
- A61K51/02—Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
- A61K51/04—Organic compounds
- A61K51/08—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
- A61K51/088—Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins conjugates with carriers being peptides, polyamino acids or proteins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07B—GENERAL METHODS OF ORGANIC CHEMISTRY; APPARATUS THEREFOR
- C07B59/00—Introduction of isotopes of elements into organic compounds ; Labelled organic compounds per se
- C07B59/008—Peptides; Proteins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/305—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F)
- C07K14/31—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Micrococcaceae (F) from Staphylococcus (G)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
Definitions
- the invention relates generally to imaging agents that bind to human epidermal growth factor receptor type 2 (HER2) and methods for making and using such agents.
- HER2 human epidermal growth factor receptor type 2
- HER2 Human epidermal growth factor receptor type 2
- HER2 is a transmembrane protein and a member of erbB family of receptor tyrosine kinase proteins.
- HER2 is a well-established tumor biomarker that is over-expressed in a wide variety of cancers, including breast, ovarian, lung, gastric, and oral cancers. Therefore, HER2 has great value as a molecular target and as a diagnostic or prognostic indicator of patient survival, or a predictive marker of the response to antineoplastic surgery.
- PET and SPECT imaging of HER2 provide high sensitivity, high spatial resolution. PET imaging of HER2 also provides strong quantification ability.
- HER2-PET and HER2-SPECT are particularly useful in real-time assays of overall tumor HER2 expression in patients, identification of HER2 expression in tumors over time, selection of patients for HER-targeted treatment (e.g., trastuzumab-based therapy), prediction of response to therapy, evaluation of drug efficacy, and many other applications.
- HER-targeted treatment e.g., trastuzumab-based therapy
- trastuzumab-based therapy e.g., trastuzumab-based therapy
- prediction of response to therapy e.g., evaluation of drug efficacy
- evaluation of drug efficacy e.g., trastuzumab-based therapy
- no PET or SPECT-labeled HER2 ligands have been developed that have a chemistry and exhibit in vivo behaviors which would be suitable for clinical applications.
- Naturally occurring Staphylococcal protein A comprises domains that form a three-helix structure (a scaffold) that binds to the fragment, crystallizable region (Fc) of immunoglobulin isotype G (IgG).
- Certain polypeptides, derived from the Z- domain of protein A contain a scaffold composed of three a-helices connected by loops. Certain amino acid residues situated on two of these helices constitute the binding site for the Fc region of IgG.
- Alternative binder molecules have been prepared by substituting surface-exposed amino acid residues (13 residues) situated on helices 1 and 2, to alter the binding ability of these molecules.
- HER2 binding molecules or HER2 binders are examples of HER2 binding molecules or HER2 binders.
- HER2 binders have been labeled with PET or SPECT-active radionuclides.
- PET and SPECT-labeled binders provide the ability to measure in vivo HER2 expression patterns in patients and would therefore aid clinicians and researchers in diagnosing, prognosing, and treating HER2- associated disease conditions.
- HER2 binding Affibody® molecules radiolabeled with the PET-active radionucleide, 18 F, have been evaluated as imaging agents for malignant tumors that over express HER2.
- HER2 binding Affibody® molecules conjugated with 99m Tc via the chelators such as maGGG (mercaptoacetyltriglycyl), CGG (cysteine-diglycyl), CGGG (SEQ ID NO: 6) (cysteine-triglycyl) or A A3, have also been used for diagnostic imaging. The binding of these molecules to target HER2 expressing tumors has been demonstrated in mice.
- the signal-generating 18 F group is introduced to the Affibody® through a thiol-reactive maleimide group.
- the thiol reactive maleimide group is prepared using a multi-step synthesis after 18 F incorporation. However, this chemistry only provides a low radiochemical yield.
- the conjugation of 99m Tc with the Affibody® is a multistep process.
- compositions of the invention are a new class of imaging agents that are capable of binding specifically to HER2 or variants thereof.
- the imaging agent composition comprises an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID. No 2 or a conservative variant thereof, conjug ated with a 99m Tc via a diaminedioxime chelator.
- the diaminedioxime chelator may comprise Pn216, cPn216, Pn44, or derivatives thereof.
- the isolated polypeptide binds specifically to HER2 or variants thereof.
- the imaging agent composition comprises an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID. No 2 or a conservative variant thereof, conjug ated with 67 Ga or 68 Ga via a NOTA chelator.
- the isolated polypeptide binds specifically to HER2 or variants thereof.
- the imaging agent composition comprises an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID. No 2 or a conservative variant thereof, conjugated with an Al 18 F-NOTA chelate.
- the isolated polypeptide binds specifically to HER2 or variants thereof.
- the imaging agent composition comprises an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID. No 2 or a conservative variant thereof, conjugated with 18 F via a linker.
- the linker comprises a group derived from an aminoxy group, an azido group, or an alkyne group.
- the isolated polypeptide binds specifically to HER2 or variants thereof.
- the imaging agent composition comprises an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID. No 2 or a conservative variant thereof, conjugated with 18 F via an isotopic fluorine exchange chemistry.
- the isolated polypeptide binds specifically to HER2 or variants thereof.
- an imaging agent composition as described herein comprises (i) providing an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID No. 2 or a conservative variant thereof; and (ii) reacting a diaminedioxime chelator with the polypeptide to form a chelator conjugated polypeptide.
- the method comprises (i) providing an isolated polypeptide comprising SEQ. ID No. 1 , SEQ. ID No.
- linker may comprise an aminoxy group, an azido group, or an alkyne group.
- the method comprises (i) providing an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID No. 2 or a conservative variant thereof; (ii) reacting the polypeptide with a NOTA- chelator to form, respectively, a NOTA-chelator conjugated polypeptide and (iii) reacting the NOTA- chelator conjugated polypeptide with an Al 18 F moiety to form, a Al 18 F-NOTA chelator conjugated polypeptide.
- the method comprises (i) providing an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID No. 2 or a conservative variant thereof; (ii) reacting the polypeptide with a silicon fluoride (e.g. [ 19 F]-silicon fluoride)-containing moiety to form a silicon fluoride conjugated polypeptide; and (iii) reacting the silicon fluoride conjugated polypeptide with an 18 F moiety to form an 18 F-silicon fluoride conjugated polypeptide.
- a silicon fluoride e.g. [ 19 F]-silicon fluoride
- FIGs. 1A and IB are graphs of the surface plasmon resonance (SPR) of the binding affinity of two anti-HER2 polypeptides, Z477 (SEQ. ID No. 3) and (Z477) 2 (SEQ. ID No. 5), respectively, at eight different concentrations, to human HER2.
- SPR surface plasmon resonance
- FIGs. 2 A and FIG. 2B are graphs of the qualitative flow cytometry of C6 (rat glioma, control) and human anti-HER2 antibody to SKOV3 (human ovarian carcinoma) respectively.
- FIG. 2C shows a bar chart for Her2 receptors per cell for SKOV3 and C6 cell lines.
- FIG. 3 is a bar graph of ELISA assays for Her2 with respect to a panel of tumor types SKOV3 2-1, SKOV3 3-1, SKOV3 3-4, with respect to SKOV3 cells, and blank.
- FIG. 4 is a reverse phase HPLC gamma chromatogram of m Tc labeled Z00477 (SEQ. ID No. 3).
- FIG. 5A is a size exclusion HPLC gamma chromatogram of aggregated 99m Tc(CO) 3 (His6)Z00477 (SEQ. ID. No. 4) ('His6' disclosed as SEQ ID NO: 7) at pH 9.
- FIG. 5B a size exclusion HPLC gamma chromatogram of non aggregated 99m Tc(CO) 3 (His6)Z00477 ('His6' disclosed as SEQ ID NO: 7) labeled Affibody® standard.
- FIG. 6 is a graph of biodistribution profile of Z00477 (SEQ. ID No. 3) in blood, tumor, liver, kidney and spleen samples from SKOV3 tumor bearing mice, including the tumonblood ratio over time.
- FIG. 7 is a diagram of the chemical structure for a Mal-cPN216 linker.
- FIG. 8A is a graph of the electrospray ionization time of flight mass spectrum (ESI-TOF-MS) and FIG. 8B is a graph of mass deconvolution result for the purified Z00477 (SEQ. ID No. 3)-cPN216.
- FIG. 9 is a reverse phase HPLC gamma trace chromatogram for Z02891- cPN216 (SEQ. ID No. 2) labeled with 99m Tc.
- FIG. 10 is a graph of the biodistribution profile of Z02891 (SEQ. ID No. 2) labeled with 99m Tc via cPN216 ( ID, % injected dose)) in blood, liver, kidneys, spleen, and tail samples from SKOV3 tumor bearing mice.
- FIG. 11 is a graph of the biodistribution profile of Z02891 (SEQ. ID No. 2) labeled with 99m Tc via cPN216 ( ID, % injected dose) in tumor, blood, liver, kidneys , bladder/urine, tail, intestine and spleen samples from SKOV3 tumor bearing mice.
- FIG. 12 is a graph of the biodistribution profile for Z02891 (SEQ. ID No. 2) in SKOV3 tumor bearing mice showing the tumor: blood ratio.
- FIG. 13A and 13B are diagrams of the chemical structures for Boc -protected malimide-aminoxy (Mal-AO-Boc) and malimide-aminoxy (Mal-AO) linkers.
- 13 A is the chemical structure for tert-butyl 2-(2-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l- yl)ethylamino)-2-oxoethoxycarbamate (Mal-AO-Boc)
- 13B is the chemical structure for 2-(aminooxy)-N-(2-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l- yl)ethyl)acetamide hydrochloride (Mal-AO.HCl).
- FIG. 14A is the reverse phase HPLC chromatogram of Z00342 (SEQ. ID No. 1) starting material and 14B is the reverse phase HPLC chromatogram of the purified Z00342 (SEQ. ID No. l)-AO imaging agent composition, both analyzed at 280 nm.
- FIG. 15 is the reverse phase HPLC gamma chromatogram for the crude
- FIG. 16 is a graph of the biodistribution profile ( ID, % injected dose) of the Z02891 (SEQ. ID No. 2) polypeptide labeled with 18 F from SKOV3-tumored animals.
- FIG. 17 is a graph of the biodistribution profile of Z02891 (SEQ. ID No. 2)
- polypeptide labeled with F ID, % injected dose
- tumor blood ratio from SKOV3-tumored animals.
- FIG. 18 is bar graph of the biodistribution profile ( ID, % injected dose) of 18 F labeled Z00342 (SEQ. ID No. 1) and 18 F labeled Z02891 (SEQ. ID No. 2) in blood, tumor, liver, kidneys, spleen and bone samples.
- FIG. 19 is a diagram of the chemical structure of the Mal-NOTA linker.
- FIG. 20A is a graph of the electrospray ionization time of flight mass spectrum (ESI-TOF-MS), and 20B is a graph of the ESI-TOF-MS mass deconvolution result for Z00477 (SEQ. ID No. 3)-NOTA.
- ESI-TOF-MS electrospray ionization time of flight mass spectrum
- FIG. 21 is a graph of the reverse phase HPLC gamma trace for the crude reaction mixture of 67 Ga-labeled Z00477 (SEQ. ID No. 3)-NOTA after 1 hour of reaction.
- FIG. 22 is a graph of the reverse phase HPLC gamma trace for the purified 67 Ga-labeled NOTA Z00477 (SEQ. ID No. 3)-NOTA polypeptide.
- FIG. 23 is an analytical HPLC of formulated 2 [top: UV channel at 280 nm showing ascorbate, 0.5 min and peptide precursor 3, 4.5 min; bottom: radioactivity channel showing 2, 5.1 min (RCP 95%) and a decomposition product at 4.6 min. [0042]
- FIG. 24 is a FASTlab 1M cassette layout for the preparation of 2 using tC2 SepPak purification.
- FIG. 25 is an analytical HPLC of formulated 2 prepared using FASTlabTM [top: radioactivity channel, showing 2 (7.7 min), 18 F-FBA (10.4 min) and an unknown impurity (12.2 min); middle: UV channel at 280 nm showing p-aminobenzoic acid formulation additive (3 min); bottom: UV channel at 350 nm showing dimethylaminobenzaldehyde by-product (10.2 min) and an unknown impurity (3.8 min)].
- FIG. 26 is a FASTlabTM cassette layout for the preparation of 2 using Sephadex purification.
- FIG. 27 is an analytical HPLC of formulated 2 prepared using FASTlab with Sephadex purification [top: radioactivity channel, showing 2 (7.1 min), 18 F-FBA (8.8 min) and an unknown impurity (10.2 min); middle: UV channel at 280 nm; bottom: UV channel at 350 nm showing dimethylaminobenzaldehyde by-product (10.0 min)].
- FIG. 28 is an analytical HPLC of formulated 5 [top: radioactivity channel, showing the product (4.7 min, 92 ) and a by-product (3.9 min, 8 ); bottom: UV channel at 280 nm].
- FIG. 29 depicts a time course study of 5 showing labelling efficiencies as measured by analytical radio HPLC.
- FIG. 30 is an analytical RCY of 5 after increasing the peptide/AlCl 3 concentration (P: product, BP: by-product, see Fig. FIG 28).
- FIG. 31 is an analytical HPLC profile of a labelling mixture of 5. (Top trace: radioactivity channel, bottom trace: UV channel at 280 nm).
- FIG. 32 is an analytical radioactivity channel HPLC of isolated 7 (Red: radioactivity channel, blue: UV channel at 280 nm).
- FIG. 33 depicts HER2 protein expression in tumour sections from the NCI- N87 and A431 xenograft models by immunohistochemistry the HERCEPTEST by DAKO. Pictures on the left are x2 magnification, pictures on the right are xlO of the highlighted square.
- FIG. 34 shows naive mice biodistributions of 9, 2, 5, and 7.
- FIG. 35 shows biodistributions of 9, 2, 5, and 7 in the NC87/A431 tumour bearing mice.
- FIG. 36 shows biodistribution profile of 2 in the dual tumour xenograft model.
- FIG. 37 shows NCI-N87 xenograft biodistribution profile of 2 using increasing concentrations of cold precursor.
- FIG. 38 shows preliminary imaging with 2 in the dual tumour xenograft model (A) and comparison to Affibody® 9 imaging study (B).
- the imaging agent compositions of the invention generally comprise an isolated polypeptide of SEQ. ID No. 1, SEQ. ID No. 2 or a conservative variant thereof, conjugated with a radioisotope such as, for example, 18 F, 99m Tc, 67 Ga or 68 Ga, m In, 123 I, 124 I, 89 Zr, or ⁇ Cu; and methods for making and using the compositions.
- the isolated polypeptide binds specifically to HER2 or its variant thereof.
- the sequence of the isolated polypeptide has at least 90% sequence similarity to any of SEQ. ID No. 1, SEQ. ID No. 2 or conservative variant thereof.
- the isolated polypeptide may comprise natural amino acids, synthetic amino acids, or amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
- Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, for example, hydroxyproline, ⁇ -carboxyglutamate, O-phosphoserine, phosphothreonine, and phosphotyrosine.
- the isolated polypeptides may be prepared using standard solid phase synthesis techniques. Alternatively, the polypeptides may be prepared using recombinant techniques. When the polypeptides are prepared using recombinant techniques, the DNA encoding the polypeptides or conservative variants thereof may be isolated. The DNA encoding the polypeptides or conservative variants thereof may be inserted into a cloning vector, introduced into a host cell (e.g., a eukaryotic cell, a plant cell, or a prokaryotic cell), and expressed using any art recognized expression system. [0060] The polypeptide may be substantially comprised of a single chiral form of amino acid residues. Thus, polypeptides of the invention may be substantially comprised of either L-amino acids or D-amino acids; although a combination of L- amino acids and D-amino acids may also be employed.
- residues on the binding interface may be non-conservatively substituted or conservatively substituted while preserving binding activity.
- the substituted residues may be derived from any of the 20 naturally occurring amino acids or any analog thereof.
- polypeptides may be about 49 residues to about 130 residues in length.
- the specific polypeptide sequences are listed in Table 1.
- Additional sequences may be added to the termini to impart selected functionality.
- additional sequences may be appended to one or both termini to facilitate purification or isolation of the polypeptide, alone or coupled to a binding target (e.g., by appending a His tag to the polypeptide).
- polypeptides listed in Table 1 may be conjugated with F via a linker; 99m Tc via a diaminedioxime chelator, with 67 Ga or 68 Ga via a NOTA chelator, with 18 F via an Al 1 l 8 o F-N0TA- chelator, with 1 1 8 0 F via SiFA (i.e., silicon fluoride acceptor) or silicon fluoride exchange chemistry, with ni In via DOTA chelator chemistry, with
- the isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID No. 2 or a conservative variant thereof, may be conjugated with 18 F.
- the 18 F may be incorporated at a C terminus, at a N-terminus, or at an internal position of the isolated polypeptide.
- the 18 F may be conjugated to the isolated polypeptide via a linker.
- the linker may comprise, an aminoxy group, an azido group, or an alkyne group.
- the aminoxy group of the linker may be attached with an aldehyde, such as a fluorine-substituted aldehyde.
- An azide group of the linker may be attached with a fluorine substituted alkyne.
- an alkyne group of the linker may be attached with a fluorine substituted azide.
- the linker may also comprise a thiol reactive group.
- the linker may comprise of a maleimido-aminoxy, maleimido- alkyne or maleimido- azide group.
- the 18 F conjugated polypeptide may be prepared by: (i) providing the isolated polypeptide comprising SEQ.ID No. 1, SEQ.ID No. 2, or a conservative variant thereof; (ii) reacting the polypeptide with a linker, wherein the linker comprises an aminoxy group, an azido group, or an alkyne group, to form a linker conjugated polypeptide; and reacting the linker with an 18 F moiety to form the 18 F conjugated polypeptide.
- the 18 F conjugated polypeptide may be prepared by: (i) providing the isolated polypeptide comprising SEQ.ID No. 1, SEQ.ID No. 2, or a conservative variant thereof; (ii) reacting the polypeptide with a linker, wherein the linker comprises a maleimido-aminoxy, maleimido-alkyne or maleimido-azide group, to form a linker
- the method may comprise: (i) providing an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID No. 2, or a conservative variant
- fluorine or radiofluorine atom(s), such as 18 F may be introduced onto the polypeptides.
- a fluorine-substituted polypeptide results when a fluorine-substituted aldehyde is reacted with the aminoxy group of the linker conjugated polypeptide.
- a fluorine substituted polypeptide results, when a fluorine substituted azide or alkyne group is reacted with the respective alkyne or azide group of the linker conjugated polypeptide.
- a radiofluorine-labeled polypeptide or imaging agent composition results, when a radiofluorine-substituted aldehyde, azide or alkyne is reacted with the respective aminoxy, alkyne or azide group of the linker conjugated polypeptide.
- the linker may have a
- radiofluorine ( F) substituent to prepare radiofluorine-labeled imaging agent compositions.
- the methods for introducing fluorine onto the polypeptide may also be used to prepare a fluorinated imaging agent composition of any length.
- the polypeptide of the imaging agent composition may comprise, for example, 40 to 130 amino acid residues.
- a linker-conjugated polypeptide or the 18 F-conjugated linker for use in the preparation of an imaging agent or imaging agent composition of the invention may be prepared by a method of the invention that is more efficient than previously known methods and result in higher yields.
- the methods are easier to carry out, faster and are performed under milder, more user friendly, conditions. For example, the method
- F-conjugated linker e.g., F-
- F-FBA 18 18 fluorobenzaldehydeX
- F-FBA is simpler than the procedures known in the art.
- F conjugated-linker is prepared in one step by the direct nucleophilic incorporation of F onto the trimethylanilinium precursor.
- F-linker i.e., F-FBA
- F-FBA is then conjugated to the polypeptide, such as, for example, an Affibody® and those described herein.
- the preparation of the linker is also easier than previously known methods in the art.
- radiolabeled aminoxy based linker-conjugated polypeptides and the cPn family of chelator conjugated polypeptides (e.g., Affibody®), show significantly better biodistribution and better tumor uptake, as well as better clearance with less liver uptake.
- the fluorine-labeled imaging agent compositions are highly desired materials in diagnostic applications. 18 F labeled imaging agent compositions may be visualized using established imaging techniques such as PET.
- the polypeptide may be conjugated with 99m Tc via a diamindioxime chelator of formula (1).
- R , R", R'", R" is independently H or C 1-10 alkyl, C 3 _i 0 alkylary, C 2-10 alkoxyalkyl, C MO hydroxyalkyl, C MO alkylamine, C MO fluoroalkyl, or 2 or more R groups, together with the atoms to which they are attached to form a carbocyclic, heterocyclic, saturated or unsaturated ring, wherein R may be H, C MO alkyl, C 3-10 alkylary, C 2-10 alkoxyalkyl, C MO hydroxyalkyl, C MO alkylamine, or C MO fluoroalkyl.
- n may vary from 0-5.
- the 99m Tc may be conjugated to the isolated polypeptide via the diamindioxime at the N-terminus of the isolated polypeptide.
- the chelator may be a bifunctional compound.
- the bifunctional compound may be Mal- cPN216.
- the Mal-cPN216 comprises a thiol-reactive maleimide group for conjugation to a terminal cysteine of the polypeptide of SEQ ID No. 1 or SEQ ID No 2 and a bis-amineoxime group (diamindioxime chelator) for chelating with 99m Tc.
- the Mal-cPN216 may have a formula (II).
- the diamindioxime chelator conjugated peptide may be prepared by (i) providing an isolated polypeptide comprising SEQ.ID No. 1, SEQ. ID No. 2 or a conservative variant thereof, (ii) reacting a diamindioxime chelator with the polypeptide to form the diamindioxime conjugated polypeptide.
- the diamindioxime chelator may be further conjugated with 99m Tc.
- the polypeptide may be conjugated with 67 Ga, or 68 Ga via NOTA (l ,4,7-triazacyclononane-N,N',N"-triacetic acid) chelator.
- the NOTA-chelator conjugated polypeptide may be prepared by (i) providing an isolated polypeptide comprising SEQ.ID No. 1, SEQ. ID No. 2 or a conservative variant thereof, (ii) reacting a NOTA chelator with the polypeptide to form the NOTA- chelator conjugated polypeptide.
- the NOTA chelator may be further conjugated with
- the Ga may be conjugated to the isolated polypeptide via NOTA chelator.
- the NOTA chelator may be functionalized with a maleimido group, as described in formula (III).
- the polypeptide may be conjugated with Al F via NOTA (l ,4,7-triazacyclononane-N,N',N"-triacetic acid) chelator
- the NOTA- conjugated polypeptide may be prepared by (i) providing an isolated polypeptide comprising SEQ.ID No. 1, SEQ. ID No. 2 or a conservative variant thereof, (ii) reacting a NOTA- chelator with the polypeptide to form the NOTA- chelator conjugated polypeptide.
- the NOTA- chelator conjugated polypeptide may then be
- the polypeptide may be conjugated with 18 F via NOTA- chelator.
- the NOTA- chelator conjugated polypeptide may be prepared by (i) providing an isolated polypeptide comprising SEQ.ID No. 1 , SEQ. ID No. 2 or a conservative variant thereof, (ii) reacting a NOTA- chelator with a source of 18 F (e.g., A1 18 F) to form an 18 F-NOTA- chelator; and (iii) reacting the 18 F-NOTA- chelator with a source of 18 F (e.g., A1 18 F) to form an 18 F-NOTA- chelator; and (iii) reacting the 18 F-NOTA- chelator with
- a chelator may comprise a chelate moiety (e.g. NOTA, DOTA) alone or a chelate moiety and a linker, each as described herein.
- a NOTA-chelator can represent a NOTA chelate moiety alone or a NOTA chelate moiety attached to a linker as described herein.
- the polypeptide may be conjugated with 18 F via
- the F-SiFA conjugated polypeptide may be prepared by: (i) providing the isolated polypeptide comprising SEQ.ID No. 1, SEQ.ID No. 2, or a conservative variant thereof; (ii) reacting the polypeptide with a linker, wherein the linker comprises a silicon fluoride acceptor (SiFA) group, to form a SiFA conjugated
- 18 polypeptide and (iii) reacting the SiFA conjugated polypeptide with an F moiety or a source of 18 F.
- the 18 F moiety or source of 18 F can any such moiety or source capable of reacting with a SiFA group and undergo isotopic fluorine exchange chemistry.
- Scheme I below illustrates radiolabelling of Z02891 (SEQ. ID No. 2) using [ 18 F]SiF coupling:
- a radiolabeled imaging agent or imaging agent composition of the invention may be conveniently prepared in an automated fashion by means of an automated radiosynthesis apparatus.
- an automated radiosynthesis apparatus There are several commercially-available examples of such platform apparatus, including TRACERlabTM (e.g., TRACERlabTM MX) and FASTlabTM (both from GE Healthcare Ltd.).
- TRACERlabTM e.g., TRACERlabTM MX
- FASTlabTM both from GE Healthcare Ltd.
- Such apparatus commonly comprises a "cassette", often disposable, in which the radiochemistry is performed, which is fitted to the apparatus in order to perform a radiosynthesis.
- the cassette normally includes fluid pathways, a reaction vessel, and ports for receiving reagent vials as well as any solid-phase extraction cartridges used in post-radiosynthetic clean up steps.
- the automated radiosynthesis apparatus can be linked to a high performance liquid chromatograph (HPLC).
- HPLC high performance liquid chromatograph
- the present invention therefore provides a cassette for the automated synthesis of a radiolabeled imaging agent or imaging agent composition of the invention, each as defined herein.
- the invention also comprises methods of imaging at least a portion of a subject.
- the method comprises administering a radiolabeled imaging agent or an imaging agent composition of the invention to a subject and imaging the subject.
- the subject may be imaged, for example, with a diagnostic device.
- a method of imaging may further comprise the steps of monitoring the delivery of the agent or composition to the subject and diagnosing the subject with a HER2-associated disease condition (e.g., breast cancer).
- the subject may be a mammal, for example, a human.
- the subject may comprise cells or tissues. The tissues may be used in biopsy.
- the diagnostic device may employ an imaging method chosen from magnetic resonance imaging, optical imaging, optical coherence tomography, X-ray, single photon emission computed tomography (SPECT), positron emission tomography (PET), or combinations thereof.
- a radiolabeled imaging agent or an imaging agent composition of the invention may be administered to humans and other animals parenterally as a pharmaceutical composition.
- a pharmaceutical composition of the invention comprises a radiolabeled imaging agent or an imaging agent composition, as described herein, and a pharmaceutically acceptable carrier, excipient, solvent or diluent.
- a pharmaceutical composition of this invention for parenteral injection comprise pharmaceutically-acceptable sterile aqueous or nonaqueous solutions, dispersions, suspensions or emulsions as well as sterile powders for reconstitution into sterile injectable solutions or dispersions just prior to use.
- suitable aqueous and nonaqueous carriers, diluents, solvents or vehicles include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils (such as olive oil), and injectable organic esters such as ethyl oleate.
- Proper fluidity can be maintained, for example, by using coating materials such as lecithin, by adjusting the particle size in dispersions, and by using surfactants.
- a pharmaceutical composition of the invention may also contain an adjuvant such as preservatives, wetting agents, emulsifying agents, and dispersing agents. Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents such as sugars, sodium chloride, and the like. Prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents, which delay absorption such as aluminum monostearate and gelatin.
- a radiolabeled imaging agent or an imaging agent composition of the invention may be dispersed in physiologically acceptable carrier to minimize potential toxicity.
- the imaging agents may be dispersed in a biocompatible solution with a pH of about 6 to about 8.
- the agent is dispersed in a biocompatible solution with a pH of about 7 to about 7.4.
- the agent is dispersed in a biocompatible solution with a pH of about 7.4.
- An imaging agent composition or a pharmaceutical composition of the invention may be combined with other additives that are commonly used in the pharmaceutical industry to suspend or dissolve the compounds in an aqueous medium, and then the suspension or solution may be sterilized by techniques known in the art.
- the imaging agent composition may be administered in a variety of forms and adapted to the chosen route of administration.
- the agents may be administered topically (i.e., via tissue or mucus membranes), intravenously, intramuscularly, intradermally, or subcutaneously.
- Forms suitable for injection include sterile aqueous solutions or dispersions and sterile powders for the preparation of sterile injectable solutions, dispersions, liposomal, or emulsion formulations.
- Forms suitable for inhalation use include agents such as those dispersed in an aerosol.
- Forms suitable for topical administration include creams, lotions, ointments, and the like.
- An imaging agent composition or a pharmaceutical composition of the invention may be concentrated to conveniently deliver a preferred amount of the agents to a subject and packaged in a container in the desired form.
- the agent may be dispensed in a container in which it is dispersed in a physiologically acceptable solution that conveniently facilitates administering the agent in concentrations between 0.1 mg and 50 mg of the agent per kg body weight of the subject.
- the target tissue may be imaged about four hours after administering the agents. In alternative embodiments, the target tissue may be imaged about 24 hours after administering the agents to the subject.
- a panel of tumorigenic cell lines with a reasonable probability of expressing HER2 was selected based on available literature (Bruskin, et. al. Nucl. Med. Biol. 2004: 31 : 205; Tran, et. al. Imaging agent composition Chem. 2007: 18: 1956), as described in Table3.
- Adherent cells were released from their flasks using cell dissociation buffer (PBS + 10 mM EDTA) rather than trypsin to avoid proteolysis of cell surface receptors.
- Cells were washed twice in PBS and resuspended in ice-cold FC buffer (PBS + 0.5 % BSA w/v) to a concentration of 5-10 x 106 cells/ml. 100 ⁇ . aliquots of cells were mixed with 5 ⁇ g of primary antibody and incubated, on ice, for 45 minutes.
- FC ice cold flow cytometry
- PBS 2% bovine serum albumin
- F(ab) 2 FITC -conjugated goat anti-mouse Immunoglobulins was added and incubated, on ice and in the dark, for 45 minutes.
- Cells were then washed twice with 1 mL of ice cold FC buffer, centrifuged at 300 x g for 5min, and resuspended in 500 ⁇ L ⁇ of FC buffer. All stained cells were passed through a 100-micron filter prior to flow cytometry to prevent clogs of the flow cell.
- Flow cytometry was carried out on a Beckman Coulter Cytomics FC500 MPL. A minimum of 5 x 10 4 events was collected for each tube. All analyses were single color, with detection of FITC in FL1. Forward scatter (FS) and side scatter (SS) data demonstrated that all cell populations were tightly grouped.
- FS Forward scatter
- SS side scatter
- the highest expressing cell line was SKOV3. These cells were injected into 6-12 week old immuno-compromised mice and allowed to grow tumors. Tumor growth curves and success rates were dependent on the number of cells inoculated. Optimal tumor growth was obtained with three to four million cells/mouse
- mice Male CD-I nude mice (Charles River Labs, Hopkinton, MA) with an age range between 6 and 15 weeks. Mice were housed in a ventilated rack with food and water ad libitum and a standard 12 hour day-night lighting cycle. For xenografts, animals were injected with 100 ⁇ of cells in PBS. Cells were implanted subcutaneously in the right hindquarter. Implantation was performed under isoflurane anesthesia. For SKOV3, between 3 x 10 6 to 4 x 10 6 cells were implanted in each mouse. Under these conditions, useable tumors (100 to 300 ⁇ g) were obtained in 3 to 4 weeks in greater than 80% of animals injected.
- Tumors were collected from mice by dissection, and whole tumors were stored at -20°C until processing. Tumors were ground on ice in 1 ml of RIPA buffer supplemented with a protease inhibitor cocktail (Santa Cruz Biotech, Santa Cruz, CA #24948) in a Dounce homogenizer. Homogenates were then incubated on ice for 30 minutes, then centrifuged at 10,000 x G for 10 minutes in a refrigerated centrifuge. Supernatants were collected and stored on ice or at 4°C until further processing. Protein concentrations in lysates were determined using a BCA protein assay kit (Pierce Biotechnology 23225).
- Lysates were diluted to a standard concentration to yield 20 ⁇ g of protein/well in the microtiter plate.
- ELISA's were run with a commercially available human HER2 kit (R&D Systems, DYC1129) according to the manufacturer's instructions. Each sample was run in triplicate, and data are reported as pg HER2 ⁇ g total protein, errors are reported as standard deviations.
- Target expression in vivo was measured by ELISA.
- Excised tumors were homogenized and analyzed for HER2 using a commercially available matched pair kit (R&D systems, DYC1129, Minneapolis, MN). The results, in FIG. 3, show that the SKOV3 cell line grows a high-expressing tumor.
- ELISA controls were cell-culture lysates of the negative control lines used for flow cytometry. These results indicate that tumor xenografts of SKOV3 are appropriate for the in vivo study of molecules targeting human HER2.
- polypeptides were received from Affibody® AB in Sweden.
- the polypeptides are referred to by their numeric internal development codes, which are prefixed with "Z".
- Table 1 details the polypeptides described herein.
- the polypeptides include polypeptide Z00342 (SEQ. ID No. 1); polypeptide Z02891 (SEQ. ID No. 2); polypeptide Z00477 (SEQ. ID No. 3 and 4), and dimer of Z00477, i.e., (Z00477) 2 (SEQ. ID No. 5).
- Binding interactions between the polypeptids and the HER2/neu antigen were measured in vitro using surface plasmon resonance (SPR) detection on a BiacoreTM 3000 instrument (GE Healthcare, Piscataway, NJ).
- SPR surface plasmon resonance
- the extracellular domain of the Her2/neu antigen was obtained as a conjugate with the Fc region of human IgG (Fc-Her2) from R&D Systems (Minneapolis, MN) and covalently attached to a CM-5 dextran-functionalized sensor chip (GE Healthcare, Piscataway, NJ) pre-equilibrated with HBS-EP buffer (0.01M HEPES pH 7.4, 0.15M NaCl, 3mM EDTA, 0.005% v/v surfactant P20) at 10 ⁇ /min and subsequently activated with EDC and NHS.
- HBS-EP buffer 0.01M HEPES pH 7.4, 0.15M NaCl, 3mM EDTA, 0.005% v/v surfactant P20
- the Fc-HER2 (5 ⁇ g/ml) in 10 mM sodium acetate (pH 5.5) was injected onto the activated sensor chip until the desired immobilization level (-3000 Resonance Units) was achieved (2 min). Residual activated groups on the sensor chip were blocked by injection of ethanolamine (1 M, pH 8.5). Any non-covalently bound conjugate was removed by repeated (5x) washing with 2.5 M NaCl, 50 mM NaOH. A second flow cell on the same sensor chip was treated identically, except with no Fc- HER2 immobilization, in order to serve as a control surface for refractive index changes and non-specific binding interactions with the sensor chip.
- FIG. 1 shows example surface plasmon resonance (SPR) data obtained for Z00477 (SEQ. ID No. 3) and (Z00477) 2 (SEQ. ID No. 5) when run on human HER2- functionalized surfaces. This relationship holds true for all polypeptides for which the affinities are known (Table 2), in which the values for the dimer Z(477)2 (SEQ. ID No. 5) are estimates based on avidity affect.
- SPR surface plasmon resonance
- the resulting solution was heated to 95 °C for 15-20 minutes, to give fac-[ 99m Tc(CO) 3 (H 2 0)3] + .
- a portion (2 mCi, 1 mL) of the solution was removed and neutralized to pH ⁇ 7 with 1 N HC1.
- a 325 ⁇ L ⁇ aliquot was removed and added to a solution of the His6-Polypeptide (SEQ ID NO: 7) (40 ⁇ g).
- the resulting solution was heated in a water bath at 35-37°C for 40 minutes.
- Typical radiochemical yields ranged from 80-95% (determined by ITLC- SG, Biodex, 0.9% NaCl).
- the crude reaction products were chromatographed on a NAP-5 column (GE Healthcare, 10 mM PBS) to give products of >99% radiochemical purity. Typical specific activities obtained were 3-4 ⁇ Ci/ ⁇ g.
- the resulting solution was then diluted with 10 mM PBS to give the proper concentration for subsequent biodistribution studies.
- HPLC was carried out on an Agilent 1100 series HPLC equipped with a Grace- Vydac Peptide/Protein C4 (4.6 x 250 mm) column and a Raytest GABI radioactivity detector.
- Solvent A was 95:5 watenMeCN with 0.1% TFA
- solvent B was 5:95 watenMeCN with 0.1% TFA.
- the gradient was as follows (all changes linear; time/%B): 0/0, 4/20, 16/60, 20/100, 25/100, 26/0, 31/0.
- FIG. 4 Representative HPLC chromatograms of NAP-5 purified radiolabeled polypeptides are shown in FIG. 4. The retention time of the radiolabeled species was virtually unchanged from the corresponding unlabeled polypeptide's retention time in a 220 nm UV chromatogram (except for the time difference due to the physical separation of the UV and gamma detectors; data not shown).
- mice Male CD-I nude mice (Charles River Labs, Hopkinton, MA) with an age range between 6 and 15 weeks. Mice were housed in a ventilated rack with food and water ad libitum and a standard 12 hour day-night lighting cycle. For xenografts, animals were injected with 100 ⁇ of cells in PBS. Cells were implanted subcutaneously in the right hindquarter. Implantation was performed under isoflurane anesthesia. For SKOV3, between 3 x 10 6 to 4 x 10 6 cells were implanted in each mouse. Under these conditions, useable tumors (100 to 300 ⁇ g) were obtained in 3 to 4 weeks in greater than 80% of animals injected.
- xenografts animals were injected with 100 ⁇ of cells in PBS. Cells were implanted subcutaneously in the right hindquarter. Implantation was performed under isoflurane anesthesia. For SKOV3, between 3 x 10 6 to 4 x 10 6 cells were implanted in each mouse
- mice were given tail-vein injections of ⁇ 1 ⁇ g of 99m Tc-labeled polypeptides ( ⁇ 3 ⁇ /l ⁇ g). Mice were placed in filter-paper lined cages until euthanasia. Three mice were euthanized at each timepoint and tissues of interest dissected and counted on a Perkin Elmer Wallac Wizard 1480 Gamma Counter. Data were collected for blood, kidney, liver, spleen, and injection site (tail). Urine from cages was pooled with the bladder and also counted. The remaining tissues were counted and the sum of all tissues plus urine for each animal was summed to provide the total injected dose.
- % injected dose for each organ was determined based on this total, and organs were weighed for determination of the % injected dose per gram, (%ID/g). Data is reported as mean value for all three mice in the timepoint with error bars representing the standard deviation of the group.
- the 99m Tc labeled Z00477 (SEQ. ID No. 4) polypeptide was injected into SKOV3 mice.
- FIG. 6 shows the tumor and blood curves for these experiments.
- the Z00477 (SEQ. ID No. 4) polypeptide shows good tumor uptake in target-expressing SKOV3 tumors, with a maximal value of approximately 3% of the injected dose per gram of tissue at 30 minutes post- injection (PI), and a peak tumor: blood ratio of more than 8 at 240 minutes PI.
- Polypeptides exhibit a monoexponential clearance from the blood with half-lives of less than two minutes. This clearance is primarily mediated by the liver and kidneys. Polypeptide uptake in the spleen was moderate, and moderate to high uptake in the liver is observed, as described in Table 5.
- Bivalent polypeptides exhibit higher affinity than the corresponding monomers, presumably due to the avidity effect. Their larger size, however, may hinder tumor penetration.
- HER2 polypeptides bivalent forms of each the four high affinity polypeptides were available.
- the monovalent and bivalent polypeptides otherwise exhibit similar biodistribution characteristics, and blood half-lives are observed for both in the one to two minute range. The results clearly indicate that both monomeric and divalent polypeptides can be targeted to HER2 in vivo.
- cPN216-amine was obtained from GE Healthcare.
- ⁇ - ⁇ - maleimidopropionic acid was purchased from Pierce Technologies (Rockford, IL).
- N- methylmorpholine, (benzotriazol- 1 -yloxy) tripyrrolidinophosphonium hexafluorophosphate (PyBoP), dithiothreitol (DTT), ammonium bicarbonate, and anhydrous DMF were purchased from Aldrich (Milwaukee, WI).
- PBS buffer (lx, pH 7.4) was obtained from Invitrogen (Carlsbad, CA).
- HPLC-grade acetonitrile (CH 3 CN), HPLC-grade trifluoroacetic acid (TFA), and Millipore 18 ⁇ water were used for HPLC purifications.
- the polypeptide Z00477 (SEQ ID No. 3) was dissolved with freshly degassed PBS buffer (lx, pH 7.4) at a concentration of approximately 1 mg/mL.
- the disulfide linkage in the polypeptide was reduced by the addition of DTT solution in freshly degassed PBS buffer (lx, pH 7.4).
- the final concentration of DTT was 20 mM.
- the reaction mixture was vortexed for 2 hours and passed through a Zeba desalt spin column (Pierce Technologies) pre-equilibrated with degassed PBS buffer (lx, pH 7.4) to remove excess of DTT reagent.
- the eluted reduced polypeptide molecule was collected, and the bifunctional compound Mal-cPN216 was added (20 equivalents per equivalent of the polypeptide) as a solution in DMSO, and the mixture was vortexed at room temperature for 3 hours and frozen with liquid-nitrogen. The reaction mixture was stored overnight before being subject to Reverse phase HPLC purification (FIGs. 8 A and 8B).
- LC-MS analysis of the purified product confirmed the presence of the desired product, and the MW suggested that only one cPN216 label was added to polypeptide constructs (Z00477 (SEQ. ID No. 3)-cPN216: calculated MW: 7429 Da, found: 7429 Da; Z02891 (SEQ. ID No. 2) -cPN216 calculated MW: 7524 Da, found: 7524 Da).
- Tin chloride 1.6 mg, 7.09xl0 "6 mol
- MDP 2.5 mg, 1.42xl0 "5 mol
- 10 aliquots were removed and transferred under a stream of nitrogen to silanized vials, immediately frozen and maintained in a liquid nitrogen bath until lyophilization.
- Each vial was partially capped with rubber septa and placed in a tray lyophilizer overnight. Vials were sealed under vacuum, removed from the lyophilizer, crimp-sealed with aluminum caps, re- pressurized with anhydrous nitrogen and stored in a freezer until future use.
- C4 RP-HPLC method 2 Solvent A: 0.06% NH 3 in water, Solvent B: CH 3 CN. Gradient elution: 0 min. 0%B, 4 min. 20%B, 16min. 60%B, 20 min. 100%B, 25 min. 100%B, 26 min. 0%B, 31 min. 0%B.
- SEC HPLC Solvent: lx (10 mM) PBS (Gibco, Invitrogen, pH 7.4 containing CaCl 2 and MgCl 2 ). Isocratic elution for 30 min. Analysis performed on a: Perkin Elmer SEC-4 Solvent Environmental control, Series 410 LC pump, ISS 200 Advanced LC sample processor and Series 200 Diode Array Detector. A Raytest GABI with Socket 8103 0111 pinhole (0.7 mm inner diameter with 250 ⁇ L ⁇ volume) flow cell gamma detector was interfaced through a Perkin Elmer NCI 900 Network Chromatography Interface. The column used was a Superdex 75 10/300 GL High Performance SEC column (GE Healthcare, code: 17-5174-01, ID no. 0639059).
- mice were given tail-vein injections of ⁇ 1 ug of 99m Tc-labeled polypeptides (-10 ⁇ ⁇ g). Mice were placed in filter-paper lined cages until euthanasia. Three mice were euthanized at each timepoint and tissues of interest dissected and counted on a Perkin Elmer Wallac Wizard 1480 Gamma Counter. Data were collected for blood, kidney, liver, spleen, and injection site (tail). Urine from cages was pooled with the bladder and also counted. The remaining tissues were counted and the sum of all tissues plus urine for each animal was summed to provide the total injected dose.
- % injected dose for each organ was determined based on this total, and organs were weighed for determination of the % injected dose per gram, (%ID/g). Data is reported as mean value for all four to five mice in the time point with error bars representing the standard deviation of the group. Four time points were taken over four hours (5, 30,120, and 240 minutes post-injection).
- Tumor blood ratios were 2, 5, and 5 at 30, 120, and 240 min post injection, respectively.
- FIG. 10, 11 and 12 show the tumor, blood and tumor: blood curves for these experiments.
- Z00477 SEQ. ID. NO. 4
- Z00342 SEQ. ID No. 1
- Z02891 SEQ. ID No. 2-cysteine polypeptides were functionalized with an aminoxy group via an engineered C-terminal cysteine.
- the purity of the polypeptide molecules provided was determined to be >95% by High Performance Liquid Chromatography (HPLC).
- a bifunctional linker Mal-aminooxy was synthesized comprising of two orthogonal groups: a thiol-reactive maleimide group for conjugation to the engineered cysteine and an aldehyde-reactive aminoxy group (FIGs. 13 A and 13B).
- This linker was prepared by reacting N-(2- aminoethyl) malemide with 2-(tert-butoxycarbonylaminooxy) acetic acid using 1- ethyl-3-[3-dimethylaminopropyl] carbodiimide (EDC) -mediated coupling conditions yielding the Boc-protected form of the linker.
- EDC 1- ethyl-3-[3-dimethylaminopropyl] carbodiimide
- the polypeptide (Z00477(SEQ ID No. 4), Z00342 (SEQ ID No. 1) Z02891 (SEQ ID. No. 2)) was dissolved with freshly degassed PBS buffer (lx, 7.4) at a concentration of approximately 1 mg/mL.
- the disulfide linkage in the polypeptide was reduced by the addition of dithiothreitol (DTT) solution in freshly degassed PBS buffer (lx, pH 7.4).
- the final concentration of DTT is 20 mM.
- the reaction mixture was vortexed for 2 hours and eluted through a Zeba desalt spin column (Pierce Technologies) pre-equilibrated with degassed PBS buffer to remove excess of DTT reagent.
- the reduced polypeptide was collected, and the bifunctional Mai- AO compound was added (15 equivalents per equivalent of the polypeptide) as a solution in DMSO. After being vortexed at room temperature overnight, the reaction mixture was purified with High Performance Liquid Chromatography (HPLC) (FIGs. 14A and 14B).
- HPLC High Performance Liquid Chromatography
- ESI-TOF-MS analysis confirmed the presence of target product with the expected molecular weights (calculated MW: 6964 Da, 8531 Da, and 7243 Da, found: 6963 Da, 8532 Da, and 7244 Da for Z00477 (SEQ. ID No. 4)-ONH 2 , Z00342 (SEQ. ID No. l)-ONH 2 , and Z02891 (SEQ. ID No. 2) -ONH 2 , respectively.
- K 18 F (40mCi mL 1 (1480 MBq mL "1 ) in purified water) was obtained from IBA Molecular (Albany, NY) and PETNET Solutions (Albany, NY) and were used as received.
- the [ 18 F ⁇ ] fluoride was first immobilized on a Chromafix 30-PS-HCO3 anion exchange cartridge (ABX, Radeberg, Germany), then eluted into a drydown vessel with a 1 mL, 4:1 mixture of acetonitrile: distilled, deionized H 2 0 (ddH 2 0) containing Kryptofix K222 (376 g.mol 1 , 8 mg, 2.13xl0 ⁇ 5 mol) and potassium carbonate (138.2 g.mol "1 , 2.1 mg, 1.52xl0 ⁇ 5 mol).
- the solvent was removed under partial vacuum and a flow of nitrogen with gentle heating ( ⁇ 45°C) (-15 min).
- the source vial and anion exchange cartridge were then washed with 0.5mL of acetonitrile containing K222 (8 mg) and the reaction mixture again brought to dryness under partial vacuum and gentle heating (- 10 min).
- the reaction vessel was repressurized with nitrogen and the azeotropic drydown repeated once with an additional 0.5mL of acetonitrile.
- the vessel was capped, crimped, placed in a heating block and maintained at 60°C for 15 minutes; at which point a small aliquot ( ⁇ 5 ⁇ ) was removed for analytical HPLC analysis .
- 450 ⁇ L ⁇ of ddH 2 0 with 0.1% TFA was used to dilute the solution to approx. 500 ⁇ L ⁇ in preparation for semi-preparative HPLC purification.
- 18 FB-Polypeptide was isolated and purified by semi-preparative HPLC .
- the HPLC fraction containing the product (0.113 mCi/4.18MBq) was diluted 5:1 with ddH 2 0 and subsequently immobilized on a tC18 Plus Sep Pak (Waters).
- 18 F-labeled polypeptides were isolated by NAP5 size exclusion chromatography by diluting the reaction mixture to approximately 0.5mL with lOmM PBS and loading onto the gel.
- the 18 F-labled polypeptides were isolated by eluting the column with 0.8 mL of lOmM PBS and used without further modification. These results are illustrated in Table 8, and FIG. 15.
- Analytical HPLC conditions used are as follows: Analysis performed on an HP Agilent 1100 with a G1311A QuatPump, G1313A autoinjector with ⁇ syringe and 2.0mL seat capillary, Phenomenex Gemini CI 8 column (4.6mmxl50mm), 5 ⁇ , 100A (S/N 420477-10), G1316A column heater, G1315A DAD and Ramon Star - GABI gamma-detector. 95:5 ddH 2 0:CH 3 CN with 0.05% TFA, Solvent B: CH 3 CN with 0.05% TFA. Gradient elution (1.0 mL min 1 ): 0 min. 0%B, 1 min.
- mice were given tail- vein injections of ⁇ 1 ug of 18 F-labeled polypeptide ( ⁇ 4 uCi/1 ⁇ g). Mice were placed in filter-paper lined cages until euthanasia. Three mice were euthanized at each timepoint and tissues of interest dissected and counted on a Perkin Elmer Wallac Wizard 1480 Gamma Counter. Data were collected for blood, kidney, liver, spleen, bone and injection site (tail). Urine from cages was pooled with the bladder and also counted. The remaining tissues were counted and the sum of all tissues plus urine for each animal was summed to provide the total injected dose.
- the percent injected dose for each organ was determined based on this total, and organs were weighed for determination of the percent injected dose per gram, (%ID/g). Data is reported as mean value for all three mice in the timepoint with error bars representing the standard deviation of the group.
- the polypeptides underwent biodistribution studies in SKOV3 cell xenograft models. Four time points were taken over four hours (5, 30, 120, and 240 minutes post-injection). Complete biodistribution data are included in Table 12 (%ID/g Z02891 (SEQ. ID No. 2) - 18 F-fluorobenzyl oxime in SKOV3 Tumor Bearing Mice) and table 13 (%ID/g Z00342 (SEQ. ID No. 1) 18 F-fluorobenzyl oxime in SKOV3 Tumor Bearing Mice).
- FIGs. 16, 17 and 18 show the tumor, blood, tumor: blood, and clearance curves for these tests.
- Tumor blood ratios were approximately 3, 34, and 128 at 30, 120, and 240 min post injection, respectively.
- Tumor blood ratios were approximately 3, 32 and 53 at 30, 120 and 240 min post injection, respectively.
- Polypeptide Z00477 (SEQ. ID 3) was labeled with Ga, specifically b/ Ga, after a NOTA (l,4,7-triazacyclononane-N,N',N"-triacetic acid) chelator was conjugated to the polypeptide. (Fig. 19)
- Bioconjugation of Mal-NOTA to polypeptide molecules was accomplished as follows.
- the polypeptide was dissolved with freshly degassed PBS buffer (lx, pH 7.4) at a concentration of approximately 1 mg/mL.
- the disulfide linkage in the polypeptide was reduced by the addition of DTT solution in freshly degassed PBS buffer (lx, pH 7.4).
- the final concentration of DTT was 20 mM.
- the reaction mixture was vortexed for 2 hours and passed through a Zeba desalt spin column (Pierce Technologies) pre-equilibrated with degassed PBS buffer (lx, pH 7.4) to remove excess of DTT reagent.
- the eluted reduced polypeptide molecule was collected, and the bifunctional compound mal-NOTA was added (15 equivalents per equivalent of the polypeptide) as a solution in DMSO, and the mixture was vortexed at room temperature. The reaction was allowed to proceed overnight to ensure the complete conversion of the polypeptide molecules.
- Reverse phase HPLC analysis of the crude reaction mixture determined the radiochemical purity of the 67 Ga-NOTA Z00477 (SEQ. ID No. 3) was determined to be 95% by HPLC after 2 hours at room temperature.
- Recombinant HER2 Z28921-Cys was purchased from Affibody AB, Sweden, Eei-aminooxyacetic acid succinic ester from IRIS Biotech, and di-tert- butyldifluorosilane was purchased from Fluorochem. Reagents and solvents were purchased from IRIS Biotech, Merck, Romil and Fluka.
- DIPEA Diisopropylethylamine
- DMAB 4-dimethylamino-benzaldehyde
- DOTA l ,4,7,10-tetraazacyclododecane-l,4,7,10-tetraacetic acid
- HER2 Human Epidermal growth factor receptor
- NMP 1 -Methyl-2-pyrrolidinone
- PET Positron emission tomography
- SiFA 4-(Di-tert-butylfluorosilyl)benzaldehyde
- TFA Trifluoroacetic acid
- TIS Triisopropylsilane
- [18F]Fluorobenzaldehyde (“[18FJFBA”) yielding typically 7 GBq of [18FJFBA in ethanol (1.5 mL, non-decay corrected yields 12-54%).
- a small fraction (92 ⁇ ) of this [18FJFBA solution was then manually conjugated to the aminoxy precursor 3 (0.4 mg, 55 nmol) in the presence of aniline hydrochloride (3.2 mg, 25 ⁇ ) in water (138 ⁇ ) in a silanised P6 vial.
- the mixture was heated at 70°C for 20 minutes using a Peltier heater. 2 was isolated via size exclusion chromatography (NAP5 cartridge, GE Healthcare).
- the product was further analysed by HPLC using a Gilson 322 pump with a Gilson UV/ViS 156 detector, a Bioscan Flow-Count radioactivity detector, and a Luna C18 Phenomenex column (50 x 4.6 mm, 3 ⁇ ) or a Luna C18 Phenomenex column (150 x 4.6 mm, 5 ⁇ ).
- the mobile phase comprised of solvents A (0.1 M ammonium acetate) and B (acetonitrile) running at 1 mL/min with a linear gradient (5-95 % B in 15 min).
- the UV absorbance was measured at 280 and 350 nm.
- FIG. 23 shows a representative example of an analytical HPLC trace of the formulation of 2.
- N-(2-Aminoethyl)maleimide TFA salt 51 mg, 0.20 mmol
- Eei-AOAc- OSu 77 mg, 0.30 mmol
- NMP 2 mL
- Sym.-collidine 80 ⁇ , 0.6 mmol
- the reaction mixture was diluted with water (7 mL) and the product, eei-aminooxyacetyl-maleimide, purified by semi -preparative HPLC.
- Recombinant Z02891-Cys (144 mg, 0.205 mmol)(purchased from Affibody AB, Sweden) and eei-aminooxyacetyl-maleimide (17 mg, 0.60 mmol) were dissolved in water (3 mL). The solution was adjusted to pH 6 by addition of ammonium acetate and the reaction mixture shaken for 90 min. The reaction mixture was diluted with water (7 mL) and the product purified by semi-prep HPLC affording 126 mg lyophilised Eei-protected product. The eei-protected product was treated with 2.5% TF A/water (16 mL) under a blanket of argon for 20 min.
- a FASTlabTM cassette was assembled containing a first vial (8.25 mg/21.9 ⁇ Kryptofix, 1.16 mg/8.4 ⁇ mol K2CO 3 , 165 ⁇ L ⁇ water, 660 ⁇ L ⁇ acetonitrile), a second vial (1.5 mg/4.8 ⁇ mol triflate 1, 1.5 mL anhydrous DMSO), a third vial (5.5 mg/0.76 ⁇ 3, 8.2 mg/63 ⁇ aniline hydrochloride, 0.7 mL ammonium acetate buffer pH 4.5/0.25 M), a fourth vial (4 mL, 4 % w/v aqueous ammonia), external vials of ethanol (25 mL) and phosphoric acid (1 % w/w, 25 mL), a pre-conditioned QMA light SepPak cartridge, an OASIS MCX SepPak cartridge, and two l C2 SepPak cartridges.
- the product vial contained an aqueous solution of p-amin
- the required programme sequence was uploaded from the PC control to the synthesizer module and the assembled cassette mounted onto the machine.
- a water bag and a product vial were attached.
- a vial containing [ 18 F]water (300 MBq, 1 mL) was attached to the FASTlabTM module and the radiosynthesis commenced.
- the process included an azeotropic drying step of the [ 18 F]-Kryptofix/potassium carbonate complex as eluted from the QMA cartridge, the radiosynthesis of [ 18 F]FBA, the purification of [ 18 F]FBA using the MCX cartridge, ammonia solution and elution with ethanol, the conjugation step to produce 2, and the purification and formulation step using phosphoric acid/ethanol on the l C2 cartridges.
- the total process took one hour and generated 2 in 33 % non-decay corrected radiochemical yield with 94 % radiochemical purity.
- a FASTlabTM cassette was assembled containing a first vial (8.25 mg/21.9 ⁇ Kryptofix, 1.16 mg/8.4 ⁇ K2CO 3 , 165 ⁇ L ⁇ water, 660 ⁇ L ⁇ acetonitrile), a second vial (1.5 mg/4.8 ⁇ triflate 1, 1.5 mL anhydrous DMSO), a third vial (5.0 mg/0.69 ⁇ 3, 8.2 mg/63 ⁇ aniline hydrochloride, 0.7 mL ammonium acetate buffer pH 4.5/0.25 M), a fourth vial (4 mL, 4 % w/v aqueous ammonia), external vials of ethanol (25 mL) and saline (Polyfusor, 0.9 % w/v, 25 mL), a pre-conditioned QMA light SepPak cartridge, an OASIS MCX SepPak cartridge, and a custom packed size exclusion cartridge (2 mL, Supelco, Cat.
- FIG. 26 shows the cassette layout of FIG. 26.
- the radiosynthesis of 2 was performed as described in Example 15. After priming the Sephadex cartridge with saline (5 mL), the crude reaction mixture was pumped through the Sephadex cartridge and pure 2 collected in the product vial. The synthesis time was 40 minutes and the non-decay corrected radiochemical yield was 10 %. The radiochemical purity of the product was 95 % and the level of DMAB was 0.8 ⁇ g/mL.
- FIG. 27 shows the HPLC analysis of the final product.
- GE Healthcare NAP5 size exclusion cartridge
- FIG. 28 shows the analytical HPLC of the formulated product. Table 11 summarises the data of individual runs.
- N,N"-bis(2-hydroxyethyl)-ethylenediamine (Aldrich, 14.8 g, 100 mmol) and pyridine (Fluka, 200mL) was stirred at 0°C under nitrogen while a solution of toluene-4-sulfonyl chloride (Fluka, 77 g, 400 mmol) dissolved in pyridine (Fluka, lOOmL) was dropped into the solution over a period of 75 minutes. The temperature was slowly raised to room temperature and continued stirred for 4 hours. Solution was poured into a mixture of ice (250 mL) and hydrochloric acid (concentrated, 250 mL) while stirring to afford a dark sticky oil.
- Tetratosyl-N,N -bis(2-hydroxyethyl)ethylene diamine See Example 17a(i)(a); 2.0 g, 2.6 mmol), benzyl amine (500 ⁇ 1, 4.6 mmol), potassium carbonate (Fluka, 792 mg, 5.7 mmol) and acetonitrile (Merck, 25 mL) was heated to 100°C and stirred overnight. Solvents were removed from solid product by filtration. The solid was washed with acetonitrile (2x 10 mL) and solvents were evaporated off. Solids was dissolved in hot ethanol (15 mL) and left for three days in room temperature. Crystals were collected by filtration and dried in vacuum overnight.
- NOTA(bis-tBu) was purified by preparative HPLC (gradient: 20-40% B over 40 min) affording 72 mg pure NOTA(bis-tBu).
- the purified material was characterised by LC-MS (gradient: 10-40% B over 5): i R : 3.75 min, found m/z: 416.2, expected MH + : 416.3.
- N-(2-Aminoethyl)maleimide trifluoroacetic acid salt 23 mg, 0.090 mmol
- NOTA(bis-tBu) 30 mg, 0.072 mmol
- PyAOP 51 mg, 0.10 mmol
- DMF ⁇ , ⁇ -dimethylformamide
- Sym.-collidine 29 ⁇ L ⁇ , 0.40 mmol
- the mixture was diluted with water/0.1 % trifluoroacetic acid (TFA) (6 mL) and the product purified by semi- preparative HPLC.
- NOTA(bis-tBu)-maleimide 33 mg, 61 ⁇ was treated with a solution of 2.5% triisopropylsilane (TIS) and 2.5% water in TFA (10 mL) for 4 hrs 30 min. TFA was evaporated in vacuo, the residue dissolved in water/0.1 % TFA (8 mL) and the product purified by semi-preparative HPLC. Purification using semi-preparative HPLC (gradient: 0-20% B over 40 min) afforded 15 mg (58%) pure NOTA(bis-acid)- maleimide. The purified material was characterised by LC-MS (gradient: 0-30% B over 5): i R : 1.34 min, found m/z 426.0, expected MH + : 426.2
- Recombinant Z02891-Cys 40 mg, 5.7 ⁇ (purchased from Affibody AB, Sweden) and NOTA(bis-acid)-maleimide (6.1 mg, 14 ⁇ ) were dissolved in water (1.5 mL). The solution was adjusted to pH 6 by adding ammonium acetate and the mixture shaken for 1 nr. The reaction mixture was diluted with water/0.1 % TFA (6 mL) and the product purified using semi-preparative HPLC. Purification using semi- preparative HPLC (gradient: 20-30% B over 40 min) afforded 38 mg (90%) pure compound 4. Purified 4 was analysed by analytical LC-MS (gradient: 10-40% B over 5 min): 3 ⁇ 4: 3.31 min, found m/z: 1864.5, expected MH 4 4+ : 1864.5
- Fluorine- 18 was purified using a QMA cartridge and eluted with saline as described by W. J. McBride et al. (Bioconj. Chem. 2010, 21, 1331). A solution of 18 F- water (25 ⁇ L, 12 MBq) was mixed with AICI 3 (1.667 ⁇ g, 12.5 nmol) in sodium acetate buffer (1.5 ⁇ L, pH 4.0, 0.5 M) and compound 6 (380 ⁇ g, 50 nmol):
- NOTA(tris-tBu)-NH-CH 2 CH 2 -NH 2 (123 mg, 0.176 mmol), 3-maleimido- propionic aid NHS ester (70 mg, 0.26 mmol) and sym.-collidine (346 ⁇ L ⁇ , 2.60 mmol) were dissolved in NMP (2 mL). The reaction mixture was stirred for 6 hr. Water (6 mL) was added and the product purified by semi-preparative HPLC. Purification using semi-preparative HPLC (gradient: 20-50% B over 40 min) afforded 115 mg (87%) pure NOTA(tris-tBu)-NH-CH 2 CH 2 -NH-maleimide. The purified material was characterised by LC-MS (gradient: 10-60% B over 5): 3 ⁇ 4: 3.36 min, found m/z: 737.4, expected MH + : 737.4
- NOTA(tris-tBu)-NH-CH 2 CH 2 -NH-maleimide (115 mg, 0.150 mmol) was treated with a solution of 2.5% TIS and 2.5% water in TFA (10 mL) for 4 hrs. The solvents were evaporated in vacuo, the residue re-dissolved in water (8 mL) and the product purified by semi-preparative HPLC. Purification using semi-preparative HPLC (gradient: 0-20% B over 40 min) afforded 80 mg (90%) pure NOTA(tris-acid)- NH-CH 2 CH 2 -NH-maleimide. The purified material was characterised by LC-MS (gradient: 0-30% B over 5): t R : 2.1 min, found m/z: 569.5, expected MH + : 569.2
- EAKYAKEMRNAYWEIALLPNLTNQQKRAFIRKLYDDPSQSSELLSEAKKLND SQAPKVDC was assembled on a CEM Liberty microwave peptide synthesiser using Fmoc chemistry starting with 0.05 mmol NovaPEG Rink Amide resin. 0.5 mmol amino acid was applied in each coupling step (5 min at 75 °C) using 0.45 mmol HBTU/0.45 mmol HO At/ 1.0 mmol DIPEA for in situ activation. Fmoc was removed by 5% piperazine in DMF. Double coupling of both Arg was applied. Asp-Ser and Leu-Ser pseudoproline dipeptides (0.5 mmol) were incorporated into the sequence.
- Example 20 Impact of the rea2ent dilution on radiochemical yields of ri8F]AlF-NOTA(COOH)2-Z02891(SEO ID No. 2)(5)
- a small volume of [ 18 F]fluoride (10 ⁇ ,, 80 MBq) was added. Two serial dilutions of this mixture (50 % and 25 % v/v) with sodium acetate buffer (1.5 ⁇ L ⁇ , pH 4.0, 0.5 M) were prepared.
- Example 21 Impact of the peptide/AlC13 concentration on radiochemical yields of ri8FlAlF-NOTA(COOH 2-Z02891(SEO ID No. 2X5)
- Example 22 Impact of microwave heatin2 on radiochemical yields of r 18 FlAlF-NOTA(COOH),-Z02891(SEO ID No. 2X5)
- a PP centrifuge vial 1.5 mL containing [ ls F]fluoride (25 ⁇ ,, 29 MBq), A1C1 3 (1.66 ⁇ g, 12.5 nmol) in 1.5 sodium acetate buffer, pH 4.0, 0.5 M), and 6 (380 ⁇ g, 50 nmol) in sodium acetate buffer (25 ⁇ , pH 4.0, 0.5 M) was heated at 100 °C for 15 minutes.
- the analytical RCY of 5a was 15-20 %.
- FIG. 31 shows the HPLC profile of the reaction mixture.
- FIG. 32 shows the HPLC analysis of the final product.
- Example 25 Tumour model validation
- the A431 and NCI-N87 xenograft models were validated for tumour growth and HER2 expression.
- the animal model setup involved inoculation of 2xl0 6 NCI- N87 or 10 7 A431 cells per animal (in ⁇ of 50%PBS/50%Matrigel) subcutaneously into the right flank followed by an inoculation period of 30 days.
- HER2 expression in these tumours was assessed by immunohistochemistry, using the FDA-validated HercepTest (Dako, K5204).
- FIG. 33 depicts that with the recommended intensity scale (0 -> +3), NCI-N87 tumours stain strongly (+3), while A431 cells show a considerably weaker staining intensity (+1).
- Example 28 Imaging of 2 in dual tumour xeno2raft model
- Dual tumour xenograft mice were generated by implantation of A431 and NCI-N87 in each of the two flanks. These mice were used to assess the biodistribution of 2, enabling a same-animal assessment of uptake in both low and high HER2 expressing tumours. Timepoints included 30 and 60 p.i.
- FIG. 36 shows that 2 performance was comparable to that observed in the single tumour animal studies, with good separation in binder uptake between the A431 and NCI-N87 tumours, starting from as early as 30min p.i.
- background tissue clearance see Table 7 for key tissue ratios
- blood levels at 60min p.i. have reduced significantly, providing a NCI-N87 tumour: blood ratio of 4.52
- partial blood clearance gives a 2.39 ratio, accompanied by a positive tumounliver ratio of 1.39.
- the concentration of cold precursor in the standard preparation was 12C ⁇ g/kg per mouse, therefore this study examined the effects of cold precursor at 10 x the original concentration used (in the mouse).
- FIG. 37 shows that the effect on tumour uptake was not significant and clearance from other tissues was not significantly affected either.
- Example 30 Compound 2 in vivo imaging studies in dual flank A431/NCI-N87 tumoured mice
- the dual-tumour mouse model described in Example 28 was used to perform a preliminary imaging study. 10 MBq of 2 were injected i.v. per animal and the mice were imaged for 30 minutes starting at 120 min p.i. The image in FIG 38 shows that clearance was through the kidneys and bladder, as previously demonstrated through the biodistribution studies. The transverse imaging shows uptake in the 2 tumours, with the NCI-N87 tumour showing considerably higher signal intensity than the A431 tumour, in agreement with the dual tumour biodistribution studies in Example 28.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Optics & Photonics (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Pharmacology & Pharmacy (AREA)
- Physics & Mathematics (AREA)
- Veterinary Medicine (AREA)
- Immunology (AREA)
- Toxicology (AREA)
- Cell Biology (AREA)
- Zoology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Oncology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Nuclear Medicine (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
Imaging agents comprising an isolated polypeptide conjugated with a radionucleide and a chelator; wherein the isolated polypeptide binds specifically to HER2, or a variant thereof; and methods for preparing and using these imaging agents.
Description
HER2 BINDING PEPTIDES LABELED WITH
ALUMINIUM- [18] FLUORIDE COMPLEXED BY NOTA
FIELD
[0001] The invention relates generally to imaging agents that bind to human epidermal growth factor receptor type 2 (HER2) and methods for making and using such agents.
BACKGROUND
[0002] Human epidermal growth factor receptor type 2 (HER2) is a transmembrane protein and a member of erbB family of receptor tyrosine kinase proteins. HER2 is a well-established tumor biomarker that is over-expressed in a wide variety of cancers, including breast, ovarian, lung, gastric, and oral cancers. Therefore, HER2 has great value as a molecular target and as a diagnostic or prognostic indicator of patient survival, or a predictive marker of the response to antineoplastic surgery.
[0003] Over the last decade, noninvasive molecular imaging of HER2 expression using various imaging modalities has been extensively studied. These modalities include radionuclide imaging with Positron Emission Tomography (PET) and Single Photon Emission Tomography (SPECT). PET and SPECT imaging of HER2 (HER2- PET and HER2-SPECT, respectively) provide high sensitivity, high spatial resolution. PET imaging of HER2 also provides strong quantification ability. HER2-PET and HER2-SPECT are particularly useful in real-time assays of overall tumor HER2 expression in patients, identification of HER2 expression in tumors over time, selection of patients for HER-targeted treatment (e.g., trastuzumab-based therapy), prediction of response to therapy, evaluation of drug efficacy, and many other applications. However, no PET or SPECT-labeled HER2 ligands have been developed that have a chemistry and exhibit in vivo behaviors which would be suitable for clinical applications.
[0004] Naturally occurring Staphylococcal protein A comprises domains that form a three-helix structure (a scaffold) that binds to the fragment, crystallizable region (Fc) of immunoglobulin isotype G (IgG). Certain polypeptides, derived from the Z- domain of protein A, contain a scaffold composed of three a-helices connected by loops. Certain amino acid residues situated on two of these helices constitute the
binding site for the Fc region of IgG. Alternative binder molecules have been prepared by substituting surface-exposed amino acid residues (13 residues) situated on helices 1 and 2, to alter the binding ability of these molecules. One such example is HER2 binding molecules or HER2 binders. These HER2 binders have been labeled with PET or SPECT-active radionuclides. Such PET and SPECT-labeled binders provide the ability to measure in vivo HER2 expression patterns in patients and would therefore aid clinicians and researchers in diagnosing, prognosing, and treating HER2- associated disease conditions.
[0005] HER2 binding Affibody® molecules, radiolabeled with the PET-active radionucleide, 18F, have been evaluated as imaging agents for malignant tumors that over express HER2. HER2 binding Affibody® molecules, conjugated with 99mTc via the chelators such as maGGG (mercaptoacetyltriglycyl), CGG (cysteine-diglycyl), CGGG (SEQ ID NO: 6) (cysteine-triglycyl) or A A3, have also been used for diagnostic imaging. The binding of these molecules to target HER2 expressing tumors has been demonstrated in mice.
[0006] In most of the cases, the signal-generating 18F group is introduced to the Affibody® through a thiol-reactive maleimide group. The thiol reactive maleimide group is prepared using a multi-step synthesis after 18 F incorporation. However, this chemistry only provides a low radiochemical yield. Similarly, the conjugation of 99mTc with the Affibody® is a multistep process. In addition, Tc reduction and the complex formation with chelates, require high pH (e.g., pH=l l) conditions and long reaction times.
[0007] Though the in vivo performance of 18F labeled Affibody® molecules was moderately good, there is significant room for improvement. For example, in some studies, the tumor uptake was found to be only 6.36±1.26 %ID/g 2 hours post- injection of the imaging agent.
[0008] Therefore, there is a need for chemistries and methods for synthesizing radiolabeled polypeptides in which a radioactive moiety, such as, for example, 18 F, can be introduced at the final stage, which in turn will provide high radiochemical yields. In addition, there is a need for a new HER2 targeting imaging agent for PET or SPECT imaging with improved properties particularly related to renal clearance and toxicity effects.
SUMMARY OF THE INVENTION
[0009] The compositions of the invention are a new class of imaging agents that are capable of binding specifically to HER2 or variants thereof.
[0010] In one or more embodiments, the imaging agent composition comprises an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID. No 2 or a conservative variant thereof, conjug ated with a 99mTc via a diaminedioxime chelator. The diaminedioxime chelator may comprise Pn216, cPn216, Pn44, or derivatives thereof. The isolated polypeptide binds specifically to HER2 or variants thereof.
[0011] In one or more embodiments, the imaging agent composition comprises an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID. No 2 or a conservative variant thereof, conjug ated with 67Ga or 68Ga via a NOTA chelator. The isolated polypeptide binds specifically to HER2 or variants thereof.
[0012] In one or more embodiments, the imaging agent composition comprises an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID. No 2 or a conservative variant thereof, conjugated with an Al 18 F-NOTA chelate. The isolated polypeptide binds specifically to HER2 or variants thereof.
[0013] In one or more embodiments, the imaging agent composition comprises an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID. No 2 or a conservative variant thereof, conjugated with 18F via a linker. The linker comprises a group derived from an aminoxy group, an azido group, or an alkyne group. The isolated polypeptide binds specifically to HER2 or variants thereof.
[0014] In one or more embodiments, the imaging agent composition comprises an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID. No 2 or a conservative variant thereof, conjugated with 18 F via an isotopic fluorine exchange chemistry. The isolated polypeptide binds specifically to HER2 or variants thereof.
[0015] In one or more embodiments, methods of making an imaging agent composition as described herein are provided. An example of a method of the invention, for preparing an imaging agent composition, comprises (i) providing an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID No. 2 or a conservative variant thereof; and (ii) reacting a diaminedioxime chelator with the polypeptide to form a chelator conjugated polypeptide. In another example, the method comprises
(i) providing an isolated polypeptide comprising SEQ. ID No. 1 , SEQ. ID No. 2 or a conservative variant thereof; (ii) reacting the polypeptide with a linker; and (iii) reacting the linker with an 18F moiety to form a 18F conjugated polypeptide. The linker may comprise an aminoxy group, an azido group, or an alkyne group.
[0016] In another example, the method comprises (i) providing an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID No. 2 or a conservative variant thereof; (ii) reacting the polypeptide with a NOTA- chelator to form, respectively, a NOTA-chelator conjugated polypeptide and (iii) reacting the NOTA- chelator conjugated polypeptide with an Al 18 F moiety to form, a Al 18 F-NOTA chelator conjugated polypeptide..
[0017] In another example, the method comprises (i) providing an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID No. 2 or a conservative variant thereof; (ii) reacting the polypeptide with a silicon fluoride (e.g. [19F]-silicon fluoride)-containing moiety to form a silicon fluoride conjugated polypeptide; and (iii) reacting the silicon fluoride conjugated polypeptide with an 18F moiety to form an 18F-silicon fluoride conjugated polypeptide.
FIGURES
[0018] These and other features, aspects, and advantages of the present invention will become better understood when the following detailed description is read with reference to the accompanying figures wherein:
[0019] FIGs. 1A and IB are graphs of the surface plasmon resonance (SPR) of the binding affinity of two anti-HER2 polypeptides, Z477 (SEQ. ID No. 3) and (Z477)2 (SEQ. ID No. 5), respectively, at eight different concentrations, to human HER2.
[0020] FIGs. 2 A and FIG. 2B are graphs of the qualitative flow cytometry of C6 (rat glioma, control) and human anti-HER2 antibody to SKOV3 (human ovarian carcinoma) respectively. FIG. 2C shows a bar chart for Her2 receptors per cell for SKOV3 and C6 cell lines.
[0021] FIG. 3 is a bar graph of ELISA assays for Her2 with respect to a panel of tumor types SKOV3 2-1, SKOV3 3-1, SKOV3 3-4, with respect to SKOV3 cells, and blank.
[0022] FIG. 4 is a reverse phase HPLC gamma chromatogram of mTc labeled Z00477 (SEQ. ID No. 3).
[0023] FIG. 5A is a size exclusion HPLC gamma chromatogram of aggregated 99mTc(CO)3(His6)Z00477 (SEQ. ID. No. 4) ('His6' disclosed as SEQ ID NO: 7) at pH 9. FIG. 5B a size exclusion HPLC gamma chromatogram of non aggregated 99mTc(CO)3(His6)Z00477 ('His6' disclosed as SEQ ID NO: 7) labeled Affibody® standard.
[0024] FIG. 6 is a graph of biodistribution profile of Z00477 (SEQ. ID No. 3) in blood, tumor, liver, kidney and spleen samples from SKOV3 tumor bearing mice, including the tumonblood ratio over time.
[0025] FIG. 7 is a diagram of the chemical structure for a Mal-cPN216 linker.
[0026] FIG. 8A is a graph of the electrospray ionization time of flight mass spectrum (ESI-TOF-MS) and FIG. 8B is a graph of mass deconvolution result for the purified Z00477 (SEQ. ID No. 3)-cPN216.
[0027] FIG. 9 is a reverse phase HPLC gamma trace chromatogram for Z02891- cPN216 (SEQ. ID No. 2) labeled with 99mTc.
[0028] FIG. 10 is a graph of the biodistribution profile of Z02891 (SEQ. ID No. 2) labeled with 99mTc via cPN216 ( ID, % injected dose)) in blood, liver, kidneys, spleen, and tail samples from SKOV3 tumor bearing mice.
[0029] FIG. 11 is a graph of the biodistribution profile of Z02891 (SEQ. ID No. 2) labeled with 99mTc via cPN216 ( ID, % injected dose) in tumor, blood, liver, kidneys , bladder/urine, tail, intestine and spleen samples from SKOV3 tumor bearing mice.
[0030] FIG. 12 is a graph of the biodistribution profile for Z02891 (SEQ. ID No. 2) in SKOV3 tumor bearing mice showing the tumor: blood ratio.
[0031] FIG. 13A and 13B are diagrams of the chemical structures for Boc -protected malimide-aminoxy (Mal-AO-Boc) and malimide-aminoxy (Mal-AO) linkers. 13 A is the chemical structure for tert-butyl 2-(2-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l- yl)ethylamino)-2-oxoethoxycarbamate (Mal-AO-Boc) and 13B is the chemical
structure for 2-(aminooxy)-N-(2-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l- yl)ethyl)acetamide hydrochloride (Mal-AO.HCl).
[0032] FIG. 14A is the reverse phase HPLC chromatogram of Z00342 (SEQ. ID No. 1) starting material and 14B is the reverse phase HPLC chromatogram of the purified Z00342 (SEQ. ID No. l)-AO imaging agent composition, both analyzed at 280 nm.
[0033] FIG. 15 is the reverse phase HPLC gamma chromatogram for the crude
18
reaction mixtures and purified final products of F-fluorobenzyl-Z00342 (SEQ. ID No. 1) and 18F-fluorobenzyl-Z02891 ' (SEQ. ID No. 2).
[0034] FIG. 16 is a graph of the biodistribution profile ( ID, % injected dose) of the Z02891 (SEQ. ID No. 2) polypeptide labeled with 18F from SKOV3-tumored animals.
[0035] FIG. 17 is a graph of the biodistribution profile of Z02891 (SEQ. ID No. 2)
18
polypeptide labeled with F ( ID, % injected dose) and the tumor: blood ratio from SKOV3-tumored animals.
[0036] FIG. 18 is bar graph of the biodistribution profile ( ID, % injected dose) of 18F labeled Z00342 (SEQ. ID No. 1) and 18F labeled Z02891 (SEQ. ID No. 2) in blood, tumor, liver, kidneys, spleen and bone samples.
[0037] FIG. 19 is a diagram of the chemical structure of the Mal-NOTA linker.
[0038] FIG. 20A is a graph of the electrospray ionization time of flight mass spectrum (ESI-TOF-MS), and 20B is a graph of the ESI-TOF-MS mass deconvolution result for Z00477 (SEQ. ID No. 3)-NOTA.
[0039] FIG. 21 is a graph of the reverse phase HPLC gamma trace for the crude reaction mixture of 67Ga-labeled Z00477 (SEQ. ID No. 3)-NOTA after 1 hour of reaction.
[0040] FIG. 22 is a graph of the reverse phase HPLC gamma trace for the purified 67Ga-labeled NOTA Z00477 (SEQ. ID No. 3)-NOTA polypeptide.
[0041] FIG. 23 is an analytical HPLC of formulated 2 [top: UV channel at 280 nm showing ascorbate, 0.5 min and peptide precursor 3, 4.5 min; bottom: radioactivity channel showing 2, 5.1 min (RCP 95%) and a decomposition product at 4.6 min.
[0042] FIG. 24 is a FASTlab1M cassette layout for the preparation of 2 using tC2 SepPak purification.
[0043] FIG. 25 is an analytical HPLC of formulated 2 prepared using FASTlab™ [top: radioactivity channel, showing 2 (7.7 min), 18F-FBA (10.4 min) and an unknown impurity (12.2 min); middle: UV channel at 280 nm showing p-aminobenzoic acid formulation additive (3 min); bottom: UV channel at 350 nm showing dimethylaminobenzaldehyde by-product (10.2 min) and an unknown impurity (3.8 min)].
[0044] FIG. 26 is a FASTlab™ cassette layout for the preparation of 2 using Sephadex purification.
[0045] FIG. 27 is an analytical HPLC of formulated 2 prepared using FASTlab with Sephadex purification [top: radioactivity channel, showing 2 (7.1 min), 18F-FBA (8.8 min) and an unknown impurity (10.2 min); middle: UV channel at 280 nm; bottom: UV channel at 350 nm showing dimethylaminobenzaldehyde by-product (10.0 min)].
[0046] FIG. 28 is an analytical HPLC of formulated 5 [top: radioactivity channel, showing the product (4.7 min, 92 ) and a by-product (3.9 min, 8 ); bottom: UV channel at 280 nm].
[0047] FIG. 29 depicts a time course study of 5 showing labelling efficiencies as measured by analytical radio HPLC.
[0048] FIG. 30 is an analytical RCY of 5 after increasing the peptide/AlCl3 concentration (P: product, BP: by-product, see Fig. FIG 28).
[0049] FIG. 31 is an analytical HPLC profile of a labelling mixture of 5. (Top trace: radioactivity channel, bottom trace: UV channel at 280 nm).
[0050] FIG. 32 is an analytical radioactivity channel HPLC of isolated 7 (Red: radioactivity channel, blue: UV channel at 280 nm).
[0051] FIG. 33 depicts HER2 protein expression in tumour sections from the NCI- N87 and A431 xenograft models by immunohistochemistry the HERCEPTEST by DAKO. Pictures on the left are x2 magnification, pictures on the right are xlO of the highlighted square.
[0052] FIG. 34 shows naive mice biodistributions of 9, 2, 5, and 7.
[0053] FIG. 35 shows biodistributions of 9, 2, 5, and 7 in the NC87/A431 tumour bearing mice.
[0054] FIG. 36 shows biodistribution profile of 2 in the dual tumour xenograft model.
[0055] FIG. 37 shows NCI-N87 xenograft biodistribution profile of 2 using increasing concentrations of cold precursor.
[0056] FIG. 38 shows preliminary imaging with 2 in the dual tumour xenograft model (A) and comparison to Affibody® 9 imaging study (B).
DETAILED DESCRIPTION
[0057] The imaging agent compositions of the invention generally comprise an isolated polypeptide of SEQ. ID No. 1, SEQ. ID No. 2 or a conservative variant thereof, conjugated with a radioisotope such as, for example, 18F, 99mTc, 67Ga or 68Ga, mIn, 123I, 124I, 89Zr, or ^Cu; and methods for making and using the compositions. The isolated polypeptide binds specifically to HER2 or its variant thereof. In one or more embodiments, the sequence of the isolated polypeptide has at least 90% sequence similarity to any of SEQ. ID No. 1, SEQ. ID No. 2 or conservative variant thereof.
[0058] The isolated polypeptide may comprise natural amino acids, synthetic amino acids, or amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, for example, hydroxyproline, γ-carboxyglutamate, O-phosphoserine, phosphothreonine, and phosphotyrosine.
[0059] The isolated polypeptides may be prepared using standard solid phase synthesis techniques. Alternatively, the polypeptides may be prepared using recombinant techniques. When the polypeptides are prepared using recombinant techniques, the DNA encoding the polypeptides or conservative variants thereof may be isolated. The DNA encoding the polypeptides or conservative variants thereof may be inserted into a cloning vector, introduced into a host cell (e.g., a eukaryotic cell, a plant cell, or a prokaryotic cell), and expressed using any art recognized expression system.
[0060] The polypeptide may be substantially comprised of a single chiral form of amino acid residues. Thus, polypeptides of the invention may be substantially comprised of either L-amino acids or D-amino acids; although a combination of L- amino acids and D-amino acids may also be employed.
[0061] As the polypeptides provided herein are derived from the Z-domain of protein A, residues on the binding interface may be non-conservatively substituted or conservatively substituted while preserving binding activity. In some embodiments, the substituted residues may be derived from any of the 20 naturally occurring amino acids or any analog thereof.
[0062] The polypeptides may be about 49 residues to about 130 residues in length. The specific polypeptide sequences are listed in Table 1.
Table 1
[0063] Additional sequences may be added to the termini to impart selected functionality. Thus, additional sequences may be appended to one or both termini to facilitate purification or isolation of the polypeptide, alone or coupled to a binding target (e.g., by appending a His tag to the polypeptide).
[0064] The polypeptides listed in Table 1 may be conjugated with F via a linker; 99mTc via a diaminedioxime chelator, with 67 Ga or 68Ga via a NOTA chelator, with 18F via an Al 1l8oF-N0TA- chelator, with 1180F via SiFA (i.e., silicon fluoride acceptor) or silicon fluoride exchange chemistry, with niIn via DOTA chelator chemistry, with
123 or 124 via fluorobenzaldehyde-like chemistry using iodobenzaldehyde, or with ^Cu via NOTA-chelator chemistry. Table 2 provides the isoelectric point (pi), of these polypeptides.
Table 2
[0065] In one or more embodiments, the isolated polypeptide, comprising SEQ. ID No. 1, SEQ. ID No. 2 or a conservative variant thereof, may be conjugated with 18F. The 18F may be incorporated at a C terminus, at a N-terminus, or at an internal position of the isolated polypeptide.
[0066] In one or more embodiments, the 18F may be conjugated to the isolated polypeptide via a linker. The linker may comprise, an aminoxy group, an azido group, or an alkyne group. The aminoxy group of the linker may be attached with an aldehyde, such as a fluorine-substituted aldehyde. An azide group of the linker may be attached with a fluorine substituted alkyne. Similarly, an alkyne group of the linker may be attached with a fluorine substituted azide. The linker may also comprise a thiol reactive group. The linker may comprise of a maleimido-aminoxy, maleimido- alkyne or maleimido- azide group. The 18F conjugated polypeptide may be prepared by: (i) providing the isolated polypeptide comprising SEQ.ID No. 1, SEQ.ID No. 2, or a conservative variant thereof; (ii) reacting the polypeptide with a linker, wherein the linker comprises an aminoxy group, an azido group, or an alkyne group, to form a linker conjugated polypeptide; and reacting the linker with an 18 F moiety to form the 18F conjugated polypeptide.
[0067] The 18F conjugated polypeptide may be prepared by: (i) providing the isolated polypeptide comprising SEQ.ID No. 1, SEQ.ID No. 2, or a conservative variant
thereof; (ii) reacting the polypeptide with a linker, wherein the linker comprises a maleimido-aminoxy, maleimido-alkyne or maleimido-azide group, to form a linker
18 18 conjugated polypeptide; and reacting the linker with an F moiety to form the F conjugated polypeptide.
[0068] In another embodiment, the method may comprise: (i) providing an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID No. 2, or a conservative variant
18
thereof; (ii) providing a linker; (iii) reacting the linker with the F moiety to form a 18F labeled linker; and (iv) reacting the 18F labeled linker with the isolated polypeptide
18 of SEQ. ID No 1, SEQ ID no 2, or a conservative variant thereof, to form the F conjugated polypeptide.
[0069] Using the above-described examples, fluorine or radiofluorine atom(s), such as 18F, may be introduced onto the polypeptides. A fluorine-substituted polypeptide results when a fluorine-substituted aldehyde is reacted with the aminoxy group of the linker conjugated polypeptide. Similarly, a fluorine substituted polypeptide results, when a fluorine substituted azide or alkyne group is reacted with the respective alkyne or azide group of the linker conjugated polypeptide. A radiofluorine-labeled polypeptide or imaging agent composition results, when a radiofluorine-substituted aldehyde, azide or alkyne is reacted with the respective aminoxy, alkyne or azide group of the linker conjugated polypeptide. Further, the linker may have a
18
radiofluorine ( F) substituent, to prepare radiofluorine-labeled imaging agent compositions. The methods for introducing fluorine onto the polypeptide may also be used to prepare a fluorinated imaging agent composition of any length. Thus, in some embodiments the polypeptide of the imaging agent composition may comprise, for example, 40 to 130 amino acid residues.
[0070] A linker-conjugated polypeptide or the 18F-conjugated linker for use in the preparation of an imaging agent or imaging agent composition of the invention may be prepared by a method of the invention that is more efficient than previously known methods and result in higher yields. The methods are easier to carry out, faster and are performed under milder, more user friendly, conditions. For example, the method
18 18 for labeling a polypeptide with an F-conjugated linker (e.g., F-
18 18 fluorobenzaldehydeX" F-FBA") is simpler than the procedures known in the art. F conjugated-linker is prepared in one step by the direct nucleophilic incorporation of
F onto the trimethylanilinium precursor. F-linker (i.e., F-FBA) is then conjugated to the polypeptide, such as, for example, an Affibody® and those described herein. The preparation of the linker is also easier than previously known methods in the art. Moreover, radiolabeled aminoxy based linker-conjugated polypeptides, and the cPn family of chelator conjugated polypeptides (e.g., Affibody®), show significantly better biodistribution and better tumor uptake, as well as better clearance with less liver uptake.
[0071] The fluorine-labeled imaging agent compositions are highly desired materials in diagnostic applications. 18 F labeled imaging agent compositions may be visualized using established imaging techniques such as PET.
[0072] In another embodiment, the polypeptide may be conjugated with 99mTc via a diamindioxime chelator of formula (1).
OH OH wherein R , R", R'", R"" is independently H or C1-10 alkyl, C3_i0 alkylary, C2-10 alkoxyalkyl, CMO hydroxyalkyl, CMO alkylamine, CMO fluoroalkyl, or 2 or more R groups, together with the atoms to which they are attached to form a carbocyclic, heterocyclic, saturated or unsaturated ring, wherein R may be H, CMO alkyl, C3-10 alkylary, C2-10 alkoxyalkyl, CMO hydroxyalkyl, CMO alkylamine, or CMO fluoroalkyl. In one embodiment, n may vary from 0-5. Examples of methods for preparing diaminedioxime chelators are described in PCT Application, International Publication No.WO2004080492(Al) entitled "Methods of radio fluorination of biologically active vector", and PCT Application, International Publication No.WO2006067376(A2) entitled "Radio labelled conjugates of RGD-containing peptides and methods for their preparation via click-chemistry", which are incorporated herein by references.
[0073] The 99mTc may be conjugated to the isolated polypeptide via the diamindioxime at the N-terminus of the isolated polypeptide. The chelator may be a bifunctional compound. In one embodiment, the bifunctional compound may be Mal- cPN216. The Mal-cPN216 comprises a thiol-reactive maleimide group for
conjugation to a terminal cysteine of the polypeptide of SEQ ID No. 1 or SEQ ID No 2 and a bis-amineoxime group (diamindioxime chelator) for chelating with 99mTc. The Mal-cPN216 may have a formula (II).
[0074] The diamindioxime chelator conjugated peptide may be prepared by (i) providing an isolated polypeptide comprising SEQ.ID No. 1, SEQ. ID No. 2 or a conservative variant thereof, (ii) reacting a diamindioxime chelator with the polypeptide to form the diamindioxime conjugated polypeptide. The diamindioxime chelator may be further conjugated with 99mTc.
[0075] In one or more embodiments, the polypeptide may be conjugated with 67 Ga, or 68Ga via NOTA (l ,4,7-triazacyclononane-N,N',N"-triacetic acid) chelator. The NOTA-chelator conjugated polypeptide may be prepared by (i) providing an isolated polypeptide comprising SEQ.ID No. 1, SEQ. ID No. 2 or a conservative variant thereof, (ii) reacting a NOTA chelator with the polypeptide to form the NOTA- chelator conjugated polypeptide. The NOTA chelator may be further conjugated with
67^ 68^
Ga or Ga.
[0076] In one embodiment, the Ga, specifically 67 Ga, may be conjugated to the isolated polypeptide via NOTA chelator. The NOTA chelator may be functionalized with a maleimido group, as described in formula (III).
[0077] In one or more embodiments, the polypeptide may be conjugated with Al F via NOTA (l ,4,7-triazacyclononane-N,N',N"-triacetic acid) chelator The NOTA-
conjugated polypeptide may be prepared by (i) providing an isolated polypeptide comprising SEQ.ID No. 1, SEQ. ID No. 2 or a conservative variant thereof, (ii) reacting a NOTA- chelator with the polypeptide to form the NOTA- chelator conjugated polypeptide. The NOTA- chelator conjugated polypeptide may then be
18 18
further conjugated with Al F to form the Al F-NOTA-chelator conjugated polypeptide.
[0078] In one or more embodiments, the polypeptide may be conjugated with 18F via NOTA- chelator. The NOTA- chelator conjugated polypeptide may be prepared by (i) providing an isolated polypeptide comprising SEQ.ID No. 1 , SEQ. ID No. 2 or a conservative variant thereof, (ii) reacting a NOTA- chelator with a source of 18F (e.g., A118F) to form an 18F-NOTA- chelator; and (iii) reacting the 18F-NOTA- chelator with
18
the isolated polypeptide to form the F-NOTA-chelator conjugated polypeptide.
[0079] In one or more embodiments, a chelator may comprise a chelate moiety (e.g. NOTA, DOTA) alone or a chelate moiety and a linker, each as described herein. By way of example, a NOTA-chelator can represent a NOTA chelate moiety alone or a NOTA chelate moiety attached to a linker as described herein.
[0080] In one or more embodiments, the polypeptide may be conjugated with 18F via
18
SiFA chemistry. The F-SiFA conjugated polypeptide may be prepared by: (i) providing the isolated polypeptide comprising SEQ.ID No. 1, SEQ.ID No. 2, or a conservative variant thereof; (ii) reacting the polypeptide with a linker, wherein the linker comprises a silicon fluoride acceptor (SiFA) group, to form a SiFA conjugated
18 polypeptide; and (iii) reacting the SiFA conjugated polypeptide with an F moiety or a source of 18F. The 18F moiety or source of 18F can any such moiety or source capable of reacting with a SiFA group and undergo isotopic fluorine exchange chemistry. Scheme I below illustrates radiolabelling of Z02891 (SEQ. ID No. 2) using [18F]SiF coupling:
Scheme I
[0081] In one or more embodiments, the methods of making a radiolabeled imaging agent or imaging agent composition of the invention as described herein, are automated. For example, a radiolabeled imaging agent or imaging agent composition of the invention may be conveniently prepared in an automated fashion by means of an automated radiosynthesis apparatus. There are several commercially-available examples of such platform apparatus, including TRACERlab™ (e.g., TRACERlab™ MX) and FASTlab™ (both from GE Healthcare Ltd.). Such apparatus commonly comprises a "cassette", often disposable, in which the radiochemistry is performed, which is fitted to the apparatus in order to perform a radiosynthesis. The cassette normally includes fluid pathways, a reaction vessel, and ports for receiving reagent vials as well as any solid-phase extraction cartridges used in post-radiosynthetic clean up steps. Optionally, in a further embodiment of the invention, the automated radiosynthesis apparatus can be linked to a high performance liquid chromatograph (HPLC).
[0082] The present invention therefore provides a cassette for the automated synthesis of a radiolabeled imaging agent or imaging agent composition of the invention, each as defined herein.
[0083] The invention also comprises methods of imaging at least a portion of a subject. In one embodiment, the method comprises administering a radiolabeled imaging agent or an imaging agent composition of the invention to a subject and imaging the subject. The subject may be imaged, for example, with a diagnostic device.
[0084] In one or more embodiments, a method of imaging may further comprise the steps of monitoring the delivery of the agent or composition to the subject and
diagnosing the subject with a HER2-associated disease condition (e.g., breast cancer). In one embodiment, the subject may be a mammal, for example, a human. In another embodiment, the subject may comprise cells or tissues. The tissues may be used in biopsy. The diagnostic device may employ an imaging method chosen from magnetic resonance imaging, optical imaging, optical coherence tomography, X-ray, single photon emission computed tomography (SPECT), positron emission tomography (PET), or combinations thereof.
[0085] A radiolabeled imaging agent or an imaging agent composition of the invention may be administered to humans and other animals parenterally as a pharmaceutical composition. A pharmaceutical composition of the invention comprises a radiolabeled imaging agent or an imaging agent composition, as described herein, and a pharmaceutically acceptable carrier, excipient, solvent or diluent.
[0086] For example, a pharmaceutical composition of this invention for parenteral injection comprise pharmaceutically-acceptable sterile aqueous or nonaqueous solutions, dispersions, suspensions or emulsions as well as sterile powders for reconstitution into sterile injectable solutions or dispersions just prior to use. Examples of suitable aqueous and nonaqueous carriers, diluents, solvents or vehicles include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils (such as olive oil), and injectable organic esters such as ethyl oleate. Proper fluidity can be maintained, for example, by using coating materials such as lecithin, by adjusting the particle size in dispersions, and by using surfactants.
[0087] A pharmaceutical composition of the invention may also contain an adjuvant such as preservatives, wetting agents, emulsifying agents, and dispersing agents. Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents such as sugars, sodium chloride, and the like. Prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents, which delay absorption such as aluminum monostearate and gelatin.
[0088] A radiolabeled imaging agent or an imaging agent composition of the invention may be dispersed in physiologically acceptable carrier to minimize potential toxicity. Thus, the imaging agents may be dispersed in a biocompatible solution with a pH of about 6 to about 8. In some embodiments, the agent is dispersed in a biocompatible solution with a pH of about 7 to about 7.4. In other embodiments, the agent is dispersed in a biocompatible solution with a pH of about 7.4.
[0089] An imaging agent composition or a pharmaceutical composition of the invention may be combined with other additives that are commonly used in the pharmaceutical industry to suspend or dissolve the compounds in an aqueous medium, and then the suspension or solution may be sterilized by techniques known in the art. The imaging agent composition may be administered in a variety of forms and adapted to the chosen route of administration. For example, the agents may be administered topically (i.e., via tissue or mucus membranes), intravenously, intramuscularly, intradermally, or subcutaneously. Forms suitable for injection include sterile aqueous solutions or dispersions and sterile powders for the preparation of sterile injectable solutions, dispersions, liposomal, or emulsion formulations. Forms suitable for inhalation use include agents such as those dispersed in an aerosol. Forms suitable for topical administration include creams, lotions, ointments, and the like.
[0090] An imaging agent composition or a pharmaceutical composition of the invention may be concentrated to conveniently deliver a preferred amount of the agents to a subject and packaged in a container in the desired form. The agent may be dispensed in a container in which it is dispersed in a physiologically acceptable solution that conveniently facilitates administering the agent in concentrations between 0.1 mg and 50 mg of the agent per kg body weight of the subject.
[0091] In one or more embodiments, the target tissue may be imaged about four hours after administering the agents. In alternative embodiments, the target tissue may be imaged about 24 hours after administering the agents to the subject.
Examples
[0092] The following examples are provided for illustration only and should not be construed as limiting the invention.
[0093] MATERIALS
[0094] A panel of tumorigenic cell lines with a reasonable probability of expressing HER2 was selected based on available literature (Bruskin, et. al. Nucl. Med. Biol. 2004: 31 : 205; Tran, et. al. Imaging agent composition Chem. 2007: 18: 1956), as described in Table3.
Table 3
[0095] All cell lines were obtained from the American Type Culture Collection (ATCC) and cultured as recommended. Cells were cultured to > 90% confluence prior to use. Flow cytometry (Beckman Coulter Cytomics FC500 MPL) was carried out on the cell lines listed in table 4 using anti-Her2 primary antibodies (R&D Systems, PN MAB 1129) and the Dako QIFIKIT (PN K0078) for quantitative analysis of indirect immunofluorescence staining. Calibration beads with 5 different populations bearing different numbers of Mab molecules were used in conjunction with the cell lines to determine number of surface receptors per cell. In all cases, appropriate isotype controls were obtained from the corresponding vendors.
[0096] Adherent cells were released from their flasks using cell dissociation buffer (PBS + 10 mM EDTA) rather than trypsin to avoid proteolysis of cell surface receptors. Cells were washed twice in PBS and resuspended in ice-cold FC buffer (PBS + 0.5 % BSA w/v) to a concentration of 5-10 x 106 cells/ml. 100 μΐ. aliquots of cells were mixed with 5 μg of primary antibody and incubated, on ice, for 45 minutes. Cells were then washed with 1 ml of ice cold flow cytometry (FC) buffer (PBS with 2% bovine serum albumin), centrifuged at 300 x g for 5 min, and resuspended in 0.5 μL· of FC buffer. 100 μL· of 1 :50 dilution with PBS of the secondary antibody fragment (F(ab)2 FITC -conjugated goat anti-mouse Immunoglobulins) was added and incubated, on ice and in the dark, for 45 minutes. Cells were then washed twice with 1 mL of ice cold FC buffer, centrifuged at 300 x g for 5min, and resuspended in 500
μL· of FC buffer. All stained cells were passed through a 100-micron filter prior to flow cytometry to prevent clogs of the flow cell.
[0097] Flow cytometry was carried out on a Beckman Coulter Cytomics FC500 MPL. A minimum of 5 x 104 events was collected for each tube. All analyses were single color, with detection of FITC in FL1. Forward scatter (FS) and side scatter (SS) data demonstrated that all cell populations were tightly grouped.
[0098] Flow cytometry was used to evaluate the cells for their HER2 expression in vitro (Figs.2A, 2B, and 2C) with SKOV3 cells showing the highest level of HER2 expression (Fig. 3). The results in Fig. 3 were reproducible (n=3).
[0099] The highest expressing cell line was SKOV3. These cells were injected into 6-12 week old immuno-compromised mice and allowed to grow tumors. Tumor growth curves and success rates were dependent on the number of cells inoculated. Optimal tumor growth was obtained with three to four million cells/mouse
[00100] In vivo studies were carried out with female CD-I nude mice (Charles River Labs, Hopkinton, MA) with an age range between 6 and 15 weeks. Mice were housed in a ventilated rack with food and water ad libitum and a standard 12 hour day-night lighting cycle. For xenografts, animals were injected with 100 μΐ of cells in PBS. Cells were implanted subcutaneously in the right hindquarter. Implantation was performed under isoflurane anesthesia. For SKOV3, between 3 x 106 to 4 x 106 cells were implanted in each mouse. Under these conditions, useable tumors (100 to 300 μg) were obtained in 3 to 4 weeks in greater than 80% of animals injected.
[00101] Tumors were collected from mice by dissection, and whole tumors were stored at -20°C until processing. Tumors were ground on ice in 1 ml of RIPA buffer supplemented with a protease inhibitor cocktail (Santa Cruz Biotech, Santa Cruz, CA #24948) in a Dounce homogenizer. Homogenates were then incubated on ice for 30 minutes, then centrifuged at 10,000 x G for 10 minutes in a refrigerated centrifuge. Supernatants were collected and stored on ice or at 4°C until further processing. Protein concentrations in lysates were determined using a BCA protein assay kit (Pierce Biotechnology 23225). Lysates were diluted to a standard concentration to yield 20 μg of protein/well in the microtiter plate. ELISA's were run with a commercially available human HER2 kit (R&D Systems, DYC1129) according to the
manufacturer's instructions. Each sample was run in triplicate, and data are reported as pg HER2^g total protein, errors are reported as standard deviations.
[00102] Target expression in vivo was measured by ELISA. Excised tumors were homogenized and analyzed for HER2 using a commercially available matched pair kit (R&D systems, DYC1129, Minneapolis, MN). The results, in FIG. 3, show that the SKOV3 cell line grows a high-expressing tumor. ELISA controls were cell-culture lysates of the negative control lines used for flow cytometry. These results indicate that tumor xenografts of SKOV3 are appropriate for the in vivo study of molecules targeting human HER2.
[00103] All polypeptides were received from Affibody® AB in Sweden. The polypeptides are referred to by their numeric internal development codes, which are prefixed with "Z". Table 1 details the polypeptides described herein. The polypeptides include polypeptide Z00342 (SEQ. ID No. 1); polypeptide Z02891 (SEQ. ID No. 2); polypeptide Z00477 (SEQ. ID No. 3 and 4), and dimer of Z00477, i.e., (Z00477)2 (SEQ. ID No. 5).
[00104] Binding interactions between the polypeptids and the HER2/neu antigen were measured in vitro using surface plasmon resonance (SPR) detection on a Biacore™ 3000 instrument (GE Healthcare, Piscataway, NJ). The extracellular domain of the Her2/neu antigen was obtained as a conjugate with the Fc region of human IgG (Fc-Her2) from R&D Systems (Minneapolis, MN) and covalently attached to a CM-5 dextran-functionalized sensor chip (GE Healthcare, Piscataway, NJ) pre-equilibrated with HBS-EP buffer (0.01M HEPES pH 7.4, 0.15M NaCl, 3mM EDTA, 0.005% v/v surfactant P20) at 10 μΕ/min and subsequently activated with EDC and NHS. The Fc-HER2 (5 μg/ml) in 10 mM sodium acetate (pH 5.5) was injected onto the activated sensor chip until the desired immobilization level (-3000 Resonance Units) was achieved (2 min). Residual activated groups on the sensor chip were blocked by injection of ethanolamine (1 M, pH 8.5). Any non-covalently bound conjugate was removed by repeated (5x) washing with 2.5 M NaCl, 50 mM NaOH. A second flow cell on the same sensor chip was treated identically, except with no Fc- HER2 immobilization, in order to serve as a control surface for refractive index changes and non-specific binding interactions with the sensor chip. Prior to the kinetic study, binding of the target analyte was tested on both surfaces and a surface
stability experiment was performed to ensure adequate removal of the bound analyte and regeneration of the sensor chip following treatment with 2.5 M NaCl, 50 mM NaOH. SPR sensorgrams were analyzed using the BIAevaluation software (GE Healthcare, Piscataway, NJ). The robustness of the kinetic model was determined by evaluation of the residuals and standard error for each of the calculated kinetic parameters, the "goodness of the fit" (χ2 < 10), and a direct comparison of the modeled sensorgrams to the experimental data. SPR measurements were collected at eight analyte concentrations (0-100 nM protein) and the resulting sensorgrams were fitted to a 1 : 1 Langmuir binding model.
[00105] FIG. 1 shows example surface plasmon resonance (SPR) data obtained for Z00477 (SEQ. ID No. 3) and (Z00477)2 (SEQ. ID No. 5) when run on human HER2- functionalized surfaces. This relationship holds true for all polypeptides for which the affinities are known (Table 2), in which the values for the dimer Z(477)2 (SEQ. ID No. 5) are estimates based on avidity affect.
[00106] Labeling of His6 (SEQ ID NO: 7)-tagged Polypeptides with the fac- [99mTc(CO)3]+ core was accomplished using modifications to a previously published procedure (Waibel, R. ; et al., A. Nat. Biotechnol. 1999, 17, 897.). Briefly, Na[99mTc04] in saline (4 mCi, 2 mL) was added to an Isolink® boranocarbonate kit (Alberto, R. et al, J. Am. Chem. Soc. 2001, 123, 3135.). The resulting solution was heated to 95 °C for 15-20 minutes, to give fac-[99mTc(CO)3(H20)3]+. A portion (2 mCi, 1 mL) of the solution was removed and neutralized to pH ~7 with 1 N HC1. A 325 μL· aliquot was removed and added to a solution of the His6-Polypeptide (SEQ ID NO: 7) (40 μg). The resulting solution was heated in a water bath at 35-37°C for 40 minutes. Typical radiochemical yields ranged from 80-95% (determined by ITLC- SG, Biodex, 0.9% NaCl). The crude reaction products were chromatographed on a NAP-5 column (GE Healthcare, 10 mM PBS) to give products of >99% radiochemical purity. Typical specific activities obtained were 3-4 μCi/μg. The resulting solution was then diluted with 10 mM PBS to give the proper concentration for subsequent biodistribution studies.
[00107] HPLC was carried out on an Agilent 1100 series HPLC equipped with a Grace- Vydac Peptide/Protein C4 (4.6 x 250 mm) column and a Raytest GABI radioactivity detector. Solvent A was 95:5 watenMeCN with 0.1% TFA, and solvent
B was 5:95 watenMeCN with 0.1% TFA. The gradient was as follows (all changes linear; time/%B): 0/0, 4/20, 16/60, 20/100, 25/100, 26/0, 31/0.
[00108] Each polypeptide was labeled with the tricarbonyltechnetium core in high yield (>90%) before purification. Purification by NAP-5 chromatography gave samples of 99mTc-labeled Polypeptides in >99% radiochemical purity (Table 4)
Table 4
[00109] Representative HPLC chromatograms of NAP-5 purified radiolabeled polypeptides are shown in FIG. 4. The retention time of the radiolabeled species was virtually unchanged from the corresponding unlabeled polypeptide's retention time in a 220 nm UV chromatogram (except for the time difference due to the physical separation of the UV and gamma detectors; data not shown).
Animal Models used to study WmTc(CO)3(His6)-Polypeptides ('His6' disclosed as SEQ ID NO: 7)
[00110] In vivo studies were carried out with female CD-I nude mice (Charles River Labs, Hopkinton, MA) with an age range between 6 and 15 weeks. Mice were housed in a ventilated rack with food and water ad libitum and a standard 12 hour day-night lighting cycle. For xenografts, animals were injected with 100 μΐ of cells in PBS. Cells were implanted subcutaneously in the right hindquarter. Implantation was performed under isoflurane anesthesia. For SKOV3, between 3 x 106 to 4 x 106 cells were implanted in each mouse. Under these conditions, useable tumors (100 to 300 μg) were obtained in 3 to 4 weeks in greater than 80% of animals injected.
Biodistribution
[00111] Mice were given tail-vein injections of ~1 μg of 99mTc-labeled polypeptides (~3 μθ/l μg). Mice were placed in filter-paper lined cages until euthanasia. Three mice were euthanized at each timepoint and tissues of interest dissected and counted on a Perkin Elmer Wallac Wizard 1480 Gamma Counter. Data were collected for blood, kidney, liver, spleen, and injection site (tail). Urine from cages was pooled
with the bladder and also counted. The remaining tissues were counted and the sum of all tissues plus urine for each animal was summed to provide the total injected dose. The % injected dose for each organ was determined based on this total, and organs were weighed for determination of the % injected dose per gram, (%ID/g). Data is reported as mean value for all three mice in the timepoint with error bars representing the standard deviation of the group.
[00112] The 99mTc labeled Z00477 (SEQ. ID No. 4) polypeptide was injected into SKOV3 mice. FIG. 6 shows the tumor and blood curves for these experiments. The Z00477 (SEQ. ID No. 4) polypeptide shows good tumor uptake in target-expressing SKOV3 tumors, with a maximal value of approximately 3% of the injected dose per gram of tissue at 30 minutes post- injection (PI), and a peak tumor: blood ratio of more than 8 at 240 minutes PI.
[00113] Polypeptides exhibit a monoexponential clearance from the blood with half-lives of less than two minutes. This clearance is primarily mediated by the liver and kidneys. Polypeptide uptake in the spleen was moderate, and moderate to high uptake in the liver is observed, as described in Table 5.
Table 5. Z00477 (SEQ. ID No. 3) His6 (SEQ ID NO: 7)tagged uptake (%ID/g) in SKOV3 tumor bearing mice
[00114] Bivalent polypeptides exhibit higher affinity than the corresponding monomers, presumably due to the avidity effect. Their larger size, however, may hinder tumor penetration. For the HER2 polypeptides, bivalent forms of each the four high affinity polypeptides were available. The Z00477 (SEQ. ID No. 3) dimer, (Z00477)2 (SEQ. ID No. 5), was radiolabeled and used for a four-hour biodistribution experiment in SKOV3-tumored mice.
[00115] The monovalent and bivalent polypeptides otherwise exhibit similar biodistribution characteristics, and blood half-lives are observed for both in the one to two minute range. The results clearly indicate that both monomeric and divalent polypeptides can be targeted to HER2 in vivo.
[00116] To introduce the 99mTc chelator cPN216 (FIG. 7), a bifunctional compound Mal-cPN216 was synthesized comprising of a thiol-reactive maleimide group for conjugation to a terminal cysteine of a polypeptide and an amine oxime group for chelating 99mTc.
[00117] cPN216-amine was obtained from GE Healthcare. Ν-β- maleimidopropionic acid was purchased from Pierce Technologies (Rockford, IL). N- methylmorpholine, (benzotriazol- 1 -yloxy) tripyrrolidinophosphonium hexafluorophosphate (PyBoP), dithiothreitol (DTT), ammonium bicarbonate, and anhydrous DMF were purchased from Aldrich (Milwaukee, WI). PBS buffer (lx, pH 7.4) was obtained from Invitrogen (Carlsbad, CA). HPLC-grade acetonitrile (CH3CN), HPLC-grade trifluoroacetic acid (TFA), and Millipore 18 ιηΩ water were used for HPLC purifications.
[00118] Example 1.
[00119] To an ice-cooled solution of Ν-β-maleimidopropionic acid (108 mg, 0.64 mmol), cPN216-amine (200 mg, 0.58 mmol), and PyBoP (333 mg, 0.64 mmol) in anhydrous DMF at 0 °C was added 0.4 M of N-methylmorpholine in DMF (128 μί, 1.16 mmol). The ice bath was removed after 2 hrs, and the mixture was stirred at room temperature overnight before being subjected to HPLC purification. The product Mal-cPN216 was obtained as a white powder (230 mg, 80% yield). IH-NMR (400MHz, DMSO-d6): δ 1.35 (m, 2 H), 1.43 (s, 12 H), 1.56 (m, 5 H), 1.85 (s, 6 H), 2.33 (dd, Jl = 8 Hz, J2 = 4 Hz, 2 H), 2.78 (m, 4 H), 3.04 (m, 2 H), 3.61 (dd, Jl = 8 Hz, J2 = 4 Hz, 2 H), 7.02 (s, 2 H), 8.02 (s, 1 H), 8.68 (s, 4 H), 11.26 (s, 2 H); m/z = 495.2 for [M+H]+ (C24H43N605, Calculated MW = 495.3).
[00120] The polypeptide Z00477 (SEQ ID No. 3)was dissolved with freshly degassed PBS buffer (lx, pH 7.4) at a concentration of approximately 1 mg/mL. The disulfide linkage in the polypeptide was reduced by the addition of DTT solution in freshly degassed PBS buffer (lx, pH 7.4). The final concentration of DTT was 20
mM. The reaction mixture was vortexed for 2 hours and passed through a Zeba desalt spin column (Pierce Technologies) pre-equilibrated with degassed PBS buffer (lx, pH 7.4) to remove excess of DTT reagent. The eluted reduced polypeptide molecule was collected, and the bifunctional compound Mal-cPN216 was added (20 equivalents per equivalent of the polypeptide) as a solution in DMSO, and the mixture was vortexed at room temperature for 3 hours and frozen with liquid-nitrogen. The reaction mixture was stored overnight before being subject to Reverse phase HPLC purification (FIGs. 8 A and 8B).
[00121] The HPLC purification was performed on a MiCHROM Magic C18AQ 5 μ 200A column (MiChrom Bioresources, Auburn, CA). Solvent A: H20 (with 0.1% formic acid), Solvent B: CH3CN (with 0.1% formic acid). Gradient: 5-100% B over 30 mins.
[00122] The fractions containing desired product were combined and neutralized with 100 mM ammonium bicarbonate solution, and the solvents were removed by lyophilization to give the desired imaging agent composition as a white solid (yield 41%).
[00123] LC-MS analysis of the purified product confirmed the presence of the desired product, and the MW suggested that only one cPN216 label was added to polypeptide constructs (Z00477 (SEQ. ID No. 3)-cPN216: calculated MW: 7429 Da, found: 7429 Da; Z02891 (SEQ. ID No. 2) -cPN216 calculated MW: 7524 Da, found: 7524 Da).
[00124] Example 2.
[00125] To a 20 mL vial was added 10.00 mL of distilled, deionized water. Nitrogen gas was bubbled through this solution for approximately 30 minutes prior to addition of the NaHC03 (450 mg, 5.36xl0"3 mol), Na2C03 (60 mg, 5.66xl0"4 mol) and sodium para-aminobenzoate (20 mg, 1.26xl0"4 mol). All reagents were weighed independently and added to the vial containing water. Tin chloride (1.6 mg, 7.09xl0"6 mol) and MDP (2.5 mg, 1.42xl0"5 mol) were weighed together into a 1 dram vial and subsequently transferred (with 1 subsequent wash) by rapid suspension in approximately 1 mL of the carbonate buffer mixture. 10 aliquots were removed and transferred under a stream of nitrogen to silanized vials, immediately frozen and
maintained in a liquid nitrogen bath until lyophilization. Each vial was partially capped with rubber septa and placed in a tray lyophilizer overnight. Vials were sealed under vacuum, removed from the lyophilizer, crimp-sealed with aluminum caps, re- pressurized with anhydrous nitrogen and stored in a freezer until future use.
[00126] Example 3.
[00127] Synthesis of the radiolabeled polypeptide was performed using a one-step kit formulation produced in house (Chelakit A+) containing a lyophilized mixture of stannous chloride as a reducing agent for technetium, methylene diphosphonic acid, p-aminobenzoate as a free-radical scavenger and sodium bicarbonate/sodium carbonate (pH 9.2) as buffer. In rapid succession, 20 of a 2 μg/μL solution of polypeptide in saline was added to the Chelakit, followed immediately by Na99mTcC>4 (0.8 mCi, 29.6 MBq) in 0.080 mL of saline (0.15M NaCl) obtained from Cardinal Health (Albany, NY). The mixture was agitated once and allowed to sit at ambient temperature for 20 min. Upon completion, the crude radiochemical yield was determined by ITLC (Table 6 below according to ITLC-SG, Biodex, 0.9% NaCl).
Table 6
[00128] The reaction volume was increased to 0.45 mL with 0.35 mL of 150 mM sterile NaCl, and the final product purified by size exclusion chromatography (NAP5, GE Healthcare, charged with 10 mM PBS). The crude reaction mixture was loaded onto the NAP5 column, allowed to enter the gel bed and the final purified product isolated after elution with 0.8 mL of 10 mL PBS. Final activity was assayed in a standard dose calibrator (CRC-15R, Capintec, Ramsey, NJ). Radiochemical yield (Table6) and purity were determined by ITLC (>98.5%), C4 RP-HPLC (FIG. 9) and SEC-HPLC analysis. The final product (10-15μΟ/μ , 0.2 - 0.5 μθ/μΐ, (0.37MBq^g, 7.4MBq/mL)) was used immediately for biodistribution studies.
[00129] The HPLC conditions used for this experiment were as follows: C4 RP- HPLC method 1 : Solvent A: 95/5 H20/CH3CN (with 0.05% TFA), Solvent B: 95/5 CH3CN/ddH20 (distilled, deionized water) with 0.05% TFA. Gradient elution: 0 min. 0%B, 4 min. 20%B, 16min. 60%B, 20 min. 100%B, 25 min. 100%B, 26 min. 0%B, 31 min. 0%B.
[00130] C4 RP-HPLC method 2: Solvent A: 0.06% NH3 in water, Solvent B: CH3CN. Gradient elution: 0 min. 0%B, 4 min. 20%B, 16min. 60%B, 20 min. 100%B, 25 min. 100%B, 26 min. 0%B, 31 min. 0%B.
[0131] RP-HPLC analysis performed on an HP Agilent 1100 with a G1311A QuatPump, G1313A autoinjector with ΙΟΟμί syringe and 2.0mL seat capillary, Grace Vydac - protein C4 column (S/N E050929-2-1, 4.6 mmxl50 mm), G1316A column heater, G1315A DAD and Ramon Star - GABI gamma-detector.
[0132] SEC HPLC: Solvent: lx (10 mM) PBS (Gibco, Invitrogen, pH 7.4 containing CaCl2 and MgCl2). Isocratic elution for 30 min. Analysis performed on a: Perkin Elmer SEC-4 Solvent Environmental control, Series 410 LC pump, ISS 200 Advanced LC sample processor and Series 200 Diode Array Detector. A Raytest GABI with Socket 8103 0111 pinhole (0.7 mm inner diameter with 250 μL· volume) flow cell gamma detector was interfaced through a Perkin Elmer NCI 900 Network Chromatography Interface. The column used was a Superdex 75 10/300 GL High Performance SEC column (GE Healthcare, code: 17-5174-01, ID no. 0639059).
[0133] The operating pH of the Chelakits used to incorporate 99mTc into the cPN216 chelate (pH = 9.2) nearly matched the calculated pi of the Z00477 (SEQ. ID No. 3) polypeptide. Labeling under these conditions were determined to cause aggregation in the final product (FIGs. 5A and 5B). Aggregation was confirmed by size exclusion HPLC and through the increased blood residence time and liver uptake observed in the biodistribution studies. By altering the isoelectric point of the polypeptide, 99mTc was successfully incorporated onto the Z02891 (SEQ. ID No. 2) construct. Size exclusion HPLC confirmed the presence of a species with the appropriate molecular weight and biodistribution studies showed uptake of the tracer into the tumor xenografts.
[0134] In vivo studies were carried out with female CD-I nude mice (Charles River Labs, Hopkinton, MA) with an age range between 6 and 15 weeks. Mice were housed in a ventilated rack with food and water ad libitum and a standard 12 hours day-night lighting cycle. For xenografts, animals were injected with 100 μΐ of cells in PBS. Cells were implanted subcutaneously in the right hindquarter. Implantation was performed under isoflurane anesthesia. For SKOV3, between 3 x 106 to 4 x 106 cells were implanted in each mouse. Under these conditions, useable tumors (100 to 300 μg) were obtained in 3 to 4 weeks in greater than 80% of animals injected.
[0135] Mice were given tail-vein injections of ~1 ug of 99mTc-labeled polypeptides (-10 μ^Ι μg). Mice were placed in filter-paper lined cages until euthanasia. Three mice were euthanized at each timepoint and tissues of interest dissected and counted on a Perkin Elmer Wallac Wizard 1480 Gamma Counter. Data were collected for blood, kidney, liver, spleen, and injection site (tail). Urine from cages was pooled with the bladder and also counted. The remaining tissues were counted and the sum of all tissues plus urine for each animal was summed to provide the total injected dose. The % injected dose for each organ was determined based on this total, and organs were weighed for determination of the % injected dose per gram, (%ID/g). Data is reported as mean value for all four to five mice in the time point with error bars representing the standard deviation of the group. Four time points were taken over four hours (5, 30,120, and 240 minutes post-injection).
[0136] The Z02891 (SEQ. ID No. 2) -cPN216-99mTc polypeptide shows strong tumor uptake in target-expressing SKOV3 tumors, with a value of 7.11 ± 1.69% (n=5) of the injected dose per gram of tissue at 30 minutes post-injection (PI), which remains fairly constant over the time-course of the study up to 240 min PI. Tumor: blood ratios were 2, 5, and 5 at 30, 120, and 240 min post injection, respectively. FIG. 10, 11 and 12 show the tumor, blood and tumor: blood curves for these experiments.
[0137] The Polypeptides exhibit a monoexponential clearance from the blood with half-lives of less than two minutes. This clearance is primarily mediated by the kidneys, with 10.58 ± 2.96 (n=5) ID/organ at 240 min post-injection PI. Activity is secreted primarily in the urine. Polypeptide uptake in the spleen was moderate to
high due to possible aggregation, and moderate uptake in the liver is observed, e.g., 12 %ID/organ (equivalent in value in mice to %ID/g) over the course of the study.
Biodistribution results for Z02891 (SEP. ID No. 2)-cPN216-99mTc
Table 7. Z02891 (SEQ. ID No. 2) cPN216 uptake (%ID/g) in SKOV3 tumor bearing mice
[0138] Example 4.
[0139] Z00477 (SEQ. ID. NO. 4), Z00342 (SEQ. ID No. 1) and Z02891 (SEQ. ID No. 2)-cysteine polypeptides were functionalized with an aminoxy group via an engineered C-terminal cysteine. The purity of the polypeptide molecules provided was determined to be >95% by High Performance Liquid Chromatography (HPLC).
[0140] Example 5.
[0141] To incorporate 18F into the Polypeptide molecules, a bifunctional linker Mal-aminooxy was synthesized comprising of two orthogonal groups: a thiol-reactive maleimide group for conjugation to the engineered cysteine and an aldehyde-reactive aminoxy group (FIGs. 13 A and 13B). This linker was prepared by reacting N-(2- aminoethyl) malemide with 2-(tert-butoxycarbonylaminooxy) acetic acid using 1- ethyl-3-[3-dimethylaminopropyl] carbodiimide (EDC) -mediated coupling conditions yielding the Boc-protected form of the linker. The Boc protecting group was then de- protected by acid cleavage to give the final Mai- AO product in quantitative yield. The final product was used directly without further purification.
[0142] General
[0143] Dichloromethane, 2-(tert-butoxycarbonylaminooxy) acetic acid, triethylamine, N-(2-aminoethyl)maleimide trifluoroacetic acid (TFA) salt, N- hydroxybenzotriazole hydrate (HOBT), l-ethyl-3-[3- dimethylaminopropyljcarbodiimide (EDC), dithiothriotol (DTT), and all other standard synthesis reagents were purchased from Sigma-Aldrich Chemical Co. (St. Louis, MO). All chemicals were used without further purification. PBS buffer (lx, pH 7.4) was obtained from Invitrogen (Carlsbad, CA). HPLC-grade ethyl acetate, hexanes, acetonitrile (CH3CN), trifluoroacetic acid (TFA), and Millipore 18 ιηΩ water were used for purifications.
[0144] Example 6.
[0145] To a solution of 2-(tert-butoxycarbonylaminooxy)acetic acid (382 mg, 2 mmol) in anhydrous dichloromethane (20 mL) was added sequentially triethylamine (307 μL, 2.2 mmol), N-(2-aminoethyl)maleimide-TFA salt (508 mg, 2 mmol), HOBT(306 mg, 2 mmol), and EDC (420 mg, 2.2 mmol). After being stirred for 24 hrs at room temperature, the reaction mixture was diluted with ethyl acetate (50 mL) and washed with saturated sodium bicarbonate solution (3 x 30 mL), water (30 mL), and brine (30 mL). The organic layer was dried over anhydrous magnesium sulfate and filtered. The filtrate was concentrated to a pale yellow solid, which was purified by column chromatography (70% ethyl acetate in hexanes) to give the product as a white powder (500 mg, 80% yield). 'H-NMR (400MHZ, CDCI3): δ 1.50 (s, 9 H), 3.55 (tt, Jl= 6.0 Hz, J2= 6.5 Hz, 2 H), 3.77 (dd, J= 7.6 Hz, 2 H), 4.30 (s, 2 H), 6.3 (s, 2 H).
[0146] Example 7.
[0147] A solution of 9.3 mg of Mal-AO-Boc in 1 mL of 3M HC1 in methanol was stirred at room temperature for 18 hours. Solvents were removed under vacuum to yield Mal-AO as a light yellow solid. (80% yield). *H-NMR (400MHZ, DMSO-d6): δ 3.27 CH2 (t, J= 4.0 Hz, 2H), 3.49 CH2 (t, J= 4.0 Hz, 2H), 4.39 CH20 (s, 2H), 7.00 CH=CH (s, 2H); m/z = 214.07 for [M+H]+ (C8H12N304, Calculated MW = 214.11) )
[0148] Example 8.
[0149] The polypeptide (Z00477(SEQ ID No. 4), Z00342 (SEQ ID No. 1) Z02891 (SEQ ID. No. 2)) was dissolved with freshly degassed PBS buffer (lx,
7.4) at a concentration of approximately 1 mg/mL. The disulfide linkage in the polypeptide was reduced by the addition of dithiothreitol (DTT) solution in freshly degassed PBS buffer (lx, pH 7.4). The final concentration of DTT is 20 mM. The reaction mixture was vortexed for 2 hours and eluted through a Zeba desalt spin column (Pierce Technologies) pre-equilibrated with degassed PBS buffer to remove excess of DTT reagent. The reduced polypeptide was collected, and the bifunctional Mai- AO compound was added (15 equivalents per equivalent of the polypeptide) as a solution in DMSO. After being vortexed at room temperature overnight, the reaction mixture was purified with High Performance Liquid Chromatography (HPLC) (FIGs. 14A and 14B).
[0150] The HPLC purification was performed on a MiCHROM Magic C18AQ 5μ 200A column (MiChrom Bioresources, Auburn, CA). Solvent A: H20 (with 0.1% formic acid), Solvent B: CH3CN (with 0.1% formic acid). Gradient: 5-100% B over 30 mins. The fractions containing desired product was combined and neutralized with 100 mM ammonium bicarbonate solution, and the solvents were removed by lyophilization to give the aminoxy-modified polypeptide as a white solid.
[0151] ESI-TOF-MS analysis confirmed the presence of target product with the expected molecular weights (calculated MW: 6964 Da, 8531 Da, and 7243 Da, found: 6963 Da, 8532 Da, and 7244 Da for Z00477 (SEQ. ID No. 4)-ONH2, Z00342 (SEQ. ID No. l)-ONH2, and Z02891 (SEQ. ID No. 2) -ONH2, respectively.
[0152] Example 9. Preparation of 18FBA.
[0153] Methods: All reactions were performed either under a nitrogen atmosphere or in a crimp-top sealed vial purged with nitrogen prior to use. Kryptofix 222 (Aldrich) and K2C03 (EMD Science) were purchased and used as received. Optima™-grade acetonitrile was used as both HPLC and reaction solvents.
[0154] K18F (40mCi mL 1 (1480 MBq mL"1) in purified water) was obtained from IBA Molecular (Albany, NY) and PETNET Solutions (Albany, NY) and were used as received. The [18F~] fluoride was first immobilized on a Chromafix 30-PS-HCO3 anion exchange cartridge (ABX, Radeberg, Germany), then eluted into a drydown vessel with a 1 mL, 4:1 mixture of acetonitrile: distilled, deionized H20 (ddH20)
containing Kryptofix K222 (376 g.mol 1, 8 mg, 2.13xl0~5 mol) and potassium carbonate (138.2 g.mol"1, 2.1 mg, 1.52xl0~5 mol). The solvent was removed under partial vacuum and a flow of nitrogen with gentle heating (~ 45°C) (-15 min). The source vial and anion exchange cartridge were then washed with 0.5mL of acetonitrile containing K222 (8 mg) and the reaction mixture again brought to dryness under partial vacuum and gentle heating (- 10 min). The reaction vessel was repressurized with nitrogen and the azeotropic drydown repeated once with an additional 0.5mL of acetonitrile. 4-formyl-N,N,N-trimethylanilinium triflate (313.30 g'mol"1, 3.1 mg, 9.89X10"6 mol) was dissolved in 0.35 mL of anhydrous DMSO (Acros) and added directly to the reaction vessel containing the K18F K222, K2CO3. The reaction mixture was heated to 90°C for 15 min and immediately cooled and quenched with 3 mL of ddH20. This mixture was subsequently passed through a cation exchange cartridge (Waters SepPak Light Accell Plus CM), diluted to 10 mL with ddH20, and loaded onto a reverse phase C18 SepPak (Waters SepPak Plus CI 8). The SepPak was flushed with 10 mL of ddH20 then purged with 30 mL of air. [ 18 F]4-fluorobenzaldehyde (18FBA), was eluted in 1.0 mL of methanol.
[0155] Example 10.
[0156] Separately, a high recovery vial (2mL, National Scientific) was charged with either the Z00477-(SEQ. ID No. 3)-ONH2 (0.35-0.5mg), Z00342-(SEQ. ID No.l)-ONH2 (0.35-0.5mg) or Z02891-(SEQ. ID No. 2)-ONH2 (0.35-0.5mg). The solid was suspended in 25 μL· of ddH20 and 8 μL· of trifluoroacetic acid. 25 μL· of 18FBA in methanol (see Example 9) was transferred to the reaction vial. The vessel was capped, crimped, placed in a heating block and maintained at 60°C for 15 minutes; at which point a small aliquot (<5 μί) was removed for analytical HPLC analysis . 450 μL· of ddH20 with 0.1% TFA was used to dilute the solution to approx. 500 μL· in preparation for semi-preparative HPLC purification. 18FB-Polypeptide was isolated and purified by semi-preparative HPLC . The HPLC fraction containing the product (0.113 mCi/4.18MBq) was diluted 5:1 with ddH20 and subsequently immobilized on a tC18 Plus Sep Pak (Waters). The SepPak was flushed first with 5 mL of ddH20 then 30 mL of air. 18 FB-Polypeptide was isolated in a minimal amount of ethanol by first eluting the void volume (approx. 0.5mL) followed by collecting 250 to 300 μL· of eluent in a separate flask. RP-HPLC analysis was performed on the
isolated product in order to establish radiochemical and chemical purity. Typically, 10 μL of a 0.1 μCi/μL· solution was injected for post formulation analysis. Isolated radiochemical yields are indicated in Table 9 and are decay corrected from the addition of polypeptide to 18FBA and radiochemical purity of >99%. Alternatively,
18 F-labeled polypeptides were isolated by NAP5 size exclusion chromatography by diluting the reaction mixture to approximately 0.5mL with lOmM PBS and loading onto the gel. The 18F-labled polypeptides were isolated by eluting the column with 0.8 mL of lOmM PBS and used without further modification. These results are illustrated in Table 8, and FIG. 15.
Table 8
[0157] Analytical HPLC conditions used are as follows: Analysis performed on an HP Agilent 1100 with a G1311A QuatPump, G1313A autoinjector with ΙΟΟμΕ syringe and 2.0mL seat capillary, Phenomenex Gemini CI 8 column (4.6mmxl50mm), 5μ, 100A (S/N 420477-10), G1316A column heater, G1315A DAD and Ramon Star - GABI gamma-detector. 95:5 ddH20:CH3CN with 0.05% TFA, Solvent B: CH3CN with 0.05% TFA. Gradient elution (1.0 mL min 1): 0 min. 0%B, 1 min. 15%B, 21min. 50%B, 22 min. 100%B, 26 min. 100%B, 27 min. 0%B, 32 min. 0%B. or gradient elution (1.2 mL min"1): 0 min. 0%B, 1 min. 15%B, lOmin. 31%B, 10.5 min. 100%B, 13.5 min. 100%B, 14 min. 0%B, 17 min. 0%B.
[0158] Semipreparative HPLC conditions used are as follows: Purification was performed on a Jasco LC with a DG-2080-54 4-line Degasser, an MX-2080-32 Dynamic Mixer and two PU-2086 Plus Prep pumps, an AS-2055 Plus Intelligent autoinjector with large volume injection kit installed, a Phenomenex 5μ Luna CI 8(2) 100A, 250 x 10 mm, 5 μ column with guard (S/N 295860-1, P/N 00G-4252-N0), an MD-2055 PDA and a Carroll & Ramsey Associates Model 105S Analogue Ratemeter attached to a solid-state SiPIN photodiode gamma detector. Gradient elution: 0 min. 5%B, 32 min. 20%B, 43 min. 95%B, 46 min. 95%B, 49 min. 5%B, Solvent A: ddH20:CH3CN with 0.05% TFA, Solvent B: CH3CN with 0.05% TFA.
[0159] Example 11
[0160] In vivo studies were carried out with female CD-I nude mice (Charles River Labs, Hopkinton, MA) with an age range between 6 and 15 weeks. Mice were housed in a ventilated rack with food and water ad libitum and a standard 12 hour day-night lighting cycle. For xenografts, animals were injected with 100 μΐ of cells in PBS. Cells were implanted subcutaneously in the right hindquarter. Implantation was performed under isoflurane anesthesia. For SKOV3, between 3 x 106 to 4 x 106 cells were implanted in each mouse. Under these conditions, useable tumors (100 to 300 μg) were obtained in 3 to 4 weeks in greater than 80% of animals injected.
[0161] Mice were given tail- vein injections of ~1 ug of 18F-labeled polypeptide (~4 uCi/1 μg). Mice were placed in filter-paper lined cages until euthanasia. Three mice were euthanized at each timepoint and tissues of interest dissected and counted on a Perkin Elmer Wallac Wizard 1480 Gamma Counter. Data were collected for blood, kidney, liver, spleen, bone and injection site (tail). Urine from cages was pooled with the bladder and also counted. The remaining tissues were counted and the sum of all tissues plus urine for each animal was summed to provide the total injected dose. The percent injected dose for each organ was determined based on this total, and organs were weighed for determination of the percent injected dose per gram, (%ID/g). Data is reported as mean value for all three mice in the timepoint with error bars representing the standard deviation of the group.
[0162] The polypeptides underwent biodistribution studies in SKOV3 cell xenograft models. Four time points were taken over four hours (5, 30, 120, and 240 minutes post-injection). Complete biodistribution data are included in Table 12 (%ID/g Z02891 (SEQ. ID No. 2) -18F-fluorobenzyl oxime in SKOV3 Tumor Bearing Mice) and table 13 (%ID/g Z00342 (SEQ. ID No. 1) 18F-fluorobenzyl oxime in SKOV3 Tumor Bearing Mice). FIGs. 16, 17 and 18 show the tumor, blood, tumor: blood, and clearance curves for these tests.
[0163] The Z02891 (SEQ. ID No. 2) 18F-fluorobenzyl oxime polypeptide shows strong tumor uptake in target-expressing SKOV3 tumors, with a value of 17.47 ± 2.89 (n=3) of the injected dose per gram of tissue at 240 minutes post-injection (PI). Tumor: blood ratios were approximately 3, 34, and 128 at 30, 120, and 240 min post
injection, respectively. The Z00342 (SEQ. ID No. 1) F-fluorobenzyl oxime polypeptide shows strong tumor uptake in target-expressing SKOV3 tumors, with a value of 12.45 ± 2.52 (n=3) of the injected dose per gram of tissue at 240 minutes PI. Tumor: blood ratios were approximately 3, 32 and 53 at 30, 120 and 240 min post injection, respectively.
[0164] The polypeptides exhibit a monoexponential clearance from the blood with half-lives of less than two minutes. This clearance of Z02891 (SEQ. ID No. 2) is primarily mediated by the kidneys, with 0.95 ± 0.07 (n=3) ID/organ at 240 min PI. Activity is secreted primarily in the urine. Polypeptide uptake in the spleen was minimal, and low uptake in the liver is observed, ca. 1.8 %ID/organ (equivalent in value in mice to %ID/g) over the course of the study (four hours post injection).
Table 9. Z02891 (SEQ. ID No. 2) lsF-fluorobenzyl oxime uptake (%ID/g) in SKOV- 3 tumor bearing mice
Table 10. Z00342 (SEQ. ID No. 1) lsF-fluorobenzyl oxime uptake (%ID/g) in SKOV-3 tumor bearing mice
Blood 7.38± 0.72 (n=3) 1.76 ± 0.09 (n=3) 0.33 ± 0.08 (n=3) 0.87 ± 0.98 (n=3)
Tumor 2.54 ± 0.00 (n=2) 4.97 ± 3.14 (n=3) 10.30 ± 1.08 12.45 ± 2.52 (n=3)
(n=3)
Liver 8.29 ± 0.41 (n=3) 6.94 ± 0.92 (n=3) 2.54 ± 1.44 (n=3) 1.41 ± 0.35 (n=3)
Kidney 78.93 ± 2.93 (n=3) 30.94 ± 4.93 (n=3) 10.75 ± 2.17 4.91 ± 0.63 (n=3)
(n=3)
Spleen 3.85 ± 0.51 (n=3) 1.77 ± 0.34 (n=3) 0.47 ± 0.08 0.23 ± 0.05
(n=3) (n=3)
[0165] General,
[0166] All reactions are performed either under a nitrogen atmosphere or in a crimp-top sealed vial purged with nitrogen. Optima™-grade acetonitrile is used as both HPLC and reaction solvents.
[0167] Example 12.
[0168] [123I]4-iodobenzaldehyde (123I BA) is added to a high recovery vial (2 mL, National Scientific) containing the polypeptide-ONH2 (Z02891, SEQ. ID No. 2), 0.35-0.5mg). The reaction commences by dissolving the polypeptide in 25 μL· of ddH20 and adding 8 of trifluoroacetic acid followed by the addition of 123
μL· IIBA in methanol. The vessel is capped, crimped, placed in a heating block and maintained at 60°C for 15 minutes; removing a small aliquot (<5 μί) for analytical HPLC analysis is done to assess the status of the reaction. The reaction mixture is diluted to a minimum 1: 1 mixture of ddH20: Acetonitrile mixture containing 0.1% TFA in preparation for semi-preparative HPLC purification. 123 IB -Polypeptide is isolated and purified by semi-preparative HPLC or NAP5 size exclusion chromatography. The HPLC fraction containing the product is further diluted (5:1) with ddH20 and subsequently immobilized on a tC18 Plus Sep Pak (Waters). Flushing the SepPak first with 5 mL of ddH20 then 30 mL of air gives the 123 IB -Polypeptide in a minimal amount of ethanol by first eluting the void volume (approx. 0.5mL) followed by collecting 250 to 300 μL· of eluent in a separate flask. RP-HPLC analysis is performed on the isolated product to establish radiochemical and chemical purity.
[0169] Example 13. Preparation of 67Ga-NOTA-Z00477 (SEP ID No. 3)
[0170] Polypeptide Z00477 (SEQ. ID 3) was labeled with Ga, specifically b/Ga, after a NOTA (l,4,7-triazacyclononane-N,N',N"-triacetic acid) chelator was conjugated to the polypeptide. (Fig. 19)
[0171] Bioconjugation of Mal-NOTA to polypeptide molecules was accomplished as follows. The polypeptide was dissolved with freshly degassed PBS buffer (lx, pH 7.4) at a concentration of approximately 1 mg/mL. The disulfide linkage in the polypeptide was reduced by the addition of DTT solution in freshly degassed PBS buffer (lx, pH 7.4). The final concentration of DTT was 20 mM. The reaction mixture was vortexed for 2 hours and passed through a Zeba desalt spin column (Pierce Technologies) pre-equilibrated with degassed PBS buffer (lx, pH 7.4) to remove excess of DTT reagent. The eluted reduced polypeptide molecule was collected, and the bifunctional compound mal-NOTA was added (15 equivalents per equivalent of the polypeptide) as a solution in DMSO, and the mixture was vortexed at room temperature. The reaction was allowed to proceed overnight to ensure the complete conversion of the polypeptide molecules.
[0172] The HPLC purification was performed on a MiCHROM Magic C18AQ 5μ 200A column (MiChrom Bioresources, Auburn, CA). Solvent A: H20 (with 0.1% formic acid), Solvent B: CH3CN (with 0.1% formic acid). Gradient: 5-100% B over 30 mins. (Fig. 20A)
[0173] The fractions containing desired product were combined and neutralized with 100 mM ammonium bicarbonate solution, and the solvents were removed by lyophilization to give the conjugated polypeptide as a white solid.
[0174] LC-MS analysis of the purified product confirmed the presence of the desired product, and the MW suggested that only one NOTA chelator was added to the polypeptide construct (calculated MW: 7504 Da, found: 7506 Da for Z00477 (SEQ. ID No. 3)-NOTA). (Fig. 20B)
[0175] Radiolabeling was subsequently accomplished as follows: 25μ1 HEPES solution (63mM) was initially added to a screw top vial followed by ΙΟμΙ 67GaCl3 (GE Healthcare) in 40.5 MBq of 0.04M HC1. 30 μg (MW = 7506, 4.0xl0"9 mol) of
the NOTA Z00477 (SEQ. ID No. 3) in 30 μΐ H20 was then added to the reaction mixture to give a final NOTA Z00477 (SEQ. ID No. 3) concentration of 61 μΜ with a pH of 3.5-4.0. The reaction vial was sealed and the reaction maintained at ambient temperature. Reverse phase HPLC analysis of the crude reaction mixture determined the radiochemical purity of the 67Ga-NOTA Z00477 (SEQ. ID No. 3) was determined to be 95% by HPLC after 2 hours at room temperature. (Fig. 21) The 67Ga-NOTA Z00477 (SEQ. ID No. 3) was purified by HPLC after a reaction time of 1 day. 22MB q of 67Ga-NOTA Z00477 (SEQ. ID No. 3) was injected onto the HPLC for the purification. 15MBq of the 67 Ga labeled product was obtained from the purification (radiochemical yield = 68%). HPLC solvents were removed under vacuum to give a solution with an approximate volume of 0.5 mL. Approximately 1.45 mL of Dulbecco's phosphate buffered saline was then added to give a final solution at pH 6- 6.5 with a radioactivity concentration of 7.7 MBq/mL. Purified, formulated 67Ga- NOTA Z00477 (SEQ. ID No. 3) was found to be stable for at least 2 hr at room temperature. (RCP = 96% by HPLC) (Fig. 22).
[0176] Analytical HPLC conditions used are as follows: A Grace Vydac C4 protein 5 micron, 300A, 4.6 x 250 mm HPLC column. Solvent A = 95/5 H20 / MeCN in 0.05% trifluoroacetic acid (TFA) Solvent B = 95/5 CH3CN / H20 in 0.05% TFA. HPLC gradient (Min/%B): 0/0, 4/20, 16/60, 20/100, 25/100, 26/0.
[0177] Semi-preparative HPLC conditions used are as follows: Column: Grace Vydac C4 protein 5 micron, 300A, 4.6 x 250 mm. Solvent A = 95/5 H20 / MeCN in 0.05% trifluoroacetic acid (TFA) Solvent B = 95/5 CH3CN / H20 in 0.05% TFA. HPLC gradient (Min/%B): 0/0, 4/20, 16/60, 20/100, 25/100, 26/0.
[0178] General
[0179] Recombinant HER2 Z28921-Cys was purchased from Affibody AB, Sweden, Eei-aminooxyacetic acid succinic ester from IRIS Biotech, and di-tert- butyldifluorosilane was purchased from Fluorochem. Reagents and solvents were purchased from IRIS Biotech, Merck, Romil and Fluka.
[0180] Analytical LC-MS spectra were recorded on a Thermo Finnigan MSQ instrument by electrospray ionisation (ESI) operated in positive mode coupled to a Thermo Finnigan Surveyor PDA chromatography system using the following conditions: Solvent A = H2O/0.1% TFA and solvent B = ACN/0.1% TFA if not
otherwise stated, flow rate: 0.6 mL/min, column: Phenomenex Luna 3 μιη C18 (2) 20 x 2 mm, detection: UV 214/254 nm.
[0181] Semi-preparative reversed-phase HPLC runs were performed on a Beckman System Gold chromatography system using the following conditions: Solvent A = H2O/0.1 % TFA and solvent B = ACN/0.1 % TFA if not otherwise stated, flow rate: 10 mL/min, column: Phenomenex Luna 5 μιη C18 (2) 250 x 21.2 mm, detection: UV 214 nm.
[0182] Preparative reversed-phase HPLC runs were performed on a Waters Prep 4000 system using the following conditions: Solvent A = H2O/0.1% TFA and solvent B = ACN/0.1 % TFA if not otherwise stated, flow rate: 50 mL/min, column: Phenomenex Luna 10μ C18 (2) 250 x 50 mm, detection: UV 214/254 nm.
0183] Abbreviations:
0184] Ala (A): Alanine
0185] Arg (R): Arginine
0186] Asn (N): Asparagine
0187] Asp (D): Aspartic acid
0188] ACN: Acetonitrile
0189] Boc: tert-Butyloxycarbonyl
0190] Cys (C): Cysteine
0191] DIPEA: Diisopropylethylamine
0192] DMF: N,N-Dimethylformamide
0193] DMAB: 4-dimethylamino-benzaldehyde
0194] DOTA: l ,4,7,10-tetraazacyclododecane-l,4,7,10-tetraacetic acid
0195] EDT: 1 ,2-Ethanedithiol
0196] EMS: Ethyl methyl sulphide
0197] ESI: Electrospray ionisation
0198] eq: Equivalent
[0199] FBA: 4-Fluorohenzaldehyde
[0200] Gin (Q): Glutamine
[0201] Glu (E): Glutamic acid
[0202] hr(s): Hour(s)
[0203] HER2: Human Epidermal growth factor receptor
[0204] HO At: 1 -Hydroxy-7-azabenzotriazole
[0205] HPLC: High performance liquid chromatography
[0206] lie (I): Isoleucine
[0207] LC-MS: Liquid chromatography - mass spectroscopy
[0208] Leu (L): Leucine
[0209] Lys (K): Lysine
[0210] Met (M): Methionine
[0211] min: Minutes
[0212] μιη: Micrometre
[0213] mii: Nanometre
[0214] NMP: 1 -Methyl-2-pyrrolidinone
[0215] NOTA: 1 ,4,7-Triazacyclononane- 1 ,4,7-triacetic Acid
[0216] PDA: Photodiode array
[0217] PET: Positron emission tomography
[0218] Phe (F): Phenylalanine
[0219] Pro (P): Proline
[0220] PyAOP: (7-Azahenzotriazol- l-yloxy)tripyrrolidinophosphonium hexafluorophosphate
[0221] Ser (S): Serine
[0222] SiFA: 4-(Di-tert-butylfluorosilyl)benzaldehyde
[0223] TFA: Trifluoroacetic acid
[0224] Thr (T): Threonine
[0225] TIS: Triisopropylsilane
[0226] Trp (W): Tryptophan
[0227] Tyr (Y): Tyrosine
[0228] Val (V): Valine
[0229] Example 14. Semi-automated radiosynthesis of Compound 2
[0230] A FASTlabTM platform (GE Healthcare) was used to prepare [18F]Fluorobenzaldehyde ("[18FJFBA") yielding typically 7 GBq of [18FJFBA in ethanol (1.5 mL, non-decay corrected yields 12-54%). A small fraction (92 μί) of this [18FJFBA solution was then manually conjugated to the aminoxy precursor 3 (0.4 mg, 55 nmol) in the presence of aniline hydrochloride (3.2 mg, 25 μιηοΐ) in water (138 μί) in a silanised P6 vial. The mixture was heated at 70°C for 20 minutes using a Peltier heater. 2 was isolated via size exclusion chromatography (NAP5 cartridge, GE Healthcare). An initial elution with 0.25 mL saline/0.1 % sodium ascorbate was discarded. A subsequent 0.75 mL saline/0.1 % sodium ascorbate elution containing 2 was collected and formulated with the same elution mixture at pH 5-5.5 to give the desired radioactive concentration. Non-decay corrected yields of the isolated 2 from the conjugation step were 17-38%, and the radiochemical purity (RCP) values for the manually prepared 2 were > 95%. (TLC system: Perkin Elmer Instant Imager using C18 reversed-phase sheets with water/30 % acetonitrile (v/v) as mobile phase. The labelled peptide remained at the origin.). The product was further analysed by HPLC using a Gilson 322 pump with a Gilson UV/ViS 156 detector, a Bioscan Flow-Count radioactivity detector, and a Luna C18 Phenomenex column (50 x 4.6 mm, 3 μιη) or a Luna C18 Phenomenex column (150 x 4.6 mm, 5 μιη). The mobile phase comprised
of solvents A (0.1 M ammonium acetate) and B (acetonitrile) running at 1 mL/min with a linear gradient (5-95 % B in 15 min). The UV absorbance was measured at 280 and 350 nm. FIG. 23 shows a representative example of an analytical HPLC trace of the formulation of 2.
[0231] Example 14a. Preparation of Compound 3 [0232] (i) Preparation of Eei-aminooxyacetyl-maleimide
[0233]
[0234] N-(2-Aminoethyl)maleimide TFA salt (51 mg, 0.20 mmol) and Eei-AOAc- OSu (77 mg, 0.30 mmol) were dissolved in NMP (2 mL). Sym.-collidine (80 μί, 0.6 mmol) was added and the reaction mixture stirred for 70 min. The reaction mixture was diluted with water (7 mL) and the product, eei-aminooxyacetyl-maleimide, purified by semi -preparative HPLC. Purification using semi-preparative HPLC (gradient: 15-30% B over 40 min where A = water/0.1 % acetic acid and B = ACN) affording 43 mg (75%) pure Eei-aminooxyacetyl-maleimide. The purified material, eei-aminooxyacetyl-maleimide, was characterised by LC-MS (gradient: 10-40% B over 5): tR: 1.93 min, found m/z: 284.1, expected MH+: 284.1
[0235] (ii) Preparation of Compound 3
[0236] Recombinant Z02891-Cys (144 mg, 0.205 mmol)(purchased from Affibody AB, Sweden) and eei-aminooxyacetyl-maleimide (17 mg, 0.60 mmol) were dissolved in water (3 mL). The solution was adjusted to pH 6 by addition of ammonium acetate and the reaction mixture shaken for 90 min. The reaction mixture was diluted with water (7 mL) and the product purified by semi-prep HPLC affording 126 mg lyophilised Eei-protected product. The eei-protected product was treated with 2.5% TF A/water (16 mL) under a blanket of argon for 20 min. The solution was diluted with water (144 mL), frozen using isopropanol/dry-ice bath under a blanket of argon and lyophilised affording 149 mg (100%) Z02891-Cys-maleimide-aminooxyacetyl (3). Lyophilised Z02891-Cys-maleimide-aminooxyacetyl (3) was analysed by analytical LC-MS (gradient: 10-40% B over 5 min, tR: 3.28 min, found m/z: 1811.8, expected MH4 4+: 1811.4
[0237] Example 15. Automated radiosynthesis of Compound 2 using tC2 SepPak purification
[0238] A FASTlabTM cassette was assembled containing a first vial (8.25 mg/21.9 μιηοΐ Kryptofix, 1.16 mg/8.4 μmol K2CO3, 165 μL· water, 660 μL· acetonitrile), a second vial (1.5 mg/4.8 μmol triflate 1, 1.5 mL anhydrous DMSO), a third vial (5.5 mg/0.76 μιηοΐ 3, 8.2 mg/63 μιηοΐ aniline hydrochloride, 0.7 mL ammonium acetate buffer pH 4.5/0.25 M), a fourth vial (4 mL, 4 % w/v aqueous ammonia), external vials of ethanol (25 mL) and phosphoric acid (1 % w/w, 25 mL), a pre-conditioned QMA light SepPak cartridge, an OASIS MCX SepPak cartridge, and two lC2 SepPak cartridges. The product vial contained an aqueous solution of p-aminobenzoic acid (0.08 % w/w, 19 mL). The cassette layout is shown in FIG. 24.
[0239] The required programme sequence was uploaded from the PC control to the synthesizer module and the assembled cassette mounted onto the machine. A water bag and a product vial were attached. A vial containing [18F]water (300 MBq, 1 mL) was attached to the FASTlab™ module and the radiosynthesis commenced. The process included an azeotropic drying step of the [18F]-Kryptofix/potassium carbonate complex as eluted from the QMA cartridge, the radiosynthesis of [18F]FBA, the purification of [ 18 F]FBA using the MCX cartridge, ammonia solution and elution with ethanol, the conjugation step to produce 2, and the purification and formulation step using phosphoric acid/ethanol on the lC2 cartridges. The total process took one hour and generated 2 in 33 % non-decay corrected radiochemical yield with 94 % radiochemical purity.
[0240] Example 16. Automated radiosynthesis of Compound 2 using Sephadex purification
[0241] A FASTlab™ cassette was assembled containing a first vial (8.25 mg/21.9 μιηοΐ Kryptofix, 1.16 mg/8.4 μιηοΐ K2CO3, 165 μL· water, 660 μL· acetonitrile), a second vial (1.5 mg/4.8 μιηοΐ triflate 1, 1.5 mL anhydrous DMSO), a third vial (5.0 mg/0.69 μιηοΐ 3, 8.2 mg/63 μιηοΐ aniline hydrochloride, 0.7 mL ammonium acetate buffer pH 4.5/0.25 M), a fourth vial (4 mL, 4 % w/v aqueous ammonia), external vials of ethanol (25 mL) and saline (Polyfusor, 0.9 % w/v, 25 mL), a pre-conditioned QMA light SepPak cartridge, an OASIS MCX SepPak cartridge, and a custom packed size exclusion cartridge (2 mL, Supelco, Cat. #57608-U) containing dry Sephadex G10
(500 mg, Sigma-Aldrich, Cat. #010120). The cassette layout is shown in FIG. 26. The radiosynthesis of 2 was performed as described in Example 15. After priming the Sephadex cartridge with saline (5 mL), the crude reaction mixture was pumped through the Sephadex cartridge and pure 2 collected in the product vial. The synthesis time was 40 minutes and the non-decay corrected radiochemical yield was 10 %. The radiochemical purity of the product was 95 % and the level of DMAB was 0.8 μg/mL. FIG. 27 shows the HPLC analysis of the final product.
[0242] Example 17. Radiosynthesis of ri8F1AlF-NOTA(COOH)2-Z02891(SEO ID No. 2X5)
[0243] 5
[0244] A solution of NOTA(COOH)2-Z02891 (4) (746 μg, 100 nmol) in sodium acetate buffer (50 μΕ, pH 4.0, 0.5 M) was mixed with a solution of A1C13 (3 μΕ, 3.33 μg, 25 nmol in sodium acetate buffer, pH 4.0, 0.5 M) in a conical polypropylene centrifuge vial (1.5 mL). This mixture was added to a small volume of [ 18 FJfluoride (50 μί) in a capped P6 vial. This vial was heated for 15 min at 100 °C. After diluting with saline (100 μΕ), the reaction solution was transferred to a NAP5 size exclusion cartridge (GE Healthcare). The final product was eluted into a P6 vial using saline (750 μΕ). The labelled peptide 5 was obtained with 11 % non-decay corrected radiochemical yield. FIG. 28 shows the analytical HPLC of the formulated product. Table 11 summarises the data of individual runs.
Table 11. Summary of [18F]A1F-NOTA(COOH)2-Z02891(SEQ ID No. 2)(5) preparations using NAP5 purification.
5 410 50 38 9 %
6 134 50 20 15 %
7 518 50 55 11 % a End o ' Synthesis radiochemical yield, non-decay corrected
[0245] Example 17a. Preparation of Compound 4
[0246] (i) Preparation of NOTA(bis-tBu)
[0247]
[0248] (a) Synthesis of Tetratosyl-N,N^-bis(2-hvdroxyethyl)ethylene diamine
[0249] N,N"-bis(2-hydroxyethyl)-ethylenediamine (Aldrich, 14.8 g, 100 mmol) and pyridine (Fluka, 200mL) was stirred at 0°C under nitrogen while a solution of toluene-4-sulfonyl chloride (Fluka, 77 g, 400 mmol) dissolved in pyridine (Fluka, lOOmL) was dropped into the solution over a period of 75 minutes. The temperature was slowly raised to room temperature and continued stirred for 4 hours. Solution was poured into a mixture of ice (250 mL) and hydrochloric acid (concentrated, 250 mL) while stirring to afford a dark sticky oil. Solvents were removed by decantation, product crude washed with water, decanted and re-dissolved in methanol (250mL). The resulting slurry was isolated by filtration and the crude product was re-dissolved in hot methanol (60°C, 600 mL) and cooled down. Solid product was filtered off and dried in vacuo. Yield 36.36 g (47.5%). Product was verified by NMR.
[0250] (b) Synthesis of l-Benzyl-4-7-ditosyl-l A7-triazonane
[0251] Tetratosyl-N,N -bis(2-hydroxyethyl)ethylene diamine (See Example 17a(i)(a); 2.0 g, 2.6 mmol), benzyl amine (500μ1, 4.6 mmol), potassium carbonate (Fluka, 792 mg, 5.7 mmol) and acetonitrile (Merck, 25 mL) was heated to 100°C and stirred overnight. Solvents were removed from solid product by filtration. The solid was washed with acetonitrile (2x 10 mL) and solvents were evaporated off. Solids was dissolved in hot ethanol (15 mL) and left for three days in room temperature. Crystals were collected by filtration and dried in vacuum overnight. Product confirmed by LC- MS (Phenomenex Luna CI 8(2) 2.0x50 mm, 3 μιη, solvents: A = water/0.1% trifluoroacetic acid and B = acetonitrile/0.1 % trifluoroacetic acid; gradient 10-80% B over 5 min; flow rate 0.6 mL/min, UV detection at 214 and 254 nm, ESI-MS) ¾ = 3.66 min. Yield 1 g (72%).
[0252] (c) Synthesis of (4-Benzyl-7-tert-butoxycarbonylmethyl-[l,4,71triazonan-l- vD-acetic acid tert-butyl ester
[0253] Sulphuric acid (Sigma, concentrated, 25 mL) was added to l-Benzyl-4-7- ditosyl-l,4,7-triazonane (See Example 17a(i)(b); 2.5 g, 4.7 mmol) while stirring and heated to 100 °C and left for 20 hours. The reaction mixture was cooled to room temperature and added drop wise into diethyl ether (VWR, 500 mL). Product (white precipitate) was filtered off and washed with acetonitrile, chloroform and dichloromethane. Solvents were removed in vacuo. The product crude (986.3 mg, 4.5 mmol) were mixed with triethylamine (Fluka, 1.4 mL, 10 mmol) in acetonitrile (50 mL). Tert-buthyl bromoacetate (Fluka, 1.47 mL, 10 mmol) was dissolved in acetonitrile (25 mL) and added dropwise. The reaction mixture was stirred in room temperature overnight. pH was controlled and triethylamine added if necessary. Solvents were removed in vacuo and crude material dissolved in dichloromethane (150 mL) and washed with water (2x 25 mL), 0.1 M hydrochloric acid (lx 25mL) and water (lx 25mL). The organic phase was filtered and solvent evaporated off. Crude material was dissolved in acetonitrile /water (1 : 1) and purified by preparative HPLC (Phenomenex Luna C18 (2) 5μιη 250x 21.2 mm, solvents: A = water/0.1% trifluoroacetic acid and B = acetonitrile/0.1 % trifluoroacetic acid; gradient 10-80% B over 60 min) and lyophilized. LC-MS (Phenomenex Luna CI 8(2) 2.0x50 mm, 3 μιη, solvents: A = water/0.1% trifluoroacetic acid and B = acetonitrile/0.1 % trifluoroacetic acid; gradient 10-80% B over 5 min; flow rate 0.6 mL/min, UV detection at 214 and 254 nm, ESI-MS) iR = 3.99 min, (Ml) 447.4. Product verified by NMR.
[0254] Product was mixed with Pd/C (10%, 235 mg) and methanol (25 mL) and stirred under argon. Argon was then removed by vacuo and hydrogen gas was started
to be supplied. Reaction mixture was left for three hours with stirring and continuously supply of hydrogen gas. Catalyst was removed by centrifugation and solvents evaporated off. Crude product was purified with preparative HPLC (Phenomenex Luna C18 (2) 5μιη 250x 21.2 mm, solvents: A = water/0.1% trifluoroacetic acid and B = acetonitrile/0.1 % trifluoroacetic acid; gradient 2-80% B over 60 min). LC-MS (Phenomenex Luna CI 8(2) 2.0x50 mm, 3 μιη, solvents: A = water/0.1 % trifluoroacetic acid and B = acetonitrile/0.1 % trifluoroacetic acid; gradient 10-80% B over 5 min; flow rate 0.6 mL/min, UV detection at 214 and 254 nm, ESI- MS) tR = 2.55 min, (Ml) 357.9.Yield 150 mg. Product confirmed by NMR.
[0255] (d) Synthesis of (4,7-Bis-tert-butoxycarbonylmethyl-ri,4,71triazonan-l- ylVacetic acid rNOTA(bis-tBu)]
[0256] (4-tert-Butoxycarbonylmethyl-[l,4,7]triazonane-l-yl)-acetic acid tert-butyl ester (See Example 17a(i)(d); 280 μιηοΐ, 100 mg) and bromoacetic acid (Fluka, lmmol, 138.21 mg) were dissolved in methanol (1 mL). Potassium carbonate dissolved in water (1 mL) was added with stirring. Reaction mixture was stirred at room temperature overnight and concentrated in vacuo. The residue was dissolved in water (2.5 mL), and pH was adjusted to 4 with hydrochloric acid (1 M). The crude product was purified by preparative HPLC (Phenomenex Luna C18 (2) 5μιη 250x 21.2 mm, solvents: A = water/0.1% trifluoroacetic acid and B = acetonitrile/0.1 % trifluoroacetic acid; gradient 10-80% B over 60 min). LC-MS (Phenomenex Luna CI 8(2) 2.0x50 mm, 3 μιη, solvents: A = water/0.1% trifluoroacetic acid and B = acetonitrile/0.1 % trifluoroacetic acid; gradient 10-80% B over 5 min; flow rate 0.6 mL/min, UV detection at 214 and 254 nm, ESI-MS) iR = 2.40 min. Yield 117.7 mg. Product confirmed by NMR.
NOTA(bis-tBu) was purified by preparative HPLC (gradient: 20-40% B over 40 min) affording 72 mg pure NOTA(bis-tBu). The purified material was characterised by LC-MS (gradient: 10-40% B over 5): iR: 3.75 min, found m/z: 416.2, expected MH+: 416.3.
[0257] (ii Preparation of NOTA(bis-tBu)-maleimide
[0258] N-(2-Aminoethyl)maleimide trifluoroacetic acid salt (23 mg, 0.090 mmol), NOTA(bis-tBu) (30 mg, 0.072 mmol) and PyAOP (51 mg, 0.10 mmol) were dissolved in Ν,Ν-dimethylformamide (DMF) (2 mL). Sym.-collidine (29 μL·, 0.40 mmol) was added and the reaction mixture shaken for 1 nr. The mixture was diluted with water/0.1 % trifluoroacetic acid (TFA) (6 mL) and the product purified by semi- preparative HPLC. Purification using semi-preparative HPLC (gradient: 20-50% B over 60 min) afforded 33 mg (87%) pure NOTA(bis-tBu)-maleimide. The purified material was characterised by LC-MS (gradient: 10-40% B over 5, ip> : 4.09 min, found m/z: 538.2, expected MH+: 538.3
[0259] (iii) Preparation of NOTA(bis-acid)-maleimide
[0260] NOTA(bis-tBu)-maleimide (33 mg, 61 μιηοΐ) was treated with a solution of 2.5% triisopropylsilane (TIS) and 2.5% water in TFA (10 mL) for 4 hrs 30 min. TFA was evaporated in vacuo, the residue dissolved in water/0.1 % TFA (8 mL) and the product purified by semi-preparative HPLC. Purification using semi-preparative HPLC (gradient: 0-20% B over 40 min) afforded 15 mg (58%) pure NOTA(bis-acid)-
maleimide. The purified material was characterised by LC-MS (gradient: 0-30% B over 5): iR: 1.34 min, found m/z 426.0, expected MH+: 426.2
[0261] (iv Preparation of 4
Recombinant Z02891-Cys (40 mg, 5.7 μιηοΐ) (purchased from Affibody AB, Sweden) and NOTA(bis-acid)-maleimide (6.1 mg, 14 μιηοΐ) were dissolved in water (1.5 mL). The solution was adjusted to pH 6 by adding ammonium acetate and the mixture shaken for 1 nr. The reaction mixture was diluted with water/0.1 % TFA (6 mL) and the product purified using semi-preparative HPLC. Purification using semi- preparative HPLC (gradient: 20-30% B over 40 min) afforded 38 mg (90%) pure compound 4. Purified 4 was analysed by analytical LC-MS (gradient: 10-40% B over 5 min): ¾: 3.31 min, found m/z: 1864.5, expected MH4 4+: 1864.5
[0262] Example 18
[0263] Time course study for the radiosynthesis of r18F]AlF-NOTA(COOH)v Z0289KSEO ID No. 2X5a
[0264] Fluorine- 18 was purified using a QMA cartridge and eluted with saline as described by W. J. McBride et al. (Bioconj. Chem. 2010, 21, 1331). A solution of 18F- water (25 \L, 12 MBq) was mixed with AICI3 (1.667 μg, 12.5 nmol) in sodium acetate buffer (1.5 \L, pH 4.0, 0.5 M) and compound 6 (380 μg, 50 nmol):
dissolved in sodium acetate buffer (25 μL·, pH 4.0, 0.5 M). The mixture was heated at 100 °C and aliquots analysed by HPLC. The analytical data are given in FIG. 29.
[0265] Example 18a. Preparation of Compound 6
[0266] (i) Preparation of NOTA(tris-tBu)
(a) Synthesis of a-bromoglutaric acid 5-benzyl ester
To a solution of L-glutamic acid-5-benzylester (Fluka, 3.0 g, 0.013 mol) and sodium bromide (Fisher, 4.6 g, 0.044 mol) in aqueous hydrobromic acid (Fluka, 1 M, 22.5 mL) cooled to 0°C was added portion wise sodium nitrite (Fluka, 1.6 g, 0.023 mol). After stirring for 2h at 0°C, concentrated sulphuric acid (Merck, 1.2 mL) was added followed by diethyl ether (Eternell). The water phase was extracted three times with diethyl ether. The combined organic phases was washed four times with brine, dried over sodium sulphate and evaporated under reduced pressure. The crude product was purified using normal phase chromatography (Silica column (40 g), solvents: A= hexane, B= ethyl acetate, gradient: 10 -35% B over 20 min, flow rate 40mL/min, UV detection at 214 and 254 nm) affording 1.81 g of the pure product. Yield 46 %. Structure verified by NMR.
(b) Synthesis of a-bromoglutaric acid 5-benzyl ester 1-tert-butyl ester
{Bioorg. Med. Chem. Lett. 2000 10, 2133-2135)
To a solution of a-bromoglutaric acid-5-benzylester (See Example 18a(i)(a); 1.2 g, 4.0 mmol) in chloroform (Merck, 5 mL) a solution of tert-butyl 2,2,2- trichloroacetimidate (Fluka, 1.57 mL, 8.52 mmol) in cyclohexane (Merck, 5 mL) was added dropwise over 5 minutes. Ν,Ν-Dimethylacetamide (Fluka, 0.88 mL) was added followed by boron trifluoride ethyl etherate (Aldrich, 80 μί) as catalyst. The reaction mixture was stirred for 5 days at room temperature. Hexane was added and the organic phase washed with brine three times, dried over sodium sulphate and evaporated under reduced pressure. The crude product was purified using normal phase chromatography (Silica column (40 g), solvents: A= hexane, B= ethyl acetate, gradient: 10 to 35 % B over 15 min, flow rate 40mL/min, UV detection at 214 and 254 nm) affording 1.13 g (79%) of the pure product. Structure was verified by NMR
(c) Synthesis of 2-ri,4,71triazonan-l-yl-pentanedioic acid 5-benzyl ester 1-tert- butyl ester
A solution of a-bromoglutaric acid-5-benzylester 1 -tert-butyl ester (See Example 18a(i)(a); 513 mg, 1.44 mmol) in chloroform (Merck, 20 mL) was added over a period of 3 hours to a solution of 1,4,7 triazacyclononane (Fluka, 557 mg, 4.31 mmol) in chloroform (Merck, 20 mL). The mixture was stirred for 3 days at room
temperature and concentrated in vacuo to a light yellow oil. The crude product was purified using normal phase chromatography (Silica column (40 g), solvents: A= ethanol: ammonia (aq) 95:5, B= chloroform: ethanol: ammonia (aq) 385:175:20, gradient: 0% B over 6 min, 100% B over 12 min, flow rate 40mL/min, UV detection
at 214 and 254 nm) affording the semi-pure product (289 mg). Yield 49 %. Product confirmed by LC-MS (column Phenomenex Luna C18(2) 2.0x50 mm, 3 μιη, solvents: A = water/0.1 % trifluoroacetic acid and B = acetonitrile/0.1 % trifluoroacetic acid; gradient 10-50% B over 5 min; flow rate 0.6 mL/min, UV detection at 214 and 254 nm, ESI-MS) iR = 2.5 min, m/z (MH+), 406.3.
(d) Synthesis of 2-(4, 7-bis-tert-butoxycarbonylmethyl-[l,4,71triazonan-l-yl- pentanedioic acid 5-benzyl ester 1-tert-butyl ester
2-[l ,4,7]Triazonan-l-yl-pentanedioic acid 5-benzyl ester 1-tert-butyl ester (See Example 18a(i)(b); 600 mg, 1.48 mmol) in dry acetonitrile (40 mL) was cooled to zero degrees before tert-butyl bromoacetate (Fluka, 548 mg, 414 μL·, 2.81 mmol) in dry acetonitrile (10 mL) was added drop wise over a period of 15 minutes. The reaction mixture was stirred for additional 15 minutes before dry potassium carbonate (Fluka, 1.13 g, 814 mmol) was added and the reaction mixture warmed slowly to room temperature over 4 hours. The mixture was filtered over Celite and evaporated to dryness to afford the crude product. Product was confirmed by LC-MS (column Phenomenex Luna C18(2) 2.0x50 mm, 3 μιη, solvents: A = water/0.1%
trifluoroacetic acid and B = acetonitrile/0.1 % trifluoroacetic acid; gradient 10-80% B over 5 min; flow rate 0.6 mL/min, UV detection at 214 and 254 nm, ESI-MS) iR = 3.9 min, m/z (MH+), 634.4.
(e) Synthesis of 2-(4, 7-bis-tert-butoxycarbonylmethyl-[l,4,71triazonan-l-yl- pentanedioic acid 1-tert-butyl ester [NOTA(tris-tBu)1
2-(4, 7-Bis-tert-butoxycarbonylmethyl-[l,4,7]triazonan-l-yl-pentanedioic acid 5- benzyl ester 1-tert-butyl ester (See Example 18a(i)(c); 938 mg, 1.48 mmol) was dissolved in 2-propanol (Arcus, 115 mL) and 10% Pd/C (Koch- Light, 315 mg) suspended in water (3 mL) was added. The mixture was treated with hydrogen (4 atm) for 3 hours, filtered over Celite and evaporated to dryness. The residue was chromatographed on silica gel (Silica column (4g), solvents: 2-propanol:ammonia 95:5, flow rate 40mL/min, UV detection at 214 and 254 nm) affording a semi-pure product (225 mg). Product was confirmed by LCMS (Phenomenex Luna C18 (2), 2.0x50mm, 3μιη; solvents: A = water/0.1% trifluoroacetic acid and B =
acetonitrile/0.1 % trifluoroacetic acid, gradient 10-80% B over 5 min, flow rate 0.6 mL/min, UV detection at 214 and 254 nm, ESI-MS) tR2.4min, MH+ 544.5.
Purified NOTA(tris-tBu) was characterised by LC-MS (gradient: 10-80% B over 5): iR: 2.4 min, found mJ . 544.5, expected MH+: 544.4
[0267] (ii) Preparation of NOTA(tris-tBu)-NH-CH2CH2-NH2
[0268]
[0269] PyAOP (96 mg, 0.18 mmol) dissolved in NMP (1 mL) was added to a solution of NOTA(tris-tBu) (100 mg, 0.18 mmol) and ethylenediamine (1.2 mL, 18 mmol) in
NMP (1 mL). The reaction mixture was shaken for 1 hr and then a second aliquot of PyAOP (38 mg, 0.073 mmol) was added. Shaking was continued for 30 min. 20% ACN/water (5 mL) was added and the product purified by semi-preparative HPLC. Purification using semi-preparative HPLC (gradient: 20-50% B over 40 min) afforded 123 mg (98%) pure NOTA(tris-tBu)-NH-CH2CH2-NH2. The purified material was characterised by LC-MS (gradient: 20-50% B over 5): iR: 1.95 min, found mJ . 586.4, expected MH+: 586.4
[0270] (iii) NOTA(tris-tBu)-NH-CH2CH2-NH-maleimide
[0271]
[0272] NOTA(tris-tBu)-NH-CH2CH2-NH2 (123 mg, 0.176 mmol), 3-maleimido- propionic aid NHS ester (70 mg, 0.26 mmol) and sym.-collidine (346 μL·, 2.60 mmol) were dissolved in NMP (2 mL). The reaction mixture was stirred for 6 hr. Water (6 mL) was added and the product purified by semi-preparative HPLC. Purification using semi-preparative HPLC (gradient: 20-50% B over 40 min) afforded 115 mg (87%) pure NOTA(tris-tBu)-NH-CH2CH2-NH-maleimide. The purified material was characterised by LC-MS (gradient: 10-60% B over 5): ¾: 3.36 min, found m/z: 737.4, expected MH+: 737.4
[0273] (iv Preparation of NOTA(tris-acid -NH-CH2CH2-NH-maleimide
[0274]
[0275] NOTA(tris-tBu)-NH-CH2CH2-NH-maleimide (115 mg, 0.150 mmol) was treated with a solution of 2.5% TIS and 2.5% water in TFA (10 mL) for 4 hrs. The
solvents were evaporated in vacuo, the residue re-dissolved in water (8 mL) and the product purified by semi-preparative HPLC. Purification using semi-preparative HPLC (gradient: 0-20% B over 40 min) afforded 80 mg (90%) pure NOTA(tris-acid)- NH-CH2CH2-NH-maleimide. The purified material was characterised by LC-MS (gradient: 0-30% B over 5): tR: 2.1 min, found m/z: 569.5, expected MH+: 569.2
[0276] (v) Preparation of Compound 6
[0277] (a) Preparation of Synthetic Z02891-Cvs
[0278] Sequence:
EAKYAKEMRNAYWEIALLPNLTNQQKRAFIRKLYDDPSQSSELLSEAKKLND SQAPKVDC was assembled on a CEM Liberty microwave peptide synthesiser using Fmoc chemistry starting with 0.05 mmol NovaPEG Rink Amide resin. 0.5 mmol amino acid was applied in each coupling step (5 min at 75 °C) using 0.45 mmol HBTU/0.45 mmol HO At/ 1.0 mmol DIPEA for in situ activation. Fmoc was removed by 5% piperazine in DMF. Double coupling of both Arg was applied. Asp-Ser and Leu-Ser pseudoproline dipeptides (0.5 mmol) were incorporated into the sequence.
The simultaneous removal of the side-chain protecting groups and cleavage of the peptide from the resin was carried out in TFA (40 mL) containing 2.5% TIS, 2.5% EDT, 2.5% EMS and 2.5% water for 1 hr. The resin was removed by filtration, washed with TFA and the combined filtrates were evaporated in vacuo. Diethyl ether was added to the residue, the formed precipitate washed with diethyl ether and dried. The cleavage procedure was repeated once more. The dried precipitates were dissolved in 20% ACN/water and left over night in order to remove remaining Trp protecting groups. The solution was lyophilised affording 148 mg (42%) crude Z02891-Cys. 148 mg crude Z02891-Cys was purified by semi-preparative HPLC (4 runs, gradient: 25-30% B over 40 min) affording 33 mg (9%) pure Z02891-Cys. The purified material was characterised by LC-MS (gradient: 10-40% B over 5): ¾: 3.40 min, found m/z: 1758.3, expected MH4 4+: 1758.4.
Synthetic Z02891-Cys (13.7 mg, 1.95 μιηοΐ) and NOTA(tris-acid)-NH-CH2CH2-NH- maleimide (11 mg, 19.3 μιηοΐ) were dissolved in water (1 mL). The solution was adjusted to pH 6 by adding ammonium acetate and the mixture shaken for 3 hrs. The reaction mixture was diluted with water/0.1 % TFA (6.5 mL) and the product was purified using semi-preparative HPLC. Purification using semi-preparative HPLC
(gradient: 15-35% B over 40 min) afforded 8.4 mg (57%) pure 6. Compound 6 was analysed by analytical LC-MS (gradient: 10-40% B over 5 min): tR: 3.31 min, found m/z: 1900.7, expected MH44+: 1900.2
[0279] Example 19. Impact of the AlC13/peptide ratio radiochemical yields of ri8F]AlF-NOTA(COOH)2-Z02891(SEO ID No. 2)(5)
[0280] Three solutions of 4 (149 μg, 20 nmol) in sodium acetate buffer (10 μί, pH 4.0, 0.5 M) were mixed with solutions of A1C13 (0.33 μg, 2.49 nmol; 0.66 μg, 4.98 nmol; and 1.33 μg, 9.96 nmol, respectively) in sodium acetate buffer (1 μL, pH 4.0, 0.5 M) in conical polypropylene centrifuge vials (1.5 mL). To these vials a small
18
volume of [10F]fluoride (10 μί) was added. The vials were heated for 15 min at 100 °C and subsequently analyzed by HPLC. The incorporation yields are given in Table 12.
Table 12. Impact of AlCl3/peptide ratio on analytical RCY of [18F]A1F- NOTA(COOH)2-Z02891(SEQ ID No. 2)(5).
[0281] Example 20. Impact of the rea2ent dilution on radiochemical yields of ri8F]AlF-NOTA(COOH)2-Z02891(SEO ID No. 2)(5)
[0282] A solution of 4 (373 μg, 50 nmol) in sodium acetate buffer (25 μΐ,, pH 4.0, 0.5 M) was mixed with a solution of AICI3 (1.66 μg, 12.5 nmol) in sodium acetate buffer (1.5 μL·, pH 4.0, 0.5 M) in a conical polypropylene centrifuge vial (1.5 mL). A small volume of [18F]fluoride (10 μΐ,, 80 MBq) was added. Two serial dilutions of this mixture (50 % and 25 % v/v) with sodium acetate buffer (1.5 μL·, pH 4.0, 0.5 M) were prepared. The three vials were then heated at 100 °C for 15 minutes and subsequently analyzed by HPLC. The data are shown in Table 13.
Table 13. Impact of reagent concentration on analytical RCY of [ F]A1F- NOTA(COOH)2-Z02891(SEQ ID No. 2)(5). The ratio of reagents was kept constant.
[0283] Example 21. Impact of the peptide/AlC13 concentration on radiochemical yields of ri8FlAlF-NOTA(COOH 2-Z02891(SEO ID No. 2X5)
[0284] Three vials containing [18F]fluoride (25 uL, 23-25 MBq), A1C13 (¼ eq. of peptide 4 in 1.5 sodium acetate buffer, pH 4.0, 0.5 M), and 4 (50, 100, 150 nmol) in sodium acetate buffer (25 μL·, pH 4.0, 0.5 M) were heated at 100 °C for 30 minutes. FIG. 30 shows the incorporation data after 15 and 30 minutes.
[0285] Example 22. Impact of microwave heatin2 on radiochemical yields of r18FlAlF-NOTA(COOH),-Z02891(SEO ID No. 2X5)
[0286] A Wheaton vial (3 mL) containing [18F]fluoride (25 μΐ,, 29 MBq), AICI3 (1.66 μg, 12.5 nmol) in 1.5 μL· sodium acetate buffer, pH 4.0, 0.5 M), and 4 (373 μg, 50 nmol) in sodium acetate buffer (25 μL·, pH 4.0, 0.5 M) was heated using a microwave device (Resonance Instruments Model 521, set temperature 80 °C, 50 W) for 5, 10, and 15 s. Table 14 gives the summary of the HPLC analyses after these time points.
[0287] Table 14. Analytical RCY from preparation of [18F]A1F-N0TA(C00H)2- Z0289KSEQ ID No. 2)(5) using microwave heating.
[0288] Example 23. Preparation of ri8F]AlF-NOTA(COOH)3-Z02891(SEQ ID No. 2)(5a)
[0290] A PP centrifuge vial (1.5 mL) containing [lsF]fluoride (25 μΐ,, 29 MBq), A1C13 (1.66 μg, 12.5 nmol) in 1.5 sodium acetate buffer, pH 4.0, 0.5 M), and 6 (380 μg, 50 nmol) in sodium acetate buffer (25 μί, pH 4.0, 0.5 M) was heated at 100 °C for 15 minutes. The analytical RCY of 5a was 15-20 %. FIG. 31 shows the HPLC profile of the reaction mixture.
[0291] Example 24. Preparation of ri8F]SiFA-Z02891(SEO ID No. 2X7)
[0293] A solution of peptide precursor 8 (750 μg, 100 nmol) in sodium acetate buffer
(50 μί, pH 4.0, 0.5 M) was added to a solution of [ FJfluoride in water (50 μί) in a polypropylene centrifuge vial (1.5 mL) and heated for 15 minutes at 95 °C. After adding saline (100 μL·, 0.9 % w/v), the mixture was purified using a saline conditioned NAP5 column (GE Healthcare). The product 7 was obtained withl8 % non-decay corrected radiochemical yield and 87 % radiochemical purity after 26 minutes. FIG. 32 shows the HPLC analysis of the final product.
[0294] Example 24a. Preparation of Compound 8
[0295] (i) Synthesis of SiFa
n-Butyllithium in hexane (2.5 M, 3.2 mL, 7.9 mmol) was added dropwise under argon to a cooled (-78 °C) solution of 2-(4-bromophenyl)-l,3-dioxolane (1.8 g, 7.9 mmol) in dry tetrahydrofurna (THF) (6 mL). After stirring for 2 hrs at -78 °C, the resulting yellow suspension was taken up in a syringe and added dropwise over a period of 20 min to a cooled solution (-70 °C) of di-ieri-butyldifluorosilane (1.5 mL, 8.33 mmol) in THF (15 mL). The reaction mixture was stirred for 1 hr at -70 °C and then allowed to warm to ambient temperature. A sample (3 mL) was withdrawn from the reaction mixture after 2 hrs 30 min and quenched with water/0.1 % TFA resulting in removal of the dioxolane protecting group. The deprotected product was purified by preparative HPLC. Purification using preparative HPLC (gradient: 40-95% B over 60 min) afforded pure SiFA. The purified material was characterised by LC-MS (gradient: 50-95% B over 5): ip>: 2.05 min, found m/z: not detected, expected MH+: 267.2
[0296] (ii) Preparation of SiFA-aminooxyacetyl-maleimide
[0297]
[0298] Eei-aminooxyacetyl-maleimide (20 mg, 71 μιηοΐ) was added to SiFA in water/ACN/0.1% TFA (from HPLC prep fractions). 1M HC1 (1 mL) was added and the reaction mixture stirred over night. The product was purified by semi-preparative HPLC. Purification using semi-preparative HPLC (gradient: 40-80% B over 40 min) afforded 15 mg (45%) pure SiFA-aminooxyacetyl-maleimide. The purified material was characterised by LC-MS (gradient: 40-70% B over 5): ip> : 3.00 min, found m/z: 462 A, expected MH+: 462.2
[0299] (iii) Preparation of Compound 8
[0300] Recombinant Z02891-Cys Affibody (24 mg, 3.4 μιηοΐ) and SiFA- aminooxyacetyl-maleimide (4.7 mg, 10 μιηοΐ) were dissolved in 50% ACN/water (1 mL). The solution was adjusted to pH 6 by adding ammonium acetate and the mixture shaken for 1 hr. The reaction mixture was diluted with 10% ACN/water/0.1 % TFA (8 mL) and the product purified using semi-preparative HPLC. Purification using semi- preparative HPLC (gradient: 20-40% B over 40 min) afforded 26 mg (100%) pure
Z02891-Cys-maleimide-aminooxyacetyl-SiFA (8). Purified Z02891-Cys-maleimide- aminooxyacetyl-SiFA (8) was analysed by analytical LC-MS (gradient: 10-40% B over 5 min): ¾: 3.87 min, found m/z: 1873.6, expected ΜΗ4 4+: 1873.5
[0301] Example 25. Tumour model validation
[0302] The A431 and NCI-N87 xenograft models were validated for tumour growth and HER2 expression. The animal model setup involved inoculation of 2xl06 NCI- N87 or 107 A431 cells per animal (in ΙΟΟμΙ of 50%PBS/50%Matrigel) subcutaneously into the right flank followed by an inoculation period of 30 days. HER2 expression in these tumours was assessed by immunohistochemistry, using the FDA-validated HercepTest (Dako, K5204).
[0303] FIG. 33 depicts that with the recommended intensity scale (0 -> +3), NCI-N87 tumours stain strongly (+3), while A431 cells show a considerably weaker staining intensity (+1). These data suggest that the tumour models have significantly different HER2 expression and are therefore suitable for comparing the uptake of the HER2 targeted Affibody molecules. Based on the adequate separation of IHC scores, no further quantitative assessment was considered necessary.
[0304] Example 26. Biodistribution of Compounds 2, 5, and 7 in normal mice
[0305] The saline formulated tracers compounds 2, 5, and 7 have been evaluated using naive CD1 mice. Following intravenous injection of 3 MBq of activity (2.5 MBq for the 2 min time point), animals were sacrificed at 2, 90, 120 and 180min post injection and retention of radioactivity was assessed in key organs. In the biodistribution measurements, 5 showed significant kidney retention (70.3 % ID at 90 minutes p.i.) which was not observed for the 2 or 7 (4.8 % ID and 10 % ID, respectively at 90 min p.i.). Defluorination of 7 was observed (bone uptake 5.3 % ID/g at 90 min p.i.). FIG. 34 compares the biodistribution data with the corresponding [mIn]DOTA-Z02891(SEQ ID No. 2)(9) compound:
[0306] Example 27. Tumour uptake of Compounds 2, 5, and 7
[0307] In a tumour mouse model with high and low HER2 level expressing tumor cells (NC87 and A431, respectively) a differential uptake of compounds 2, 5, and 7 was observed as expected. FIG. 35, Tables 15 and 16 compare the biodistribution data with corresponding [mIn]DOTA-Z02891(SEQ ID No. 2)(9) compound.
[0308] Table 15. Key ratios from the NCI-N87 xenograft biodistribution of
Compounds 9, 2, 5 and 7.
Table 16. Key ratios from A431 xenograft biodistribution of
[0309] Example 28. Imaging of 2 in dual tumour xeno2raft model
[0310] Dual tumour xenograft mice were generated by implantation of A431 and NCI-N87 in each of the two flanks. These mice were used to assess the biodistribution of 2, enabling a same-animal assessment of uptake in both low and high HER2 expressing tumours. Timepoints included 30 and 60 p.i.
[0311] FIG. 36 shows that 2 performance was comparable to that observed in the single tumour animal studies, with good separation in binder uptake between the A431 and NCI-N87 tumours, starting from as early as 30min p.i. As far as background tissue clearance (see Table 7 for key tissue ratios), blood levels at 60min p.i. have reduced significantly, providing a NCI-N87 tumour: blood ratio of 4.52, while at 30min, partial blood clearance gives a 2.39 ratio, accompanied by a positive tumounliver ratio of 1.39. These properties suggest that the pharmacokinetics of 2 is sufficient for imaging human subjects within a suitable imaging window.
[0312] Table 17. Key ratios from the dual tumour xenograft biodistribution of 2.
[0313] Example 29. Compound 2 add-back studies in NCI-N87 tumoured mice
[0314] For the add-back studies performed in the NCI-N87 tumour model to assess the effect of excess cold ligand in binder efficacy, the following four different preparations were assessed at 90min p.L:
1. Standard compound 2 preparation
2. Standard preparation plus 10( g/kg per mouse cold precursor
3. Standard preparation plus 50( g/kg per mouse cold precursor
4. Standard preparation plus 100( g/kg per mouse cold precursor
The concentration of cold precursor in the standard preparation was 12C^g/kg per mouse, therefore this study examined the effects of cold precursor at 10 x the original concentration used (in the mouse). FIG. 37 shows that the effect on tumour uptake was not significant and clearance from other tissues was not significantly affected either.
[0315] Example 30. Compound 2 in vivo imaging studies in dual flank A431/NCI-N87 tumoured mice
[0316] The dual-tumour mouse model described in Example 28 was used to perform a preliminary imaging study. 10 MBq of 2 were injected i.v. per animal and the mice were imaged for 30 minutes starting at 120 min p.i. The image in FIG 38 shows that clearance was through the kidneys and bladder, as previously demonstrated through the biodistribution studies. The transverse imaging shows uptake in the 2 tumours,
with the NCI-N87 tumour showing considerably higher signal intensity than the A431 tumour, in agreement with the dual tumour biodistribution studies in Example 28.
[0317] Comparison of the current 2 imaging study with the Affibody® 9 imaging study (FIG. 38) shows a similar difference in uptake between high and low HER2 expressing tumours. However, 2 has a considerably improved background from the kidneys due to minimal kidney retention also seen in the biodistributions.
[0318] All patents, journal articles, publications and other documents discussed and/or cited above are hereby incorporated by reference.
Claims
1. An imaging agent composition comprising an isolated polypeptide comprising SEQ. ID No. 1, SEQ. ID. No 2 or a conservative variant thereof, conjugated with an
Al 1180F-NOTA-chelator to form an Al 1180F-NOTA-chelator conjugated polypeptide wherein the isolated Al18F-NOTA-chelator conjugated polypeptide binds specifically to HER2 or variants thereof.
2. A method of making an imaging agent composition according to claim 1 comprising (i) providing an isolated polypeptide comprising SEQ. ID No. 1 , SEQ. ID No. 2 or a conservative variant thereof; (ii) reacting the polypeptide with a NOTA- chelator to form a NOTA-chelator conjugated polypeptide; and (iii) reacting the
NOTA-chelator conjugated polypeptide with an Al 18 F moiety to form a Al 18 F-NOTA- chelator conjugated polypeptide.
3. A method of preparing an 18 F-NOTA-chelator comprising reacting a NOTA- chelator with a source of A118F.
4. A method according to claim 3, wherein said NOTA-chelator comprises a NOTA chelate moiety and a linker.
5. A method of making an imaging agent composition according to claim 1 comprising (i) providing the isolated polypeptide comprising SEQ.ID No. 1, SEQ.ID No. 2, or a conservative variant thereof; (ii) reacting the polypeptide with a NOTA- chelator, wherein the NOTA-chelator comprises a NOTA chelate moiety and a linker, to form a NOTA-chelator conjugated polypeptide; and (iii) reacting the NOTA- chelator conjugated polypeptide with an 18 F moiety or a source of 18 F.
6. A pharmaceutical composition comprising an imaging agent composition according to claim 1 and a pharmaceutically acceptable carrier.
Applications Claiming Priority (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US12/975,425 US20120165650A1 (en) | 2010-12-22 | 2010-12-22 | Her2 binders |
| US201161438297P | 2011-02-01 | 2011-02-01 | |
| US201161510520P | 2011-07-22 | 2011-07-22 | |
| US201161541287P | 2011-09-30 | 2011-09-30 | |
| PCT/US2011/065794 WO2012087908A1 (en) | 2010-12-22 | 2011-12-19 | Her2 binding peptides labeled with aluminium-[18] fluoride complexed by nota |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP2654804A1 true EP2654804A1 (en) | 2013-10-30 |
Family
ID=45444771
Family Applications (4)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP21190695.3A Pending EP3936155A1 (en) | 2010-12-22 | 2011-12-19 | Radiolabeled her2-binding peptide conjugates |
| EP11804895.8A Active EP2654803B1 (en) | 2010-12-22 | 2011-12-19 | Radiolabeled her2-binding peptide conjugates |
| EP11804897.4A Withdrawn EP2654804A1 (en) | 2010-12-22 | 2011-12-19 | Her2 binding peptides labeled with aluminium-[18]fluoride complexed by nota |
| EP21190694.6A Pending EP3957332A1 (en) | 2010-12-22 | 2011-12-19 | Radiolabeled her2-binding peptide conjugates |
Family Applications Before (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP21190695.3A Pending EP3936155A1 (en) | 2010-12-22 | 2011-12-19 | Radiolabeled her2-binding peptide conjugates |
| EP11804895.8A Active EP2654803B1 (en) | 2010-12-22 | 2011-12-19 | Radiolabeled her2-binding peptide conjugates |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP21190694.6A Pending EP3957332A1 (en) | 2010-12-22 | 2011-12-19 | Radiolabeled her2-binding peptide conjugates |
Country Status (13)
| Country | Link |
|---|---|
| EP (4) | EP3936155A1 (en) |
| JP (2) | JP2014507400A (en) |
| KR (6) | KR102498607B1 (en) |
| CN (1) | CN103533963B (en) |
| AU (2) | AU2011354599B2 (en) |
| BR (2) | BR112013015786A2 (en) |
| CA (3) | CA2822815A1 (en) |
| IL (1) | IL227003A (en) |
| MX (2) | MX2013007371A (en) |
| NZ (2) | NZ612312A (en) |
| RU (2) | RU2013128361A (en) |
| SG (2) | SG191270A1 (en) |
| WO (2) | WO2012087908A1 (en) |
Families Citing this family (21)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20120165650A1 (en) | 2010-12-22 | 2012-06-28 | General Electric Company | Her2 binders |
| JP2014507400A (en) * | 2010-12-22 | 2014-03-27 | ジーイー・ヘルスケア・リミテッド | HER2-binding peptide labeled with aluminum- [18F] fluoride complexed with NOTA |
| WO2014076179A1 (en) * | 2012-11-14 | 2014-05-22 | Affibody Ab | New polypeptide |
| JP2016513098A (en) * | 2013-02-07 | 2016-05-12 | イミューノメディクス、インコーポレイテッドImmunomedics, Inc. | An extremely potent prodrug form of 2-pyrrolinodoxorubicin (P2PDOX) conjugated with an antibody for cancer targeted therapy |
| CN103948947A (en) * | 2013-05-08 | 2014-07-30 | 南京市第一医院 | Radionuclide molecular probe using CD13 as molecular target and NGR as ligand, and labeling technique and application thereof |
| WO2014209205A1 (en) * | 2013-06-27 | 2014-12-31 | Ge Healthcare Limited | Use of her2 binders |
| CN103833829A (en) * | 2014-01-07 | 2014-06-04 | 江苏省原子医学研究所 | Radioactive <18>F-labeled imaging drug <18>F-AL-NOTA-IF7 targeting Anxa1 in tumor blood vessels and preparation method thereof |
| CN103951754B (en) * | 2014-03-26 | 2016-08-24 | 中国药科大学 | A kind of targeted therapy and the bifunctional antitumor bispecific miniaturization antibody of detection |
| EP3015462A1 (en) * | 2014-10-29 | 2016-05-04 | OctreoPharm Schiences GmbH | Enantiopure chelating agents for chelator coupled pharmaceuticals, corresponding preparation method thereof and chelator coupled pharmaceuticals |
| JP7266365B2 (en) * | 2015-05-26 | 2023-04-28 | ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア | Novel heteroaromatic silicon fluoride acceptors useful for 18F labeling of molecules and biomolecules and methods for their preparation |
| WO2017156034A1 (en) * | 2016-03-10 | 2017-09-14 | Becton, Dickinson And Company | Methods of evaluating a cellular sample for her-2/neu expression and compositions for practicing the same |
| US10695450B2 (en) | 2016-07-26 | 2020-06-30 | Laboratoires Cyclopharma | Synthesis of a radioactive agent composition |
| FR3054445B1 (en) * | 2016-07-26 | 2019-07-05 | Laboratoires Cyclopharma | SYNTHESIS OF A RADIOACTIVE AGENT COMPOSITION |
| GB2581619A (en) | 2017-09-15 | 2020-08-26 | Univ California | Inhibition of aminoacylase 3 (AA3) in the treatment of cancer |
| MX2020006395A (en) | 2017-12-18 | 2020-12-03 | Janssen Biotech Inc | Radiolabeling of polypeptides. |
| CN110251695B (en) * | 2019-07-10 | 2021-12-21 | 莎穆(上海)生物科技有限公司 | HER 2-targeted radioactive complex and preparation method and application thereof |
| CA3157675A1 (en) * | 2019-12-18 | 2021-06-24 | Erika Reitano | Anti-her2 polypeptides derivatives as new diagnostic molecular probes |
| US20230040008A1 (en) | 2019-12-18 | 2023-02-09 | Bracco Imaging S.P.A. | Anti-her2 polypeptides derivatives as new diagnostic molecular probes |
| KR102502287B1 (en) | 2020-04-17 | 2023-02-22 | 앱클론(주) | Anti-HER2 affibody and switchable chimeric antigen receptor using the same as switch molecule |
| CN114206398A (en) * | 2020-04-30 | 2022-03-18 | 霍伯生物技术公司 | Visualization of HER2 expression in human patients |
| EP4446300B1 (en) | 2023-04-14 | 2025-11-26 | Trasis S.A. | Preparation methods of aluminium fluoride complexes |
Family Cites Families (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| MY133346A (en) * | 1999-03-01 | 2007-11-30 | Biogen Inc | Kit for radiolabeling ligands with yttrium-90 |
| US7993626B2 (en) * | 2007-01-11 | 2011-08-09 | Immunomedics, Inc. | Methods and compositions for F-18 labeling of proteins, peptides and other molecules |
| US7563433B2 (en) * | 2007-01-11 | 2009-07-21 | Immunomedics, Inc. | Methods and compositions for F-18 labeling of proteins, peptides and other molecules |
| US7772188B2 (en) * | 2003-01-28 | 2010-08-10 | Ironwood Pharmaceuticals, Inc. | Methods and compositions for the treatment of gastrointestinal disorders |
| GB0305704D0 (en) | 2003-03-13 | 2003-04-16 | Amersham Plc | Radiofluorination methods |
| EP1641818B1 (en) * | 2003-07-04 | 2008-12-03 | Affibody AB | Polypeptides having binding affinity for her2 |
| GB0428012D0 (en) | 2004-12-22 | 2005-01-26 | Hammersmith Imanet Ltd | Radiolabelling methods |
| WO2008049866A1 (en) * | 2006-10-27 | 2008-05-02 | Affibody Ab | New chelating compound |
| US8303960B2 (en) * | 2007-02-27 | 2012-11-06 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Radiolabeled affibody molecules |
| US8124725B2 (en) * | 2007-12-19 | 2012-02-28 | General Electric Company | PDGF-Rβ binders |
| EP2072525A1 (en) * | 2007-12-21 | 2009-06-24 | Affibody AB | New polypeptides having affinity for HER2 |
| NZ612327A (en) * | 2010-12-22 | 2015-03-27 | Ge Healthcare Ltd | Her2 binding peptides labelled with a 18f - containing organosilicon compound |
| JP2014507400A (en) * | 2010-12-22 | 2014-03-27 | ジーイー・ヘルスケア・リミテッド | HER2-binding peptide labeled with aluminum- [18F] fluoride complexed with NOTA |
-
2011
- 2011-12-19 JP JP2013546278A patent/JP2014507400A/en active Pending
- 2011-12-19 RU RU2013128361/10A patent/RU2013128361A/en not_active Application Discontinuation
- 2011-12-19 SG SG2013047725A patent/SG191270A1/en unknown
- 2011-12-19 JP JP2013546277A patent/JP2014503546A/en active Pending
- 2011-12-19 EP EP21190695.3A patent/EP3936155A1/en active Pending
- 2011-12-19 CA CA2822815A patent/CA2822815A1/en not_active Abandoned
- 2011-12-19 BR BR112013015786-0A patent/BR112013015786A2/en not_active IP Right Cessation
- 2011-12-19 AU AU2011354599A patent/AU2011354599B2/en active Active
- 2011-12-19 EP EP11804895.8A patent/EP2654803B1/en active Active
- 2011-12-19 AU AU2011349482A patent/AU2011349482A1/en not_active Abandoned
- 2011-12-19 KR KR1020217014930A patent/KR102498607B1/en active Active
- 2011-12-19 BR BR112013015796A patent/BR112013015796A2/en not_active IP Right Cessation
- 2011-12-19 RU RU2013128358/10A patent/RU2592685C2/en active
- 2011-12-19 CA CA2822693A patent/CA2822693C/en active Active
- 2011-12-19 EP EP11804897.4A patent/EP2654804A1/en not_active Withdrawn
- 2011-12-19 MX MX2013007371A patent/MX2013007371A/en unknown
- 2011-12-19 WO PCT/US2011/065794 patent/WO2012087908A1/en not_active Ceased
- 2011-12-19 WO PCT/US2011/065777 patent/WO2012096760A1/en not_active Ceased
- 2011-12-19 SG SG2013048061A patent/SG191292A1/en unknown
- 2011-12-19 KR KR1020187010276A patent/KR20180042442A/en not_active Ceased
- 2011-12-19 NZ NZ612312A patent/NZ612312A/en not_active IP Right Cessation
- 2011-12-19 KR KR1020257003816A patent/KR20250024122A/en active Pending
- 2011-12-19 KR KR1020237004408A patent/KR102766210B1/en active Active
- 2011-12-19 EP EP21190694.6A patent/EP3957332A1/en active Pending
- 2011-12-19 CA CA3159948A patent/CA3159948A1/en active Pending
- 2011-12-19 MX MX2013007365A patent/MX2013007365A/en not_active Application Discontinuation
- 2011-12-19 NZ NZ612161A patent/NZ612161A/en unknown
- 2011-12-19 KR KR1020137019116A patent/KR20140045312A/en not_active Ceased
- 2011-12-19 KR KR1020137019088A patent/KR20130132935A/en not_active Withdrawn
- 2011-12-19 CN CN201180068114.4A patent/CN103533963B/en not_active Expired - Fee Related
-
2013
- 2013-06-17 IL IL227003A patent/IL227003A/en active IP Right Grant
Non-Patent Citations (1)
| Title |
|---|
| See references of WO2012087908A1 * |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN103533963B (en) | With by NOTA complexation [18]the HER2 binding peptide of aluminium fluoride labelling | |
| CN103402550B (en) | With containing 18the HER2 binding peptide of the organosilicon compound substance markers of F | |
| US20240139352A1 (en) | Her2 binders | |
| US9061080B2 (en) | HER2 binding peptides labeled with aluminium-[18] fluoride complexed by NOTA | |
| CN103491984B (en) | Radiolabeled HER2-binding peptide | |
| HK1193987A (en) | Her2 binding peptides labeled with aluminium-[18] fluoride complexed by nota | |
| HK1191244A (en) | Her2 binding peptides labelled with a 18f - containing organosilicon compound | |
| HK1192847B (en) | Radiolabled her2 binding peptides | |
| HK1192847A (en) | Radiolabled her2 binding peptides |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20130619 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| DAX | Request for extension of the european patent (deleted) | ||
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20170701 |