EP2517021A1 - Methods for analyzing components of glycan containing microparticles - Google Patents
Methods for analyzing components of glycan containing microparticlesInfo
- Publication number
- EP2517021A1 EP2517021A1 EP10814745A EP10814745A EP2517021A1 EP 2517021 A1 EP2517021 A1 EP 2517021A1 EP 10814745 A EP10814745 A EP 10814745A EP 10814745 A EP10814745 A EP 10814745A EP 2517021 A1 EP2517021 A1 EP 2517021A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- mps
- glyco
- populations
- glycan
- cell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 239000011859 microparticle Substances 0.000 title claims abstract description 187
- 150000004676 glycans Chemical class 0.000 title claims abstract description 93
- 238000000034 method Methods 0.000 title claims abstract description 65
- 210000004027 cell Anatomy 0.000 claims abstract description 155
- 239000013060 biological fluid Substances 0.000 claims abstract description 97
- 239000000090 biomarker Substances 0.000 claims abstract description 55
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 48
- 150000003904 phospholipids Chemical class 0.000 claims abstract description 31
- 238000011282 treatment Methods 0.000 claims abstract description 22
- TZCPCKNHXULUIY-RGULYWFUSA-N 1,2-distearoyl-sn-glycero-3-phosphoserine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCCCC TZCPCKNHXULUIY-RGULYWFUSA-N 0.000 claims abstract description 15
- ZWZWYGMENQVNFU-UHFFFAOYSA-N Glycerophosphorylserin Natural products OC(=O)C(N)COP(O)(=O)OCC(O)CO ZWZWYGMENQVNFU-UHFFFAOYSA-N 0.000 claims abstract description 15
- 239000003814 drug Substances 0.000 claims abstract description 13
- 229940079593 drug Drugs 0.000 claims abstract description 12
- 238000012544 monitoring process Methods 0.000 claims abstract description 8
- 239000002253 acid Substances 0.000 claims abstract description 6
- 239000011230 binding agent Substances 0.000 claims description 64
- 102000004169 proteins and genes Human genes 0.000 claims description 56
- 108090000623 proteins and genes Proteins 0.000 claims description 56
- 238000000684 flow cytometry Methods 0.000 claims description 32
- 208000035475 disorder Diseases 0.000 claims description 30
- 210000002381 plasma Anatomy 0.000 claims description 29
- 239000003795 chemical substances by application Substances 0.000 claims description 21
- 150000002632 lipids Chemical class 0.000 claims description 21
- 108090001090 Lectins Proteins 0.000 claims description 18
- 102000004856 Lectins Human genes 0.000 claims description 18
- 238000004113 cell culture Methods 0.000 claims description 18
- 239000002523 lectin Substances 0.000 claims description 18
- 210000001519 tissue Anatomy 0.000 claims description 14
- 108020004707 nucleic acids Proteins 0.000 claims description 13
- 102000039446 nucleic acids Human genes 0.000 claims description 13
- 150000007523 nucleic acids Chemical class 0.000 claims description 13
- 230000027455 binding Effects 0.000 claims description 11
- 239000012530 fluid Substances 0.000 claims description 10
- 210000001175 cerebrospinal fluid Anatomy 0.000 claims description 9
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 8
- 239000007790 solid phase Substances 0.000 claims description 8
- 210000002700 urine Anatomy 0.000 claims description 7
- 239000012228 culture supernatant Substances 0.000 claims description 6
- 238000001502 gel electrophoresis Methods 0.000 claims description 6
- 239000007791 liquid phase Substances 0.000 claims description 6
- 238000004949 mass spectrometry Methods 0.000 claims description 6
- 210000000056 organ Anatomy 0.000 claims description 6
- 230000003321 amplification Effects 0.000 claims description 4
- 230000004071 biological effect Effects 0.000 claims description 4
- 238000003018 immunoassay Methods 0.000 claims description 4
- 238000003199 nucleic acid amplification method Methods 0.000 claims description 4
- 230000007170 pathology Effects 0.000 claims description 4
- 206010037423 Pulmonary oedema Diseases 0.000 claims description 3
- 208000036142 Viral infection Diseases 0.000 claims description 3
- 208000005333 pulmonary edema Diseases 0.000 claims description 3
- 210000001179 synovial fluid Anatomy 0.000 claims description 3
- 230000009385 viral infection Effects 0.000 claims description 3
- 238000000099 in vitro assay Methods 0.000 claims description 2
- 150000002484 inorganic compounds Chemical class 0.000 claims description 2
- 229910010272 inorganic material Inorganic materials 0.000 claims description 2
- 210000003296 saliva Anatomy 0.000 claims description 2
- 210000000582 semen Anatomy 0.000 claims description 2
- 239000000427 antigen Substances 0.000 abstract description 36
- 108091007433 antigens Proteins 0.000 abstract description 36
- 102000036639 antigens Human genes 0.000 abstract description 36
- 201000010099 disease Diseases 0.000 abstract description 18
- 238000001514 detection method Methods 0.000 abstract description 14
- 238000002955 isolation Methods 0.000 abstract description 14
- 230000004481 post-translational protein modification Effects 0.000 abstract description 9
- 230000001225 therapeutic effect Effects 0.000 abstract description 5
- 238000003745 diagnosis Methods 0.000 abstract description 3
- 238000011156 evaluation Methods 0.000 abstract description 3
- 108090000672 Annexin A5 Proteins 0.000 description 58
- 102000004121 Annexin A5 Human genes 0.000 description 58
- 210000004369 blood Anatomy 0.000 description 32
- 239000008280 blood Substances 0.000 description 32
- 238000005516 engineering process Methods 0.000 description 23
- 238000004458 analytical method Methods 0.000 description 21
- 230000001640 apoptogenic effect Effects 0.000 description 20
- 241000282414 Homo sapiens Species 0.000 description 18
- 239000000523 sample Substances 0.000 description 18
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 15
- 108010025715 plants leukoagglutinins Proteins 0.000 description 15
- 239000000463 material Substances 0.000 description 13
- 239000000203 mixture Substances 0.000 description 13
- 239000000126 substance Substances 0.000 description 13
- 238000012360 testing method Methods 0.000 description 13
- 241000700159 Rattus Species 0.000 description 12
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 12
- 241001465754 Metazoa Species 0.000 description 11
- 210000001772 blood platelet Anatomy 0.000 description 11
- 150000001720 carbohydrates Chemical class 0.000 description 11
- 239000002609 medium Substances 0.000 description 11
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 10
- 239000011324 bead Substances 0.000 description 10
- 206010012601 diabetes mellitus Diseases 0.000 description 10
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 10
- 238000000926 separation method Methods 0.000 description 10
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 10
- 235000000346 sugar Nutrition 0.000 description 10
- 108010026552 Proteome Proteins 0.000 description 9
- 239000000872 buffer Substances 0.000 description 9
- 238000005119 centrifugation Methods 0.000 description 9
- 230000000694 effects Effects 0.000 description 9
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 9
- 241000699670 Mus sp. Species 0.000 description 8
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 8
- 238000012512 characterization method Methods 0.000 description 8
- 230000000875 corresponding effect Effects 0.000 description 8
- 238000002474 experimental method Methods 0.000 description 8
- 108090000288 Glycoproteins Proteins 0.000 description 7
- 102000003886 Glycoproteins Human genes 0.000 description 7
- 210000002889 endothelial cell Anatomy 0.000 description 7
- 230000013595 glycosylation Effects 0.000 description 7
- 238000006206 glycosylation reaction Methods 0.000 description 7
- IPCSVZSSVZVIGE-UHFFFAOYSA-M hexadecanoate Chemical compound CCCCCCCCCCCCCCCC([O-])=O IPCSVZSSVZVIGE-UHFFFAOYSA-M 0.000 description 7
- 230000008569 process Effects 0.000 description 7
- 238000011002 quantification Methods 0.000 description 7
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 7
- 239000006228 supernatant Substances 0.000 description 7
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 6
- SQVRNKJHWKZAKO-PFQGKNLYSA-N N-acetyl-beta-neuraminic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-PFQGKNLYSA-N 0.000 description 6
- 210000003743 erythrocyte Anatomy 0.000 description 6
- 239000012894 fetal calf serum Substances 0.000 description 6
- 239000000499 gel Substances 0.000 description 6
- 238000000338 in vitro Methods 0.000 description 6
- 230000001965 increasing effect Effects 0.000 description 6
- 230000003993 interaction Effects 0.000 description 6
- 238000002372 labelling Methods 0.000 description 6
- 238000006116 polymerization reaction Methods 0.000 description 6
- 230000004044 response Effects 0.000 description 6
- UMGDCJDMYOKAJW-UHFFFAOYSA-N thiourea Chemical compound NC(N)=S UMGDCJDMYOKAJW-UHFFFAOYSA-N 0.000 description 6
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 5
- 102000004877 Insulin Human genes 0.000 description 5
- 108090001061 Insulin Proteins 0.000 description 5
- 241001521394 Maackia amurensis Species 0.000 description 5
- 241000283984 Rodentia Species 0.000 description 5
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 5
- ZSJLQEPLLKMAKR-UHFFFAOYSA-N Streptozotocin Natural products O=NN(C)C(=O)NC1C(O)OC(CO)C(O)C1O ZSJLQEPLLKMAKR-UHFFFAOYSA-N 0.000 description 5
- 230000006907 apoptotic process Effects 0.000 description 5
- 238000013459 approach Methods 0.000 description 5
- 238000003556 assay Methods 0.000 description 5
- 235000014633 carbohydrates Nutrition 0.000 description 5
- 230000001413 cellular effect Effects 0.000 description 5
- 150000001875 compounds Chemical class 0.000 description 5
- 208000029078 coronary artery disease Diseases 0.000 description 5
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 5
- 239000008103 glucose Substances 0.000 description 5
- 239000001963 growth medium Substances 0.000 description 5
- 230000006698 induction Effects 0.000 description 5
- 229940125396 insulin Drugs 0.000 description 5
- 239000007788 liquid Substances 0.000 description 5
- 239000000101 novel biomarker Substances 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 230000002947 procoagulating effect Effects 0.000 description 5
- 238000000746 purification Methods 0.000 description 5
- 238000004445 quantitative analysis Methods 0.000 description 5
- 229960005322 streptomycin Drugs 0.000 description 5
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 5
- 229960001052 streptozocin Drugs 0.000 description 5
- 238000013293 zucker diabetic fatty rat Methods 0.000 description 5
- 201000001320 Atherosclerosis Diseases 0.000 description 4
- 241000283707 Capra Species 0.000 description 4
- 241000579895 Chlorostilbon Species 0.000 description 4
- 241000699666 Mus <mouse, genus> Species 0.000 description 4
- 229930182555 Penicillin Natural products 0.000 description 4
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 4
- 241000288906 Primates Species 0.000 description 4
- 238000010171 animal model Methods 0.000 description 4
- 239000012298 atmosphere Substances 0.000 description 4
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 4
- 238000001962 electrophoresis Methods 0.000 description 4
- 229910052876 emerald Inorganic materials 0.000 description 4
- 239000010976 emerald Substances 0.000 description 4
- 239000012091 fetal bovine serum Substances 0.000 description 4
- 230000001900 immune effect Effects 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 230000002503 metabolic effect Effects 0.000 description 4
- 239000002245 particle Substances 0.000 description 4
- 230000001991 pathophysiological effect Effects 0.000 description 4
- 239000008188 pellet Substances 0.000 description 4
- 229940049954 penicillin Drugs 0.000 description 4
- 102000004196 processed proteins & peptides Human genes 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 238000011552 rat model Methods 0.000 description 4
- 238000011808 rodent model Methods 0.000 description 4
- 125000005629 sialic acid group Chemical group 0.000 description 4
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 4
- 238000010186 staining Methods 0.000 description 4
- UMCMPZBLKLEWAF-BCTGSCMUSA-N 3-[(3-cholamidopropyl)dimethylammonio]propane-1-sulfonate Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCC[N+](C)(C)CCCS([O-])(=O)=O)C)[C@@]2(C)[C@@H](O)C1 UMCMPZBLKLEWAF-BCTGSCMUSA-N 0.000 description 3
- 102000000412 Annexin Human genes 0.000 description 3
- 108050008874 Annexin Proteins 0.000 description 3
- 208000024172 Cardiovascular disease Diseases 0.000 description 3
- 102000014914 Carrier Proteins Human genes 0.000 description 3
- 102000004127 Cytokines Human genes 0.000 description 3
- 108090000695 Cytokines Proteins 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 229930186217 Glycolipid Natural products 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 101000780122 Homo sapiens Annexin A5 Proteins 0.000 description 3
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 3
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 3
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 3
- 206010028980 Neoplasm Diseases 0.000 description 3
- 101710160107 Outer membrane protein A Proteins 0.000 description 3
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 3
- 239000012620 biological material Substances 0.000 description 3
- 238000001574 biopsy Methods 0.000 description 3
- 201000011510 cancer Diseases 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 208000037976 chronic inflammation Diseases 0.000 description 3
- 208000037893 chronic inflammatory disorder Diseases 0.000 description 3
- 230000002596 correlated effect Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- HKSZLNNOFSGOKW-UHFFFAOYSA-N ent-staurosporine Natural products C12=C3N4C5=CC=CC=C5C3=C3CNC(=O)C3=C2C2=CC=CC=C2N1C1CC(NC)C(OC)C4(C)O1 HKSZLNNOFSGOKW-UHFFFAOYSA-N 0.000 description 3
- 210000001808 exosome Anatomy 0.000 description 3
- 239000000284 extract Substances 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 230000004060 metabolic process Effects 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 229950006780 n-acetylglucosamine Drugs 0.000 description 3
- 210000002569 neuron Anatomy 0.000 description 3
- 229910052757 nitrogen Inorganic materials 0.000 description 3
- 230000001717 pathogenic effect Effects 0.000 description 3
- -1 phosphatidylserine Chemical class 0.000 description 3
- 230000026731 phosphorylation Effects 0.000 description 3
- 238000006366 phosphorylation reaction Methods 0.000 description 3
- 238000011321 prophylaxis Methods 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 206010039073 rheumatoid arthritis Diseases 0.000 description 3
- 239000010979 ruby Substances 0.000 description 3
- 229910001750 ruby Inorganic materials 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 239000012128 staining reagent Substances 0.000 description 3
- HKSZLNNOFSGOKW-FYTWVXJKSA-N staurosporine Chemical compound C12=C3N4C5=CC=CC=C5C3=C3CNC(=O)C3=C2C2=CC=CC=C2N1[C@H]1C[C@@H](NC)[C@@H](OC)[C@]4(C)O1 HKSZLNNOFSGOKW-FYTWVXJKSA-N 0.000 description 3
- 210000000130 stem cell Anatomy 0.000 description 3
- 150000008163 sugars Chemical class 0.000 description 3
- 230000019635 sulfation Effects 0.000 description 3
- 238000005670 sulfation reaction Methods 0.000 description 3
- 239000013589 supplement Substances 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 2
- HVCOBJNICQPDBP-UHFFFAOYSA-N 3-[3-[3,5-dihydroxy-6-methyl-4-(3,4,5-trihydroxy-6-methyloxan-2-yl)oxyoxan-2-yl]oxydecanoyloxy]decanoic acid;hydrate Chemical compound O.OC1C(OC(CC(=O)OC(CCCCCCC)CC(O)=O)CCCCCCC)OC(C)C(O)C1OC1C(O)C(O)C(O)C(C)O1 HVCOBJNICQPDBP-UHFFFAOYSA-N 0.000 description 2
- HJCMDXDYPOUFDY-WHFBIAKZSA-N Ala-Gln Chemical compound C[C@H](N)C(=O)N[C@H](C(O)=O)CCC(N)=O HJCMDXDYPOUFDY-WHFBIAKZSA-N 0.000 description 2
- 208000037260 Atherosclerotic Plaque Diseases 0.000 description 2
- 210000002237 B-cell of pancreatic islet Anatomy 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 2
- 108010078791 Carrier Proteins Proteins 0.000 description 2
- 208000017667 Chronic Disease Diseases 0.000 description 2
- 206010009944 Colon cancer Diseases 0.000 description 2
- VDUXCWJUZIOGJA-JPXBYFMYSA-N Coronarian Chemical compound O[C@H]1O[C@H](COC(=O)CC[N+]([O-])=O)[C@@H](O)[C@H](O)[C@H]1OC(=O)CC[N+]([O-])=O VDUXCWJUZIOGJA-JPXBYFMYSA-N 0.000 description 2
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- PIWKPBJCKXDKJR-UHFFFAOYSA-N Isoflurane Chemical compound FC(F)OC(Cl)C(F)(F)F PIWKPBJCKXDKJR-UHFFFAOYSA-N 0.000 description 2
- 108010074734 Limax flavus agglutinin Proteins 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- MBLBDJOUHNCFQT-UHFFFAOYSA-N N-acetyl-D-galactosamine Natural products CC(=O)NC(C=O)C(O)C(O)C(O)CO MBLBDJOUHNCFQT-UHFFFAOYSA-N 0.000 description 2
- FDJKUWYYUZCUJX-UHFFFAOYSA-N N-glycolyl-beta-neuraminic acid Natural products OCC(O)C(O)C1OC(O)(C(O)=O)CC(O)C1NC(=O)CO FDJKUWYYUZCUJX-UHFFFAOYSA-N 0.000 description 2
- MWUXSHHQAYIFBG-UHFFFAOYSA-N Nitric oxide Chemical compound O=[N] MWUXSHHQAYIFBG-UHFFFAOYSA-N 0.000 description 2
- 108010046016 Peanut Agglutinin Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 206010040047 Sepsis Diseases 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- 108010046516 Wheat Germ Agglutinins Proteins 0.000 description 2
- 230000021736 acetylation Effects 0.000 description 2
- 238000006640 acetylation reaction Methods 0.000 description 2
- 230000001154 acute effect Effects 0.000 description 2
- 150000001413 amino acids Chemical group 0.000 description 2
- 125000003277 amino group Chemical group 0.000 description 2
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 2
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 2
- 108091008324 binding proteins Proteins 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 229910052799 carbon Inorganic materials 0.000 description 2
- 239000006143 cell culture medium Substances 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 239000013068 control sample Substances 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 238000012137 double-staining Methods 0.000 description 2
- 238000001493 electron microscopy Methods 0.000 description 2
- 230000003511 endothelial effect Effects 0.000 description 2
- 230000005284 excitation Effects 0.000 description 2
- 238000005194 fractionation Methods 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 125000000350 glycoloyl group Chemical group O=C([*])C([H])([H])O[H] 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 210000002216 heart Anatomy 0.000 description 2
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 2
- 238000003119 immunoblot Methods 0.000 description 2
- 238000010324 immunological assay Methods 0.000 description 2
- 238000001114 immunoprecipitation Methods 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 229960002725 isoflurane Drugs 0.000 description 2
- BQINXKOTJQCISL-GRCPKETISA-N keto-neuraminic acid Chemical class OC(=O)C(=O)C[C@H](O)[C@@H](N)[C@@H](O)[C@H](O)[C@H](O)CO BQINXKOTJQCISL-GRCPKETISA-N 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 238000000968 medical method and process Methods 0.000 description 2
- 208000030159 metabolic disease Diseases 0.000 description 2
- 238000001471 micro-filtration Methods 0.000 description 2
- 238000000386 microscopy Methods 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- 210000004623 platelet-rich plasma Anatomy 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 230000013823 prenylation Effects 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 238000004393 prognosis Methods 0.000 description 2
- 238000011158 quantitative evaluation Methods 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 239000012679 serum free medium Substances 0.000 description 2
- 230000009450 sialylation Effects 0.000 description 2
- 229940054269 sodium pyruvate Drugs 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- PFNFFQXMRSDOHW-UHFFFAOYSA-N spermine Chemical compound NCCCNCCCCNCCCN PFNFFQXMRSDOHW-UHFFFAOYSA-N 0.000 description 2
- 238000007619 statistical method Methods 0.000 description 2
- CGPUWJWCVCFERF-UHFFFAOYSA-N staurosporine Natural products C12=C3N4C5=CC=CC=C5C3=C3CNC(=O)C3=C2C2=CC=CC=C2N1C1CC(NC)C(OC)C4(OC)O1 CGPUWJWCVCFERF-UHFFFAOYSA-N 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 238000002054 transplantation Methods 0.000 description 2
- 238000000539 two dimensional gel electrophoresis Methods 0.000 description 2
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 2
- 230000034512 ubiquitination Effects 0.000 description 2
- 238000010798 ubiquitination Methods 0.000 description 2
- 238000005199 ultracentrifugation Methods 0.000 description 2
- 238000010200 validation analysis Methods 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 230000035899 viability Effects 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- CZMRCDWAGMRECN-UHFFFAOYSA-N 2-{[3,4-dihydroxy-2,5-bis(hydroxymethyl)oxolan-2-yl]oxy}-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound OCC1OC(CO)(OC2OC(CO)C(O)C(O)C2O)C(O)C1O CZMRCDWAGMRECN-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- HRPVXLWXLXDGHG-UHFFFAOYSA-N Acrylamide Chemical compound NC(=O)C=C HRPVXLWXLXDGHG-UHFFFAOYSA-N 0.000 description 1
- 108010005094 Advanced Glycation End Products Proteins 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 206010002383 Angina Pectoris Diseases 0.000 description 1
- 108091023037 Aptamer Proteins 0.000 description 1
- 206010053555 Arthritis bacterial Diseases 0.000 description 1
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 102000004219 Brain-derived neurotrophic factor Human genes 0.000 description 1
- 108090000715 Brain-derived neurotrophic factor Proteins 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 102100036305 C-C chemokine receptor type 8 Human genes 0.000 description 1
- 102000053028 CD36 Antigens Human genes 0.000 description 1
- 108010045374 CD36 Antigens Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 206010063094 Cerebral malaria Diseases 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 108010062580 Concanavalin A Proteins 0.000 description 1
- SHZGCJCMOBCMKK-UHFFFAOYSA-N D-mannomethylose Natural products CC1OC(O)C(O)C(O)C1O SHZGCJCMOBCMKK-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- HMFHBZSHGGEWLO-SOOFDHNKSA-N D-ribofuranose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H]1O HMFHBZSHGGEWLO-SOOFDHNKSA-N 0.000 description 1
- 206010070901 Diabetic dyslipidaemia Diseases 0.000 description 1
- 208000032928 Dyslipidaemia Diseases 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 206010048554 Endothelial dysfunction Diseases 0.000 description 1
- 208000037487 Endotoxemia Diseases 0.000 description 1
- 241000672609 Escherichia coli BL21 Species 0.000 description 1
- 101000837299 Euglena gracilis Trans-2-enoyl-CoA reductase Proteins 0.000 description 1
- PNNNRSAQSRJVSB-SLPGGIOYSA-N Fucose Natural products C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C=O PNNNRSAQSRJVSB-SLPGGIOYSA-N 0.000 description 1
- 102000005744 Glycoside Hydrolases Human genes 0.000 description 1
- 108010031186 Glycoside Hydrolases Proteins 0.000 description 1
- 208000031886 HIV Infections Diseases 0.000 description 1
- 208000037357 HIV infectious disease Diseases 0.000 description 1
- 229940121710 HMGCoA reductase inhibitor Drugs 0.000 description 1
- 101000716063 Homo sapiens C-C chemokine receptor type 8 Proteins 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 206010061216 Infarction Diseases 0.000 description 1
- 208000004575 Infectious Arthritis Diseases 0.000 description 1
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 1
- 206010022489 Insulin Resistance Diseases 0.000 description 1
- SHZGCJCMOBCMKK-DHVFOXMCSA-N L-fucopyranose Chemical compound C[C@@H]1OC(O)[C@@H](O)[C@H](O)[C@@H]1O SHZGCJCMOBCMKK-DHVFOXMCSA-N 0.000 description 1
- 101710191666 Lactadherin Proteins 0.000 description 1
- 102100039648 Lactadherin Human genes 0.000 description 1
- 208000017170 Lipid metabolism disease Diseases 0.000 description 1
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 1
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 1
- 102000005431 Molecular Chaperones Human genes 0.000 description 1
- 108010006519 Molecular Chaperones Proteins 0.000 description 1
- OVRNDRQMDRJTHS-CBQIKETKSA-N N-Acetyl-D-Galactosamine Chemical compound CC(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@H](O)[C@@H]1O OVRNDRQMDRJTHS-CBQIKETKSA-N 0.000 description 1
- OVRNDRQMDRJTHS-KEWYIRBNSA-N N-acetyl-D-galactosamine Chemical compound CC(=O)N[C@H]1C(O)O[C@H](CO)[C@H](O)[C@@H]1O OVRNDRQMDRJTHS-KEWYIRBNSA-N 0.000 description 1
- OVRNDRQMDRJTHS-ZTVVOAFPSA-N N-acetyl-D-mannosamine Chemical compound CC(=O)N[C@@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-ZTVVOAFPSA-N 0.000 description 1
- OVRNDRQMDRJTHS-OZRXBMAMSA-N N-acetyl-beta-D-mannosamine Chemical compound CC(=O)N[C@@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-OZRXBMAMSA-N 0.000 description 1
- FDJKUWYYUZCUJX-AJKRCSPLSA-N N-glycoloyl-beta-neuraminic acid Chemical compound OC[C@@H](O)[C@@H](O)[C@@H]1O[C@](O)(C(O)=O)C[C@H](O)[C@H]1NC(=O)CO FDJKUWYYUZCUJX-AJKRCSPLSA-N 0.000 description 1
- SUHQNCLNRUAGOO-UHFFFAOYSA-N N-glycoloyl-neuraminic acid Natural products OCC(O)C(O)C(O)C(NC(=O)CO)C(O)CC(=O)C(O)=O SUHQNCLNRUAGOO-UHFFFAOYSA-N 0.000 description 1
- FDJKUWYYUZCUJX-KVNVFURPSA-N N-glycolylneuraminic acid Chemical compound OC[C@H](O)[C@H](O)[C@@H]1O[C@](O)(C(O)=O)C[C@H](O)[C@H]1NC(=O)CO FDJKUWYYUZCUJX-KVNVFURPSA-N 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- 206010029113 Neovascularisation Diseases 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 208000031481 Pathologic Constriction Diseases 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 229940122907 Phosphatase inhibitor Drugs 0.000 description 1
- 108010089814 Plant Lectins Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 102000016611 Proteoglycans Human genes 0.000 description 1
- 108010067787 Proteoglycans Proteins 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 208000001647 Renal Insufficiency Diseases 0.000 description 1
- 208000025747 Rheumatic disease Diseases 0.000 description 1
- PYMYPHUHKUWMLA-LMVFSUKVSA-N Ribose Natural products OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 1
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 1
- BLRPTPMANUNPDV-UHFFFAOYSA-N Silane Chemical compound [SiH4] BLRPTPMANUNPDV-UHFFFAOYSA-N 0.000 description 1
- 108010052164 Sodium Channels Proteins 0.000 description 1
- 102000018674 Sodium Channels Human genes 0.000 description 1
- 208000007718 Stable Angina Diseases 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 102000002262 Thromboplastin Human genes 0.000 description 1
- 108010000499 Thromboplastin Proteins 0.000 description 1
- 108090000901 Transferrin Proteins 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 208000030886 Traumatic Brain injury Diseases 0.000 description 1
- 102000009270 Tumour necrosis factor alpha Human genes 0.000 description 1
- 108050000101 Tumour necrosis factor alpha Proteins 0.000 description 1
- 208000007814 Unstable Angina Diseases 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 240000002895 Vicia hirsuta Species 0.000 description 1
- GBXZONVFWYCRPT-KVTDHHQDSA-N [(2s,3s,4r,5r)-3,4,5,6-tetrahydroxy-1-oxohexan-2-yl] dihydrogen phosphate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](C=O)OP(O)(O)=O GBXZONVFWYCRPT-KVTDHHQDSA-N 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 206010000269 abscess Diseases 0.000 description 1
- 150000001242 acetic acid derivatives Chemical class 0.000 description 1
- 229960001138 acetylsalicylic acid Drugs 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 1
- HMFHBZSHGGEWLO-UHFFFAOYSA-N alpha-D-Furanose-Ribose Natural products OCC1OC(O)C(O)C1O HMFHBZSHGGEWLO-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 210000004381 amniotic fluid Anatomy 0.000 description 1
- 210000001742 aqueous humor Anatomy 0.000 description 1
- PYMYPHUHKUWMLA-WDCZJNDASA-N arabinose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)C=O PYMYPHUHKUWMLA-WDCZJNDASA-N 0.000 description 1
- 238000003491 array Methods 0.000 description 1
- 238000004630 atomic force microscopy Methods 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 239000007640 basal medium Substances 0.000 description 1
- 210000000227 basophil cell of anterior lobe of hypophysis Anatomy 0.000 description 1
- 238000003766 bioinformatics method Methods 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000007321 biological mechanism Effects 0.000 description 1
- 230000008236 biological pathway Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 239000000091 biomarker candidate Substances 0.000 description 1
- 230000008499 blood brain barrier function Effects 0.000 description 1
- 230000017531 blood circulation Effects 0.000 description 1
- 210000001218 blood-brain barrier Anatomy 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 229940077737 brain-derived neurotrophic factor Drugs 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- UDSAIICHUKSCKT-UHFFFAOYSA-N bromophenol blue Chemical compound C1=C(Br)C(O)=C(Br)C=C1C1(C=2C=C(Br)C(O)=C(Br)C=2)C2=CC=CC=C2S(=O)(=O)O1 UDSAIICHUKSCKT-UHFFFAOYSA-N 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 1
- 229940127093 camptothecin Drugs 0.000 description 1
- 238000005251 capillar electrophoresis Methods 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 108091008400 carbohydrate binding proteins Proteins 0.000 description 1
- 102000023852 carbohydrate binding proteins Human genes 0.000 description 1
- 239000002041 carbon nanotube Substances 0.000 description 1
- 229910021393 carbon nanotube Inorganic materials 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 230000019522 cellular metabolic process Effects 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 210000003850 cellular structure Anatomy 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 125000003636 chemical group Chemical group 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 210000003040 circulating cell Anatomy 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 239000005515 coenzyme Substances 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 238000010835 comparative analysis Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 210000004351 coronary vessel Anatomy 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 230000005786 degenerative changes Effects 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 229940000406 drug candidate Drugs 0.000 description 1
- 238000007876 drug discovery Methods 0.000 description 1
- 239000003596 drug target Substances 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 238000002296 dynamic light scattering Methods 0.000 description 1
- 230000002526 effect on cardiovascular system Effects 0.000 description 1
- 230000005670 electromagnetic radiation Effects 0.000 description 1
- 230000008694 endothelial dysfunction Effects 0.000 description 1
- 210000003989 endothelium vascular Anatomy 0.000 description 1
- 239000002158 endotoxin Substances 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 230000009144 enzymatic modification Effects 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 239000006167 equilibration buffer Substances 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 238000001917 fluorescence detection Methods 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 150000002270 gangliosides Chemical class 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 108091005996 glycated proteins Proteins 0.000 description 1
- 230000036252 glycation Effects 0.000 description 1
- 108091010992 glycosaminoglycan binding proteins Proteins 0.000 description 1
- 102000036208 glycosaminoglycan binding proteins Human genes 0.000 description 1
- 230000036449 good health Effects 0.000 description 1
- 239000011544 gradient gel Substances 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- 229920000140 heteropolymer Polymers 0.000 description 1
- 150000002402 hexoses Chemical class 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 208000033519 human immunodeficiency virus infectious disease Diseases 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000003100 immobilizing effect Effects 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000007574 infarction Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 230000003914 insulin secretion Effects 0.000 description 1
- 206010022498 insulinoma Diseases 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 230000008611 intercellular interaction Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- PGLTVOMIXTUURA-UHFFFAOYSA-N iodoacetamide Chemical compound NC(=O)CI PGLTVOMIXTUURA-UHFFFAOYSA-N 0.000 description 1
- 230000000302 ischemic effect Effects 0.000 description 1
- 210000004153 islets of langerhan Anatomy 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 201000006370 kidney failure Diseases 0.000 description 1
- 102000005861 leptin receptors Human genes 0.000 description 1
- 108010019813 leptin receptors Proteins 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 229920006008 lipopolysaccharide Polymers 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 210000005229 liver cell Anatomy 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 206010025135 lupus erythematosus Diseases 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 238000000816 matrix-assisted laser desorption--ionisation Methods 0.000 description 1
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 210000002284 membrane microdomain Anatomy 0.000 description 1
- 210000002901 mesenchymal stem cell Anatomy 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 230000002025 microglial effect Effects 0.000 description 1
- 238000000329 molecular dynamics simulation Methods 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 230000002107 myocardial effect Effects 0.000 description 1
- 208000010125 myocardial infarction Diseases 0.000 description 1
- 239000002086 nanomaterial Substances 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- CERZMXAJYMMUDR-UHFFFAOYSA-N neuraminic acid Natural products NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO CERZMXAJYMMUDR-UHFFFAOYSA-N 0.000 description 1
- 230000004770 neurodegeneration Effects 0.000 description 1
- 208000015122 neurodegenerative disease Diseases 0.000 description 1
- 230000000926 neurological effect Effects 0.000 description 1
- 210000000019 nipple aspirate fluid Anatomy 0.000 description 1
- 230000001473 noxious effect Effects 0.000 description 1
- 229920001542 oligosaccharide Polymers 0.000 description 1
- 150000002482 oligosaccharides Chemical class 0.000 description 1
- 201000008482 osteoarthritis Diseases 0.000 description 1
- DIVDFFZHCJEHGG-UHFFFAOYSA-N oxidopamine Chemical compound NCCC1=CC(O)=C(O)C=C1O DIVDFFZHCJEHGG-UHFFFAOYSA-N 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 208000021255 pancreatic insulinoma Diseases 0.000 description 1
- 201000003045 paroxysmal nocturnal hemoglobinuria Diseases 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000004963 pathophysiological condition Effects 0.000 description 1
- 230000008289 pathophysiological mechanism Effects 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 230000035479 physiological effects, processes and functions Effects 0.000 description 1
- 239000003726 plant lectin Substances 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 108010057417 polysialyl neural cell adhesion molecule Proteins 0.000 description 1
- 108091005611 polysialylated proteins Proteins 0.000 description 1
- 230000001323 posttranslational effect Effects 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000002250 progressing effect Effects 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 238000000575 proteomic method Methods 0.000 description 1
- 238000004451 qualitative analysis Methods 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 229930002330 retinoic acid Natural products 0.000 description 1
- 230000000250 revascularization Effects 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000011896 sensitive detection Methods 0.000 description 1
- 201000001223 septic arthritis Diseases 0.000 description 1
- 239000004017 serum-free culture medium Substances 0.000 description 1
- 125000005630 sialyl group Chemical group 0.000 description 1
- 208000007056 sickle cell anemia Diseases 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 229910000077 silane Inorganic materials 0.000 description 1
- 108010076805 snowdrop lectin Proteins 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 229940063675 spermine Drugs 0.000 description 1
- 238000013222 sprague-dawley male rat Methods 0.000 description 1
- 238000012453 sprague-dawley rat model Methods 0.000 description 1
- 230000036262 stenosis Effects 0.000 description 1
- 208000037804 stenosis Diseases 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 150000003467 sulfuric acid derivatives Chemical class 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 206010043554 thrombocytopenia Diseases 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 230000009529 traumatic brain injury Effects 0.000 description 1
- 230000000472 traumatic effect Effects 0.000 description 1
- 230000008736 traumatic injury Effects 0.000 description 1
- 229960001727 tretinoin Drugs 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 238000002604 ultrasonography Methods 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 230000002485 urinary effect Effects 0.000 description 1
- 208000019553 vascular disease Diseases 0.000 description 1
- 210000003556 vascular endothelial cell Anatomy 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 210000004127 vitreous body Anatomy 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2400/00—Assays, e.g. immunoassays or enzyme assays, involving carbohydrates
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2405/00—Assays, e.g. immunoassays or enzyme assays, involving lipids
- G01N2405/04—Phospholipids, i.e. phosphoglycerides
Definitions
- the present invention relates to methods for isolating, characterizing, comparing and using specific biological components in the biological fluids that are characterized on the basis of post-translational modifications of cell surface, and that can be used for the medical management of disorders.
- Biomarker research activities suffer from a major technical problem related to the presence of extremely abundant proteins within biological fluids that mask the less abundant sub-proteome that can provide reliable biomarkers of medical interest.
- specific analytical and/or protein- depletion technologies are used to exclude proteins such as albumin, immunoglobulins, or transferrin and try circumventing this problem (Thouvenot E et al , 2008; Apweiler R et al , 2009a).
- MPs circulating microparticles
- a growing number of preclinical and clinical studies indicate circulating microparticles (MPs) as potential biomarkers and/or additional mediators of protein-based signalling through cell surface receptors or transporter.
- MPs are vesicles having a size comprised between 1 and 0.1 micrometer that are formed by the plasma membrane and shed from apoptotic or otherwise activated cell types in response to various conditions and stimuli (chemicals, growth factors, shear stress, apoptotic signals, etc.).
- MPs composition and membrane antigens are dependent from the cellular origin and/or the type of stimulus that triggered their generation.
- MPs formation is associated with the loss of membrane asymmetry and the exposure of specific phospholipids, such as phosphatidylserine, on the outer leaflet which, together with MPs surface antigen, are responsible of strong procoagulant activity that MPs normally exhibit.
- Phospholipid-binding agents in particular proteins (Stace C and Ktistakis N. 2006; Lemmon M, 2008), are used for the affinity- based isolation of MPs, after being separated from cellular components within the biological fluid by centrifugation.
- exosomes other types of vesicular particles, called exosomes, are also released after cell activation and can be co-purified with MPs, but they diverge from MPs in size (in general below 0.1 micrometer), surface antigens (given their intracellular origin), and absence of phosphatidylserine, leading to potential confusions and doubts on the actual relevance of some published data (Horstman L et al , 2007; Thery C et al, 2009).
- MPs are present in the blood of healthy individuals (being produced in particular by endothelial cells, platelets and other circulating cells) but their absolute levels as well as the proportion of their different cellular origin may dramatically change under several pathological conditions. MPs appear as being released from a large variety of cell types within biological fluids, consequently shedding cell antigens that can be relevant for various biological functions or disorders that are associated to inflammation and apoptosis.
- MPs are generally believed to have noxious properties, related to their high procoagulant activity and capability of impairing endothelial activities, inhibiting Nitric Oxide production, inducing cytokine release, and activating cell proliferation and many other biological pathways (Morel O et al , 2009; Mause S et al, 2005; Leroyer A et al, 2007; Mezentsev A et al, 2005; Essayagh S et al, 2005).
- MPs derived from platelets, endothelial cells and monocytes, in diseases such as thrombocytopenia, paroxysmal nocturnal haemoglobinuria, sickle cell disease and other chronic inflammatory disorders have been established.
- the levels of MPs have been shown to be significantly increased and correlated with the development of number of different disorders, including diabetes (Koga H et al, 2005; Sabatier F et al , 2002), HIV infection (Mack M et al, 2000), autoimmune and rheumatic diseases (Beyer C and Pisetsky D, 2010), following heart, stem cell or kidney transplantation (Al-Massarani G et al, 2009; Nomura S et al , 2008; Garcia S et al, 2005), neoangiogenesis and cancer (Mostefai H et al, 2008), sepsis (Soriano A et al. 2005), neurological pathologies (Horstman L et al.
- MPs have been also detected in cerebrospinal fluid and plasma, for example after traumatic brain injury (Morel N et al , 2008), as well as in pulmonary edema fluid (Bastarache J et al, 2009), and as a consequence to the exposure of blood to carbon nanotubes (Semberova J et al. 2009) or coronary stents (Inoue T et al , 2006).
- MPs-based proteomic studies can provide novel biomarkers, in particular for atherosclerosis and other vascular diseases (Merrick B, 2008; Smalley D et al, 2008b; Boulanger C et al. 2006; Shantsila E, 2009), MPs have not been clinically validated yet as biomarkers, apart from preliminary studies on cell type-specific MPs populations that are released from endothelial cells in patients at high risk for coronary heart disease (Nozaki T et al , 2009).
- PTM post-translationally modified
- Phosphorylation, glycosylation, ubiquitination, and prenylation are the most common and characterized categories of post-translational modifications but, by including specific variants, more than 300 modifications have been listed, and large repertoires of PTM proteins have been generated in databases such as dbPTM (Lee H et al , 2009) and HPRD (Keshava Prasad J et al, 2009).
- the present invention provides methods for isolating, characterizing, comparing, and using novel components of biological fluids that are characterized within MPs populations on the basis of post-translational modifications present on cell surface.
- Glycan-containing Microparticles (Glyco-MPs) populations have been characterized on the basis of their dimension (comprised between 0.1 and 1 microMeter) and the presence of glycan epitopes (such as polysialic acid) on their surface.
- the methods involve the isolation of biological fluids (in particular of human, primate, or rodent origin) and the separation of Glyco-MPs from the acellular fraction of such biological fluids using at least a glycan-binding agent in a solid or a liquid phase.
- Glyco-MPs can be further isolated, characterized, and/or compared using additional binding agents that are specific for cell surface components, such as phospholipids (and in particular phosphatidyl serine) and/or cell specific antigens.
- the Glyco-MPs that are obtained by this method can be used to establish the concentration and/or other molecular components (such as cell-specific antigens, phospholipids, or glycans) that differ between control and test subjects (e.g., normal or at risk of a disease, treated or untreated for a disease) and that can be used as biomarkers within biological fluids for diagnosing or monitoring diseases in a subject, and/or for evaluating the therapeutic efficacy of a medical treatment or a candidate drug.
- concentration and/or other molecular components such as cell-specific antigens, phospholipids, or glycans
- biomarkers within biological fluids for diagnosing or monitoring diseases in a subject, and/or for evaluating the therapeutic efficacy of a medical treatment or a candidate drug.
- Control Samples e.g., from one or more healthy or untreated subjects
- Test Samples e.g., from one or more disease-affected or treated subjects
- the Control Samples and the Test Samples can be different biological fluids obtained from the same subject (e.g. , blood and cerebrospinal fluid, or blood and urine), for evaluating the presence of Glyco-MPs populations in different physiological locations.
- the corresponding Glyco-MPs populations are then isolated on the basis of their size and by means of at least a Gly can-binding agent that binds the surface of Glyco-MPs in experimental conditions that allow maintaining their integrity. Binding agents that recognize other components of Glyco-MPs surface (such as phospholipids and/or cell type-specific antigens) can be also used for isolating and characterizing Glyco-MPs (sub) populations in the preferred format (in solid or liquid phase).
- the resulting materials are then compared by any of the known methods for analyzing materials of biological origin that can lead to the determination of features that are associated to a Glyco-MPs subpopulation (or to a MPs subpopulation that lacks the glycan epitope associated to a specific Glyco-MPs subpopulation) in specific subjects, biological fluids, and/or patho-physiological conditions. Then, this signature can be used for evaluating the status of a given subject with (or without) the isolation of Glyco-MPs populations.
- Total plasma MPs were prepared as described in the Material & Methods section of Example 1 and stored at -80°C until use.
- the different MP populations have been detected and quantified by flow cytometry using, as fluorescently labelled binding agents, Annexin V (AnnV), MAA lectin (MAA), an anti-erythroid cells antibody (TER1 19), and anti-CD41 antibody (CD41) in the indicated combinations (Panel A).
- the level of Glucose and Insulin were measured in the corresponding mice group.
- the glucose and insulin levels in the corresponding mice groups are provided (Panels B and C). Data are expressed as Mean ⁇ SEM.
- Figure 4 Quantitative analysis of Glyco-MPs populations in human plasma.
- An exemplary process for the characterization of feature(s) that allow comparing Glyco-MPs (sub)populations having specific cell origins involves the generation and the isolation of Glyco-MPs from primary cells or cell lines having specific origin (e.g. , pancreatic cells, leukocytes, platelets, neuronal cells, endothelial cells, stem cells).
- Control and Test cell cultures e.g., differentiated or undifferentiated, treated or untreated, healthy or in an apoptotic state
- normal (or disease-specific) features that can be identified as being associated to Glyco-MPs (sub) populations, such as cell surface antigens having specific cell origins in a given biological fluid, that can be used for the analysis of biological fluids in different categories of subjects (e.g., being treated or not treated, affected or no affected by a disorder) for determining if any of them can be defined as a biomarker associated to a normal or disorder-specific status.
- Figure 6 Antigen-independent quantitative analysis of Glyco-MPs of Control and Test Glyco-MPs populations from a cell line.
- Min6 cell cultures were treated for 24 hours with palmitate at two concentrations (1.0 mM or 1.5 mM) or vehicle only (BSA) in serum-free medium.
- BSA vehicle only
- cell culture medium was collected and total Annexin V- positive MPs (Panel A) and PolySia(2-2B antibody)-positive Glyco-MPs (Panel B) were stained with fluorescently labelled Annexin V and anti-PolySia 2-2B antibody, respectively, and then quantified by flow cytometry.
- the data on the effect of palmitate on Glyco-MP generation in this cell line are representative of three independent experiments. Similar results were obtained with Min6 cells using staurosporin as apoptotic agent (data not shown).
- Figure 7 Quantitative analysis of Glyco-MPs of Control and Test Glyco-MPs populations from cell lines of different origins.
- the indicated cell lines were exposed to an apoptotic agent and the
- MPs populations were analyzed in terms of percentage of Annexin V-positive MPs subpopulations that correspond to either 2-2B antibody- or MAA-specific Glyco-MPs subpopulations, as determined by flow cytometry (Panel A).
- the analysis has been then performed in more detail for two cell lines (HT29, Panel B; HepG2, Panel C) by comparing the data that have been generated by flow cytometry using a series of fluorescently labelled binding agents either at the level of cell surface (as percentages of all cells) or at the level of the concentration of MPs populations (as Annexin V-positive MPs population and as specific Glyco-MPs subpopulations concentration) in the cell culture supernatant. The comparison is made between control and apoptotic conditions as defined in Example 2. The average fold induction for Annexin V-positive MPs population for HT29 and HepG2 cells was of 4.0 and 12.9, respectively
- Min6 cell cultures were treated for 24 hours with ImM palmitate in serum-free medium.
- culture medium was collected and total MPs were prepared for 2D-gel electrophoresis as described in the Material & Methods section of Example 2.
- Total proteins (Panel A) and glycoproteins (Panel B) were visualized on the same gel by staining it with SYPRO Ruby and ProQ Emerald 488 staining reagents, respectively.
- images were captured using a Typhoon 9400 laser scanner in the area at low pi and medium molecular weight. Specific proteins that appears in a specific region of the gel has being modified with a glycan are indicated with a code and an arrow.
- the analysis of the Glyco-MPs proteome that is detected using from cell culture or other biological fluids can be pursued in more details using the technical approaches described in the literature.
- the present invention is based on unexpected findings of the presence and distribution of a specific post-translational modification on the surface of MPs populations. These evidences suggest that MPs populations that are isolated within biological fluids on the basis of at least a post-translational modification (such as phosphorylation, glycosylation, ubiquitination, and prenylation) can be used for obtaining information for the medical management of disorders, in particular for defining and comparing biomarkers present in biological fluids.
- a post-translational modification such as phosphorylation, glycosylation, ubiquitination, and prenylation
- the glycan epitopes that are present on the surface of MPs populations can be used for isolating and characterizing a novel and useful MPs population named as Glyco-MPs.
- Glyco-MPs populations can provide information about the state of a tissue, a cell population, an organ, or a subject through the analysis of biological fluids where MPs populations are released from cells. Changes in the regulation and processing of glycans have been correlated to a number of abnormal physiologic conditions.
- Glyco-MPs populations do not simply represent MPs subpopulations having a specific cell origin, but are possibly the result of the aggregation of MPs populations having different cell origins, independently (or not) from cell type-specific antigens.
- the detection of the Glyco- MPs populations may serve as a proxy for detection of a relevant MPs population in a phosphatidylserine and/or cell type-independent manner.
- phosphatidylserine- based MPs can be usefully combined in methods that allow isolating Glyco-MPs subpopulations that represent a more informative MPs subpopulation for proteomic, immunologic, and/or glycomic analysis.
- the isolation, the comparison, and the use of Glyco-MPs populations is intended to provide means for a more sensitive detection and characterization of biological features that can be used as biomarkers for a disorder.
- a method for identifying Glycan-containing Microparticles (Glyco- MPs) populations in a biological fluid comprises the following steps:
- the step (c) of the method involves separating the Glyco-MPs populations from the said acellular fraction by means of an agent that binds a specific epitope (such as an N-linked Glycan, an O-linked Glycan, or PolySia-related epitope) as glycan-binding agent.
- the step (c) of the method may also involve the use of at least one further binding agent recognizing a phospholipid, a protein, a lipid, or a glycan other than the selected glycan epitope (e.g. , an PolySia- related epitope).
- Glyco-MPs refers to phospholipid-containing vesicles of cellular origin that have a submicron dimension, in particular comprised between 100 and 1000 nanometers, and that are separated from a biological fluid by means of at least a glycan-binding agent.
- the origin of the Glyco-MPs can be established on the basis of the presence of molecules that are known to be associated to a cell type, and in particular those localized on the cell surface.
- Glyco-MPs populations are originated by cell types that form organs or tissues, at the interface between the biological fluids and tissues (i.e. endothelial cells or the blood-brain barrier) or within the biological fluids itself (e.g. , platelets, erythrocytes).
- Glyco-MPs populations can be also isolated using biological fluids obtained in cell culture conditions from laboratory cell lines and primary cells of animal origin that are isolated from biopsies or biological fluids.
- Flow cytometry is a preferred technology for isolating Glyco-MPs populations (and MPs in general for in vitro/ex vivo studies) according to their size and it can be standardized using size-calibrated fluorescent beads (Robert S et al , 2009; Rukoyatkina N et al , 2009).
- Flow cytometry analysis of Glyco-MPs populations can be performed by adapting technologies that have developed for the measurement, the preparative sorting into distinct size fractions, and the image processing of artificial nanoparticles and liposomes having similar size (van Gaal E et al , 2010; unding A et al, 2008).
- separating refers to both the physical separation and isolation of Glyco-MPs populations (and of MPs populations in general) from a biological fluid (e.g., by microfiltration or centrifugation), and the separation of Glyco-MPs populations (and of MPs populations in general) that can be performed by technologies, such flow cytometry or microscopy, which provide means for detecting images and other quantifiable signals characterizing MPs within a sample.
- biological fluids refers to any bodily fluid (and fraction thereof) from, excreted by or secreted by any living cell or organism, including but not limited to blood, cerebrospinal fluid, urine, synovial fluid, bronchoalveolar lavage fluid, aqueous/vitreous humor, amniotic fluid, seminal fluid, saliva, nipple aspirate fluid, pulmonary edema fluid, tears, proximal fluid (the fluid derived from the extracellular milieu of tissues), fluids obtained from an abscess (or any other infection or inflammation site) or a joint (if affected by disease such as rheumatoid arthritis, osteoarthritis or septic arthritis).
- sample encompasses both an initial aliquot of the biological fluid as well as the product of any manipulation of the initial source of proteins, including but not limited to partial purification, fractionation, enzyme digestion, or other treatment.
- acellular fraction refers to a fraction of a biological fluid in which cells are absent, for example following a centrifugation, a separation by flow cytometry, or an affinity-based chromatography or sorting.
- the methods of the invention involve the isolation of biological fluids from humans, primates, rodents, or any other animal presenting an interest for medical or veterinary research.
- the biological fluids can be obtained by puncture, involving the removal of a volume of at least 0.01 ml ⁇ e.g., in smaller animal) or at least 1 ml (e.g. , in human or primates).
- the biological fluid is not mixed with cells that results from the rupture of tissues that contains the biological fluid (such as arterial or venous walls in the case of blood) during the puncture, thus excluding any contamination from uhdesired tissues and cell types.
- the isolation of the acellular fraction of biological fluids can be performed by eliminating any cellular elements having a size superior to 1000 nanometers, as it is made possible by flow cytometry, microfiltration, or centrifugation. Consistently with what described in the literature (Piccin A et al, 2007), the separation of the Glyco-MPs populations from the acellular fraction of a biological fluid can be performed by applying technologies for isolating cell vesicles having a diameter comprised between 100 and 1000 nm, as well as a composition, that is typical of Glyco-MPs populations.
- the centrifugation of the biological fluids can be performed at a speed comprised between l,500g and 15,000g, at a temperature comprised between 15°C and 37°C, and for a time comprised between 1 minutes and 60 minutes should allow the separation of fraction containing the Glyco-MPs populations (the supernatants) from the cells (forming the pellet).
- a further purification step can be performed to isolate Glyco-MPs (but not exosomes) by centrifuging the supernatant obtained above at a speed comprised between 15,000g and 30,000g, at a temperature comprised between 15°C and 37°C, and for a time comprised between 1 and 60 minutes, in order to obtain a pellet formed by Glyco-MPs populations.
- binding agent refers to any material that can bind to the desired molecule (that is, a component of Glyco-MPs such as a protein, a protein variant, a phospholipid, a glycan, or a lipid) and consequently allow detecting, labelling, and/or separating the structures containg such molecule (i. e. Glyco-MPs) in a sample (i.e. the acellular fraction of a biological fluid), preferably by interacting with components on the surface of Glyco-MPs.
- a component of Glyco-MPs such as a protein, a protein variant, a phospholipid, a glycan, or a lipid
- the binding agent for the desired molecule can be a natural or recombinant protein (such as an antibody or a protein that binds a cell surface antigen), a peptide, a lectin, a glycan, a nucleic acid, a lipid, a phospholipid, an inorganic compound, a nanomaterial, a nucleic acid, an aptamer or a low molecular weight ligand.
- a natural or recombinant protein such as an antibody or a protein that binds a cell surface antigen
- a peptide such as an antibody or a protein that binds a cell surface antigen
- a peptide such as an antibody or a protein that binds a cell surface antigen
- a peptide such as an antibody or a protein that binds a cell surface antigen
- a peptide such as an antibody or a protein that binds a cell surface antigen
- a lectin such as an antibody or
- the binding agent for the desired molecule can be labelled.
- the label can produce a signal detectable by external means, for example, desirably by visual examination or by electromagnetic radiation, heat, and chemical reagents.
- the label or other signal producing system component can also be bound to a specific binding partner, another molecule or to a support such as beads, using any method known in the art, such as chemically cross-linking or using the biotin-streptavidin system.
- the label can directly produce a signal, and therefore, additional components are not required to produce a signal.
- Numerous organic molecules for example fluorescers (such as FITC, PE, and any other known to be compatible with flow cytometry-based MPs detection), absorb ultraviolet and visible light.
- labels directly produce a signal, such as radioactive isotopes and dyes.
- the label may need other components to produce a signal, and the signal producing system would then include all the components required to produce a measurable signal, which may include substrates, coenzymes, metal ions, or substances that react with enzymatic products.
- the binding agent for the desired molecule (that is, a component of Glyco-MPs surface) can be provided in a liquid phase or in a solid phase (for example, by the immobilization on a bead or a plate from which it can be or not separated) forming thus a complex with the Glyco-MPs once that the acellular fraction of a biological fluid is contacted with such agent. Subsequently, depending on the further uses, such complex can be dissociated (for instance, by temperature or chemical- induced denaturation) or the binding agent for the desired molecule can be kept associated.
- Glycan refers to chemical groups also named as sugars or carbohydrates.
- Glycans can be monomers or polymers of sugar residues, but typically contain at least three sugars, and can be linear or branched.
- a glycan may include natural sugar residues (e.g., glucose, N- acetylglucosamine, N-acetyl neuraminic acid, galactose, mannose, fucose, hexose, arabinose, ribose, xylose, sialic acids) and/or modified sugars (e.g., 2'-fluororibose, 2'-deoxyribose, phosphomannose).
- natural sugar residues e.g., glucose, N- acetylglucosamine, N-acetyl neuraminic acid, galactose, mannose, fucose, hexose, arabinose, ribose, xylose, sialic acids
- modified sugars e.g., 2'-fluororib
- Glycans can be distinguished in N-linked, O-linked, or C-linked glycans on the basis of the linkage to a glycoconjugate via nitrogen, oxygen, or carbon linkage.
- the glycoconjugate can be also in the form of an advanced glycation end products, resulting from the non-enzymatic modification of glycans.
- the relevance of protein glycation has been demonstrated in several pathological conditions, including chronic complications associated to diabetes mellitus and renal failure as well as degenerative changes, and more sensitive and selective methods are now available for identification and quantification of such glycated proteins (Priego Capote F and Sanchez J, 2009; Thornalley P, 2005,).
- glycocan refers in general to the carbohydrate portion of a glycoconjugate, includes, but is not limited to, glycoproteins, glycolipids, proteoglycans and glycophosphosphingolipids or any other known glycoconjugate that present a glycan epitope.
- Glycoconjugates are found predominantly on the outer cell wall and in secreted fluids usually consist of O- or N- glycosidic linkages of oligosaccharides (a polymer containing a small number, typically three to ten saccharides) to compatible amino acid side chains in proteins or to lipid moieties. Some glycans also have modifications such as acetylation and sulfation.
- Glycoconjugates contain cell-surface glycans that have been shown to be important in cell-cell interactions due to the presence on the cell surface of various glycan binding receptors, in addition to the glycoconjugates themselves.
- cell surface glycan refers to a glycan that is present on the exterior surface of a cell that is, in general, covalently linked to a polypeptide (as part of a cell-surface glycoprotein) or a lipid (as part of a cell membrane glycolipid) and that can be exposed as well on the surface of Glyco-MPs populations.
- a cell surface glycan are formed by homo- and/or heteropolymers of sugar residues which form specific glycan epitopes (also called giycoepitopes) that are specifically recognized by glycan-binding agent.
- glycocan-binding agent refers to binding agents that specifically bind a glycoepitope.
- Recognition systems of giycoepitopes include, but is not limited to, antibodies, lectins (of animal, plant, or pathogen origin), enzymes containing carbohydrate recognition domain (CRD), antibodies against glycans, cytokines, chaperone and transport proteins, microbial carbohydrate-binding proteins, glycosaminoglycan-binding proteins, or any other known recognition system for glycan epitopes, without limitation.
- glycan-binding agents including the mass of part or all of the saccharide structure, the charges of the chemical units of the saccharide, identities of the chemical units of the saccharide, total charge of the saccharide, or total number of sulfates or acetates.
- the methods that are applicable for identifying such properties include, but are not limited to, capillary electrophoresis, NMR, mass spectrometry (both MALDI and ESI), and HPLC with fluorescence detection.
- Glycans can be detected and/or analyzed on Glyco-MPs, either in the absence or in presence of proteases or glycosidase.
- glycan epitopes that can be used for isolating and characterized within Glyco-MPs populations may be explored using technologies for comparative glycan analysis (Krishnamoorthy L and Mahal L, 2009) and synthesis (Bernades G et al, 2009), glycan arrays (Taylor M and Drickamer K, 2009), means for interfering protein-glycan interactions (Rek A et al, 2009), bioinformatics methods (Mahal L, 2008), and chemical tools for binding and/or modifying glycans, for example for studying the biology of carbohydrates in neuronal cells (Murrey H and Hsieh- Wilson L, 2008; Yanagisawa M and Yu R, 2007; Hwang H et al, 2010).
- lectins are of particular interest given their specificity for different sugar moieties that are either onto a soluble carbohydrate or onto a carbohydrate moiety that is a part of a glycoprotein or glycolipid (Gemeiner P et al, 2009). Consequently, distinct glycopro files can be generated and compared according to the choice and/or the combination of lectins according to their glycan epitope.
- a list of lectin that can be used in the methods of the invention includes: GNA (Snowdrop lectin), PNA (Peanut agglutinin), VVL (Hairy vetch lectin), WGA (Wheat Germ agglutinin), SNA (Sambuscus nigra lectin), MAL/MAA (Maackia amurensis leukoagglutinin), MAH (Maackia amurensis hemoagglutinin), LFA (Limax flavus agglutinin) and ConA (Concanavalin A).
- sialic acid is a generic term for the N- or O- substituted derivatives of neuraminic acid, a nine-carbon monosaccharide (Varki A, 2008).
- the amino group of neuraminic acid typically bears either an acetyl or a glycolyl group in a sialic acid. It is also the name for the most common member of this group, N-acetylneuraminic acid (Neu5Ac or NANA) and 2-Keto-3- deoxynononic acid (Kdn).
- sialic acids include, but are not limited to, N-Acetylglucosamine, N- Acetylgalactosamine (GalNAc), N-Acetylmannosamine (ManNAc) and N-Glycolylneur- aminic acid (Neu5Gc).
- Sialic acids are found widely distributed in animal tissues and in bacteria, especially in glycoproteins and gangliosides. The amino group bears either an acetyl or a glycolyl group. The hydroxyl substituents may vary considerably: acetyl, lactyl, methyl, sulfate and phosphate groups have been found.
- Hydroxyl substituents present on the sialic acid may be modified by acetylation, methylation, sulfation, and phosphorylation.
- the predominant sialic acid is N-acetylneuraminic acid (Neu5Ac).
- Sialic acids impart a negative charge to glycans, because the carboxyl group tends to dissociate a proton at physiological pH.
- Glycosylation changes associated with apoptosis have been reported in different cell lines from different histological origin (colon, breast, pancreas, and bladder cancer) as these cells are recognized by selected lectins, in presence or in absence of specific enzymes that synthesize or degrade sugar chains (Malagolini N et al, 2009).
- histological origin colon, breast, pancreas, and bladder cancer
- specific enzymes that synthesize or degrade sugar chains
- Antibodies to variants of PolySia-related epitopes have been generated and compared in terms of binding specificity, epitope presentation, and degree of polymerization (Hayrinen J et al, 1995; Hayrinen J et al , 2002; Sato C et al, 1995; Sato C et al , 2000), establishing the specificity of these antibodies for PolySia related epitopes having defined lengths arid degrees of polymerization ranging from 2 up to 200 sialyl residues.
- a series of human and rodent proteins have been showed as presenting one or more PolySia-related epitopes and/or degree of polymerization of the PolySia-related epitopes, the main one being PSA-NCAM has been used for identifying, studying the activities, and/or sorting specific cell types such as neuronal cells (Bonfanti L, 2006) and pancreatic beta-cell subpopulations (Banerjee M and Otonkoski T, 2009).
- Other proteins presenting PolySia-related epitopes have been identified such as betal integrin (Bartik P et al , 2008) and DPP-4 (Cuchacovich M et al.
- Glyco-MPs populations and such glycan- binding agents can be studied by means of competing soluble glycans such as those generated using chemical technologies and characterized by mass spectrometry (Galuska S et al , 2007; Patane J et al , 2009). Moreover, technologies for the enrichment of peptides that are linked to glycans can be used for the analysis of the structure and attachment site identification of glycans that are present on the Glyco- MPs populations (Nilsson J et al, 2009). Series of glycan-binding agents may be used for detecting and isolating different types of Glyco-MPs subpopulations in parallel.
- glycan-binding agents that are compatible with technologies that maintain MPs integrity (such as FACS, immunological assays, or magnetic beads-based cell isolation are preferred.
- a panel of antibodies and binding proteins that have been characterized in the literature for different PolySia-related epitopes into biological materials can be used for detecting, isolating and comparing the corresponding Glyco-MPs (sub)populations presenting such PolySia-related epitopes.
- This analysis can be accompanied also by the detection of known cell type-specific antigens (using antibodies or other molecules that specifically bind such antigens) that can be more or less frequently associated to total MPs populations or Glyco-MPs (sub) populations within biological fluids and/or in cell culture conditions.
- known cell type-specific antigens using antibodies or other molecules that specifically bind such antigens
- Glyco-MPs sub populations within biological fluids and/or in cell culture conditions.
- Glyco-MPs populations that expose glycan epitopes can be also performed by using experimental in vitro and in vivo approaches for either inhibiting glycosylation or for integrating unnatural precursors for labelling the glycan epitopes (Bork E et al, 2007).
- the analysis of Glyco-MPs populations comprises detecting alterations in one or more features of sialylation, including the type of linkage, the degree of polymerization, modifications of sialic acids (including sulfation, branching, presence or absence of a bisecting N-acetylglucosamine), and changes in the number of polysialylated proteins, lipids and/or molecule-specific sites on Glyco-MPs.
- These studies can be performed in parallel with the determination of other features of Glyco-MPs populations such as the presence of cell type-specific antigens or of biological activities that are established in vitro using cell line-based assays (as for procoagulant activity).
- the methods of the invention provide Glyco-MPs populations that are separated from the acellular fraction by means of at least one further binding agent recognizing a phospholipid, a protein, a lipid, or a glycan other than the one used for isolating the Glyco-MPs population.
- This additional binding agent preferably binds a phospholipid which is phosphatidylserine.
- said phosphatidylserine- binding agent is Annexin V or Lactadherin (Shi J and Gilbert G, 2003; Logue et al. 2009) or other proteins, peptides, or chemicals (Thapa N et al , 2008; Lemmon M, 2008; Stace C and Ktistakis N et al, 2006).
- Phospholipid-binding agents and in particular phosphatidylserine- binding agents, are preferred, with preference for those not requiring calcium for binding phosphatidylserine and not altering MPs integrity.
- MPs population have been often isolated and characterized from biological fluids using phosphatidylserine-binding agents that are in a solid or a liquid phase.
- the methods may involve the use of one or more additional binding agents that bind a protein, lipid, or glycan of the cell surface that is transferred to the surface of Glyco-MPs populations following their release from the cells, thus identifying their origin.
- binding agent that bind a protein, lipid, or glycan of the cell surface is defined according to a specific cell type, tissue, organ, drug treatment, age, sex, pathology, genotype, phenotype, predisposition, viral infection, and/or clinical status.
- Additional binding agents to e used according to the invention can be defined as agents that bind a cell type-specific antigen ⁇ e.g. , an antibody).
- the separation and/or the detection of Glyco-MPs populations with an additional binding agent can be performed prior to, simultaneously, or following the separation step that involve the glycan-binding agent and may be used as well for separating MPs populations.
- This step may be performed in liquid or solid phase, and in the latter case the solid phase can be in the forms of beads, and in particular magnetic beads, a support that has been already used for immobilizing Annexin V and sorting apoptotic cells from a biological fluid (Said T et al , 2008).
- additional binding agents can be used not only as a mean for positively selecting the Glyco-MPs population but as a negative selection tool ⁇ e.g., for eliminating specific MPs populations presenting a specific cell surface antigen or cell debris and other undesired entities within the sample of biological fluid).
- specific Glyco-MPs subpopulation may be negatively selected in order to define an MPs subpopulation having a potential medical or biological interest
- a MPs subpopulation that is deprived of specific glycan epitopes may be enriched in other antigens that may be of interest for defining and validating a biomarker in a population.
- a further aspect of the present invention is a Glyco-MPs population that is obtained according to the methods defined above.
- the Glyco-MPs populations can be provided in a liquid or a solid phase, and in association or not with the binding agent.
- These novel biological entities can provide novel biomarkers that are associated to Glyco-MPs in general or to specific Glyco-MPs subpopulations of interest that are defined in connection to specific cell types and/or disorders.
- biomarker can allow screening subjects at risk of being affected by a disorder, since it can be identified by using common technologies such as flow cytometry, mass spectrometry, gel electrophoresis, an immunoassay (e.g.
- the Glyco-MPs population provide means for defining novel biomarkers.
- the biomarkers can be defined by means of the concentration of Glyco-MPs population only or the concentration of Glyco-MPs and of the concentration of at least another population of MPs that present a protein, lipid, phospholipid, and/or glycan of the cell surface.
- Such biomarkers can correspond to a peptide, a protein, a phospholipid, a lipid, a nucleic acid, a glycan, or any combinations of such Glyco-MPs components.
- the biomarker can be specific for a disorder and may be identified by means of one or more technologies such as flow cytometry, mass spectrometry, gel electrophoresis, immunoassay, nucleic acid amplification, or in vitro assays for a biological activity.
- biomarker refers to a molecule, a parameter, a characteristic, or an entity that is objectively measured and evaluated as an indicator of a specific state of an organism, in particular in association to a normal or pathogenic process, or the response to a medical treatment.
- this factor can be defined by the concentration and/or the components of Glyco-MPs that are isolated from biological fluids of humans or animals (rodents or primates, in particular). Accordingly, the biomarkers can be defined by means of:
- the biomarker can be found associated to the whole Glyco-MPs population and/or to specific Glyco-MPs subpopulations defined by any molecular parameter of interest (for example, the presence of a cell-type specific antigen).
- the quantitative evaluation of Glyco-MPs in specific volume of a biological fluid can be, or not, associated to a quantitative evaluation of total MPs in such volume.
- the concentration of Glyco-MPs (sub)populations that present (in particular on the surface) a cell component e.g. , a protein, a protein variant, a phospholipid, a nucleic acid, a glycan, a glycoconjugate
- any other organic or inorganic elements may be used as biomarker.
- Such component that is found associated to a Glyco-MPs populations can be used as a biomarker that allows establishing a specific status of the cells originating the Glyco MPs (sub) population and/or the possible interactions of Glyco MPs (sub)populations with the surface of the specific cell types or of a virus, with a drug, an antibody, and any other compound present in the biological fluid.
- a biomarker such as a Glyco-MPs population or a Glyco-MPs component
- a disorder can be established independently from the cause of the disorder but only from its effects and other associated biological evidences.
- the Glyco-MPs populations can allow the identification of biomarkers for characterizing the state of a subject (such as normal, affected or at a risk of disorder, responding or not to a therapy) by using samples of one or more biological fluid obtained from such subject. Once that biomarkers are found associated to Glyco-MPs, such biomarkers can be identified in the subjects of interest (e.g., animal models, patients, at risk individuals) for obtaining information of medical interest on a subject, throughout the time (e.g. , before, during, and/or after a medical intervention or treatment) and/or in comparison to reference populations (e.g., control, healthy subjects or subjects affected by a disorder).
- subjects of interest e.g., animal models, patients, at risk individuals
- reference populations e.g., control, healthy subjects or subjects affected by a disorder.
- Such biomarkers may be detectable even without using Glyco-MPs populations but, given the complexity of biological fluids, Glyco-MPs population may provide a more precise and reliable analysis of biomarkers otherwise undetectable.
- the subtraction of specific Glyco-MPs subpopulation may provide a MPs population that is particularly enriched (or deprived of) specific antigens in defined test conditions, thus representing an alternative mean to identify biomarkers
- kits for isolating and/or using Glyco-MPs for medical or veterinary application.
- the kits for isolating Glyco-MPs populations comprise a glycan-binding agent (for example, specific for a PolySia- related epitope as listed in Table 2) and at least one further binding agent recognizing a phospholipid (for instance, a phosphatidylserine-binding agent) a protein, a lipid, or a glycan other than the one used for isolating the Glyco-MPs population.
- a glycan-binding agent for example, specific for a PolySia- related epitope as listed in Table 2
- the binding agents for the desired molecules can be provided in a liquid or a solid phase, with or without means for detecting and comparing effectively the interaction with Glyco- MPs (and consequently for quantifying the Glyco-MPs (sub)population of interest) by using one or more proteomic, immunological, biochemical, chemical, biological or nucleic acid detection method.
- the present invention also provides the use of the Glyco-MPs populations, or of a kit as defined above for identifying biomarkers of medical interest in a sample of biological fluid.
- the Glyco-MPs populations of the invention can be isolated, compared, and used according to desired medical application. Examples of the process for analyzing and comparing Glyco-MPs and identifying biomarkers of medical interest are summarized in Figures 1 and 5, but many other possibilities can be envisaged in connection to specific medical goals, features of the biomarker, and/or the type of populations to be evaluated.
- the biological fluids into which Glyco-MPs features are studied can be obtained from distinct groups of subjects that are appropriately selected (e.g., on the basis of drug treatment, age, sex, pathologies, genotype, phenotype, exposure to risk factors, viral infection, or clinical status) and then compared at the level of Glyco-MPs (sub)populations using biomarkers that can be evaluated by means of one or more proteomic, immunological, biochemical, chemical, biological, or nucleic acid detection method.
- This comparison may also involve the use of appropriate statistical and/or imaging methods (including MRI, CAT, and ultrasound, immunodiagnostic test, detection of protein levels, or biopsy), should allow confirming the identification of a biomarker associated to Glyco-MPs that can be further used in diagnostic and drug discovery/validation methods for a disorder, as well as of any other disorder that may alter the structure and/or the activity of an organ, a tissue, or a cell type.
- the present invention also provides methods for diagnosing or monitoring a disorder that comprises the identification of a biomarker that have been characterized using Glyco-MPs. Such medical methods involve the isolation, the characterization, and the comparison of Glyco-MPs populations in a sample of biological fluid. Glyco-MPs quantitative and/or qualitative features might be of considerable value for diagnosing and monitoring of human disorders, as well as for evaluating drug candidates and drug treatments for any disease, and in particular for establishing their effects on biological fluids.
- These methods can involve determining Glyco-MPs concentration and/or composition in test and control samples by suing technologies such as flow cytometry, mass spectrometry, gel electrophoresis, an immunoassay (e.g. , immunoblot, immunoprecipitation, ELISA), nucleic acid amplification, procoagulant activity, and/or electron microscopy on biological fluids or Glyco-MPs populations (that is, by applying technologies that allow the identification of biomarkers of interest).
- These methods may involve the isolation and the comparison of Glyco-MPs populations within selected biological fluids (e.g. , blood, urine) where Glyco-MPs populations can be isolated.
- these methods may involve comparing the concentration and/or composition of total MPs. Still optionally, the methods may involve the detection of the biomarker(s) that can be found associated with Glyco-MPs populations within a tissue.
- tissue can be the ones from which Glyco-MPs populations can be originated (e.g. , obtained from biopsies of the CNS) but can also be any other cell types or biological material of interest for diagnosing or monitoring a disorder.
- Glyco-MPs populations i.e. Glyco-MPs vs plasma MPs population ratios, Glyco-MPs populations presenting or not a specific cell surface antigen
- test and control samples using appropriate statistical methods and criteria should provide a basis for a conclusion on the state of the subject, for instance whether the disorder is progressing or regressing in response to a treatment, if the subject is (or will be) affected by a disorder, or if the subject has been exposed to a drug, to a traumatic insult, or any other event that alters the metabolism within a biological fluid, and in particular the generation of Glyco- MPs populations.
- diagnosis refers to diagnosis, prognosis, monitoring a disorder in a subject individual that either has not previously had the disorder or that has had the disease but who was treated and is believed to be cured.
- This application of the methods of the invention can be extended to the selection of participants in (pre) clinical trials, and to the identification of patients most likely to respond to a particular treatment.
- monitoring refers to tests performed on patients known to have a disorder for the purpose of measuring its progress or for measuring the response of a patient to a therapeutic or prophylactic treatment.
- treatment refers to therapy, prevention and prophylaxis of a disorder, in particular by the administration of medicine or the performance of medical procedures, for either prophylaxis (prevention) or to cure the infirmity or malady in the instance where the patient is affected.
- the quantitative and/or qualitative in vitro/ex vivo analysis of Glyco-MPs populations provide relevant information for evaluating a subject, having a predefined clinical status, disorder predisposition, positive/negative response to a treatment, and/or sensibility to a drug or a pathogen (see Figure 1).
- this analysis may lead to a definition of a profile in which different elements characterizing Glyco-MPs populations are used, including concentration (absolute or relative to total MPs or cell type-specific MPs in the preferred biological fluid), presence/absence of one or more antigens, reduced/increased presence of one or more antigens, size, phospholipid composition, intracellular components, and the like.
- This method of evaluation can be also applied for characterizing a cell population that is maintained in vitro/ex vivo (such as cell lines, primary cells, stem cell, tissue material preparations) whereby the presence of Glyco-MPs population is established in the cell culture supernatant (see Figure 5).
- a cell population that is maintained in vitro/ex vivo (such as cell lines, primary cells, stem cell, tissue material preparations) whereby the presence of Glyco-MPs population is established in the cell culture supernatant (see Figure 5).
- human Glyco-MPs can be identified and characterized in patients that have been selected by different criteria (for example at risk, suffering, or under treatment for a disorder).
- Glyco-MPs populations can be detected, isolated, and characterized for identifying biomarkers of medical interest, in particular by using proteomic and other technologies that are described in the literature for studying specifically membrane proteins within biological fluids (Lai Z et al. , 2009; Cordwell S and Thingholm T, 2010), not only in blood but also in urine (Smalley D et al, 2008a) or cerebrospinal fluid (Hale J et al , 2008; Shi M et al , 2009; Roche S et al , 2008; Zougman A et al, 2008),
- rat models of diabetes Two different rat models of diabetes were used to determine Annexin V-positive and Glyco-MPs levels in vivo.
- ZDF male Zucker diabetic fatty
- ZLC age-matched Zucker lean controls
- SD male Sprague Dawley rats (8-weeks old, Janvier, France) received for 5 days a daily injection of Streptozotocin (20mg/kg) or saline.
- mice were fasted for 6 hours, and then anesthetized using Isoflurane.
- blood was collected by retro-orbital puncture and transferred into a tube containing 1/10 volume of citrate buffer in order to prepare platelet-rich plasma.
- the blood samples is centrifuged at l,500g for 15 minutes at room temperature. The supernatant is then carefully removed and transferred to a new tube.
- Platelet- free plasma is then obtained by centrifugation at 13,000g for 2 minutes at room temperature. Again, the supernatant is carefully transferred into a new tube and snap-frozen using liquid nitrogen. Samples were stored at -80°C until use.
- mice Male Db/db mice (13-weeks old, CERJ, Le Genest Saint Isle, France, 15 animals per group) were compared to their lean counterpart (db lean) in standard chow diet. At the end of the protocol, animals were fasted for 6 hours, and then anesthetized using isoflurane. Blood was collected by retro-orbital puncture and transferred into a tube containing 1/10 volume citrate in order to detect the different MPs populations. Another tube with EDTA was prepared for glucose and insulin analysis. Platelet-free plasma is then obtained and stored as indicated above for samples of rat origin.
- the DNA encoding human Annexin V (Genebank NM_001 154) was used for producing Histidine-tagged, recombinant Annexin V in bacteria (E. Coli strain BL21 star PI OS).
- the recombinant protein results from the fusion of the DNA sequence coding for a synthetic sequence (MGRSHHHHHHGMASMTGGQQMGRDLYDDDKDRWGSE; SEQ ID NO: 1) that includes an hexahistidine tag (HHHHHH; SEQ ID NO: 2) and the Xpress epitope (DLYDDDK; Invitrogen Life Technologies), in 5' to the DNA encoding human Annexin V (amino acids 1-320).
- Histidine-tagged, recombinant Annexin V was purified using an HIS-Trap column (GE Healthcare). Purity was assessed by SDS- PAGE gel and sequence was verified by MALDI-TOF mass spectrometry. His-tagged Annexin V was then labelled with FITC (NHS-Fluoroscein; Thermo-Scientific, Pierce Protein Research Products; Cat. No. 46410), following the manufacturer's protocol.
- FITC NHS-Fluoroscein; Thermo-Scientific, Pierce Protein Research Products; Cat. No. 46410
- MPs populations presenting phosphatidylserine and/or PolySia- related epitopes on their surface were identified in Platelet-free plasma as cell particles having a diameter comprised between 0.5 and ⁇ ⁇ and positively stained with labelled Annexin V and/or with indicated lectin or monoclonal antibodies, respectively.
- counting beads Flowcount Fluorospheres, Beckman- Coulter, France; 30 ⁇ 1 / sample with a 0.5 ⁇ cut-off to obtain reproducible results
- the samples of platelet-free plasma were incubated in the dark for 30 minutes with either His-tagged, FITC-labeled Annexin V (60ng) in incubation buffer (2.5mM CaCl 2 , 140mM NaCl, lOmM Hepes pH 7.4) or Annexin V PE-Cy5 that was prepared with the Lightening Link TM PE- Cy5 Tandem Conjugation kit.
- 60 ⁇ g of Annexin V was labeled with Lightening Link Modifying agent with 100 ⁇ g of PE-Cy5 3 hours in a dark room.
- Distinct Glyco-MPs populations were analysed by flow cytometry using, as glycan-bnding agent, a monoclonal IgM antibody directed to PolySia (final concentration 30 g/ml; AbCys, clone 2-2B; Rougon G et al, 1986) which was then 5
- PE-conjugated secondary antibody Goat anti-mouse IgM PE, dilution 1/8; Caltag Laboratories
- MAA FITC Maackia amurensis
- the labelling reaction was stopped with a quencher and the preparation was adjusted at 15 ⁇ g/ml.
- 30 ⁇ of MPs were mixed with 10 ⁇ of Glycan- binding agent at 300 g/ml and ⁇ ⁇ of Annexin V (AnnV PE-Cy5) at 15 ⁇ g/ml or PE anti-mouse Ter-1 19 (TER; BD-Pharmingen, Cat. No.
- the quantifications were performed for each sample by FACS (FC500 flow cytometer; Beckman-Coulter, France), using the two MPs-labelling compounds either in parallel on two different aliquots of the same sample, or simultaneously on the same aliquot, then analysing separately the two signals.
- the molecular features of potential medical interest that are present in Glyco-MPs populations can be characterized by applying a process in which samples of biological fluid having different origins (e.g. , blood, cerebrospinal fluid, urine; before or after treatment; in control individuals or patients) are isolated and compared for the quantitative and qualitative features using appropriate technologies (Figure 1).
- biological fluid having different origins e.g. , blood, cerebrospinal fluid, urine; before or after treatment; in control individuals or patients
- the Glyco-MPs populations were obtained and defined by using a process that allow comparing the concentration of glycan-specific and phospholipid-specific MPs populations in different subjects, in particular for assessing the contribution of glycan-specific Glyco-MPs populations to the overall MPs concentration in a sample of biological fluid, as generally defined on the basis of the presence of phosphatidylserine on their surface.
- This approach was applied for initiating a more general evaluation of quantitative, size, and/or molecular features of Glyco-MPs populations that are obtained using samples of biological fluid isolated from different subjects in conditions that maintain the MPs integrity.
- rat models for diabetes were used, such as ZDF rats and rats injected with a low dose of Streptozotocin for 5 days, in order to induce pancreatic degeneration leading to a decrease in insulin secretion and ultimately to diabetes (Chen D and Wang M, 2005).
- mice are homozygous for a mutation of Leptin receptor that become identifiably as obese around three to four weeks of age. Elevations of plasma insulin begin at 10 to 14 days of age and of blood sugar at four to eight weeks. A number of features are observed in this model, including an uncontrolled rise in blood sugar and severe depletion of the insulin- producing beta-cells of the pancreatic islets, and consequently it is used for preclinical validation of candidate drugs against type 2 diabetes and dyslipidemia (Reifel-Miller A et al, 2005).
- Glyco-MPs populations such as positive MPs populations that are positive for PolySia-related epitope
- known methods such as those based on phospholipids or cell type-specific antigens, for establishing the qualitative and quantitative features of MPs subpopulations in a biological fluid, for example that is obtained from preclinical models of diseases, such as those for diabetes, endotoxemia, atherosclerosis, cancer, or rheumatoid arthritis.
- Glyco-MPs populations by using binding agents specific for different glycans and/or different biological fluids, different percentages of total MPs populations are identified as Glyco-MPs populations.
- specific Glyco- MPs populations such as PolySia-positive Glyco-MPs or Glyco-MPs subpopulations identified according to lectin binding features
- Glyco-MPs subpopulation appear as being generated and metabolized within biological fluids in manners that appears being either very different or very similar to the overall MPs populations (even if such Glyco-MPs populations have almost certainly different cell origins and even if a different cell surface components are known to be modified with glycans) depending on glycan epitope/binding agent (such as PolySia-related epitopes and corresponding binding agents) that is used.
- glycan epitope/binding agent such as PolySia-related epitopes and corresponding binding agents
- stable coronary disease that is defined by one or more of the following conditions: stable or unstable angina pectoris with positive ECG stress test or positive myocardial scintigraphy or stenosis of >50% of coronary artery, history of myocardial infarction, history of coronary revascularization, under treatment by Aspirin and/or statin at stable dose for at least 3 months.
- the control subjects were included as not having a history of coronary disease or family history of coronary disease.
- platelet-rich plasma was obtained from the blood samples by centrifugation at l ,500g for 15 minutes at room temperature. The supernatant is then carefully removed and transferred to a new tube. Platelet-free plasma is then obtained by centrifugation at 13,000g for 2 minutes at room temperature. Again, the supernatant is carefully transferred into a new tube and snap-frozen using liquid nitrogen. Samples were stored at -80°C until use.
- Phospoholipid-positive MPs populations presenting phosphatidylserine or Glyco-MPs populations that present a PolySia-related epitope as relevant targets on their surface were identified in Platelet-free plasma as cell particles having a diameter comprised between 0.5 and ⁇ ⁇ and positively stained with labelled Annexin V.
- the samples of platelet- free plasma were incubated in the dark for 30 minutes with either His-tagged, FITC-labeled Annexin V (60ng) in incubation buffer (2.5mM CaC12, 140mM NaCl, lOmM Hepes pH 7.4), or with a monoclonal IgM antibody directed to a PolySia-related epitope (final concentration 30 ⁇ ; AbCys, clone 2-2B; Rougon G et al , 1986) which was then detected using a PE-conjugated secondary antibody (Goat anti-mouse IgM PE, dilution 1/8; Caltag Laboratories).
- incubation buffer 2.5mM CaC12, 140mM NaCl, lOmM Hepes pH 7.4
- a monoclonal IgM antibody directed to a PolySia-related epitope final concentration 30 ⁇ ; AbCys, clone 2-2B; Rougon G et al , 1986
- counting beads (Flowcount Fluorospheres, Beckman-Coulter, France; 30 ⁇ 1 / sample with a 0.5 ⁇ cut-off to obtain reproducible results) were added to each sample in order to express MPs counts as absolute number per ⁇ of biological fluid.
- 30 ⁇ of Glyco-MPs were labelled with Annexin V PE (Beckman Coulter, 731726) or 5 ⁇ and Maackia amurensis lectin (MAA FITC; EY laboratories F-7801-2, CA, USA) 10 ⁇ at 300 ⁇ .
- the analysis was performed for each sample by FACS (FC500 flow cytometer; Beckman-Coulter, France), using the two MPs-labelling compounds in parallel, or simultaneously on the same aliquot, then analysing separately the two signals.
- Apoptosis is a process of cell death that has been shown to occur during the progression of human atherosclerotic plaque. The consequences of apoptosis are deleterious because it enhances plaque thrombogenicity after plaque rupture and leads to acute ischemic events and infarction.
- Such mechanism is associated with a systemic pro-inflammatory state, with changes in multiple cytokines and shedding of MPs population in blood circulation that are originated from diverse apoptotic or activated cell types.
- the levels of circulating MP (sub)populations are positively correlated with the development of number of chronic inflammatory diseases including cardiovascular diseases (Mayr M et al, 2008; Boulanger C et al. 2006; Shantsila E, 2009).
- rodent and (more importantly) human plasma contains detectable amounts of Glyco-MPs populations that can be isolated and characterized in conditions that maintain MPs integrity and that can provide a different understanding of MPs relevance in patho-physiological mechanisms and/or in the definition of biomarkers.
- Glyco-MPs subpopulations can be compared and used (as such or as proxy) for establishing novel biomarkers within biological fluids that reflecting a patho-physiological state of a subject and therefore could be used for disease prediction, diagnosis, prognosis and follow-up, with a strong focus on both chronic conditions (including inflammatory bowel disease, rheumatoid arthritis, atherosclerosis, diabetes, cancer, and in general metabolic and cardiovascular diseases) and acute conditions (including transplantation, stroke, sepsis, traumatic injuries).
- chronic conditions including inflammatory bowel disease, rheumatoid arthritis, atherosclerosis, diabetes, cancer, and in general metabolic and cardiovascular diseases
- acute conditions including transplantation, stroke, sepsis, traumatic injuries.
- Example 3 Quantification and characctrization of Glyco-MPs subpopulations that are generated in cell culture conditions.
- the murine pancreatic cell line Min6 (Miyazaki et ⁇ , 1990) was cultured in DMEM medium (4.5g/L Glucose, Gibco) supplemented with 15% fetal bovine serum (AbCys), 1 % penicilin/streptomycin (VWR, val de Fontenay, France), 1% sodium pyruvate (Gibco), and 3.75 ⁇ of beta-mercaptoethanol. Cells were cultured at 37°C in 5% C02 atmosphere and seeded either at 35,000 cells/cm2 (for stimulation experiments) or at 5 ⁇ 106 into 150 cm2 culture flask (BD Bioscience; for FACS experiments).
- HAVEC Human Umbilical Vascular Endothelial Cell
- EBM Endothelial Basal Medium
- EBM plus SingleQuots of growth supplements EBM BulletKit, Cambrex CC-3124; Walkersville, USA.
- Cells were seeded at 2 500 to 5 000 cells / cm 2 into 150 cm 2 culture flask (BD Bioscience; Le Pont-De-Claix, France) and maintained at 37 °C in 5% C02 atmosphere. Cells were used for experiments when they reached 80% confluence.
- HUVEC were then treated for 24 hours at 37°C without (control condition) or with tumour necrosis factor-alpha (10 ⁇ g/ml; R&D System) as apoptotic agent in the culture medium.
- the human neuroblastoma cell line SH-SY5Y (CRL-2266; ATCC, VA, USA) were plated into 150 cm 2 culture flask (Falcon Becton Dickinson, Heidelberg, Germany) at 60 000 cells/ cm2 and incubated in MEM culture medium (Gibco), supplemented with Ham's F12 glutamax, 1% penicillin and streptomycin, 0.5% non essential amino acids, 0,5% sodium pyruvate and 10% fetal bovine serum and maintained at 37°C in 5% C02 atmosphere.
- differentiation culture medium MEM supplemented medium containing 5 ⁇ retinoic acid and 2% fetal bovine serum
- differentiation culture medium supplemented medium containing 5 ⁇ retinoic acid and 2% fetal bovine serum
- Differentiated SH-SY5Y cells were then cultured for 24 hours at 37°C with MEM supplemented medium and DMSO 0.1% (control condition) or MEM supplemented medium with DMSO 0.1% (control condition) and 6-OHDA (defs 100 ⁇ ) or MEM supplemented medium with DMSO 0.1% and staurosporine (0.5 ⁇ g/ml; R&D System) as apoptotic agent.
- the immortalized mouse microglial cell line BV-2 (Blasi E et al , 1990) were cultured in RPMI 1640 (Gibco) containing 1.1% GlutaMax, 10% fetal bovine serum and 1% penicillin and streptomycin. Cells were seeded at 2500 to 5000 cell/cm 2 into 150 cm 2 culture flask (BD Bioscience) and maintained at 37°C in 5% C02 atmosphere. Cells were washed twice with warm RPMI and then cultured for 24 hours at 37°C in the same medium supplemented with 0.1% DMSO (control condition) or with 0.1% DMSO and Lipopolysaccharides (100 ng/rriL) as apoptotic agent.
- the human colon carcinoma cell line HT29 (Cat. No. HTB-38; ATCC, USA) were cultured in McCOY's 5A medium 10% fetal calf serum (FCS), 1 % penicillin/streptomycin (PS) and 1 % glutamine (Invitrogen/Gibco, Cergy Pontoise, France). When cells reached 80% of confluency, they were rinsed twice and cultured for 24 hours at 37°C with 2% serum replacement supplement (SR-3; Sigma, MO, USA) instead of FCS, and without (control condition) or with staurosporine (0.1 ⁇ ) as apoptotic agent.
- FCS fetal calf serum
- PS penicillin/streptomycin
- glutamine Invitrogen/Gibco, Cergy Pontoise, France
- the human hepatocellular carcinoma cell line HepG2 (Cat. No. HB- 8065; ATCC, USA) were cultures in DMEM medium 10% fetal calf serum (FCS), 1% penicillin/streptomycin (PS) and 1% glutamine (Invitrogen/Gibco, Cergy Pontoise, France). When cells reached 80% of confluence, they were rinsed twice and cultured for 24 hours at 37°C with 2% serum replacement supplement (SR-3; Sigma, MO, USA) instead of FCS, and without (control condition) or with camptothecin (10 ⁇ ) as apoptotic agent.
- FCS fetal calf serum
- PS penicillin/streptomycin
- glutamine Invitrogen/Gibco, Cergy Pontoise, France
- composition of biological fluids depends not only from the activity of cells circulating within or surrounding the biological fluid (e.g., endothelial cells or platelets, leukocytes, in the case of blood) but also from the drainage of the interstitial liquid of the organs and tissues.
- biological fluids and consequently MPs populations within them
- the molecular features that allow differentiating cell type- and/or disease-specific Glyco-MPs (sub)populations of potential major interest can be initially defined by means of specific primary cells or cell lines that are related to the disease which and that can be used to generated Glyco-MPs within cell culture, in more tightly controlled conditions than in physiological biological fluids (Figure 5).
- Figure 5 The molecular features that allow differentiating cell type- and/or disease-specific Glyco-MPs (sub)populations of potential major interest can be initially defined by means of specific primary cells or cell lines that are related to the disease which and that can be used to generated Glyco-MPs within cell culture, in more tightly controlled conditions than in physiological biological fluids.
- Figure 5 the presence and metabolism of cell type-specific, PolySia-positive Glyco-MPs populations can be also evaluated to understand if and how its ratio with Annexin V-positive MPs populations changes between cell types, and thus if different cell type contributes in different manner to the PolySia-positive Glyco-MP
- Min6 murine insulinoma cell line
- palmitate a compound that induces stress and apoptosis in pancreatic beta-cells
- the cell culture medium was collected and spun down and MPs populations were then quantified by flow cytometry.
- Min6 cells appeared to generate significant levels of both Annexin V-positive and Glyco-MPs populations in serum-free culture medium but the basal level of MPs populations was further increased b the exposure to palmitate in a significant and dose-dependent increase for both MPs populations with a similar dynamics.
- Annexin V-positive MPs populations that are also positive for different PolySia-related epitopes was then tested in other cell lines that shed low levels of MPs in normal culture condition and in response to different apoptotic agents. This comparison is intended to verify if these cell lines release distinct Glyco-MPs populations at different rates.
- the Glyco-MPs subpopulations correspond to almost to the totality of Annexin V-positive MPs (as in the case of SH-SY5Y cells that are exposed to 6- OHDA with 2-2B antibody as glycan-binding agent), are different depending on the selected apoptotic agent (as in the case of SH-SY5Y cells), or present major differences between glycan-binding agents that recognized distinct PolySia-related antigens (as in the case of HT29 and HepG2 cells).
- the apoptotic agent does not change in a significant manner neither the number of cells that present the specific PoySia-related epitopes on their surface nor the percentage of M93 -positive, Annexin V-positive MPs subpopulation, since this Glyco-MPs subpopulation is increased in a manner similar to the Annexin V-positive MPs population, suggesting that KM93 may almost represent an alternative to Annexin V for detecting MPs populations from specific cell types such as HT29 and HepG2 cells.
- the situation that is observed using the other agents is different, since there is an overall decrease in the percentage of these Glyco-MPs subpopulations.
- Annexin V- positive and MPs populations having specific post-translational profiles (e.g. , glycosylation profiles that characterize Glyco-MPs) but in very variable absolute and relative amounts.
- Glyco-MPs populations should provide a representation of MPs-producing cell types different from those of phoshatidylserine- exposing MPs population that are normally selected from biological fluids using Annexin V binding properties.
- Glyco-MPs populations are biological products that are different from those used so far for studying MPs and that provide novel opportunities to identify MPs-associated biomarkers, in particular using proteomic or immunological technologies.
- Glyco-MPs populations can be used for studying the presence of cell-type specific antigens that are specifically associated to this MPs population, and consequently Glyco-MPs populations can be of even greater medical interest for evaluating the clinical status of a patient, the progression of a disease or the therapeutic efficacy of a drug treatment.
- MPs population were obtained from palmitate-induced Min6 cells as indicated in Example 2. Following the step of ultracentrifugation, total MPs populations were used for preparing an extract containing approx. 450 micrograms of protein into 0.5 ml of 2D lysis buffer (7M urea, 2M thiourea, 4% CHAPS, 20 mM spermine base, 0.8% DTT, 0.2% pH 3-10 BioLytes, phosphatase inhibitor cocktails 1 & 2, and EDTA-free protease inhibitor cocktail tablets). The proteins were fully extracted on ice by sonication with 20 second pulses at 20-25%) of maximum amplitude level. This step was repeated 5 times with a minimum of 1 minute pauses.
- Extracts were centrifuged at 16, lOOg for 10 minutes at 10°C to remove insoluble particles.
- Total protein content was determined using the 2D-Quant Kit (GE Healthcare).
- Non-protein impurities were removed using the ReadyPrep 2D Cleanup kit prior to isoelectrofocalisation (IEF) steps.
- Protein pellets were solubilized by incubating them with 450 ⁇ 1 of rehydration buffer (7M urea, 2M thiourea, 4% CHAPS, 0.4%) DTT and 0.2%> pH 3-10 BioLytes) at room temperature for 5 minutes.
- samples were subjected to IEF using premade 24 cm IPG strips, nonlinear pH 3-10, on an IPGphor instrument (Bio-Rad Laboratories, Hercules, CA, USA) in electrophoresis buffer (7M urea, 2M thiourea, 4% CHAPS, 0.4% DTT and 0.2% pH 3-10 BioLytes) at 20°C for a total of 140 kVh achieved with a maximum tension of 8000V. After a low current 500V final step, strips were refocused at 8000V for 30 minutes.
- proteins in strips were reduced and alkylated by using 10 mL of equilibration buffer (6M urea, 2% SDS, 50 mM Tris-HCl H 8.8, 20% glycerol, 2% DTT for 15 min and then for 15 minutes with the same buffer without DTT and containing 2.5% iodoacetamide).
- Equilibrated IPG strips were shortly soaked in 0.22 ⁇ m-flltered electrophoresis buffer and immediately transferred onto 20.2x25.5 cm in size and 1 mm thick gradient 8-16% polyacrylamide gradient gels (38: 1 acrylamide:bis ratio) pre-casted into low-fluorescence glass plates treated with bind and repel silane and including 2 fluorescent markers (Jule Inc, CT, USA).
- Strips were immobilized by embedding them into a 0.5% agarose solution in electrophoresis buffer that was labelled with trace amounts of bromophenol blue. The second dimension separation was performed overnight at 30°C using an Ettan Dalt six device with an updated upper buffer chamber (GE Healthcare) according to the manufacturer's instructions.
- gels were fixed and then stained for glycoproteins using the ProQ Emerald 488 staining reagent (Invitrogen, Carlsbad, CA, USA) according to the manufacturer's instructions. Images were captured using a Typhoon 9400 laser scanner (Molecular Dynamics, Sunnyvale, CA, USA) using the 488 nm excitation wavelength with a 100 ⁇ resolution. Upon data acquisition, gels were briefly rinsed using milliQ water and were then stained for total proteins by an overnight incubation in SYPRO Ruby solution (Invitrogen, Carlsbad, CA, USA). After extensive washings, image acquisition was performed at a 100 ⁇ resolution using the 457 nm excitation wavelength. DeCyder 6.5 software (GE Healthcare).
- the resulting proteomic maps can be then analyzed to identify candidate biomarkers (presenting or not a glycan) using different technologies that are specific for cell surface glycans, membrane microdomains, and/or membrane proteins (Lai Z et al, 2009; Cordwell S and Thingholm TE, 2009; Apweiler R et al , 2009a; Apweiler R et al , 2009b; Zheng Y and Foster L, 2009) in order to define the surfaceome of Glyco-MPs populations as it has been proposed for human cells (da Cunha J et al. ,2009).
- this approach can be used to establish if and how Glyco-MPs and total MPs populations are differentially metabolized within the biological fluid, expose cell surface components in specific manners, and/or interact differentially with cells and other components of the biological fluid.
- This analysis can be performed also by using the extensive lists of glycans and of the corresponding glycan-binding agents (such as such as monoclonal antibodies, plant lectins, and chemicals) that have been published (see Table 1 and Table 2), indicating the specificity of the interaction, the compatibility with the integrity and viability of cells, and their use for identifying specific cell types and/or antigens of medical interest.
- Such glycan-binding agents may be used for detecting and isolating different types of Glyco-MPs subpopulations in parallel.
- glycan-binding agents that are compatible with technologies that maintain MPs integrity (such as FACS, immunological assays, or magnetic beads-based cell isolation) should be preferred.
- a panel of antibodies and binding proteins have been characterized in the literature for different PolySia-containing biological materials and can be used for detecting, isolating and comparing different PolySia-positive Glyco- MPs (sub)populations presenting higher or lower specificity for (un)modified PolySia groups, molecules containing PolySia groups with different degrees of polymerization and/or linkage.
- This analysis can be accompanied also by the detection of known cell type-specific antigens (using antibodies or other molecules that specifically bind such antigens) that can be more or less frequently associated to total MPs populations or Glyco-MPs (sub) populations within biological fluids and/or in cell culture conditions (Burnier L et al , 2009; Orozco A and Lewis D, 2010; van der Heyde H et al, 201 1). REFERENCES
- Hayrinen J et aL 1995. J Infect Dis; 171 : 1481-90. Hayrinen J et al , 2002. Mol Immun; 39: 399-41 1.
- Circ Cardiovasc Genet 2: 379 - 388.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Chemical & Material Sciences (AREA)
- Hematology (AREA)
- Immunology (AREA)
- Urology & Nephrology (AREA)
- Cell Biology (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Food Science & Technology (AREA)
- Medicinal Chemistry (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Investigating Or Analysing Biological Materials (AREA)
Abstract
The invention provides methods for isolating, characterizing, comparing, and using novel components of biological fluids that are characterized on the basis of post-translational modifications of cell surface. In particular, Glycan- containing Microparticles (Glyco-MPs) populations have been characterized on basis of their dimension and the presence of specific glycan epitopes (such as polysialic acid) on their surface, Phospholipids (such as phosphatidylserine) and/or cell type- specific antigens can be also used as additional criteria for isolating, characterizing, comparing, and/or Glyco-MPs populations. The novel methods allow the detection and isolation of Glyco-MPs that can be used for defining biomarkers within biological fluids that are relevant in the diagnosis or monitoring diseases, and/or in the evaluation of the therapeutic efficacy of a medical treatment or a candidate drug.
Description
METHODS FOR ANALYZING COMPONENTS OF GLYCAN CONTAINING MICROPARTICLES
The present invention relates to methods for isolating, characterizing, comparing and using specific biological components in the biological fluids that are characterized on the basis of post-translational modifications of cell surface, and that can be used for the medical management of disorders.
BACKGROUND OF THE INVENTION
Despite huge efforts made by the scientific community, there is still an urgent need in identifying novel biomarkers for a number of chronic conditions including metabolic, cardiovascular and neurodegenerative diseases, in particular by using biological fluids which can be more easily obtained and analyzed in clinical settings. For example, selected plasma proteins are now considered as relevant biomarkers of various clinical conditions and the use of "omics" technologies should lead to the discovery of more as more (non-)protein biomarkers and other complex profiles such as biochemical and metabolic signatures (Service R, 2008; Bain J et al, 2009; Turer A et al , 2009).
Biomarker research activities suffer from a major technical problem related to the presence of extremely abundant proteins within biological fluids that mask the less abundant sub-proteome that can provide reliable biomarkers of medical interest. In the case of blood or cerebrospinal fluids, specific analytical and/or protein- depletion technologies are used to exclude proteins such as albumin, immunoglobulins, or transferrin and try circumventing this problem (Thouvenot E et al , 2008; Apweiler R et al , 2009a). However, major technical improvements are still needed for characterizing the more variable, but minor, fractions of circulating proteome that are difficult to separate such as proteins on cell surface membrane, which are of major interest as potential novel drug targets and biomarkers (Lai Z et al, 2009; Cordwell S and Thingholm T, 2009).
In the field of membrane proteomics within biological fluids, a growing number of preclinical and clinical studies indicate circulating microparticles (MPs) as potential biomarkers and/or additional mediators of protein-based signalling through cell surface receptors or transporter. As extensively reviewed (Hugel B et al. , 2005; Miguet L et al , 2007; Doeuvre L et al, 2009; Burnier L et al, 2009), MPs are vesicles having a size comprised between 1 and 0.1 micrometer that are formed by the plasma membrane and shed from apoptotic or otherwise activated cell types in response to various conditions and stimuli (chemicals, growth factors, shear stress,
apoptotic signals, etc.). MPs composition and membrane antigens are dependent from the cellular origin and/or the type of stimulus that triggered their generation.
MPs formation is associated with the loss of membrane asymmetry and the exposure of specific phospholipids, such as phosphatidylserine, on the outer leaflet which, together with MPs surface antigen, are responsible of strong procoagulant activity that MPs normally exhibit. Phospholipid-binding agents, in particular proteins (Stace C and Ktistakis N. 2006; Lemmon M, 2008), are used for the affinity- based isolation of MPs, after being separated from cellular components within the biological fluid by centrifugation.
The MPs variable concentration and composition, release mechanism, and activities in biological fluids have been extensively studied in plasma or urine, as well as in cell culture conditions, but other biological fluids, such as cerebrospinal or synovial fluids, have been indicated as containing vesicles features that are similar to those found for plasma MPs. However, many of the studies have not been pursued in a standardized manner regarding the MPs purification from biological fluids (Piccin A et al, 2007). In fact, other types of vesicular particles, called exosomes, are also released after cell activation and can be co-purified with MPs, but they diverge from MPs in size (in general below 0.1 micrometer), surface antigens (given their intracellular origin), and absence of phosphatidylserine, leading to potential confusions and doubts on the actual relevance of some published data (Horstman L et al , 2007; Thery C et al, 2009).
MPs are present in the blood of healthy individuals (being produced in particular by endothelial cells, platelets and other circulating cells) but their absolute levels as well as the proportion of their different cellular origin may dramatically change under several pathological conditions. MPs appear as being released from a large variety of cell types within biological fluids, consequently shedding cell antigens that can be relevant for various biological functions or disorders that are associated to inflammation and apoptosis. Due to the phospholipids, Tissue Factor, and other molecules present on their surface, MPs are generally believed to have noxious properties, related to their high procoagulant activity and capability of impairing endothelial activities, inhibiting Nitric Oxide production, inducing cytokine release, and activating cell proliferation and many other biological pathways (Morel O et al , 2009; Mause S et al, 2005; Leroyer A et al, 2007; Mezentsev A et al, 2005; Essayagh S et al, 2005).
The genesis and role of MPs derived from platelets, endothelial cells and monocytes, in diseases such as thrombocytopenia, paroxysmal nocturnal
haemoglobinuria, sickle cell disease and other chronic inflammatory disorders have been established. The levels of MPs have been shown to be significantly increased and correlated with the development of number of different disorders, including diabetes (Koga H et al, 2005; Sabatier F et al , 2002), HIV infection (Mack M et al, 2000), autoimmune and rheumatic diseases (Beyer C and Pisetsky D, 2010), following heart, stem cell or kidney transplantation (Al-Massarani G et al, 2009; Nomura S et al , 2008; Garcia S et al, 2005), neoangiogenesis and cancer (Mostefai H et al, 2008), sepsis (Soriano A et al. 2005), neurological pathologies (Horstman L et al. , 2007) or cerebral malaria (Combes V et al , 2005). MPs have been also detected in cerebrospinal fluid and plasma, for example after traumatic brain injury (Morel N et al , 2008), as well as in pulmonary edema fluid (Bastarache J et al, 2009), and as a consequence to the exposure of blood to carbon nanotubes (Semberova J et al. 2009) or coronary stents (Inoue T et al , 2006).
Qualitative and quantitative analyses of MPs tried to elucidate if and how the composition and/or the concentration of MPs can be associated to activities of potential therapeutic or diagnostic interest using proteomic technologies, in addition to classical flow cytometry analysis. The composition of MPs-associate proteomes have been studied in endothelial cell-derived MPs (Banfi, C et al, 2005), total plasma MPs (Jin M et al, 2005; Smalley D et al , 2007), total urinary MPs (Smalley D et al, 2008a), platelet MPs (Garcia B et al , 2005; Dean W et al, 2009), MPs in stored red blood cells (Rubin O et al, 2008), and atherosclerotic plaques-derived MPs (Mayr M et al, 2008). Even though it has been suggested that MPs-based proteomic studies can provide novel biomarkers, in particular for atherosclerosis and other vascular diseases (Merrick B, 2008; Smalley D et al, 2008b; Boulanger C et al. 2006; Shantsila E, 2009), MPs have not been clinically validated yet as biomarkers, apart from preliminary studies on cell type-specific MPs populations that are released from endothelial cells in patients at high risk for coronary heart disease (Nozaki T et al , 2009).
An important aspect that has been so far not systematically compared and explored within MPs populations is the level and the importance of post-translationally modified (PTM) proteins on their surface. Altered levels of PTM proteins, even without global protein expression changes, are often linked to cellular responses and disease states. The complex and dynamic nature of the PTM proteome represents a major technical challenge but recent improvements have been made in the separation and the characterization of PTM proteins, leading to identification of more precisely defined post-translational modifications (Mirza S and Olivier M, 2008; Tate
E, 2008; Krueger K and Srivastava S, 2006). Phosphorylation, glycosylation, ubiquitination, and prenylation are the most common and characterized categories of post-translational modifications but, by including specific variants, more than 300 modifications have been listed, and large repertoires of PTM proteins have been generated in databases such as dbPTM (Lee H et al , 2009) and HPRD (Keshava Prasad J et al, 2009).
Apart from isolated examples of PTM proteins that have been detected using antigen-specific compounds or by proteomics within MPs populations, there are no evidence in the prior art that post-translational modifications may provide a more comprehensive and precise understanding on relevance of MPs for defining biomarkers to be used in clinical proteomics (Apweiler R et al. , 2009a; Apweiler R et al, 2009b).
SUMMARY OF INVENTION
The present invention provides methods for isolating, characterizing, comparing, and using novel components of biological fluids that are characterized within MPs populations on the basis of post-translational modifications present on cell surface. In particular, Glycan-containing Microparticles (Glyco-MPs) populations have been characterized on the basis of their dimension (comprised between 0.1 and 1 microMeter) and the presence of glycan epitopes (such as polysialic acid) on their surface.
The methods involve the isolation of biological fluids (in particular of human, primate, or rodent origin) and the separation of Glyco-MPs from the acellular fraction of such biological fluids using at least a glycan-binding agent in a solid or a liquid phase. Glyco-MPs can be further isolated, characterized, and/or compared using additional binding agents that are specific for cell surface components, such as phospholipids (and in particular phosphatidyl serine) and/or cell specific antigens.
The Glyco-MPs that are obtained by this method can be used to establish the concentration and/or other molecular components (such as cell-specific antigens, phospholipids, or glycans) that differ between control and test subjects (e.g., normal or at risk of a disease, treated or untreated for a disease) and that can be used as biomarkers within biological fluids for diagnosing or monitoring diseases in a subject, and/or for evaluating the therapeutic efficacy of a medical treatment or a candidate drug.
Further objects of the invention, including kits and medical methods for isolating and characterizing Glyco-MPs populations, as provided in the Detailed Description.
DESCRIPTION OF THE FIGURES
Figure 1 - Characterization of features that differentiate Glyco-MPs
(sub)populations in biological fluids.
An exemplary process for the characterization of features that differentiate Glyco-MPs (sub)populations in biological fluids involves the isolation of Control Samples (e.g., from one or more healthy or untreated subjects) and of Test Samples (e.g., from one or more disease-affected or treated subjects). Alternatively, the Control Samples and the Test Samples can be different biological fluids obtained from the same subject (e.g. , blood and cerebrospinal fluid, or blood and urine), for evaluating the presence of Glyco-MPs populations in different physiological locations.
The corresponding Glyco-MPs populations are then isolated on the basis of their size and by means of at least a Gly can-binding agent that binds the surface of Glyco-MPs in experimental conditions that allow maintaining their integrity. Binding agents that recognize other components of Glyco-MPs surface (such as phospholipids and/or cell type-specific antigens) can be also used for isolating and characterizing Glyco-MPs (sub) populations in the preferred format (in solid or liquid phase).
The resulting materials are then compared by any of the known methods for analyzing materials of biological origin that can lead to the determination of features that are associated to a Glyco-MPs subpopulation (or to a MPs subpopulation that lacks the glycan epitope associated to a specific Glyco-MPs subpopulation) in specific subjects, biological fluids, and/or patho-physiological conditions. Then, this signature can be used for evaluating the status of a given subject with (or without) the isolation of Glyco-MPs populations.
Figure 2 - Antigen-independent quantitative analysis of Glyco-MPs populations in animal models
This analysis was performed in two rat models with altered metabolism: streptozotocin-injected and ZDF and ZLC rats.
In the first model, blood from male diabetic ZDF or control ZLC rats (n=6 per group; 20-weeks old) was obtained by retro-orbital puncture. Total plasma MPs were prepared as described in the Material & Methods section of Example 1 and stored at -80°C until use. The Annexin V-positive MPs (Panel A) and the PolySia (2-2B antibody)-positive Glyco-MPs (Panel B) populations were stained
with fluorescently labelled Annexin V and anti-PolySia 2-2B antibody, respectively, and then quantified by flow cytometry. Data are expressed as Mean ± SEM.
In the second model, male Sprague Dawley rats (8-weeks old, n=8/group) were daily injected with Streptozotocin (20mpk) for 5 days. At the end of the treatment, rats were anesthesized and blood samples were obtained by retro-orbital puncture after a 6 hour fasting. Total plasma MPs were prepared as described in the Material & Methods section of Example 1 and stored at -80°C until use. The Annexin V-positive MPs (Panel C) and the PolySia(2-2B antibody)-positive Glyco-MPs (Panel D) populations were stained with fluorescently labelled Annexin V and anti-PolySia 2-2B antibody, respectively, and then quantified by flow cytometry. Data are expressed as Mean ± SEM.
Figure 3 - Antigen-specific quantitative analysis of Glyco-MPs populations in animal models
Total plasma MPs were prepared as described in the Material & Methods section of Example 1 and stored at -80°C until use. The different MP populations have been detected and quantified by flow cytometry using, as fluorescently labelled binding agents, Annexin V (AnnV), MAA lectin (MAA), an anti-erythroid cells antibody (TER1 19), and anti-CD41 antibody (CD41) in the indicated combinations (Panel A). The level of Glucose and Insulin were measured in the corresponding mice group. The glucose and insulin levels in the corresponding mice groups are provided (Panels B and C). Data are expressed as Mean ± SEM.
Figure 4 - Quantitative analysis of Glyco-MPs populations in human plasma.
In a first assay, blood samples were collected and Platelet Free Plasma fraction is obtained in six fasted individuals. The Annexin V-positive and the PolySia(2-2B antibody)-positive Glyco-MPs populations were stained in these fractions using fluorescently labelled Annexin V and anti-PolySia 2-2B antibody, respectively, and then quantified by flow cytometry. The concentration of the specific MPs populations in each individual (SI , S2, S3, S4, S5, S6) were used to generate a correlation plot (Panel A).
In a second assay, blood samples were collected and Platelet Free Plasma fraction is obtained from two groups of subjects (Control and Coronarian) as indicated in Example 1. Total Annexin V-positive (AnnV+) and Annexin V-/MAA lectin positive (AnnV+ MAA+) MPs populations were detected and quantified by flow cytometry (Panel B). Data are expressed as Mean ± SEM and as fold induction between the two groups of subjects.
Figure 5 - Characterization of features that allow distinguishing Glyco-MPs (sub) populations that have specific cell origins.
An exemplary process for the characterization of feature(s) that allow comparing Glyco-MPs (sub)populations having specific cell origins involves the generation and the isolation of Glyco-MPs from primary cells or cell lines having specific origin (e.g. , pancreatic cells, leukocytes, platelets, neuronal cells, endothelial cells, stem cells). Control and Test cell cultures (e.g., differentiated or undifferentiated, treated or untreated, healthy or in an apoptotic state), can be compared by any of the known methods for characterizing materials of biological origin, as described for Figure 1. If this analysis is further confirmed in relevant cell types, it can lead to the determination of normal (or disease-specific) features that can be identified as being associated to Glyco-MPs (sub) populations, such as cell surface antigens having specific cell origins in a given biological fluid, that can be used for the analysis of biological fluids in different categories of subjects (e.g., being treated or not treated, affected or no affected by a disorder) for determining if any of them can be defined as a biomarker associated to a normal or disorder-specific status.
Figure 6 - Antigen-independent quantitative analysis of Glyco-MPs of Control and Test Glyco-MPs populations from a cell line.
Min6 cell cultures were treated for 24 hours with palmitate at two concentrations (1.0 mM or 1.5 mM) or vehicle only (BSA) in serum-free medium. At the end of the treatment, cell culture medium was collected and total Annexin V- positive MPs (Panel A) and PolySia(2-2B antibody)-positive Glyco-MPs (Panel B) were stained with fluorescently labelled Annexin V and anti-PolySia 2-2B antibody, respectively, and then quantified by flow cytometry. The data on the effect of palmitate on Glyco-MP generation in this cell line are representative of three independent experiments. Similar results were obtained with Min6 cells using staurosporin as apoptotic agent (data not shown).
Figure 7 - Quantitative analysis of Glyco-MPs of Control and Test Glyco-MPs populations from cell lines of different origins.
The indicated cell lines were exposed to an apoptotic agent and the
MPs populations were analyzed in terms of percentage of Annexin V-positive MPs subpopulations that correspond to either 2-2B antibody- or MAA-specific Glyco-MPs subpopulations, as determined by flow cytometry (Panel A).
The analysis has been then performed in more detail for two cell lines (HT29, Panel B; HepG2, Panel C) by comparing the data that have been generated by flow cytometry using a series of fluorescently labelled binding agents
either at the level of cell surface (as percentages of all cells) or at the level of the concentration of MPs populations (as Annexin V-positive MPs population and as specific Glyco-MPs subpopulations concentration) in the cell culture supernatant. The comparison is made between control and apoptotic conditions as defined in Example 2. The average fold induction for Annexin V-positive MPs population for HT29 and HepG2 cells was of 4.0 and 12.9, respectively
Figure 8 - Qualitative analysis of Glyco-MPs by 2D-gel electrophoresis.
Min6 cell cultures were treated for 24 hours with ImM palmitate in serum-free medium. At the end of the treatment, culture medium was collected and total MPs were prepared for 2D-gel electrophoresis as described in the Material & Methods section of Example 2. Total proteins (Panel A) and glycoproteins (Panel B) were visualized on the same gel by staining it with SYPRO Ruby and ProQ Emerald 488 staining reagents, respectively. After extensive washing steps, images were captured using a Typhoon 9400 laser scanner in the area at low pi and medium molecular weight. Specific proteins that appears in a specific region of the gel has being modified with a glycan are indicated with a code and an arrow. The analysis of the Glyco-MPs proteome that is detected using from cell culture or other biological fluids can be pursued in more details using the technical approaches described in the literature.
DETAILED DESCRIPTION OF THE INVENTION
The present invention is based on unexpected findings of the presence and distribution of a specific post-translational modification on the surface of MPs populations. These evidences suggest that MPs populations that are isolated within biological fluids on the basis of at least a post-translational modification (such as phosphorylation, glycosylation, ubiquitination, and prenylation) can be used for obtaining information for the medical management of disorders, in particular for defining and comparing biomarkers present in biological fluids.
In particular, the glycan epitopes that are present on the surface of MPs populations can be used for isolating and characterizing a novel and useful MPs population named as Glyco-MPs. Glyco-MPs populations can provide information about the state of a tissue, a cell population, an organ, or a subject through the analysis of biological fluids where MPs populations are released from cells. Changes in the regulation and processing of glycans have been correlated to a number of abnormal physiologic conditions. However, no evidences have been provided so far on the possibility to integrate the information on glycans (and in general on a specific post-
translational modification) on the analysis of MPs populations in order to provide novel and useful insight of MPs features (such as concentration, composition, and/or surface antigens) within biological fluids.
As shown in the Examples below, Glyco-MPs populations do not simply represent MPs subpopulations having a specific cell origin, but are possibly the result of the aggregation of MPs populations having different cell origins, independently (or not) from cell type-specific antigens. The detection of the Glyco- MPs populations may serve as a proxy for detection of a relevant MPs population in a phosphatidylserine and/or cell type-independent manner. In fact phosphatidylserine- based MPs can be usefully combined in methods that allow isolating Glyco-MPs subpopulations that represent a more informative MPs subpopulation for proteomic, immunologic, and/or glycomic analysis. In particular, the isolation, the comparison, and the use of Glyco-MPs populations is intended to provide means for a more sensitive detection and characterization of biological features that can be used as biomarkers for a disorder.
A method for identifying Glycan-containing Microparticles (Glyco- MPs) populations in a biological fluid comprises the following steps:
a) Obtaining a sample of a biological fluid sample from a subject; b) Isolating the acellular fraction of said biological fluid;
c) Separating the Glyco-MPs from the said acellular fraction by means of at least a glycan-binding agent.
In a preferred embodiment, the step (c) of the method involves separating the Glyco-MPs populations from the said acellular fraction by means of an agent that binds a specific epitope (such as an N-linked Glycan, an O-linked Glycan, or PolySia-related epitope) as glycan-binding agent. The step (c) of the method may also involve the use of at least one further binding agent recognizing a phospholipid, a protein, a lipid, or a glycan other than the selected glycan epitope (e.g. , an PolySia- related epitope).
The expression "Glyco-MPs" refers to phospholipid-containing vesicles of cellular origin that have a submicron dimension, in particular comprised between 100 and 1000 nanometers, and that are separated from a biological fluid by means of at least a glycan-binding agent.
The origin of the Glyco-MPs can be established on the basis of the presence of molecules that are known to be associated to a cell type, and in particular those localized on the cell surface. Glyco-MPs populations are originated by cell types that form organs or tissues, at the interface between the biological fluids and tissues
(i.e. endothelial cells or the blood-brain barrier) or within the biological fluids itself (e.g. , platelets, erythrocytes). Glyco-MPs populations can be also isolated using biological fluids obtained in cell culture conditions from laboratory cell lines and primary cells of animal origin that are isolated from biopsies or biological fluids.
Flow cytometry is a preferred technology for isolating Glyco-MPs populations (and MPs in general for in vitro/ex vivo studies) according to their size and it can be standardized using size-calibrated fluorescent beads (Robert S et al , 2009; Rukoyatkina N et al , 2009). Flow cytometry analysis of Glyco-MPs populations can be performed by adapting technologies that have developed for the measurement, the preparative sorting into distinct size fractions, and the image processing of artificial nanoparticles and liposomes having similar size (van Gaal E et al , 2010; unding A et al, 2008). Combinations of antibodies, labelling agents, and other technical elements for an improved detection of MPs have been recently summarized (Orozco A and Lewis D, 2010; van der Heyde H et al, 201 1). Glyco- MPs populations can be also isolated and characterized using other methods previously reported for MPs populations, including atomic force microscopy (Yuana Y et al 2010), dynamic light scattering (Lawrie A et al. 2009), scanning electronic microscopy or antibody array (Lai S et al, 2009).
The term "separating" refers to both the physical separation and isolation of Glyco-MPs populations (and of MPs populations in general) from a biological fluid (e.g., by microfiltration or centrifugation), and the separation of Glyco-MPs populations (and of MPs populations in general) that can be performed by technologies, such flow cytometry or microscopy, which provide means for detecting images and other quantifiable signals characterizing MPs within a sample.
The expression "biological fluids" refers to any bodily fluid (and fraction thereof) from, excreted by or secreted by any living cell or organism, including but not limited to blood, cerebrospinal fluid, urine, synovial fluid, bronchoalveolar lavage fluid, aqueous/vitreous humor, amniotic fluid, seminal fluid, saliva, nipple aspirate fluid, pulmonary edema fluid, tears, proximal fluid (the fluid derived from the extracellular milieu of tissues), fluids obtained from an abscess (or any other infection or inflammation site) or a joint (if affected by disease such as rheumatoid arthritis, osteoarthritis or septic arthritis). Databases and other repertoires of the proteomes from biological fluids (Li S et al, 2009; Hu S et al, 2006) can be used to compare with results obtained by studying Glyco-MPs populations. This expression preferably applies also to plasma, cell culture supernatant and any other fluid obtained from a preliminary fractionation, depletion, or any other purification of
such biological fluids. For instance, cell culture supernatants have been used for studying MPs populations that are released from liver or mesenchymal stem cells (Chen T et al, 2010; Herrera M et al, 2010).
The term "sample" encompasses both an initial aliquot of the biological fluid as well as the product of any manipulation of the initial source of proteins, including but not limited to partial purification, fractionation, enzyme digestion, or other treatment.
The expression "acellular fraction" refers to a fraction of a biological fluid in which cells are absent, for example following a centrifugation, a separation by flow cytometry, or an affinity-based chromatography or sorting. The methods of the invention involve the isolation of biological fluids from humans, primates, rodents, or any other animal presenting an interest for medical or veterinary research. The biological fluids can be obtained by puncture, involving the removal of a volume of at least 0.01 ml {e.g., in smaller animal) or at least 1 ml (e.g. , in human or primates). It is of major importance to ascertain that the biological fluid is not mixed with cells that results from the rupture of tissues that contains the biological fluid (such as arterial or venous walls in the case of blood) during the puncture, thus excluding any contamination from uhdesired tissues and cell types.
The isolation of the acellular fraction of biological fluids can be performed by eliminating any cellular elements having a size superior to 1000 nanometers, as it is made possible by flow cytometry, microfiltration, or centrifugation. Consistently with what described in the literature (Piccin A et al, 2007), the separation of the Glyco-MPs populations from the acellular fraction of a biological fluid can be performed by applying technologies for isolating cell vesicles having a diameter comprised between 100 and 1000 nm, as well as a composition, that is typical of Glyco-MPs populations. These two criteria can be applied in any order that is appropriate for eliminating undesired biological entities that may be present in the biological fluid (such as cell debris, soluble proteins, exosomes, cells, or virus). The centrifugation of the biological fluids can be performed at a speed comprised between l,500g and 15,000g, at a temperature comprised between 15°C and 37°C, and for a time comprised between 1 minutes and 60 minutes should allow the separation of fraction containing the Glyco-MPs populations (the supernatants) from the cells (forming the pellet). Optionally, a further purification step can be performed to isolate Glyco-MPs (but not exosomes) by centrifuging the supernatant obtained above at a speed comprised between 15,000g and 30,000g, at a temperature comprised
between 15°C and 37°C, and for a time comprised between 1 and 60 minutes, in order to obtain a pellet formed by Glyco-MPs populations.
The expression "binding agent" refers to any material that can bind to the desired molecule (that is, a component of Glyco-MPs such as a protein, a protein variant, a phospholipid, a glycan, or a lipid) and consequently allow detecting, labelling, and/or separating the structures containg such molecule (i. e. Glyco-MPs) in a sample (i.e. the acellular fraction of a biological fluid), preferably by interacting with components on the surface of Glyco-MPs. The binding agent for the desired molecule can be a natural or recombinant protein (such as an antibody or a protein that binds a cell surface antigen), a peptide, a lectin, a glycan, a nucleic acid, a lipid, a phospholipid, an inorganic compound, a nanomaterial, a nucleic acid, an aptamer or a low molecular weight ligand.
The binding agent for the desired molecule can be labelled. There are numerous methods by which the label can produce a signal detectable by external means, for example, desirably by visual examination or by electromagnetic radiation, heat, and chemical reagents. The label or other signal producing system component can also be bound to a specific binding partner, another molecule or to a support such as beads, using any method known in the art, such as chemically cross-linking or using the biotin-streptavidin system. The label can directly produce a signal, and therefore, additional components are not required to produce a signal. Numerous organic molecules, for example fluorescers (such as FITC, PE, and any other known to be compatible with flow cytometry-based MPs detection), absorb ultraviolet and visible light. Other labels directly produce a signal, such as radioactive isotopes and dyes. Alternatively, the label may need other components to produce a signal, and the signal producing system would then include all the components required to produce a measurable signal, which may include substrates, coenzymes, metal ions, or substances that react with enzymatic products.
The binding agent for the desired molecule (that is, a component of Glyco-MPs surface) can be provided in a liquid phase or in a solid phase (for example, by the immobilization on a bead or a plate from which it can be or not separated) forming thus a complex with the Glyco-MPs once that the acellular fraction of a biological fluid is contacted with such agent. Subsequently, depending on the further uses, such complex can be dissociated (for instance, by temperature or chemical- induced denaturation) or the binding agent for the desired molecule can be kept associated.
The term "Glycan" refers to chemical groups also named as sugars or carbohydrates. Glycans can be monomers or polymers of sugar residues, but typically contain at least three sugars, and can be linear or branched. A glycan may include natural sugar residues (e.g., glucose, N- acetylglucosamine, N-acetyl neuraminic acid, galactose, mannose, fucose, hexose, arabinose, ribose, xylose, sialic acids) and/or modified sugars (e.g., 2'-fluororibose, 2'-deoxyribose, phosphomannose).
Glycans can be distinguished in N-linked, O-linked, or C-linked glycans on the basis of the linkage to a glycoconjugate via nitrogen, oxygen, or carbon linkage. The glycoconjugate can be also in the form of an advanced glycation end products, resulting from the non-enzymatic modification of glycans. The relevance of protein glycation has been demonstrated in several pathological conditions, including chronic complications associated to diabetes mellitus and renal failure as well as degenerative changes, and more sensitive and selective methods are now available for identification and quantification of such glycated proteins (Priego Capote F and Sanchez J, 2009; Thornalley P, 2005,).
In the present disclosure, the term "glycan" refers in general to the carbohydrate portion of a glycoconjugate, includes, but is not limited to, glycoproteins, glycolipids, proteoglycans and glycophosphosphingolipids or any other known glycoconjugate that present a glycan epitope. Glycoconjugates are found predominantly on the outer cell wall and in secreted fluids usually consist of O- or N- glycosidic linkages of oligosaccharides (a polymer containing a small number, typically three to ten saccharides) to compatible amino acid side chains in proteins or to lipid moieties. Some glycans also have modifications such as acetylation and sulfation. Glycoconjugates contain cell-surface glycans that have been shown to be important in cell-cell interactions due to the presence on the cell surface of various glycan binding receptors, in addition to the glycoconjugates themselves.
The expression "cell surface glycan" refers to a glycan that is present on the exterior surface of a cell that is, in general, covalently linked to a polypeptide (as part of a cell-surface glycoprotein) or a lipid (as part of a cell membrane glycolipid) and that can be exposed as well on the surface of Glyco-MPs populations. A cell surface glycan are formed by homo- and/or heteropolymers of sugar residues which form specific glycan epitopes (also called giycoepitopes) that are specifically recognized by glycan-binding agent.
The expression "glycan-binding agent" refers to binding agents that specifically bind a glycoepitope. Recognition systems of giycoepitopes include, but is not limited to, antibodies, lectins (of animal, plant, or pathogen origin), enzymes
containing carbohydrate recognition domain (CRD), antibodies against glycans, cytokines, chaperone and transport proteins, microbial carbohydrate-binding proteins, glycosaminoglycan-binding proteins, or any other known recognition system for glycan epitopes, without limitation.
Several properties of the cell surface glycans present on Glyco-MPs surface can be determined, with or without using glycan-binding agents, including the mass of part or all of the saccharide structure, the charges of the chemical units of the saccharide, identities of the chemical units of the saccharide, total charge of the saccharide, or total number of sulfates or acetates. The methods that are applicable for identifying such properties include, but are not limited to, capillary electrophoresis, NMR, mass spectrometry (both MALDI and ESI), and HPLC with fluorescence detection. Glycans can be detected and/or analyzed on Glyco-MPs, either in the absence or in presence of proteases or glycosidase. In particular, the structural and functional diversity within glycan epitopes that can be used for isolating and characterized within Glyco-MPs populations may be explored using technologies for comparative glycan analysis (Krishnamoorthy L and Mahal L, 2009) and synthesis (Bernades G et al, 2009), glycan arrays (Taylor M and Drickamer K, 2009), means for interfering protein-glycan interactions (Rek A et al, 2009), bioinformatics methods (Mahal L, 2008), and chemical tools for binding and/or modifying glycans, for example for studying the biology of carbohydrates in neuronal cells (Murrey H and Hsieh- Wilson L, 2008; Yanagisawa M and Yu R, 2007; Hwang H et al, 2010).
Extensive lists of glycans and of the corresponding glycan-binding agents (such as monoclonal antibodies, lectins of plant or animal origin, and chemicals) and related technologies have been published, indicating the specificity of the interaction, the compatibility with the integrity and viability of cells, and their potential use for identifying specific cell types and/or antigens of medical interest (see e.g. , Varki A et al , 2009).
A general overview of glycan epitopes of potential interest and of the corresponding glycan binding agents is provided in Table 1 below.
Table 1
Among the glycan-binding agents, lectins are of particular interest given their specificity for different sugar moieties that are either onto a soluble carbohydrate or onto a carbohydrate moiety that is a part of a glycoprotein or glycolipid (Gemeiner P et al, 2009). Consequently, distinct glycopro files can be generated and compared according to the choice and/or the combination of lectins according to their glycan epitope. A list of lectin that can be used in the methods of the invention includes: GNA (Snowdrop lectin), PNA (Peanut agglutinin), VVL (Hairy vetch lectin), WGA (Wheat Germ agglutinin), SNA (Sambuscus nigra lectin), MAL/MAA (Maackia amurensis leukoagglutinin), MAH (Maackia amurensis hemoagglutinin), LFA (Limax flavus agglutinin) and ConA (Concanavalin A).
The Examples below show that a specific glycan known as sialic acid, alone or in polymerized forms of this glycan known as polysialic acid, as well as any glycan recognized on the basis of the presence of a sialic acid (hereafter collectively defined as "PolySia-related epitopes") can be preferably used in methods for isolating Glyco-MPs populations of interest.
The expression "sialic acid," as used herein, is a generic term for the N- or O- substituted derivatives of neuraminic acid, a nine-carbon monosaccharide (Varki A, 2008). The amino group of neuraminic acid typically bears either an acetyl or a glycolyl group in a sialic acid. It is also the name for the most common member of this group, N-acetylneuraminic acid (Neu5Ac or NANA) and 2-Keto-3-
deoxynononic acid (Kdn). Other members of sialic acid include, but are not limited to, N-Acetylglucosamine, N- Acetylgalactosamine (GalNAc), N-Acetylmannosamine (ManNAc) and N-Glycolylneur- aminic acid (Neu5Gc). Sialic acids are found widely distributed in animal tissues and in bacteria, especially in glycoproteins and gangliosides. The amino group bears either an acetyl or a glycolyl group. The hydroxyl substituents may vary considerably: acetyl, lactyl, methyl, sulfate and phosphate groups have been found. Hydroxyl substituents present on the sialic acid may be modified by acetylation, methylation, sulfation, and phosphorylation. The predominant sialic acid is N-acetylneuraminic acid (Neu5Ac). Sialic acids impart a negative charge to glycans, because the carboxyl group tends to dissociate a proton at physiological pH.
Glycosylation changes associated with apoptosis, including at the level of sialylation, have been reported in different cell lines from different histological origin (colon, breast, pancreas, and bladder cancer) as these cells are recognized by selected lectins, in presence or in absence of specific enzymes that synthesize or degrade sugar chains (Malagolini N et al, 2009). However, there is no evidence in the literature on any preference or other features of glycosylation that can be used for isolating MPs populations having medical and/or technical relevance.
Moreover, the Examples below show that evidences generated by studying the glycan epitopes present on the surface of cell lines in presence of apoptotic agents cannot be used for interpreting or anticipating the presence of specific glycan epitopes on the surface of Glyco-MPs populations, which rather appear as biological entities providing distinctive (and possibly more relevant) biological information.
Antibodies to variants of PolySia-related epitopes (in terms of chemical derivativization, linkage and/or degree of polymerization) have been generated and compared in terms of binding specificity, epitope presentation, and degree of polymerization (Hayrinen J et al, 1995; Hayrinen J et al , 2002; Sato C et al, 1995; Sato C et al , 2000), establishing the specificity of these antibodies for PolySia related epitopes having defined lengths arid degrees of polymerization ranging from 2 up to 200 sialyl residues. A series of human and rodent proteins have been showed as presenting one or more PolySia-related epitopes and/or degree of polymerization of the PolySia-related epitopes, the main one being PSA-NCAM has been used for identifying, studying the activities, and/or sorting specific cell types such as neuronal cells (Bonfanti L, 2006) and pancreatic beta-cell subpopulations (Banerjee M and Otonkoski T, 2009). Other proteins presenting PolySia-related
epitopes have been identified such as betal integrin (Bartik P et al , 2008) and DPP-4 (Cuchacovich M et al. 2001), sodium channels (Zuber C et al , 1992), and CD36 (Yabe U et al, 2003). Moreover, panels of peptides and proteins that are linked with PolySia-related epitopes were identified and quantified in blood using (glyco)proteomic technologies, provding additional candidates of proteins that can be associated to this type of glycosylation (Alley W and Novotny M, 2010; Kurogochi M et al. ,2010).
A list of preferred PolySia-related epitope and related PolySia- binding agents that are known in the literature and then can be used in methods for identifying Glyco-MPs populations is provided in Table 2.
Table 2
The interaction between Glyco-MPs populations and such glycan- binding agents can be studied by means of competing soluble glycans such as those
generated using chemical technologies and characterized by mass spectrometry (Galuska S et al , 2007; Patane J et al , 2009). Moreover, technologies for the enrichment of peptides that are linked to glycans can be used for the analysis of the structure and attachment site identification of glycans that are present on the Glyco- MPs populations (Nilsson J et al, 2009). Series of glycan-binding agents may be used for detecting and isolating different types of Glyco-MPs subpopulations in parallel.
However, glycan-binding agents that are compatible with technologies that maintain MPs integrity (such as FACS, immunological assays, or magnetic beads-based cell isolation are preferred. For example, a panel of antibodies and binding proteins that have been characterized in the literature for different PolySia-related epitopes into biological materials can be used for detecting, isolating and comparing the corresponding Glyco-MPs (sub)populations presenting such PolySia-related epitopes.
This analysis can be accompanied also by the detection of known cell type-specific antigens (using antibodies or other molecules that specifically bind such antigens) that can be more or less frequently associated to total MPs populations or Glyco-MPs (sub) populations within biological fluids and/or in cell culture conditions. List of antigens that can be used to further distinguish Glyco-MPs populations according to their cell origin has been published (Burnier L et al, 2009; Orozco A and Lewis D, 2010; van der Heyde H et al, 2011).
The study of Glyco-MPs populations that expose glycan epitopes (such Polysia-related epitopes) can be also performed by using experimental in vitro and in vivo approaches for either inhibiting glycosylation or for integrating unnatural precursors for labelling the glycan epitopes (Bork E et al, 2007). Preferably, the analysis of Glyco-MPs populations comprises detecting alterations in one or more features of sialylation, including the type of linkage, the degree of polymerization, modifications of sialic acids (including sulfation, branching, presence or absence of a bisecting N-acetylglucosamine), and changes in the number of polysialylated proteins, lipids and/or molecule-specific sites on Glyco-MPs. These studies can be performed in parallel with the determination of other features of Glyco-MPs populations such as the presence of cell type-specific antigens or of biological activities that are established in vitro using cell line-based assays (as for procoagulant activity).
The methods of the invention provide Glyco-MPs populations that are separated from the acellular fraction by means of at least one further binding agent recognizing a phospholipid, a protein, a lipid, or a glycan other than the one used for
isolating the Glyco-MPs population. This additional binding agent preferably binds a phospholipid which is phosphatidylserine. In particular, said phosphatidylserine- binding agent is Annexin V or Lactadherin (Shi J and Gilbert G, 2003; Logue et al. 2009) or other proteins, peptides, or chemicals (Thapa N et al , 2008; Lemmon M, 2008; Stace C and Ktistakis N et al, 2006).
Phospholipid-binding agents, and in particular phosphatidylserine- binding agents, are preferred, with preference for those not requiring calcium for binding phosphatidylserine and not altering MPs integrity. MPs population have been often isolated and characterized from biological fluids using phosphatidylserine-binding agents that are in a solid or a liquid phase.
Alternatively (or in addition) the methods may involve the use of one or more additional binding agents that bind a protein, lipid, or glycan of the cell surface that is transferred to the surface of Glyco-MPs populations following their release from the cells, thus identifying their origin. These methods can be performed using a binding agent that bind a protein, lipid, or glycan of the cell surface is defined according to a specific cell type, tissue, organ, drug treatment, age, sex, pathology, genotype, phenotype, predisposition, viral infection, and/or clinical status. Additional binding agents to e used according to the invention can be defined as agents that bind a cell type-specific antigen {e.g. , an antibody).
The separation and/or the detection of Glyco-MPs populations with an additional binding agent can be performed prior to, simultaneously, or following the separation step that involve the glycan-binding agent and may be used as well for separating MPs populations. This step may be performed in liquid or solid phase, and in the latter case the solid phase can be in the forms of beads, and in particular magnetic beads, a support that has been already used for immobilizing Annexin V and sorting apoptotic cells from a biological fluid (Said T et al , 2008). These additional binding agents can be used not only as a mean for positively selecting the Glyco-MPs population but as a negative selection tool {e.g., for eliminating specific MPs populations presenting a specific cell surface antigen or cell debris and other undesired entities within the sample of biological fluid). Equally, specific Glyco-MPs subpopulation may be negatively selected in order to define an MPs subpopulation having a potential medical or biological interest For instance, a MPs subpopulation that is deprived of specific glycan epitopes may be enriched in other antigens that may be of interest for defining and validating a biomarker in a population.
A further aspect of the present invention is a Glyco-MPs population that is obtained according to the methods defined above. The Glyco-MPs populations
can be provided in a liquid or a solid phase, and in association or not with the binding agent. These novel biological entities can provide novel biomarkers that are associated to Glyco-MPs in general or to specific Glyco-MPs subpopulations of interest that are defined in connection to specific cell types and/or disorders. For instance, such biomarker can allow screening subjects at risk of being affected by a disorder, since it can be identified by using common technologies such as flow cytometry, mass spectrometry, gel electrophoresis, an immunoassay (e.g. , immunoblot, immunoprecipitation, ELISA), nucleic acid amplification, procoagulant activity, and/or electron microscopy on biological fluids or Glyco-MPs populations obtained from such subjects in a singleplex or multiplex formats as summarized in Figures 1 and 5. For instance, the Examples show that a significant fraction of a Annexin V-positive MPs population can be isolated and characterized as a Glyco-MPs population by double staining in flow cytometry.
The Glyco-MPs population provide means for defining novel biomarkers. In particular, the biomarkers can be defined by means of the concentration of Glyco-MPs population only or the concentration of Glyco-MPs and of the concentration of at least another population of MPs that present a protein, lipid, phospholipid, and/or glycan of the cell surface. Such biomarkers can correspond to a peptide, a protein, a phospholipid, a lipid, a nucleic acid, a glycan, or any combinations of such Glyco-MPs components. The biomarker can be specific for a disorder and may be identified by means of one or more technologies such as flow cytometry, mass spectrometry, gel electrophoresis, immunoassay, nucleic acid amplification, or in vitro assays for a biological activity.
The term "biomarker" refers to a molecule, a parameter, a characteristic, or an entity that is objectively measured and evaluated as an indicator of a specific state of an organism, in particular in association to a normal or pathogenic process, or the response to a medical treatment.
In the present case, this factor can be defined by the concentration and/or the components of Glyco-MPs that are isolated from biological fluids of humans or animals (rodents or primates, in particular). Accordingly, the biomarkers can be defined by means of:
a) The concentration of a Glyco-MPs presenting a specific glycan epitope (for example, a PolySia-related epitope);
b) The ratio between the concentration of total MPs population and of a Glyco-MPs population of (a);
6035
c) The ratio between the concentration of a Glyco-MPs population of (a) and a different glyco-MPs population;
d) The concentration of MPs not presenting the specific glycan epitope of (a); and/or
e) The concentration of MPs populations of (a) and/or (d) that present a protein, lipid, phospholipid, and/or glycan other than the specific glycan epitope of (a).
The biomarker can be found associated to the whole Glyco-MPs population and/or to specific Glyco-MPs subpopulations defined by any molecular parameter of interest (for example, the presence of a cell-type specific antigen). The quantitative evaluation of Glyco-MPs in specific volume of a biological fluid can be, or not, associated to a quantitative evaluation of total MPs in such volume. The concentration of Glyco-MPs (sub)populations that present (in particular on the surface) a cell component (e.g. , a protein, a protein variant, a phospholipid, a nucleic acid, a glycan, a glycoconjugate) or any other organic or inorganic elements may be used as biomarker. Such component that is found associated to a Glyco-MPs populations can be used as a biomarker that allows establishing a specific status of the cells originating the Glyco MPs (sub) population and/or the possible interactions of Glyco MPs (sub)populations with the surface of the specific cell types or of a virus, with a drug, an antibody, and any other compound present in the biological fluid.
An association between a biomarker (such as a Glyco-MPs population or a Glyco-MPs component) and a disorder can be established independently from the cause of the disorder but only from its effects and other associated biological evidences.
The Glyco-MPs populations can allow the identification of biomarkers for characterizing the state of a subject (such as normal, affected or at a risk of disorder, responding or not to a therapy) by using samples of one or more biological fluid obtained from such subject. Once that biomarkers are found associated to Glyco-MPs, such biomarkers can be identified in the subjects of interest (e.g., animal models, patients, at risk individuals) for obtaining information of medical interest on a subject, throughout the time (e.g. , before, during, and/or after a medical intervention or treatment) and/or in comparison to reference populations (e.g., control, healthy subjects or subjects affected by a disorder). Such biomarkers may be detectable even without using Glyco-MPs populations but, given the complexity of biological fluids, Glyco-MPs population may provide a more precise and reliable analysis of biomarkers otherwise undetectable. Alternatively, the subtraction of
specific Glyco-MPs subpopulation may provide a MPs population that is particularly enriched (or deprived of) specific antigens in defined test conditions, thus representing an alternative mean to identify biomarkers
The present Invention also relates to kits for isolating and/or using Glyco-MPs for medical or veterinary application. The kits for isolating Glyco-MPs populations comprise a glycan-binding agent (for example, specific for a PolySia- related epitope as listed in Table 2) and at least one further binding agent recognizing a phospholipid (for instance, a phosphatidylserine-binding agent) a protein, a lipid, or a glycan other than the one used for isolating the Glyco-MPs population. The binding agents for the desired molecules can be provided in a liquid or a solid phase, with or without means for detecting and comparing effectively the interaction with Glyco- MPs (and consequently for quantifying the Glyco-MPs (sub)population of interest) by using one or more proteomic, immunological, biochemical, chemical, biological or nucleic acid detection method.
The present invention also provides the use of the Glyco-MPs populations, or of a kit as defined above for identifying biomarkers of medical interest in a sample of biological fluid. At this scope, the Glyco-MPs populations of the invention can be isolated, compared, and used according to desired medical application. Examples of the process for analyzing and comparing Glyco-MPs and identifying biomarkers of medical interest are summarized in Figures 1 and 5, but many other possibilities can be envisaged in connection to specific medical goals, features of the biomarker, and/or the type of populations to be evaluated.
In particular, the biological fluids into which Glyco-MPs features are studied, can be obtained from distinct groups of subjects that are appropriately selected (e.g., on the basis of drug treatment, age, sex, pathologies, genotype, phenotype, exposure to risk factors, viral infection, or clinical status) and then compared at the level of Glyco-MPs (sub)populations using biomarkers that can be evaluated by means of one or more proteomic, immunological, biochemical, chemical, biological, or nucleic acid detection method. This comparison may also involve the use of appropriate statistical and/or imaging methods (including MRI, CAT, and ultrasound, immunodiagnostic test, detection of protein levels, or biopsy), should allow confirming the identification of a biomarker associated to Glyco-MPs that can be further used in diagnostic and drug discovery/validation methods for a disorder, as well as of any other disorder that may alter the structure and/or the activity of an organ, a tissue, or a cell type.
The present invention also provides methods for diagnosing or monitoring a disorder that comprises the identification of a biomarker that have been characterized using Glyco-MPs. Such medical methods involve the isolation, the characterization, and the comparison of Glyco-MPs populations in a sample of biological fluid. Glyco-MPs quantitative and/or qualitative features might be of considerable value for diagnosing and monitoring of human disorders, as well as for evaluating drug candidates and drug treatments for any disease, and in particular for establishing their effects on biological fluids.
These methods can involve determining Glyco-MPs concentration and/or composition in test and control samples by suing technologies such as flow cytometry, mass spectrometry, gel electrophoresis, an immunoassay (e.g. , immunoblot, immunoprecipitation, ELISA), nucleic acid amplification, procoagulant activity, and/or electron microscopy on biological fluids or Glyco-MPs populations (that is, by applying technologies that allow the identification of biomarkers of interest). These methods may involve the isolation and the comparison of Glyco-MPs populations within selected biological fluids (e.g. , blood, urine) where Glyco-MPs populations can be isolated.
Optionally these methods may involve comparing the concentration and/or composition of total MPs. Still optionally, the methods may involve the detection of the biomarker(s) that can be found associated with Glyco-MPs populations within a tissue. Such tissues can be the ones from which Glyco-MPs populations can be originated (e.g. , obtained from biopsies of the CNS) but can also be any other cell types or biological material of interest for diagnosing or monitoring a disorder.
It will be understood that it is not absolutely essential that an actual control sample be run at the same time that assays are being performed on a test sample. Once "normal" (i. e. control) concentration and/or composition of Glyco-MPs populations (i.e. Glyco-MPs vs plasma MPs population ratios, Glyco-MPs populations presenting or not a specific cell surface antigen) have been established, these levels can provide a basis for comparison without the need to rerun a new control sample with each assay. The comparison between the test and control samples using appropriate statistical methods and criteria should provide a basis for a conclusion on the state of the subject, for instance whether the disorder is progressing or regressing in response to a treatment, if the subject is (or will be) affected by a disorder, or if the subject has been exposed to a drug, to a traumatic insult, or any other event that alters
the metabolism within a biological fluid, and in particular the generation of Glyco- MPs populations.
The term "diagnosing" refers to diagnosis, prognosis, monitoring a disorder in a subject individual that either has not previously had the disorder or that has had the disease but who was treated and is believed to be cured. This application of the methods of the invention can be extended to the selection of participants in (pre) clinical trials, and to the identification of patients most likely to respond to a particular treatment.
The term "monitoring" refers to tests performed on patients known to have a disorder for the purpose of measuring its progress or for measuring the response of a patient to a therapeutic or prophylactic treatment.
The term "treatment" refers to therapy, prevention and prophylaxis of a disorder, in particular by the administration of medicine or the performance of medical procedures, for either prophylaxis (prevention) or to cure the infirmity or malady in the instance where the patient is affected.
The quantitative and/or qualitative in vitro/ex vivo analysis of Glyco-MPs populations provide relevant information for evaluating a subject, having a predefined clinical status, disorder predisposition, positive/negative response to a treatment, and/or sensibility to a drug or a pathogen (see Figure 1). In fact, this analysis may lead to a definition of a profile in which different elements characterizing Glyco-MPs populations are used, including concentration (absolute or relative to total MPs or cell type-specific MPs in the preferred biological fluid), presence/absence of one or more antigens, reduced/increased presence of one or more antigens, size, phospholipid composition, intracellular components, and the like. This method of evaluation can be also applied for characterizing a cell population that is maintained in vitro/ex vivo (such as cell lines, primary cells, stem cell, tissue material preparations) whereby the presence of Glyco-MPs population is established in the cell culture supernatant (see Figure 5). In this manner, human Glyco-MPs can be identified and characterized in patients that have been selected by different criteria (for example at risk, suffering, or under treatment for a disorder).
The Examples below demonstrated that, by combining in vitro and in vivo studies of biological fluids, Glyco-MPs populations can be detected, isolated, and characterized for identifying biomarkers of medical interest, in particular by using proteomic and other technologies that are described in the literature for studying specifically membrane proteins within biological fluids (Lai Z et al. , 2009; Cordwell S and Thingholm T, 2010), not only in blood but also in urine (Smalley D et al, 2008a)
or cerebrospinal fluid (Hale J et al , 2008; Shi M et al , 2009; Roche S et al , 2008; Zougman A et al, 2008),
All references cited herein are fully incorporated by reference in their entirety. Having now fully described the invention, it will be understood by those of skill in the art that the invention may be practiced within a wide and equivalent range of conditions, parameters and the like, without affecting the spirit or scope of the invention or any embodiment thereof.
EXAMPLES
Example 1; Quantification of Glyco-MPs in the blood of rodent models
Materials & Methods
Preparation of platelet-free plasma from rat blood in the diabetes models
Two different rat models of diabetes were used to determine Annexin V-positive and Glyco-MPs levels in vivo. First, male Zucker diabetic fatty (ZDF) rats (20 weeks old, Charles River, USA) were compared to age-matched Zucker lean controls (ZLC). Second, male Sprague Dawley (SD) rats (8-weeks old, Janvier, France) received for 5 days a daily injection of Streptozotocin (20mg/kg) or saline. At the end of the protocol (for both models), animals were fasted for 6 hours, and then anesthetized using Isoflurane. In these rat models, blood was collected by retro-orbital puncture and transferred into a tube containing 1/10 volume of citrate buffer in order to prepare platelet-rich plasma.
In both cases, within one hour of collection, the blood samples is centrifuged at l,500g for 15 minutes at room temperature. The supernatant is then carefully removed and transferred to a new tube.
Platelet- free plasma is then obtained by centrifugation at 13,000g for 2 minutes at room temperature. Again, the supernatant is carefully transferred into a new tube and snap-frozen using liquid nitrogen. Samples were stored at -80°C until use.
Preparation of platelet-free plasma from mouse blood in the diabetes model
Male Db/db mice (13-weeks old, CERJ, Le Genest Saint Isle, France, 15 animals per group) were compared to their lean counterpart (db lean) in standard chow diet. At the end of the protocol, animals were fasted for 6 hours, and then anesthetized using isoflurane. Blood was collected by retro-orbital puncture and transferred into a tube containing 1/10 volume citrate in order to detect the different
MPs populations. Another tube with EDTA was prepared for glucose and insulin analysis. Platelet-free plasma is then obtained and stored as indicated above for samples of rat origin.
Production and purification of recombinant human Annexin V protein
The DNA encoding human Annexin V (Genebank NM_001 154) was used for producing Histidine-tagged, recombinant Annexin V in bacteria (E. Coli strain BL21 star PI OS). The recombinant protein results from the fusion of the DNA sequence coding for a synthetic sequence (MGRSHHHHHHGMASMTGGQQMGRDLYDDDKDRWGSE; SEQ ID NO: 1) that includes an hexahistidine tag (HHHHHH; SEQ ID NO: 2) and the Xpress epitope (DLYDDDK; Invitrogen Life Technologies), in 5' to the DNA encoding human Annexin V (amino acids 1-320). The Histidine-tagged, recombinant Annexin V was purified using an HIS-Trap column (GE Healthcare). Purity was assessed by SDS- PAGE gel and sequence was verified by MALDI-TOF mass spectrometry. His-tagged Annexin V was then labelled with FITC (NHS-Fluoroscein; Thermo-Scientific, Pierce Protein Research Products; Cat. No. 46410), following the manufacturer's protocol.
Quantification of phospholipid-positive, Glvco-MPs, antigen specific populations
MPs populations presenting phosphatidylserine and/or PolySia- related epitopes on their surface were identified in Platelet-free plasma as cell particles having a diameter comprised between 0.5 and Ι μιη and positively stained with labelled Annexin V and/or with indicated lectin or monoclonal antibodies, respectively. In addition, counting beads (Flowcount Fluorospheres, Beckman- Coulter, France; 30μ1 / sample with a 0.5μιη cut-off to obtain reproducible results) were added to each sample in order to express MPs counts as absolute number per μΐ of biological fluid.
The samples of platelet-free plasma (each having a volume of 30μ1) were incubated in the dark for 30 minutes with either His-tagged, FITC-labeled Annexin V (60ng) in incubation buffer (2.5mM CaCl2, 140mM NaCl, lOmM Hepes pH 7.4) or Annexin V PE-Cy5 that was prepared with the Lightening Link TM PE- Cy5 Tandem Conjugation kit. In the latter case, 60 μg of Annexin V was labeled with Lightening Link Modifying agent with 100 μg of PE-Cy5 3 hours in a dark room.
Distinct Glyco-MPs populations were analysed by flow cytometry using, as glycan-bnding agent, a monoclonal IgM antibody directed to PolySia (final concentration 30 g/ml; AbCys, clone 2-2B; Rougon G et al, 1986) which was then
5
detected using a PE-conjugated secondary antibody (Goat anti-mouse IgM PE, dilution 1/8; Caltag Laboratories) or using a fluorescent lectin from Maackia amurensis (MAA FITC; EY laboratories; Cat. No. F-7801-2). When double staining reactions were performed, the labelling reaction was stopped with a quencher and the preparation was adjusted at 15 μg/ml. 30 μΐ of MPs were mixed with 10 μΐ of Glycan- binding agent at 300 g/ml and Ι ΟμΙ of Annexin V (AnnV PE-Cy5) at 15 μg/ml or PE anti-mouse Ter-1 19 (TER; BD-Pharmingen, Cat. No. 553673) at 20 μg/ml for erythrocyte -derived MPs or PE-Cy7 anti-mouse CD41 (CD41 PC7; eBioscience, Cat. No. 25-041 1-80) at 10 μg/ml for platelet-derived MPs. Samples were then analyzed by flow cytometry.
The quantifications were performed for each sample by FACS (FC500 flow cytometer; Beckman-Coulter, France), using the two MPs-labelling compounds either in parallel on two different aliquots of the same sample, or simultaneously on the same aliquot, then analysing separately the two signals.
Results & Conclusions
The molecular features of potential medical interest that are present in Glyco-MPs populations can be characterized by applying a process in which samples of biological fluid having different origins (e.g. , blood, cerebrospinal fluid, urine; before or after treatment; in control individuals or patients) are isolated and compared for the quantitative and qualitative features using appropriate technologies (Figure 1).
At least initially, the Glyco-MPs populations were obtained and defined by using a process that allow comparing the concentration of glycan-specific and phospholipid-specific MPs populations in different subjects, in particular for assessing the contribution of glycan-specific Glyco-MPs populations to the overall MPs concentration in a sample of biological fluid, as generally defined on the basis of the presence of phosphatidylserine on their surface. This approach was applied for initiating a more general evaluation of quantitative, size, and/or molecular features of Glyco-MPs populations that are obtained using samples of biological fluid isolated from different subjects in conditions that maintain the MPs integrity.
At this scope, a series of experiments were designed to quantify in parallel Annexin V-positive MPs populations and Glyco-MPs populations in blood of both rat and mouse origin by flow cytometry, using fluorescent calibrated beads with a 0.5μπι cut-off to obtain reproducible results (Robert S et al , 2009). Glyco-MPs populations were identified and compared to phosphatidylserine-containing Annexin V-binding MPs populations by means of a commercial anti-PolySia antibody, in order
to determine if polysialic acid can be considered as a candidate glycan for isolating and characterizing Glyco-MPs populations.
Blood was collected and samples were processed according to the technical flowchart (Figure 1) for identifying Glyco-MPs within preclinical models. In particular, rat models for diabetes were used, such as ZDF rats and rats injected with a low dose of Streptozotocin for 5 days, in order to induce pancreatic degeneration leading to a decrease in insulin secretion and ultimately to diabetes (Chen D and Wang M, 2005).
Flow cytometry analysis not only confirmed that PolySia-positive Glyco-MPs population can be identified in rat plasma as a substantial fraction (about 60%) of Annexin V-positive MPs population in control samples but also that the levels of both two MPs populations were proportionally increased in both ZDF rats (Figure 2, panels A and B) and Streptozotocin-injected rats (Figure 2, panels C and D), even if the basal concentration of MPs populations in control rats were different in the two models by almost an order of magnitude.
Another rodent model for diabetic dyslipidemia has been used for assessing the potential relevance of Glyco-MPs. The db/db mice are homozygous for a mutation of Leptin receptor that become identifiably as obese around three to four weeks of age. Elevations of plasma insulin begin at 10 to 14 days of age and of blood sugar at four to eight weeks. A number of features are observed in this model, including an uncontrolled rise in blood sugar and severe depletion of the insulin- producing beta-cells of the pancreatic islets, and consequently it is used for preclinical validation of candidate drugs against type 2 diabetes and dyslipidemia (Reifel-Miller A et al, 2005).
In this model, the induction of Annexin V positive MPs reached 1.5- fold in db/db mice (n=13) versus the control group (n=12) including db/lean mice (heretozygous for this specific mutation). This trend is maintained for MPs that are positive for an erythrocyte-specific antigen but not observed in a Glyco-MPs population that is isolated by means of a labeled lectin (MAA). However, if the erythrocyte-specific antigen is detected in the Glyco-MPs subpopulation, this small MPs subpopulations has a 3.6 fold increase in the db/dbmice when compared to controls that is significatively higher than the 2.3-fold induction of MPs subpopulation in dbdb mice that is positive for both Annexin V and the erythrocyte-specific antigen. The platelet fraction of total Annexin V positive population did not detect any change between insulin-resistant and lean animals even if combined with MAA-based detection (Figure 3 A). The development of insulin resistance in db/db mice at 13
weeks in the experiment was confirmed by measuring the glycemia (Figure 3B) and insulinemia (Figure 3C).
Thus, it was surprisingly demonstrated that Glyco-MPs populations, such as positive MPs populations that are positive for PolySia-related epitope, can be isolated and used in parallel with (or in alternative to) known methods, such as those based on phospholipids or cell type-specific antigens, for establishing the qualitative and quantitative features of MPs subpopulations in a biological fluid, for example that is obtained from preclinical models of diseases, such as those for diabetes, endotoxemia, atherosclerosis, cancer, or rheumatoid arthritis.
It can be suggested that, by using binding agents specific for different glycans and/or different biological fluids, different percentages of total MPs populations are identified as Glyco-MPs populations. However, the specific Glyco- MPs populations (such as PolySia-positive Glyco-MPs or Glyco-MPs subpopulations identified according to lectin binding features) are of particular interest. Glyco-MPs subpopulation appear as being generated and metabolized within biological fluids in manners that appears being either very different or very similar to the overall MPs populations (even if such Glyco-MPs populations have almost certainly different cell origins and even if a different cell surface components are known to be modified with glycans) depending on glycan epitope/binding agent (such as PolySia-related epitopes and corresponding binding agents) that is used.
This finding is of major importance since there are no evidence in the literature on if and how the presence of a specific glycans on the surface of MPs allow identifying alternative MPs populations that have relevant features for assessing the overall MPs concentration in a sample of biological fluid, as well as and drug- and/or disease induced changes of potential medical interest, as in the rodent models described in this Example.
Example 2: Quantification of Glyco-MPs in human blood
Materials & Methods
Preparation of platelet-free plasma from human blood in control- case studies
In humans, blood was collected using a classical 19-gauge needle by slow-pull syringe venipuncture and, after discarding the first 2 ml of blood, the subsequent 6 ml of blood transferred into 1/10 volume of 3.2% sodium citrate (Vacutainer Tubes, BD).
In the case-control study for evaluating MPs populations in coronary patients compared to control subjects, two 2 parallel groups (each comprising 6
subjects) were established in open conditions: stable coronary patients (coronarian) versus control subjects.
All participants were Caucasian male aged from 50 to 75 years, in a seemingly good health at the time of selection, and provided written informed consent prior to enrolment. The stable coronary patients were included on the basis of a status defined as "stable coronary disease" that is defined by one or more of the following conditions: stable or unstable angina pectoris with positive ECG stress test or positive myocardial scintigraphy or stenosis of >50% of coronary artery, history of myocardial infarction, history of coronary revascularization, under treatment by Aspirin and/or statin at stable dose for at least 3 months. The control subjects were included as not having a history of coronary disease or family history of coronary disease.
In both cases, within one-two hour of collection, platelet-rich plasma was obtained from the blood samples by centrifugation at l ,500g for 15 minutes at room temperature. The supernatant is then carefully removed and transferred to a new tube. Platelet-free plasma is then obtained by centrifugation at 13,000g for 2 minutes at room temperature. Again, the supernatant is carefully transferred into a new tube and snap-frozen using liquid nitrogen. Samples were stored at -80°C until use.
Quantification of phospholipid-positive MPs and Glyco-MPs populations
Phospoholipid-positive MPs populations presenting phosphatidylserine or Glyco-MPs populations that present a PolySia-related epitope as relevant targets on their surface were identified in Platelet-free plasma as cell particles having a diameter comprised between 0.5 and Ι μηι and positively stained with labelled Annexin V. The samples of platelet- free plasma (each having a volume of 30μ1) were incubated in the dark for 30 minutes with either His-tagged, FITC-labeled Annexin V (60ng) in incubation buffer (2.5mM CaC12, 140mM NaCl, lOmM Hepes pH 7.4), or with a monoclonal IgM antibody directed to a PolySia-related epitope (final concentration 30 μ^ηιΐ; AbCys, clone 2-2B; Rougon G et al , 1986) which was then detected using a PE-conjugated secondary antibody (Goat anti-mouse IgM PE, dilution 1/8; Caltag Laboratories). In addition, counting beads (Flowcount Fluorospheres, Beckman-Coulter, France; 30μ1 / sample with a 0.5μιη cut-off to obtain reproducible results) were added to each sample in order to express MPs counts as absolute number per μΐ of biological fluid. Alternatively, 30 μΐ of Glyco-MPs were labelled with Annexin V PE (Beckman Coulter, 731726) or 5 μΐ and Maackia amurensis lectin (MAA FITC; EY laboratories F-7801-2, CA, USA) 10 μΐ at 300 μ^πιΐ.
The analysis was performed for each sample by FACS (FC500 flow cytometer; Beckman-Coulter, France), using the two MPs-labelling compounds in parallel, or simultaneously on the same aliquot, then analysing separately the two signals.
Results & Conclusions
A confirmation to the observations that were made in rodent models was sought in samples of human origin, wherein the Glyco-MPs populations were determined by flow cytometry, in absolute terms or combined with Annexin V binding data.
In a first study, PolySia Glyco-MPs populations were identified and compared to phosphatidylserine-containing, Annexin V-binding MPs populations by flow cytometry using the plasma of six individuals. As in the animal model, the levels of these two MPs populations showed an extremely tight correlation (with about 60% of Annexin V-positive MPs that are PolySia-positive Glyco-MPs) in all the samples, even if the basal level of MPs populations were different (Figure 4, Panel A).
In a second study, a group of human subjects were selected according to their clinical status associated to Coronary Artery Disease. This disorder is the main death cause in the industrialized world and is mainly due to atherosclerosis, which is a chronic inflammatory disease, initiated and propagated by continuous damage to the vascular endothelium, referred to as endothelial dysfunction. Apoptosis is a process of cell death that has been shown to occur during the progression of human atherosclerotic plaque. The consequences of apoptosis are deleterious because it enhances plaque thrombogenicity after plaque rupture and leads to acute ischemic events and infarction. Such mechanism is associated with a systemic pro-inflammatory state, with changes in multiple cytokines and shedding of MPs population in blood circulation that are originated from diverse apoptotic or activated cell types. The levels of circulating MP (sub)populations are positively correlated with the development of number of chronic inflammatory diseases including cardiovascular diseases (Mayr M et al, 2008; Boulanger C et al. 2006; Shantsila E, 2009).
In a case-control study that was performed in human subjects, the case group defined as stable coronary patients showed a decrease in the concentration of Annexin V-positive MPs population. However, the Glyco-MPs subpopulation that was selected by using both a lectin (MAA) and Annexin V was actually is induced by 3.2 fold in the case group, wherein this specific Glyco-MPs population that represented less than 2% of Annexin V-positive MPs population in the control group, represented almost 10% (Figure 4, Panel B).
6035
Thus, rodent and (more importantly) human plasma contains detectable amounts of Glyco-MPs populations that can be isolated and characterized in conditions that maintain MPs integrity and that can provide a different understanding of MPs relevance in patho-physiological mechanisms and/or in the definition of biomarkers. Thus, Glyco-MPs subpopulations can be compared and used (as such or as proxy) for establishing novel biomarkers within biological fluids that reflecting a patho-physiological state of a subject and therefore could be used for disease prediction, diagnosis, prognosis and follow-up, with a strong focus on both chronic conditions (including inflammatory bowel disease, rheumatoid arthritis, atherosclerosis, diabetes, cancer, and in general metabolic and cardiovascular diseases) and acute conditions (including transplantation, stroke, sepsis, traumatic injuries).
Example 3: Quantification and characctrization of Glyco-MPs subpopulations that are generated in cell culture conditions.
Materials & Methods
Cell culture protocols
The murine pancreatic cell line Min6 (Miyazaki et αί, 1990) was cultured in DMEM medium (4.5g/L Glucose, Gibco) supplemented with 15% fetal bovine serum (AbCys), 1 % penicilin/streptomycin (VWR, val de Fontenay, France), 1% sodium pyruvate (Gibco), and 3.75 μ^Ι of beta-mercaptoethanol. Cells were cultured at 37°C in 5% C02 atmosphere and seeded either at 35,000 cells/cm2 (for stimulation experiments) or at 5 χ 106 into 150 cm2 culture flask (BD Bioscience; for FACS experiments). When cells reached confluence, they were rinsed twice and cultured with serum-free and glucose-free medium. For proteomic experiments, the cells were then treated for 24 hours with palmitate at two concentrations (1.0 mM or 1.5 mM; Sigma, France) or vehicle only (BSA 30% alone) in the same medium.
Human Umbilical Vascular Endothelial Cell (HUVEC) cells (CC- 2517; Cambrex, Walkersville, USA) were cultured in EBM®, Endothelial Basal Medium (EBM media; Cambrex, CC-3121 ; Walkersville, USA) and EBM plus SingleQuots of growth supplements (EGM BulletKit, Cambrex CC-3124; Walkersville, USA). Cells were seeded at 2 500 to 5 000 cells / cm2 into 150 cm2 culture flask (BD Bioscience; Le Pont-De-Claix, France) and maintained at 37 °C in 5% C02 atmosphere. Cells were used for experiments when they reached 80% confluence. HUVEC were then treated for 24 hours at 37°C without (control condition) or with tumour necrosis factor-alpha (10 μg/ml; R&D System) as apoptotic agent in the culture medium.
The human neuroblastoma cell line SH-SY5Y (CRL-2266; ATCC, VA, USA) were plated into 150 cm2 culture flask (Falcon Becton Dickinson, Heidelberg, Germany) at 60 000 cells/ cm2 and incubated in MEM culture medium (Gibco), supplemented with Ham's F12 glutamax, 1% penicillin and streptomycin, 0.5% non essential amino acids, 0,5% sodium pyruvate and 10% fetal bovine serum and maintained at 37°C in 5% C02 atmosphere. After having reached 80% confluence, cells were differentiated by culturing them with differentiation culture medium (MEM supplemented medium containing 5 μΜ retinoic acid and 2% fetal bovine serum) for 6 days and then, after washing the cells, with differentiation culture medium supplemented with 10 μg/ml of Brain-Derived Neurotrophic Factor for additional 5 days. Differentiated SH-SY5Y cells were then cultured for 24 hours at 37°C with MEM supplemented medium and DMSO 0.1% (control condition) or MEM supplemented medium with DMSO 0.1% (control condition) and 6-OHDA (defs 100 μΜ) or MEM supplemented medium with DMSO 0.1% and staurosporine (0.5 μg/ml; R&D System) as apoptotic agent.
The immortalized mouse microglial cell line BV-2 (Blasi E et al , 1990) were cultured in RPMI 1640 (Gibco) containing 1.1% GlutaMax, 10% fetal bovine serum and 1% penicillin and streptomycin. Cells were seeded at 2500 to 5000 cell/cm2 into 150 cm2 culture flask (BD Bioscience) and maintained at 37°C in 5% C02 atmosphere. Cells were washed twice with warm RPMI and then cultured for 24 hours at 37°C in the same medium supplemented with 0.1% DMSO (control condition) or with 0.1% DMSO and Lipopolysaccharides (100 ng/rriL) as apoptotic agent.
The human colon carcinoma cell line HT29 (Cat. No. HTB-38; ATCC, USA) were cultured in McCOY's 5A medium 10% fetal calf serum (FCS), 1 % penicillin/streptomycin (PS) and 1 % glutamine (Invitrogen/Gibco, Cergy Pontoise, France). When cells reached 80% of confluency, they were rinsed twice and cultured for 24 hours at 37°C with 2% serum replacement supplement (SR-3; Sigma, MO, USA) instead of FCS, and without (control condition) or with staurosporine (0.1 μΜ) as apoptotic agent.
The human hepatocellular carcinoma cell line HepG2 (Cat. No. HB- 8065; ATCC, USA) were cultures in DMEM medium 10% fetal calf serum (FCS), 1% penicillin/streptomycin (PS) and 1% glutamine (Invitrogen/Gibco, Cergy Pontoise, France). When cells reached 80% of confluence, they were rinsed twice and cultured for 24 hours at 37°C with 2% serum replacement supplement (SR-3; Sigma, MO,
USA) instead of FCS, and without (control condition) or with camptothecin (10 μΜ) as apoptotic agent.
Analysis of cell and MPs populations by flow cytometry
At the end of treatment, cells and MPs populations were analyzed separately.
In the case of cells, after removing the cell culture supernatant, the cells were trypsined and counted. 500 000 cells were analyzed by flow cytometry using Annexin V (FITC or PE) and the glycan-binding agents: Maackia amurensis (MAA FITC; EY laboratories, CA, USA), 2-2B antibody, or KM93 (anti-sialyl Lewis X, 10μg/ml; VWR International, Fontenay sous Bois, France). Ι ΟΟμΙ of cells and 10 μΐ of each glycan-binding agent at 50μg/ml were mixed, spined 5 minutes at 450g to remove the excess of glycan-binding agent and analyzed by flow cytometry. When needed, the following secondary antibodies were used, goat anti-IgG-PE (Abeam; Cat. No. ab97070), goat anti-mouse IgM-PE (Invitrogen; Cat. No. M31504), rat anti- mouse IgG2A-FITC (BD Pharmingen; Cat. No. 553390).
In the case of MPs populations, cell culture superaatants were collected and spun down for 15 minutes at l ,500g at room temperature. Total MPs were then isolated by ultracentrifugation at 30,000g for 45 minutes at room temperature. Supernatants were discarded and pellets were re-suspended in PBS buffer (final volume of 400 microliter per condition). Samples were stored at -80°C until use. Distinct MPs populations were analysed by flow cytometry using Annexin V PE (Beckman Coulter, 731726) and the following glycan-binding agent: fluorescent lectins from Maackia amurensis (MAA FITC; EY laboratories, CA, USA; 20 μΐ of MPs were mixed with 10 μΐ of lectin at 50 μg/ml), 2-2B antibody (IgM)-PE (MACs, 130-093-274), or KM93 (anti-sialyl Lewis X, Ι ΟμΙ at K^g ml; VWR International, Fontenay sous Bois, France).
Results & Conclusions
The composition of biological fluids depends not only from the activity of cells circulating within or surrounding the biological fluid (e.g., endothelial cells or platelets, leukocytes, in the case of blood) but also from the drainage of the interstitial liquid of the organs and tissues. Thus, biological fluids (and consequently MPs populations within them) may be therefore considered as a reporter of the pathophysiological status of large variety of cell types for which specific biomarkers can be identified into MPs populations, or more specifically Glyco-MPs populations that are associated to specific cell types, biological activities, exposure to chemicals, and/or diseases.
The molecular features that allow differentiating cell type- and/or disease-specific Glyco-MPs (sub)populations of potential major interest can be initially defined by means of specific primary cells or cell lines that are related to the disease which and that can be used to generated Glyco-MPs within cell culture, in more tightly controlled conditions than in physiological biological fluids (Figure 5). However, on the basis of the findings of Example 1 , the presence and metabolism of cell type-specific, PolySia-positive Glyco-MPs populations can be also evaluated to understand if and how its ratio with Annexin V-positive MPs populations changes between cell types, and thus if different cell type contributes in different manner to the PolySia-positive Glyco-MPs populations.
A preliminary study was performed in a murine insulinoma cell line (Min6) that was stimulated with increasing concentrations of palmitate, a compound that induces stress and apoptosis in pancreatic beta-cells (Jeffrey et al, 2008). At the end of the treatment, the cell culture medium was collected and spun down and MPs populations were then quantified by flow cytometry. Min6 cells appeared to generate significant levels of both Annexin V-positive and Glyco-MPs populations in serum-free culture medium but the basal level of MPs populations was further increased b the exposure to palmitate in a significant and dose-dependent increase for both MPs populations with a similar dynamics. However, if Glyco-MPs populations that are characterized as presenting a PolySia-related epitope defined by a monoclonal antibody increases in parallel with the Annexin V-positive MPs populations in the different conditions, its percentage stays around 40%, and not 60% as determined in a cell-type independent manner within human and rat plasma (Figure 6 A and 6B).
The release of Annexin V-positive MPs populations that are also positive for different PolySia-related epitopes was then tested in other cell lines that shed low levels of MPs in normal culture condition and in response to different apoptotic agents. This comparison is intended to verify if these cell lines release distinct Glyco-MPs populations at different rates.
In a first set of experiments, the percentage of Annexin-V positive MPs population that is also either 2-2B antibody- or MAA-positive was calculated, showing these glycan-binding agents allow identifying Glyco-MPs populations that are cell- and/or apoptotic agent-specific (Figure 7, Panel A). Depending on the chosen combinations, the Glyco-MPs subpopulations correspond to almost to the totality of Annexin V-positive MPs (as in the case of SH-SY5Y cells that are exposed to 6- OHDA with 2-2B antibody as glycan-binding agent), are different depending on the selected apoptotic agent (as in the case of SH-SY5Y cells), or present major
differences between glycan-binding agents that recognized distinct PolySia-related antigens (as in the case of HT29 and HepG2 cells).
The comparisons of glycan epitopes between control and apoptosis- induced Glyco-MPs subpopulations were performed by flow cytometry but also extended to the original cell lines with the major differences between glycan-binding agents, including those previously used and a monoclonal antibody recognizing another variant of PolySia-related epitopes (KM93, see Table 2; Figure 7, Panels B and C). In fact, the apoptotic agent does not change in a significant manner neither the number of cells that present the specific PoySia-related epitopes on their surface nor the percentage of M93 -positive, Annexin V-positive MPs subpopulation, since this Glyco-MPs subpopulation is increased in a manner similar to the Annexin V-positive MPs population, suggesting that KM93 may almost represent an alternative to Annexin V for detecting MPs populations from specific cell types such as HT29 and HepG2 cells. The situation that is observed using the other agents is different, since there is an overall decrease in the percentage of these Glyco-MPs subpopulations. Actually, they grow much less than Annexin V-positive MPs population (as shown by measured fold induction), suggesting that, at least in specific situations, a Glyco-MPs population may be subtracted from the total MPs population for assessing specific biomarkers in the resulting, more informative MPs subpopulation.
These data confirm that specific Glyco-MPs subpopulations can provide substantially different information on how different apoptotic and other pathophysiological events affect MPs shedding and/or metabolism, and on how biomarkers can be found characterized as being associated to MPs subpopulations (being Glyco- MPs subpopulations or MPs subpopulations not presenting specific glycan epitopes). Moreover, the information on such apoptotic and other patho-physiological events that have been characterized by studying cell surface and composition cannot be equally applied to MPs surface and composition since shedding, metabolic and other biological mechanisms can clearly distinguish them from the originating cells.
It can be concluded that a variety of cell types release Annexin V- positive and MPs populations having specific post-translational profiles (e.g. , glycosylation profiles that characterize Glyco-MPs) but in very variable absolute and relative amounts. When these two MPs populations are compared in biological fluids such as plasma or cerebrospinal fluid, Glyco-MPs populations should provide a representation of MPs-producing cell types different from those of phoshatidylserine- exposing MPs population that are normally selected from biological fluids using Annexin V binding properties.
Thus, Glyco-MPs populations (and in particular Glyco-MPs populations that are positive for PolySia-related epitopes) are biological products that are different from those used so far for studying MPs and that provide novel opportunities to identify MPs-associated biomarkers, in particular using proteomic or immunological technologies. Glyco-MPs populations can be used for studying the presence of cell-type specific antigens that are specifically associated to this MPs population, and consequently Glyco-MPs populations can be of even greater medical interest for evaluating the clinical status of a patient, the progression of a disease or the therapeutic efficacy of a drug treatment.
Example 4: MPs glycoproteome and Glyco-MPs
(glyco)proteome
Materials & Methods
Two-dimensional gel electrophoresis
MPs population were obtained from palmitate-induced Min6 cells as indicated in Example 2. Following the step of ultracentrifugation, total MPs populations were used for preparing an extract containing approx. 450 micrograms of protein into 0.5 ml of 2D lysis buffer (7M urea, 2M thiourea, 4% CHAPS, 20 mM spermine base, 0.8% DTT, 0.2% pH 3-10 BioLytes, phosphatase inhibitor cocktails 1 & 2, and EDTA-free protease inhibitor cocktail tablets). The proteins were fully extracted on ice by sonication with 20 second pulses at 20-25%) of maximum amplitude level. This step was repeated 5 times with a minimum of 1 minute pauses. Extracts were centrifuged at 16, lOOg for 10 minutes at 10°C to remove insoluble particles. Total protein content was determined using the 2D-Quant Kit (GE Healthcare). Non-protein impurities were removed using the ReadyPrep 2D Cleanup kit prior to isoelectrofocalisation (IEF) steps. Protein pellets were solubilized by incubating them with 450μ1 of rehydration buffer (7M urea, 2M thiourea, 4% CHAPS, 0.4%) DTT and 0.2%> pH 3-10 BioLytes) at room temperature for 5 minutes.
After a further centrifugation at 16, 1 OOg for 5 minutes at 22°C to remove insoluble fragments, samples were subjected to IEF using premade 24 cm IPG strips, nonlinear pH 3-10, on an IPGphor instrument (Bio-Rad Laboratories, Hercules, CA, USA) in electrophoresis buffer (7M urea, 2M thiourea, 4% CHAPS, 0.4% DTT and 0.2% pH 3-10 BioLytes) at 20°C for a total of 140 kVh achieved with a maximum tension of 8000V. After a low current 500V final step, strips were refocused at 8000V for 30 minutes.
Prior to the second dimension, proteins in strips were reduced and alkylated by using 10 mL of equilibration buffer (6M urea, 2% SDS, 50 mM Tris-HCl
H 8.8, 20% glycerol, 2% DTT for 15 min and then for 15 minutes with the same buffer without DTT and containing 2.5% iodoacetamide). Equilibrated IPG strips were shortly soaked in 0.22 μm-flltered electrophoresis buffer and immediately transferred onto 20.2x25.5 cm in size and 1 mm thick gradient 8-16% polyacrylamide gradient gels (38: 1 acrylamide:bis ratio) pre-casted into low-fluorescence glass plates treated with bind and repel silane and including 2 fluorescent markers (Jule Inc, CT, USA). Strips were immobilized by embedding them into a 0.5% agarose solution in electrophoresis buffer that was labelled with trace amounts of bromophenol blue. The second dimension separation was performed overnight at 30°C using an Ettan Dalt six device with an updated upper buffer chamber (GE Healthcare) according to the manufacturer's instructions.
After electrophoresis, gels were fixed and then stained for glycoproteins using the ProQ Emerald 488 staining reagent (Invitrogen, Carlsbad, CA, USA) according to the manufacturer's instructions. Images were captured using a Typhoon 9400 laser scanner (Molecular Dynamics, Sunnyvale, CA, USA) using the 488 nm excitation wavelength with a 100 μιη resolution. Upon data acquisition, gels were briefly rinsed using milliQ water and were then stained for total proteins by an overnight incubation in SYPRO Ruby solution (Invitrogen, Carlsbad, CA, USA). After extensive washings, image acquisition was performed at a 100 μηι resolution using the 457 nm excitation wavelength. DeCyder 6.5 software (GE Healthcare).
Results & Conclusions
A preliminary characterization of the MPs-associated proteome was performed in Min6 cells that, as shown in Example 3, produce substantial amounts of both Annexin V-positive and Glyco-MPs populations that are positive for a PolySia- related epitope. Protein extracts were generated by using total MPs populations and subjected to two-dimensional gel electrophoresis.
Total proteins and glycoproteins were visualized by staining the gel using SYPRO Ruby and ProQ Emerald 488 staining reagents, respectively. This approach allows the fluorescence-based detection of low nanogram amounts of glycoproteins and proteins, thus providing a comparative analysis of the (glyco)proteomes of cell lines and their changes following, for example, the exposure to a growth factor (Hill J et al. , 2009).
As expected, total protein staining revealed the presence of a large number of proteins, many of them glycosylated as detected by ProQ Emerald 488 staining (Figure 7). This proteomic approach can be applied to compare different MPs populations of interest such as Annexin V-positive and Glyco-MPs populations
isolated from the same biological fluid, or Glyco-MPs populations that are positive for PolySIa-related epitope and that are originated from different biological fluids (or from the biological fluid of subject treated or not with a drug). The resulting proteomic maps can be then analyzed to identify candidate biomarkers (presenting or not a glycan) using different technologies that are specific for cell surface glycans, membrane microdomains, and/or membrane proteins (Lai Z et al, 2009; Cordwell S and Thingholm TE, 2009; Apweiler R et al , 2009a; Apweiler R et al , 2009b; Zheng Y and Foster L, 2009) in order to define the surfaceome of Glyco-MPs populations as it has been proposed for human cells (da Cunha J et al. ,2009). Moreover this approach can be used to establish if and how Glyco-MPs and total MPs populations are differentially metabolized within the biological fluid, expose cell surface components in specific manners, and/or interact differentially with cells and other components of the biological fluid.This analysis can be performed also by using the extensive lists of glycans and of the corresponding glycan-binding agents (such as such as monoclonal antibodies, plant lectins, and chemicals) that have been published (see Table 1 and Table 2), indicating the specificity of the interaction, the compatibility with the integrity and viability of cells, and their use for identifying specific cell types and/or antigens of medical interest.
Such glycan-binding agents may be used for detecting and isolating different types of Glyco-MPs subpopulations in parallel. However, glycan-binding agents that are compatible with technologies that maintain MPs integrity (such as FACS, immunological assays, or magnetic beads-based cell isolation) should be preferred. For example, a panel of antibodies and binding proteins have been characterized in the literature for different PolySia-containing biological materials and can be used for detecting, isolating and comparing different PolySia-positive Glyco- MPs (sub)populations presenting higher or lower specificity for (un)modified PolySia groups, molecules containing PolySia groups with different degrees of polymerization and/or linkage. This analysis can be accompanied also by the detection of known cell type-specific antigens (using antibodies or other molecules that specifically bind such antigens) that can be more or less frequently associated to total MPs populations or Glyco-MPs (sub) populations within biological fluids and/or in cell culture conditions (Burnier L et al , 2009; Orozco A and Lewis D, 2010; van der Heyde H et al, 201 1).
REFERENCES
Al-Massarani G et al, 2009. Am J Transplant; 9: 550-7.
Alley W and Novotny M, 2010. J Proteome Res; 9:3062-72.
Apweiler R et al. , 2009a. Clin Chem Lab Med; 47: 724-44.
Apweiler R et al , 2009b. Cytometry Part A; 75 A: 816-832.
Bain J et al, 2009; Diabetes; 58: 2429-43.
Banerjee M and Otonkoski T, 2009. Diabetologia; 52: 621-5.
Banfi C et al, 2005. Proteomics; 5: 4443-55.
Bartik P ei aZ. , 2008. Int J Oncol; 32: 1021-31.
Bastarache J et al , 2009. Am J Physiol Lung Cell Mol Physiol; 297: L1035-41.
Bernades G et al , 2009. ACS Chem Bio; 4 :715-732.
Beyer C and Pisetsky D, 2010. Nat Rev Rheumatol ; 6: 21 -9.
Blasi E et al , 1990. J Neuroimmunol ; 27: 229-37.
Bonfanti L, 2006. Prog Neurobiol; 80: 129-64.
Boulanger C et al, 2006. Hypertension; 48: 180-186.
Bork E et al, 2007. J Neurochem; 103 Suppl 1 : 65-71.
Brinkman-Van der Linden E et al, 2002. Anal Biochem; 303: 98-104.
Burnier L et al, 2009. Thromb Haemost; 101 : 439-51.
Carlsson S et al , 2007. Glycobiology; 17: 663-76.
Chen D and Wang M, 2005. Diabetes Obes Metab; 7: 307-17.
Chen T et al, 2010. Nucleic Acids Res. 38:215-24.
Combes V et al , 2005. Am J Pathol;166, 295-302.
Cordwell S and Thingholm T, 2010. Proteomics; 10: 61 1-27.
Cuchacovich M et al. 2001. Clin Exp Rheumatol; 19: 673-80.
da Cunha J et al , 2009. Proc Natl Acad Sci USA; 106 : 16752-7.
Dean W et al , 2009. Thromb Haemost; 102: 71 1-8.
Doeuvre L et al , 2009. J Neurochem; 1 10: 457-68.
Dotan N et al, 2006. Lupus; 15: 442-50.
Essayagh S et al , 2005. Thromb Haemost; 94:;853-858.
Galuska S et al , 2007. Anal Chem; 79: 7161-9.
Garcia B et al, 2005. J Proteom Res; 4: 1516-1521.
Garcia S et al , 2005. J Heart Lung Transplant; 24: 2184-9.
Gemeiner P et al , 2009. Biotechnol Adv; 27: 1-15.
Hale J et al, 2008. Methods Mol Biol; 425:53-66.
Hayrinen J et aL , 1995. J Infect Dis; 171 : 1481-90.
Hayrinen J et al , 2002. Mol Immun; 39: 399-41 1.
Herrera M et a/., 2010. J Cell Mol Med ; 14(6B): 1605-18.
Hill J et al, 2009. Proteome Science; 7: 2.
Horstman L et al, 2007. Int Rev Neurobiol; 79: 227-68.
Hu S et al, 2006. Proteomics; 6: 6326-6353.
Hugel B et al, 2005. Physiology; 20: 22-27.
Hwang H et al , 2010. Mass Spectrom Rev; 29: 79-125.
Inoue T et al , 2006. Platelets; 17: 416-20.
Iskratsch T et al, 2009. Anal Biochem; 386: 133-46.
Jeffrey K et al , 2008. Proc Natl Acad Sci USA; 105 : 8452-7.
Jin M et al , 2005. Proteomics; 5: 1940-52.
Kannagi R and Hakomori S, 2001. Adv Exp Med Biol; 491 : 587-630.
Kannagi R et al , 2009. Glycoconjugate J; 26: 923-928.
Keshava Prasad T et al , 2009. Nucleic Acids Res;37: D767-72.
Kobzdej M et al. , 2002. Blood; 100: 4485-94.
Koga H et al, 2005. J Amer College Cardiol; 45: 1622-1630
Kris namoorthy L and Mahal L, 2009. ACS Chem. Bio; 4: 715-732.
Krueger K and Srivastava S, 2006. Mol Cell Proteomics; 5:1799-810.
Kunding A et al , 2008. Biophys J; 95: 1 176-88.
Kurogochi M et al.,2Q\Q. Mol Cell Proteomics; 9: 2354-68.
Lai Z et al , 2009; Curr Opin Mol Therap; 1 1 : 623-631.
Lai S et al , 2009. Mol Cell Proteomics; 8: 799-804.
Lawrie A et al. 2009. Vox Sang; 96: 206-12.
Lee T et al, 2009. BMC Res Notes; 2: 1 1 1.
Lemmon M, 2008. Nat Rev Mol Cell Biol. 9: 99-1 1 1.
Leroyer A et al , 2007. J Am Coll Cardiol 49: 772-777
Li S et al, 2009. Nucleic Acids Res; 37: D907-912.
Logue et al. 2009. Nat Protoc; 4: 1383-95.
Mack M et al, 2000. Nat Med; 6: 769-775.
Mahal L, 2008. Anti-Cancer Ag Med Chem; 8: 37-51.
Malagolini N et al, 2009. Glycobiology; 19: 172-81.
Mause S et al , 2005. Arterioscler Thromb Vase Biol 25: 1512-1518
Mayr M et al, 2008. Circ Cardiovasc Genet; 2: 379 - 388.
Merrick B, 2008. Brief Funct Genomic Proteomic; 7: 35-49.
Mezentsev A et al, 2005. Am J Physiol Heart Circ Physiol; 289: HI 106-1 1 14
Miguet, L. et al, 2007. Subcell Biochem; 43: 21-34.
Mitoma J et al. ,. 2009. Glycoconj J; 26: 51 1-23.
Mirza S and Olivier M, 2008. Physiol Genomics; 33: 3-11.
Miyazaki J et al, 1990. Endocrinology; 127: 126-32.
Morel N et al, 2008. J Trauma 64:698-704.
Morel O et al, 2009. Haematologica; 94:313-317.
Mostefai H et al, 2008. Physiol Res; 57: 31 1-20.
Murrey H and Hsieh- Wilson L, 2008. Chem Rev; 108: 1708-1731.
Nilsson J et al , 2009. Nat Methods; 6: 809-11.
Nomura S et al , 2008. Biol Blood Marrow Transplant; 14: 766-74. Nozaki T et al, 2009. J Am Coll Cardiol; 54: 601-8.
Ohtsubo K and Marth J, 2006. Cell; 126: 855-867.
Orozco A and Lewis D, 2010. Cytometry A; 77: 502-14.
Patane J et al, 2009. Carbohydr Res; 344: 820-4.
Piccin et al , 2007. Blood Rev; 21 : 157-171.
Priego Capote F and Sanchez J, 2009. Mass Spectrom Rev; 28: 135-46.
Pritchard J, 2008. BMC Neurosci; 9(Suppl 3):S1.
Reifel-Miller A et al , 2005. Mol Endocrinol; 19: 1593-605.
Rek A et al , 2009. Br J Pharmacol; 157: 686-94.
Robert S et al , 2009. J Thromb Haemost; 7: 190-197.
Roche S et al , 2008. J Immunol Methods; 338: 75-8.
Rougon G et al , 1986. J Cell Biol; 103: 2429-2437.
Rubin O et al, 2008. Vox Sang; 95: 288-97.
Rukoyatkina N et al, 2009. Br J Haematol; 144: 591-602.
Sabatier F et al, 2002. Diabetes ; 51 : 2840-2845.
Said T et al, 2008. J Androl; 29: 134-42.
Sato C et al , 1995. J Biol Chem; 270: 18923-8.
Sato C et al, 2000. J Biol Chem; 275: 15422-31.
Semberova J et al. 2009. Nano Lett; 9: 3312-3317.
Service R, 2008. Science; 321 : 1760.
Shantsila E 2009. J Hum Hypertens 23:359-361.
Shi J and Gilbert G, 2003. Blood; 101 : 2628-2636.
Shi M et al , 2009. Neurobiol Dis; 35: 157-64.
Smalley D et al, 2007. Thromb Haemost; 97: 67-80.
Smalley D et al, 2008a. J Proteome Res; 7: 2088-96.
Smalley D et al , 2008b. Clin Lab; 54: 67-79.
Soriano A et al. 2005. Crit Care Med; 33: 2540-6.
Stace C and Ktistakis N. 2006. Bioch Biophys Acta; 1761 : 913-926.
Stoica B et al , 2005. Mol Cell Neurosci; 29, 355-371.
Tate E, 2008. J Chem Biol; 1 : 17-26.
Taylor M and Drickamer K, 2009. Glycobiology; 19: 1 155-62.
Thapa N et al , 2008; J Cell Mol Med; 12: 1649-60.
Thery C et al, 2009. Nat Rev Immunol; 9: 581-93.
Thornalley P, 2005,. Perit Dial Int; 25: 522-33.
Thouvenot E et al , 2008. J Proteome Res; 7: 4409-4421.
Turer A et al;, 2009; Circulation; 1 19: 1736-46.
van der Heyde H et al, 2011. Methods Mol Biol; 699: 337-54.
van Gaal E et al , 2010. J Control Release; 141 :328-38.
Varki A et al, 2009. Essentials of Glycobiology. Cold Spring Harbor Laboratory Press
Varki A, 2008. Trends Mol Med; 14: 351-360.
Wu et al , 2009. Glycoconjugate J; 26: 899-913.
Yabe U et a/. , 2003. J Biol Chem; 278: 13875-80.
Yanagisawa M and Yu R, 2007. Glycobiology; 17: 57R-74R.
Yuana Y et al 2010. J Thromb Haemost; 8: 315-23.
Zheng Y and Foster L, 2009. J Proteomics; 72 : 12-22.
Zougman A et al. , 2008. J Proteome Res; 7, 386-399.
Zuber C et al, 1992. J Biol Chem; 267: 9965-71.
Claims
1. A method for identifying Glycan-containing Microparticles (Glyco-MPs) populations comprising the following steps:
a) Obtaining a sample of a biological fluid sample from a subject; b) Isolating the acellular fraction of said biological fluid;
c) Separating the Glyco-MPs populations from the said acellular fraction by means of an agent binding a PolySia-related epitope and at least one further binding agent recognizing a phospholipid, a protein, a lipid, or a glycan other than said PolySia-related epitope.
2. The method of claim 1 wherein the Glyco-MPs populations having a size comprised between 100 and 1000 nanometrs are separated from said acellular fraction.
3. The method of claim 1 or 2 wherein the PolySia-related epitope is polysialic acid.
4. The method of claims 1 to 3 wherein the biological fluid is any of the following: plasma, blood, cerebrospinal fluid, urine, synovial fluid, bronchoalveolar lavage fluid, seminal fluid, saliva, pulmonary edema fluid, and cell culture supernatants.
5. The method of claims 1 to 4 wherein the Glyco-MPs populations are separated from said acellular fraction by means of the further binding agent that recognizes a phospholipid.
6. The method of claim 5 wherein the phospholipid is phosphatidylserine.
7. The method of claim 1 to 4 wherein said protein, lipid, or glycan is a protein, lipid, or glycan of the cell surface.
8. The method of claim 7 wherein the protein, lipid, or glycan of the cell surface is defined according to a specific cell type, tissue, organ, drug treatment, age, sex, pathology, genotype, phenotype, predisposition, viral infection, and/or clinical status.
9. The method of any of the preceding claims wherein the binding agent is an antibody, a protein, a peptide, a lectin, a glycan, a nucleic acid, a lipid, a phospholipid, or an inorganic compound.
10. The method of any of the preceding claims wherein the binding agent is immobilized on a solid phase and/or is labelled.
1 1. A Glyco-MPs population obtained according to the methods of claims 1 to 10.
12. The Glyco-MPs populations of claim 1 1 , wherein said Glyco- MPs are provided in a liquid phase.
13. The Glyco-MPs populations of claim 11, wherein said Glyco-
MPs are immobilized on solid phase.
14. Biomarker that is defined by means of Glyco-MPs populations of claim 1 1 to 13.
15. The biomarker of claim 14, wherein said biomarkers is defined by means of:
a) The concentration of Glyco-MPs presenting a PolySia-related epitope;
b) The ratio between the concentration of total MPs population and of a Glyco-MPs population;
c) The ratio between the concentration of a Glyco-MPs population of (a) and a different glyco-MPs population;
d) The concentration of MPs not presenting a specific glycan epitope of (a); and/or
e) The concentration of MPs populations of (a) and/or (d) that present a protein, lipid, phospholipid, and/or a glycan other than the specific glycan epitope of (a).
16. The biomarker of claim 14, wherein said biomarker corresponds to a peptide, a protein, a phospholipid, lipid, a nucleic acid, a glycan, or combinations of said molecules that are present on the surface of Glyco-MPs populations.
17. The biomarker of claims 14 to 16, wherein said biomarker is specific for a disorder.
18. The biomarker of claimsl4 to 17, wherein said biomarker is identified by means of flow cytometry, mass spectrometry, gel electrophoresis, immunoassay, nucleic acid amplification, or in vitro assays for a biological activity.
19. Kit for isolating the Glyco-MPs of claims 1 1 to 13 comprising an agent binding a PolySia-related epitope and at least one further binding agent recognizing a phospholipid, a protein, a lipid, or a glycan other than a PolySia-related epitope.
20. Use of the Glyco-MPs of claims 1 1 to 13 or of a kit of claim 19 for identifying biomarkers of medical interest in a sample of biological fluid.
21. A method for diagnosing or monitoring a disorder that comprises the identification of a biomarker of claims 14 to 18 in a sample of biological fluid.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP10814745A EP2517021A1 (en) | 2009-12-22 | 2010-12-22 | Methods for analyzing components of glycan containing microparticles |
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP09290988 | 2009-12-22 | ||
| PCT/IB2010/056035 WO2011077399A1 (en) | 2009-12-22 | 2010-12-22 | Methods for analyzing components of glycan containing microparticles |
| EP10814745A EP2517021A1 (en) | 2009-12-22 | 2010-12-22 | Methods for analyzing components of glycan containing microparticles |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP2517021A1 true EP2517021A1 (en) | 2012-10-31 |
Family
ID=43928159
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP10814745A Withdrawn EP2517021A1 (en) | 2009-12-22 | 2010-12-22 | Methods for analyzing components of glycan containing microparticles |
Country Status (2)
| Country | Link |
|---|---|
| EP (1) | EP2517021A1 (en) |
| WO (1) | WO2011077399A1 (en) |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP7153493B2 (en) * | 2018-07-27 | 2022-10-14 | シスメックス株式会社 | Method for measuring bioparticles, method for detecting non-specific signals, method for measuring bioparticles, and reagent kit for detecting bioparticles |
| US11525824B2 (en) | 2018-07-27 | 2022-12-13 | Sysmex Corporation | Bioparticle measuring method |
-
2010
- 2010-12-22 EP EP10814745A patent/EP2517021A1/en not_active Withdrawn
- 2010-12-22 WO PCT/IB2010/056035 patent/WO2011077399A1/en not_active Ceased
Non-Patent Citations (1)
| Title |
|---|
| See references of WO2011077399A1 * |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2011077399A1 (en) | 2011-06-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Li et al. | Comprehensive structural glycomic characterization of the glycocalyxes of cells and tissues | |
| Medzihradszky et al. | Characterizing sialic acid variants at the glycopeptide level | |
| Muchmore et al. | A structural difference between the cell surfaces of humans and the great apes | |
| Wuhrer | Glycomics using mass spectrometry | |
| Zou et al. | Comprehensive analytical approach toward glycomic characterization and profiling in urinary exosomes | |
| Chandler et al. | Glycomics and glycoproteomics of membrane proteins and cell‐surface receptors: Present trends and future opportunities | |
| JP5552421B2 (en) | Characterization of N-glycans using exoglycosidases | |
| EP2774994B1 (en) | Undifferentiated cell detection method and complex carbohydrate detection method | |
| CA2513250C (en) | A serum marker for measuring liver fibrosis | |
| Rangel-Angarita et al. | Mucinomics as the next frontier of mass spectrometry | |
| JP2010525327A (en) | MS method for evaluating glycans | |
| Pacharra et al. | Neurofascin 186 is O-mannosylated within and outside of the mucin domain | |
| CA2658311A1 (en) | Cancer specific glycans and use thereof | |
| Wylie et al. | Quantitation of sialic acids in infant formulas by liquid chromatography–mass spectrometry: an assessment of different protein sources and discovery of new analogues | |
| Islam et al. | Lectins as potential tools for cancer biomarker discovery from extracellular vesicles | |
| JP2016521299A5 (en) | ||
| Li et al. | Comprehensive review of MS‐based studies on N‐glycoproteome and N‐glycome of extracellular vesicles | |
| Wu et al. | Comprehensive overview the role of glycosylation of extracellular vesicles in cancers | |
| Chen et al. | In-depth site-specific O-glycosylation analysis of glycoproteins and endogenous peptides in cerebrospinal fluid (CSF) from healthy individuals, mild cognitive impairment (MCI), and Alzheimer’s disease (AD) patients | |
| Furukawa et al. | Recent advances in cellular glycomic analyses | |
| EP1913385A2 (en) | Tissue carbohydrate compositions and analysis thereof | |
| Kailemia et al. | Targeted measurements of O-and N-glycopeptides show that proteins in high density lipoprotein particles are enriched with specific glycosylation compared to plasma | |
| Ozcan et al. | Characterization of novel O-glycans isolated from tear and saliva of ocular rosacea patients | |
| Janković et al. | Extracellular vesicles and glycans: new avenue for biomarker research | |
| Kratz et al. | Glycosylation changes in the salivary glycoproteins of alcohol-dependent patients: a pilot study |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20120717 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| DAX | Request for extension of the european patent (deleted) | ||
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20130702 |