EP2464662A1 - Complexing system - Google Patents
Complexing systemInfo
- Publication number
- EP2464662A1 EP2464662A1 EP10747066A EP10747066A EP2464662A1 EP 2464662 A1 EP2464662 A1 EP 2464662A1 EP 10747066 A EP10747066 A EP 10747066A EP 10747066 A EP10747066 A EP 10747066A EP 2464662 A1 EP2464662 A1 EP 2464662A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- polypeptide
- helix
- helices
- derived
- snare
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 230000000536 complexating effect Effects 0.000 title claims abstract description 71
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 440
- 102000000583 SNARE Proteins Human genes 0.000 claims abstract description 438
- 108010041948 SNARE Proteins Proteins 0.000 claims abstract description 438
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 389
- 229920001184 polypeptide Polymers 0.000 claims abstract description 326
- 108010010469 Qa-SNARE Proteins Proteins 0.000 claims abstract description 214
- 108010005730 R-SNARE Proteins Proteins 0.000 claims abstract description 154
- 102100030552 Synaptosomal-associated protein 25 Human genes 0.000 claims abstract description 87
- 108040000979 soluble NSF attachment protein activity proteins Proteins 0.000 claims abstract description 86
- 238000000034 method Methods 0.000 claims abstract description 64
- 102000002215 Synaptobrevin Human genes 0.000 claims abstract 26
- 102000050389 Syntaxin Human genes 0.000 claims abstract 25
- 108030001720 Bontoxilysin Proteins 0.000 claims description 118
- 102000004169 proteins and genes Human genes 0.000 claims description 117
- 108090000623 proteins and genes Proteins 0.000 claims description 117
- 150000001413 amino acids Chemical class 0.000 claims description 110
- 108010057722 Synaptosomal-Associated Protein 25 Proteins 0.000 claims description 95
- 229940053031 botulinum toxin Drugs 0.000 claims description 85
- 239000003599 detergent Substances 0.000 claims description 43
- 102000005962 receptors Human genes 0.000 claims description 39
- 108020003175 receptors Proteins 0.000 claims description 39
- 230000015572 biosynthetic process Effects 0.000 claims description 38
- 239000003053 toxin Substances 0.000 claims description 38
- 231100000765 toxin Toxicity 0.000 claims description 38
- 230000005945 translocation Effects 0.000 claims description 35
- 150000001875 compounds Chemical class 0.000 claims description 20
- 101710184444 Complexin Proteins 0.000 claims description 17
- 239000000758 substrate Substances 0.000 claims description 17
- 230000001537 neural effect Effects 0.000 claims description 15
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 13
- 239000002062 molecular scaffold Substances 0.000 claims description 12
- 238000011282 treatment Methods 0.000 claims description 12
- HEGSGKPQLMEBJL-RQICVUQASA-N (2r,3s,4s,5r)-2-(hydroxymethyl)-6-octoxyoxane-3,4,5-triol Chemical compound CCCCCCCCOC1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O HEGSGKPQLMEBJL-RQICVUQASA-N 0.000 claims description 11
- 108010056088 Somatostatin Proteins 0.000 claims description 10
- 230000005764 inhibitory process Effects 0.000 claims description 10
- 210000000225 synapse Anatomy 0.000 claims description 10
- 201000010099 disease Diseases 0.000 claims description 9
- 238000005406 washing Methods 0.000 claims description 8
- 238000002560 therapeutic procedure Methods 0.000 claims description 7
- 108010039491 Ricin Proteins 0.000 claims description 6
- 238000003556 assay Methods 0.000 claims description 6
- -1 nonylglucopyranoside Chemical compound 0.000 claims description 6
- 208000008454 Hyperhidrosis Diseases 0.000 claims description 5
- 238000007707 calorimetry Methods 0.000 claims description 5
- 238000004587 chromatography analysis Methods 0.000 claims description 5
- QZRAABPTWGFNIU-UHFFFAOYSA-N 3-[dimethyl(octyl)azaniumyl]propane-1-sulfonate Chemical compound CCCCCCCC[N+](C)(C)CCCS([O-])(=O)=O QZRAABPTWGFNIU-UHFFFAOYSA-N 0.000 claims description 4
- 108010055044 Tetanus Toxin Proteins 0.000 claims description 4
- 239000002537 cosmetic Substances 0.000 claims description 4
- 208000035475 disorder Diseases 0.000 claims description 4
- 229940118376 tetanus toxin Drugs 0.000 claims description 4
- WKALLSVICJPZTM-UHFFFAOYSA-N 3-[decyl(dimethyl)azaniumyl]propane-1-sulfonate Chemical compound CCCCCCCCCC[N+](C)(C)CCCS([O-])(=O)=O WKALLSVICJPZTM-UHFFFAOYSA-N 0.000 claims description 3
- 208000002193 Pain Diseases 0.000 claims description 3
- 206010039424 Salivary hypersecretion Diseases 0.000 claims description 3
- 208000010118 dystonia Diseases 0.000 claims description 3
- 238000001962 electrophoresis Methods 0.000 claims description 3
- IZWSFJTYBVKZNK-UHFFFAOYSA-N lauryl sulfobetaine Chemical compound CCCCCCCCCCCC[N+](C)(C)CCCS([O-])(=O)=O IZWSFJTYBVKZNK-UHFFFAOYSA-N 0.000 claims description 3
- SBWGZAXBCCNRTM-CTHBEMJXSA-N n-methyl-n-[(2s,3r,4r,5r)-2,3,4,5,6-pentahydroxyhexyl]octanamide Chemical group CCCCCCCC(=O)N(C)C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO SBWGZAXBCCNRTM-CTHBEMJXSA-N 0.000 claims description 3
- 230000001613 neoplastic effect Effects 0.000 claims description 3
- 208000026451 salivation Diseases 0.000 claims description 3
- 239000000523 sample Substances 0.000 claims description 3
- 230000035900 sweating Effects 0.000 claims description 3
- 230000002485 urinary effect Effects 0.000 claims description 3
- 206010056948 Automatic bladder Diseases 0.000 claims description 2
- 206010063006 Facial spasm Diseases 0.000 claims description 2
- 208000018522 Gastrointestinal disease Diseases 0.000 claims description 2
- 208000019695 Migraine disease Diseases 0.000 claims description 2
- 208000007101 Muscle Cramp Diseases 0.000 claims description 2
- 208000005392 Spasm Diseases 0.000 claims description 2
- 208000004350 Strabismus Diseases 0.000 claims description 2
- 208000003028 Stuttering Diseases 0.000 claims description 2
- 206010043269 Tension headache Diseases 0.000 claims description 2
- 208000008548 Tension-Type Headache Diseases 0.000 claims description 2
- 206010008129 cerebral palsy Diseases 0.000 claims description 2
- 230000001684 chronic effect Effects 0.000 claims description 2
- 230000037315 hyperhidrosis Effects 0.000 claims description 2
- 206010027599 migraine Diseases 0.000 claims description 2
- 239000000203 mixture Substances 0.000 claims description 2
- 210000003800 pharynx Anatomy 0.000 claims description 2
- 230000001737 promoting effect Effects 0.000 claims description 2
- 230000037303 wrinkles Effects 0.000 claims description 2
- 102000015799 Qa-SNARE Proteins Human genes 0.000 description 189
- 102000005917 R-SNARE Proteins Human genes 0.000 description 128
- 235000018102 proteins Nutrition 0.000 description 109
- 235000001014 amino acid Nutrition 0.000 description 106
- 102000004183 Synaptosomal-Associated Protein 25 Human genes 0.000 description 94
- 101710117542 Botulinum neurotoxin type A Proteins 0.000 description 45
- 239000000499 gel Substances 0.000 description 42
- 239000011324 bead Substances 0.000 description 38
- 108020001507 fusion proteins Proteins 0.000 description 33
- 102000037865 fusion proteins Human genes 0.000 description 33
- 102000003786 Vesicle-associated membrane protein 2 Human genes 0.000 description 32
- 108090000169 Vesicle-associated membrane protein 2 Proteins 0.000 description 32
- 230000002427 irreversible effect Effects 0.000 description 30
- 108700012359 toxins Proteins 0.000 description 30
- 231100001103 botulinum neurotoxin Toxicity 0.000 description 27
- 230000004927 fusion Effects 0.000 description 27
- 230000004048 modification Effects 0.000 description 25
- 238000012986 modification Methods 0.000 description 25
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 24
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 23
- 239000003446 ligand Substances 0.000 description 23
- 230000002255 enzymatic effect Effects 0.000 description 20
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 19
- 239000003814 drug Substances 0.000 description 15
- 239000012528 membrane Substances 0.000 description 15
- 210000002569 neuron Anatomy 0.000 description 15
- 229960002685 biotin Drugs 0.000 description 14
- 239000011616 biotin Substances 0.000 description 14
- 230000008685 targeting Effects 0.000 description 14
- 210000004027 cell Anatomy 0.000 description 13
- 238000010494 dissociation reaction Methods 0.000 description 13
- 230000005593 dissociations Effects 0.000 description 13
- 239000000243 solution Substances 0.000 description 13
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 13
- 235000020958 biotin Nutrition 0.000 description 12
- 239000003795 chemical substances by application Substances 0.000 description 12
- 230000006870 function Effects 0.000 description 12
- 238000004519 manufacturing process Methods 0.000 description 12
- 102000004190 Enzymes Human genes 0.000 description 11
- 108090000790 Enzymes Proteins 0.000 description 11
- 108010024636 Glutathione Proteins 0.000 description 11
- 102000005720 Glutathione transferase Human genes 0.000 description 11
- 108010070675 Glutathione transferase Proteins 0.000 description 11
- 108010057266 Type A Botulinum Toxins Proteins 0.000 description 11
- 101150026889 VAMP2 gene Proteins 0.000 description 11
- 238000000429 assembly Methods 0.000 description 11
- 230000000712 assembly Effects 0.000 description 11
- 239000003153 chemical reaction reagent Substances 0.000 description 11
- 229940088598 enzyme Drugs 0.000 description 11
- 229960003180 glutathione Drugs 0.000 description 11
- 230000003957 neurotransmitter release Effects 0.000 description 11
- 101150090293 DENND11 gene Proteins 0.000 description 10
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 10
- 108090000190 Thrombin Proteins 0.000 description 10
- 238000003776 cleavage reaction Methods 0.000 description 10
- 230000000694 effects Effects 0.000 description 10
- 229920000642 polymer Polymers 0.000 description 10
- 230000007017 scission Effects 0.000 description 10
- 230000000946 synaptic effect Effects 0.000 description 10
- 229960004072 thrombin Drugs 0.000 description 10
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 9
- 101000639133 Rattus norvegicus Vesicle-associated membrane protein 2 Proteins 0.000 description 9
- KBZOIRJILGZLEJ-LGYYRGKSSA-N argipressin Chemical compound C([C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CSSC[C@@H](C(N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N1)=O)N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCN=C(N)N)C(=O)NCC(N)=O)C1=CC=CC=C1 KBZOIRJILGZLEJ-LGYYRGKSSA-N 0.000 description 9
- 229930195712 glutamate Natural products 0.000 description 9
- 210000004295 hippocampal neuron Anatomy 0.000 description 9
- 238000003384 imaging method Methods 0.000 description 9
- 238000002156 mixing Methods 0.000 description 9
- 230000008569 process Effects 0.000 description 9
- 108010090804 Streptavidin Proteins 0.000 description 8
- 230000001580 bacterial effect Effects 0.000 description 8
- 210000004556 brain Anatomy 0.000 description 8
- 239000002105 nanoparticle Substances 0.000 description 8
- 239000002096 quantum dot Substances 0.000 description 8
- 150000003384 small molecules Chemical class 0.000 description 8
- 230000008901 benefit Effects 0.000 description 7
- 229940089093 botox Drugs 0.000 description 7
- 210000004899 c-terminal region Anatomy 0.000 description 7
- 230000009918 complex formation Effects 0.000 description 7
- 238000005516 engineering process Methods 0.000 description 7
- 210000002504 synaptic vesicle Anatomy 0.000 description 7
- 210000003568 synaptosome Anatomy 0.000 description 7
- 102100033465 DENN domain-containing protein 11 Human genes 0.000 description 6
- 101000870898 Homo sapiens DENN domain-containing protein 11 Proteins 0.000 description 6
- 108090000189 Neuropeptides Proteins 0.000 description 6
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 6
- 206010033799 Paralysis Diseases 0.000 description 6
- 101000642686 Rattus norvegicus Syntaxin-3 Proteins 0.000 description 6
- 229920002684 Sepharose Polymers 0.000 description 6
- 108010090618 Syntaxin 1 Proteins 0.000 description 6
- 102000013265 Syntaxin 1 Human genes 0.000 description 6
- 125000003275 alpha amino acid group Chemical group 0.000 description 6
- 239000002299 complementary DNA Substances 0.000 description 6
- 235000018417 cysteine Nutrition 0.000 description 6
- 229940079593 drug Drugs 0.000 description 6
- 238000005304 joining Methods 0.000 description 6
- 238000002372 labelling Methods 0.000 description 6
- 210000005036 nerve Anatomy 0.000 description 6
- 210000000715 neuromuscular junction Anatomy 0.000 description 6
- 239000013612 plasmid Substances 0.000 description 6
- 238000006116 polymerization reaction Methods 0.000 description 6
- 238000003380 quartz crystal microbalance Methods 0.000 description 6
- 239000007787 solid Substances 0.000 description 6
- 229960000553 somatostatin Drugs 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 241000894006 Bacteria Species 0.000 description 5
- 101100043731 Caenorhabditis elegans syx-3 gene Proteins 0.000 description 5
- 241000699666 Mus <mouse, genus> Species 0.000 description 5
- 101710138657 Neurotoxin Proteins 0.000 description 5
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 5
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 5
- 230000002411 adverse Effects 0.000 description 5
- 210000000170 cell membrane Anatomy 0.000 description 5
- 238000006243 chemical reaction Methods 0.000 description 5
- 238000004132 cross linking Methods 0.000 description 5
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 5
- 210000000172 cytosol Anatomy 0.000 description 5
- 125000000524 functional group Chemical group 0.000 description 5
- 239000012216 imaging agent Substances 0.000 description 5
- 239000002581 neurotoxin Substances 0.000 description 5
- 231100000618 neurotoxin Toxicity 0.000 description 5
- 238000000746 purification Methods 0.000 description 5
- 239000011780 sodium chloride Substances 0.000 description 5
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 4
- 239000004475 Arginine Substances 0.000 description 4
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 4
- 108010059378 Endopeptidases Proteins 0.000 description 4
- 102000005593 Endopeptidases Human genes 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 101000584382 Homo sapiens Synaptic vesicle glycoprotein 2C Proteins 0.000 description 4
- 108091005804 Peptidases Proteins 0.000 description 4
- 239000004365 Protease Substances 0.000 description 4
- 101100310552 Rattus norvegicus Snap25 gene Proteins 0.000 description 4
- 102100030637 Synaptic vesicle glycoprotein 2C Human genes 0.000 description 4
- 102100030545 Synaptosomal-associated protein 23 Human genes 0.000 description 4
- 238000013459 approach Methods 0.000 description 4
- 230000003197 catalytic effect Effects 0.000 description 4
- 238000003119 immunoblot Methods 0.000 description 4
- 108020004707 nucleic acids Proteins 0.000 description 4
- 102000039446 nucleic acids Human genes 0.000 description 4
- 150000007523 nucleic acids Chemical class 0.000 description 4
- 239000002245 particle Substances 0.000 description 4
- 210000003105 phrenic nerve Anatomy 0.000 description 4
- 230000004850 protein–protein interaction Effects 0.000 description 4
- 238000011160 research Methods 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 238000010186 staining Methods 0.000 description 4
- 238000012360 testing method Methods 0.000 description 4
- 210000001519 tissue Anatomy 0.000 description 4
- VHJLVAABSRFDPM-UHFFFAOYSA-N 1,4-dithiothreitol Chemical compound SCC(O)C(O)CS VHJLVAABSRFDPM-UHFFFAOYSA-N 0.000 description 3
- 102100031673 Corneodesmosin Human genes 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 239000000232 Lipid Bilayer Substances 0.000 description 3
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 3
- UEZVMMHDMIWARA-UHFFFAOYSA-N Metaphosphoric acid Chemical compound OP(=O)=O UEZVMMHDMIWARA-UHFFFAOYSA-N 0.000 description 3
- 108010029485 Protein Isoforms Proteins 0.000 description 3
- 102000001708 Protein Isoforms Human genes 0.000 description 3
- 229940096437 Protein S Drugs 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 102000004874 Synaptophysin Human genes 0.000 description 3
- 108090001076 Synaptophysin Proteins 0.000 description 3
- 108010004977 Vasopressins Proteins 0.000 description 3
- 108010017749 Vesicle-Associated Membrane Protein 3 Proteins 0.000 description 3
- 102100031486 Vesicle-associated membrane protein 3 Human genes 0.000 description 3
- 108010031318 Vitronectin Proteins 0.000 description 3
- VREFGVBLTWBCJP-UHFFFAOYSA-N alprazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NN=C2CN=C1C1=CC=CC=C1 VREFGVBLTWBCJP-UHFFFAOYSA-N 0.000 description 3
- 230000003321 amplification Effects 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 238000003491 array Methods 0.000 description 3
- 230000009286 beneficial effect Effects 0.000 description 3
- 239000012620 biological material Substances 0.000 description 3
- 108010069023 botulinum toxin type E Proteins 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 150000005829 chemical entities Chemical class 0.000 description 3
- 238000010367 cloning Methods 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 238000012377 drug delivery Methods 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 239000011521 glass Substances 0.000 description 3
- 229940088597 hormone Drugs 0.000 description 3
- 239000005556 hormone Substances 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 150000002484 inorganic compounds Chemical class 0.000 description 3
- 229910010272 inorganic material Inorganic materials 0.000 description 3
- 239000000543 intermediate Substances 0.000 description 3
- 150000002632 lipids Chemical class 0.000 description 3
- 235000018977 lysine Nutrition 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 125000001360 methionine group Chemical class N[C@@H](CCSC)C(=O)* 0.000 description 3
- 239000011859 microparticle Substances 0.000 description 3
- 210000003205 muscle Anatomy 0.000 description 3
- 239000002071 nanotube Substances 0.000 description 3
- 239000002070 nanowire Substances 0.000 description 3
- 239000002858 neurotransmitter agent Substances 0.000 description 3
- 229910052759 nickel Inorganic materials 0.000 description 3
- 238000003199 nucleic acid amplification method Methods 0.000 description 3
- 238000006384 oligomerization reaction Methods 0.000 description 3
- 230000001769 paralizing effect Effects 0.000 description 3
- 230000003389 potentiating effect Effects 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 238000001338 self-assembly Methods 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 230000032258 transport Effects 0.000 description 3
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 2
- 102000000844 Cell Surface Receptors Human genes 0.000 description 2
- 108010001857 Cell Surface Receptors Proteins 0.000 description 2
- 101000985020 Clostridium botulinum D phage Botulinum neurotoxin type D Proteins 0.000 description 2
- 101710137249 Complexin-1 Proteins 0.000 description 2
- 102100027826 Complexin-1 Human genes 0.000 description 2
- 241001055367 Dario Species 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 239000007995 HEPES buffer Substances 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000652300 Homo sapiens Synaptosomal-associated protein 23 Proteins 0.000 description 2
- 101000852166 Homo sapiens Vesicle-associated membrane protein 7 Proteins 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 2
- 108010085220 Multiprotein Complexes Proteins 0.000 description 2
- 102000007474 Multiprotein Complexes Human genes 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 102000003797 Neuropeptides Human genes 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 2
- 102000005157 Somatostatin Human genes 0.000 description 2
- 101800003906 Substance P Proteins 0.000 description 2
- 101710189545 Synaptosomal-associated protein 23 Proteins 0.000 description 2
- 101710189801 Synaptosomal-associated protein 25-A Proteins 0.000 description 2
- 108090000631 Trypsin Proteins 0.000 description 2
- 102000004142 Trypsin Human genes 0.000 description 2
- 108010017743 Vesicle-Associated Membrane Protein 1 Proteins 0.000 description 2
- 102100037105 Vesicle-associated membrane protein 1 Human genes 0.000 description 2
- 102100036499 Vesicle-associated membrane protein 7 Human genes 0.000 description 2
- 238000004026 adhesive bonding Methods 0.000 description 2
- YZXBAPSDXZZRGB-DOFZRALJSA-N arachidonic acid Chemical compound CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(O)=O YZXBAPSDXZZRGB-DOFZRALJSA-N 0.000 description 2
- 230000003376 axonal effect Effects 0.000 description 2
- 238000005251 capillar electrophoresis Methods 0.000 description 2
- 125000004432 carbon atom Chemical group C* 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 238000007385 chemical modification Methods 0.000 description 2
- 230000001713 cholinergic effect Effects 0.000 description 2
- 230000008602 contraction Effects 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 230000034994 death Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- VYFYYTLLBUKUHU-UHFFFAOYSA-N dopamine Chemical compound NCCC1=CC=C(O)C(O)=C1 VYFYYTLLBUKUHU-UHFFFAOYSA-N 0.000 description 2
- 229940066758 endopeptidases Drugs 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 239000010408 film Substances 0.000 description 2
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 2
- 238000002866 fluorescence resonance energy transfer Methods 0.000 description 2
- 150000002270 gangliosides Chemical class 0.000 description 2
- 238000001502 gel electrophoresis Methods 0.000 description 2
- 239000003292 glue Substances 0.000 description 2
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 2
- 229910052737 gold Inorganic materials 0.000 description 2
- 239000010931 gold Substances 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 238000012744 immunostaining Methods 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 230000003585 interneuronal effect Effects 0.000 description 2
- 238000004020 luminiscence type Methods 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 238000004949 mass spectrometry Methods 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 239000011159 matrix material Substances 0.000 description 2
- 238000000816 matrix-assisted laser desorption--ionisation Methods 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 238000002844 melting Methods 0.000 description 2
- 230000008018 melting Effects 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- 235000006109 methionine Nutrition 0.000 description 2
- 238000002493 microarray Methods 0.000 description 2
- 230000003278 mimic effect Effects 0.000 description 2
- 239000002121 nanofiber Substances 0.000 description 2
- 210000001640 nerve ending Anatomy 0.000 description 2
- 210000000653 nervous system Anatomy 0.000 description 2
- 230000002232 neuromuscular Effects 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 150000002894 organic compounds Chemical class 0.000 description 2
- 230000003518 presynaptic effect Effects 0.000 description 2
- 210000000063 presynaptic terminal Anatomy 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 239000011347 resin Substances 0.000 description 2
- 229920005989 resin Polymers 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 238000004621 scanning probe microscopy Methods 0.000 description 2
- QZAYGJVTTNCVMB-UHFFFAOYSA-N serotonin Chemical compound C1=C(O)C=C2C(CCN)=CNC2=C1 QZAYGJVTTNCVMB-UHFFFAOYSA-N 0.000 description 2
- 238000004904 shortening Methods 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 239000010409 thin film Substances 0.000 description 2
- 239000002407 tissue scaffold Substances 0.000 description 2
- 239000012588 trypsin Substances 0.000 description 2
- SFLSHLFXELFNJZ-QMMMGPOBSA-N (-)-norepinephrine Chemical compound NC[C@H](O)C1=CC=C(O)C(O)=C1 SFLSHLFXELFNJZ-QMMMGPOBSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- RAXXELZNTBOGNW-UHFFFAOYSA-N 1H-imidazole Chemical group C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 1
- 241000251468 Actinopterygii Species 0.000 description 1
- ZKHQWZAMYRWXGA-KQYNXXCUSA-N Adenosine triphosphate Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O ZKHQWZAMYRWXGA-KQYNXXCUSA-N 0.000 description 1
- ZKHQWZAMYRWXGA-UHFFFAOYSA-N Adenosine triphosphate Natural products C1=NC=2C(N)=NC=NC=2N1C1OC(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)C(O)C1O ZKHQWZAMYRWXGA-UHFFFAOYSA-N 0.000 description 1
- 101000879393 Aplysia californica Synaptobrevin Proteins 0.000 description 1
- 108091023037 Aptamer Proteins 0.000 description 1
- 101100107610 Arabidopsis thaliana ABCF4 gene Proteins 0.000 description 1
- 101000950981 Bacillus subtilis (strain 168) Catabolic NAD-specific glutamate dehydrogenase RocG Proteins 0.000 description 1
- 101710117515 Botulinum neurotoxin type E Proteins 0.000 description 1
- 108090000715 Brain-derived neurotrophic factor Proteins 0.000 description 1
- 102000004219 Brain-derived neurotrophic factor Human genes 0.000 description 1
- 102100024881 C3 and PZP-like alpha-2-macroglobulin domain-containing protein 8 Human genes 0.000 description 1
- 108090000932 Calcitonin Gene-Related Peptide Proteins 0.000 description 1
- 102100025588 Calcitonin gene-related peptide 1 Human genes 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 241000193403 Clostridium Species 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 101710137424 Complexin-2 Proteins 0.000 description 1
- 102100027823 Complexin-2 Human genes 0.000 description 1
- 239000000055 Corticotropin-Releasing Hormone Substances 0.000 description 1
- 241001146209 Curio rowleyanus Species 0.000 description 1
- 102000009025 Endorphins Human genes 0.000 description 1
- 108010049140 Endorphins Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 102000016901 Glutamate dehydrogenase Human genes 0.000 description 1
- 102000009465 Growth Factor Receptors Human genes 0.000 description 1
- 108010009202 Growth Factor Receptors Proteins 0.000 description 1
- 206010019233 Headaches Diseases 0.000 description 1
- 101000904173 Homo sapiens Progonadoliberin-1 Proteins 0.000 description 1
- 101000584505 Homo sapiens Synaptic vesicle glycoprotein 2A Proteins 0.000 description 1
- 101000639146 Homo sapiens Vesicle-associated membrane protein 4 Proteins 0.000 description 1
- 101000639143 Homo sapiens Vesicle-associated membrane protein 5 Proteins 0.000 description 1
- 101000852161 Homo sapiens Vesicle-associated membrane protein 8 Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- SIKJAQJRHWYJAI-UHFFFAOYSA-N Indole Chemical group C1=CC=C2NC=CC2=C1 SIKJAQJRHWYJAI-UHFFFAOYSA-N 0.000 description 1
- 244000050403 Iris x germanica Species 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 239000002616 MRI contrast agent Substances 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 101710151321 Melanostatin Proteins 0.000 description 1
- XJLXINKUBYWONI-NNYOXOHSSA-O NADP(+) Chemical compound NC(=O)C1=CC=C[N+]([C@H]2[C@@H]([C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OC[C@@H]3[C@H]([C@@H](OP(O)(O)=O)[C@@H](O3)N3C4=NC=NC(N)=C4N=C3)O)O2)O)=C1 XJLXINKUBYWONI-NNYOXOHSSA-O 0.000 description 1
- 108010025020 Nerve Growth Factor Proteins 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- 102000009493 Neurokinin receptors Human genes 0.000 description 1
- 108050000302 Neurokinin receptors Proteins 0.000 description 1
- 208000025966 Neurological disease Diseases 0.000 description 1
- 102400000064 Neuropeptide Y Human genes 0.000 description 1
- 108070000018 Neuropeptide receptor Proteins 0.000 description 1
- 102000004108 Neurotransmitter Receptors Human genes 0.000 description 1
- 108090000590 Neurotransmitter Receptors Proteins 0.000 description 1
- 102000016979 Other receptors Human genes 0.000 description 1
- 102400000050 Oxytocin Human genes 0.000 description 1
- 101800000989 Oxytocin Proteins 0.000 description 1
- XNOPRXBHLZRZKH-UHFFFAOYSA-N Oxytocin Natural products N1C(=O)C(N)CSSCC(C(=O)N2C(CCC2)C(=O)NC(CC(C)C)C(=O)NCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(CCC(N)=O)NC(=O)C(C(C)CC)NC(=O)C1CC1=CC=C(O)C=C1 XNOPRXBHLZRZKH-UHFFFAOYSA-N 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 108010047386 Pituitary Hormones Proteins 0.000 description 1
- 102000006877 Pituitary Hormones Human genes 0.000 description 1
- 240000009305 Pometia pinnata Species 0.000 description 1
- 235000017284 Pometia pinnata Nutrition 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 102100024028 Progonadoliberin-1 Human genes 0.000 description 1
- 238000001069 Raman spectroscopy Methods 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 101100068078 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GCN4 gene Proteins 0.000 description 1
- 108010034546 Serratia marcescens nuclease Proteins 0.000 description 1
- 102000006384 Soluble N-Ethylmaleimide-Sensitive Factor Attachment Proteins Human genes 0.000 description 1
- 108010019040 Soluble N-Ethylmaleimide-Sensitive Factor Attachment Proteins Proteins 0.000 description 1
- 108050001286 Somatostatin Receptor Proteins 0.000 description 1
- 102000011096 Somatostatin receptor Human genes 0.000 description 1
- 229920001872 Spider silk Polymers 0.000 description 1
- 101001060868 Strawberry mild yellow edge-associated virus Helicase Proteins 0.000 description 1
- 102100030701 Synaptic vesicle glycoprotein 2A Human genes 0.000 description 1
- 102100024836 Synaptosomal-associated protein 29 Human genes 0.000 description 1
- 101710189458 Synaptosomal-associated protein 29 Proteins 0.000 description 1
- 102100035936 Syntaxin-2 Human genes 0.000 description 1
- 108700038219 Syntaxin-2 Proteins 0.000 description 1
- 206010043376 Tetanus Diseases 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 108010003205 Vasoactive Intestinal Peptide Proteins 0.000 description 1
- GXBMIBRIOWHPDT-UHFFFAOYSA-N Vasopressin Natural products N1C(=O)C(CC=2C=C(O)C=CC=2)NC(=O)C(N)CSSCC(C(=O)N2C(CCC2)C(=O)NC(CCCN=C(N)N)C(=O)NCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(CCC(N)=O)NC(=O)C1CC1=CC=CC=C1 GXBMIBRIOWHPDT-UHFFFAOYSA-N 0.000 description 1
- 102000002852 Vasopressins Human genes 0.000 description 1
- 102100031489 Vesicle-associated membrane protein 4 Human genes 0.000 description 1
- 102100031484 Vesicle-associated membrane protein 5 Human genes 0.000 description 1
- 102100036505 Vesicle-associated membrane protein 8 Human genes 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 239000002250 absorbent Substances 0.000 description 1
- 230000002745 absorbent Effects 0.000 description 1
- OIPILFWXSMYKGL-UHFFFAOYSA-N acetylcholine Chemical compound CC(=O)OCC[N+](C)(C)C OIPILFWXSMYKGL-UHFFFAOYSA-N 0.000 description 1
- 229960004373 acetylcholine Drugs 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 150000001295 alanines Chemical class 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 230000002320 anti-botulinal effect Effects 0.000 description 1
- 230000009830 antibody antigen interaction Effects 0.000 description 1
- 229940114079 arachidonic acid Drugs 0.000 description 1
- 235000021342 arachidonic acid Nutrition 0.000 description 1
- 229910002056 binary alloy Inorganic materials 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000001851 biosynthetic effect Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 230000003925 brain function Effects 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 244000309466 calf Species 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 239000002041 carbon nanotube Substances 0.000 description 1
- 229910021393 carbon nanotube Inorganic materials 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 238000006555 catalytic reaction Methods 0.000 description 1
- 210000005056 cell body Anatomy 0.000 description 1
- 230000003196 chaotropic effect Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000012412 chemical coupling Methods 0.000 description 1
- 238000010382 chemical cross-linking Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 238000010668 complexation reaction Methods 0.000 description 1
- 230000001010 compromised effect Effects 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- IDLFZVILOHSSID-OVLDLUHVSA-N corticotropin Chemical compound C([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)NC(=O)[C@@H](N)CO)C1=CC=C(O)C=C1 IDLFZVILOHSSID-OVLDLUHVSA-N 0.000 description 1
- 229960000258 corticotropin Drugs 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 239000000412 dendrimer Substances 0.000 description 1
- 229920000736 dendritic polymer Polymers 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 1
- 229960003638 dopamine Drugs 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 239000012149 elution buffer Substances 0.000 description 1
- 210000003890 endocrine cell Anatomy 0.000 description 1
- 230000012202 endocytosis Effects 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 230000028023 exocytosis Effects 0.000 description 1
- 230000005294 ferromagnetic effect Effects 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 102000034287 fluorescent proteins Human genes 0.000 description 1
- 108091006047 fluorescent proteins Proteins 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 238000007499 fusion processing Methods 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 229940049906 glutamate Drugs 0.000 description 1
- 229960002449 glycine Drugs 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- ZRALSGWEFCBTJO-UHFFFAOYSA-N guanidine group Chemical group NC(=N)N ZRALSGWEFCBTJO-UHFFFAOYSA-N 0.000 description 1
- 231100000869 headache Toxicity 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 238000011102 hetero oligomerization reaction Methods 0.000 description 1
- 238000005734 heterodimerization reaction Methods 0.000 description 1
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 239000000960 hypophysis hormone Substances 0.000 description 1
- 230000003100 immobilizing effect Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000030214 innervation Effects 0.000 description 1
- 210000002490 intestinal epithelial cell Anatomy 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 210000004020 intracellular membrane Anatomy 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 230000005923 long-lasting effect Effects 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 150000002669 lysines Chemical class 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000000155 melt Substances 0.000 description 1
- 239000013528 metallic particle Substances 0.000 description 1
- CWWARWOPSKGELM-SARDKLJWSA-N methyl (2s)-2-[[(2s)-2-[[2-[[(2s)-2-[[(2s)-2-[[(2s)-5-amino-2-[[(2s)-5-amino-2-[[(2s)-1-[(2s)-6-amino-2-[[(2s)-1-[(2s)-2-amino-5-(diaminomethylideneamino)pentanoyl]pyrrolidine-2-carbonyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-5-oxopentanoyl]amino]-5 Chemical compound C([C@@H](C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)OC)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CCCN=C(N)N)C1=CC=CC=C1 CWWARWOPSKGELM-SARDKLJWSA-N 0.000 description 1
- 239000000693 micelle Substances 0.000 description 1
- 238000012775 microarray technology Methods 0.000 description 1
- 108091005573 modified proteins Proteins 0.000 description 1
- 102000035118 modified proteins Human genes 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 238000003032 molecular docking Methods 0.000 description 1
- 210000004412 neuroendocrine cell Anatomy 0.000 description 1
- 229940127284 new molecular entity Drugs 0.000 description 1
- 230000003040 nociceptive effect Effects 0.000 description 1
- SFLSHLFXELFNJZ-UHFFFAOYSA-N norepinephrine Natural products NCC(O)C1=CC=C(O)C(O)=C1 SFLSHLFXELFNJZ-UHFFFAOYSA-N 0.000 description 1
- 229960002748 norepinephrine Drugs 0.000 description 1
- 238000001668 nucleic acid synthesis Methods 0.000 description 1
- URPYMXQQVHTUDU-OFGSCBOVSA-N nucleopeptide y Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 URPYMXQQVHTUDU-OFGSCBOVSA-N 0.000 description 1
- HEGSGKPQLMEBJL-RKQHYHRCSA-N octyl beta-D-glucopyranoside Chemical compound CCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O HEGSGKPQLMEBJL-RKQHYHRCSA-N 0.000 description 1
- 230000003606 oligomerizing effect Effects 0.000 description 1
- 210000003463 organelle Anatomy 0.000 description 1
- XNOPRXBHLZRZKH-DSZYJQQASA-N oxytocin Chemical compound C([C@H]1C(=O)N[C@H](C(N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CSSC[C@H](N)C(=O)N1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(C)C)C(=O)NCC(N)=O)=O)[C@@H](C)CC)C1=CC=C(O)C=C1 XNOPRXBHLZRZKH-DSZYJQQASA-N 0.000 description 1
- 229960001723 oxytocin Drugs 0.000 description 1
- 125000001312 palmitoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 210000000578 peripheral nerve Anatomy 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N phenol group Chemical group C1(=CC=CC=C1)O ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 230000035479 physiological effects, processes and functions Effects 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 230000001242 postsynaptic effect Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 230000006916 protein interaction Effects 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000004064 recycling Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000012191 relaxation of muscle Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 239000012723 sample buffer Substances 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 239000004065 semiconductor Substances 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 229940076279 serotonin Drugs 0.000 description 1
- 229910052709 silver Inorganic materials 0.000 description 1
- 239000004332 silver Substances 0.000 description 1
- 210000002460 smooth muscle Anatomy 0.000 description 1
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 1
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- NHXLMOGPVYXJNR-ATOGVRKGSA-N somatostatin Chemical compound C([C@H]1C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CSSC[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CC=2C3=CC=CC=C3NC=2)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N1)[C@@H](C)O)NC(=O)CNC(=O)[C@H](C)N)C(O)=O)=O)[C@H](O)C)C1=CC=CC=C1 NHXLMOGPVYXJNR-ATOGVRKGSA-N 0.000 description 1
- 210000003594 spinal ganglia Anatomy 0.000 description 1
- 210000003699 striated muscle Anatomy 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 210000002182 synaptic membrane Anatomy 0.000 description 1
- 230000005062 synaptic transmission Effects 0.000 description 1
- 102000003137 synaptotagmin Human genes 0.000 description 1
- 108060008004 synaptotagmin Proteins 0.000 description 1
- 239000000271 synthetic detergent Substances 0.000 description 1
- 125000000101 thioether group Chemical group 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000031998 transcytosis Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical group [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 238000009424 underpinning Methods 0.000 description 1
- 229960003726 vasopressin Drugs 0.000 description 1
- 238000012800 visualization Methods 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/02—Drugs for disorders of the nervous system for peripheral neuropathies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/06—Antimigraine agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/94—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving narcotics or drugs or pharmaceuticals, neurotransmitters or associated receptors
- G01N33/9406—Neurotransmitters
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/55—Fusion polypeptide containing a fusion with a toxin, e.g. diphteria toxin
Definitions
- the present invention relates to a complexing system for forming a molecular scaffold which is based on the SNARE complex.
- vesicles are merged with a membrane in a process known as vesicle fusion.
- vesicle fusion In eukaryotic cells, vesicles are merged with a membrane in a process known as vesicle fusion.
- vesicle fusion can be merged with the cell plasma membrane or other cell compartments such as endosomes or lysosomes.
- the most studied form of vesicle fusion is the docking of synaptic vesicles with the pre-synaptic membrane in neuronal cells to release neurotransmitters to cause propagation of a nerve impulse in the post-synaptic neuron.
- SNARE proteins are a large protein superfamily consisting of more than 60 members in yeast and mammalian cells. SNAREs are small, abundant and mostly membrane-bound proteins. Although they vary considerably in structure and size, they all share segments in their cytosolic domains called SNARE motifs that are capable of assembly into a tight, four -helix bundle called a SNARE complex. It is thought that SNARE motifs are about 60-70 amino acids in length (Jahn R and Scheller RH), although this is not well defined.
- SNARE complexes are sometimes composed of three proteins: syntaxin and SNAP-25, which are resident in the cell membrane; and synaptobrevin (also referred to as vesicle-associated membrane protein or VAMP), which is anchored in the vesicular membrane.
- syntaxin and SNAP-25 which are resident in the cell membrane
- synaptobrevin also referred to as vesicle-associated membrane protein or VAMP
- syntaxin and synaptobrevin are anchored in their respective membranes by their C-terminal domains, whereas SNAP-25 is tethered to the plasma membrane via several cysteine-linked palmitoyl chains.
- the core SNARE complex is a four- ⁇ -helix bundle in which one ⁇ -helix is contributed by syntaxin, one ⁇ -helix is contributed by synaptobrevin and two ⁇ -helices are contributed by SNAP-25. This SNARE complex has been found to be very stable.
- Figure 1 A schematic representation of the molecular machinery involved in vesicle fusion is shown in Figure 1. Summary of Invention
- the inventors have found that the SNARE complex and the formation of it can be used for various applications.
- the basis of the invention is a complexing system comprising:
- polypeptide helix derived from synaptobrevin or a homolog thereof
- the invention also relates to a method of producing a stable SNARE complex using the above complexing system and use of the above complexing system and resulting stable SNARE complex.
- a complexing system for forming a molecular scaffold comprising:
- polypeptide helix derived from synaptobrevin or a homolog thereof
- the four polypeptide helices can form a stable SNARE complex, and wherein at least two of the polypeptide helices are less than 50 amino acids in length.
- the complexing system may not have at least two of the polypeptide helices being less than 50 amino acids in length.
- the present invention allows the controlled assembly of a stable complex formed of distinct functional units.
- the advantage of having a stable complex is that it can be used in relatively harsh conditions without the risk of the complex dissociating. This means that the helix or helices to which the one or more cargo moiety is/are attached will remain part of the complex, ensuring that the one or more cargo moiety does not dissociate from the rest of the complex.
- the complexing system is based on the formation of a stable SNARE complex. Therefore, the four polypeptide helices of the present invention can, to a certain degree, have any sequence as long as they can form a stable SNARE complex.
- the SNARE complex is formed from the following proteins: SNAP-25; syntaxin; and synaptobrevin. These proteins, as well as other SNARE proteins, contain SNARE motifs or SNARE domains which are the portions of the proteins which are involved in forming the SNARE complex. These SNARE domains or motifs are helices which pack together to form the SNARE complex. Generally, only a portion of the SNARE proteins is involved in SNARE complex formation; not the entire SNARE protein. For example, syntaxin has a C-terminal transmembrane domain, a SNARE domain and an N-terminal regulatory domain, also known as the head domain. Obviously, only the SNARE domain is involved in forming the SNARE complex.
- SNARE motif and SNARE domain are well known to those skilled in the art. Further, the SNARE motifs and SNARE domains of the various different SNARE proteins are also well known to a skilled person (Jahn R and Scheller RH (2006); Sieber et al. (2006); Besteiro (2006)).
- the four polypeptide helices of the present invention are based on the SNARE domains or motifs of the SNARE proteins that form the SNARE complex, i.e. a SNAP protein; syntaxin; and synaptobrevin or a homolog thereof.
- the complexing system comprises: two polypeptide helices derived from the SNARE motif of a SNAP protein; one polypeptide helix derived from the SNARE motif of syntaxin; and one polypeptide helix derived from the SNARE motif of synaptobrevin or a homolog thereof, wherein the four polypeptide helices can form a stable SNARE complex. It may not be necessary for a helix of the invention to be the same length as the SNARE motif or domain from a SNARE protein. It may be shorter in length as long as it can still form a stable SNARE complex when complexed with the other helices of the invention.
- the SNAP protein from which the two polypeptide helices are derived can be any SNAP protein which can form part of a SNARE complex.
- the skilled person is aware of the various SNAP proteins which can form part of a
- the SNAP protein may be SNAP-25A, SNAP-25B, SNAP-23 (also known as syndet), or SNAP-29.
- the SNAP protein is not ⁇ -SNAP.
- the SNAP protein is SNAP-25, i.e.
- SNAP-25A or SNAP-25B SNAP proteins contain two SNARE motifs. Therefore, the two polypeptide helices may be derived from the two SNARE motifs in a particular SNAP protein. Alternatively, the two polypeptide helices may be derived from different SNAP proteins. Preferably, they are derived from the same SNAP protein.
- syntaxin protein from which the polypeptide helix is derived can be any syntaxin protein which can form part of a SNARE complex.
- the syntaxin protein may be selected from syntaxin IA, syntaxin IB, syntaxin 2 (also known as epimorphin), syntaxin 3 and syntaxin 4, syntaxin 5, syntaxin 6, syntaxin 7, syntaxin 8, syntaxin 10, syntaxin 11, syntaxin 13, syntaxin 17 or syntaxin 18.
- the syntaxin protein is syntaxin IA or 3.
- the synaptobrevin protein or homolog thereof from which the polypeptide helix is derived can be any synaptobrevin protein or homolog which can form part of a SNARE complex.
- Synaptobrevin is a member of the vesicle-associated membrane protein (VAMP) family.
- VAMP vesicle-associated membrane protein
- Other VAMP proteins are known to be able to form SNARE complexes and, therefore, may be suitable for providing the basis upon which a polypeptide helix can be derived.
- homologs of synaptobrevin are VAMP proteins which can form part of a SNARE complex. Such VAMP proteins are well known to those skilled in the art.
- synaptobrevin protein or homolog thereof may be selected from synaptobrevin 1, synaptobrevin 2, synaptobrevin 3 (also known as cellubrevin) and synaptobrevin 7 (also known as TI-VAMP).
- the polypeptide helix is derived from a synaptobrevin protein.
- the synaptobrevin protein is synaptobrevin 1, 2 or 3.
- the organism from which the SNARE proteins originate can be any suitable organism in which SNARE complexes are utilised.
- the proteins may originate from: mammals, such as humans, primates, and rodents; fish; and invertebrates, such as flies.
- the SNARE proteins may be derived from yeast (Rossi G et al. (1997)).
- the organism from which the SNARE proteins originate may depend on the application of the complexing system. For example, for medical applications, the SNARE proteins preferably originate from humans.
- the four polypeptide helices of the invention are derived from the SNARE proteins which form the SNARE complex.
- the helices of the SNARE motif or domain of the SNARE proteins which form the SNARE complex are generally about 60-70 amino acids in length.
- the four polypeptide helices of the invention are derived from the SNARE motif or SNARE domain of the SNARE proteins.
- the term "derived from” means that the sequence of the polypeptide helix is substantially the same as the sequence of the SNARE domain/motif or a portion thereof so that it is capable of forming a stable SNARE complex.
- the sequence of the polypeptide helix should have at least about 80% sequence identity with the sequence of the selected SNARE domain/motif or the portion thereof.
- sequence identity should be at least about 85%, and even more preferably at least about 90%. In one embodiment, the sequence identity may be at least about 95%, at least about 98% or even 100%. However, in some embodiments, it may be preferable for the sequence of the polypeptide helix to differ from the sequence of the selected SNARE domain/motif or the portion thereof. This may be beneficial in terms of expression of the protein, purification of the protein or down-stream applications. For example, and without limitation, this may include the addition of histidine residues at either end of the sequence to enable purification, or incorporation of additional lysine or cysteine residues for functional attachment of the peptides to surfaces or cargoes.
- the two SNAP derived helices may comprise a sequence selected from SEQ ID NOs. 1, 2, 5, 6, 24, 41, 48, 49, 50, 51, 64 and 65.
- the syntaxin derived helix may comprise a sequence selected from SEQ ID NOs. 3, 7, 9, 25, 32, 33, 34, 35, 36, 37, 38, 46, 47, 60, 61, 62 and 66.
- the helix derived from synaptobrevin or a homolog thereof may comprise a sequence selected from SEQ ID NOs. 4, 8, 27, 28, 29, 30, 31, 42, 43, 44, 45, 52, 53, 67, 68 and 69. Further, the helices derived from the SNARE proteins may consist of the above sequences.
- a helix of the invention may comprise or consist of a sequence selected from SEQ ID NOs. 1-9, 12-15 and 18-69.
- Each polypeptide helix should be long enough so that it can interact with the other helices to form a stable SNARE complex. In effect, this means that the polypeptide helix must be derived from a sufficiently long portion of the SNARE motif/domain to allow the formation of a stable SNARE complex. It is relatively straight forward and well within the capabilities of a skilled person to test whether a polypeptide helix is long enough to allow formation of a stable SNARE complex.
- Adverse conditions are those which generally cause dissociation of protein complexes and protein-protein interactions. Such conditions will be apparent to a skilled person. For example, such adverse conditions may be exposing the complex to a strong surfactant or a disrupting detergent.
- a SNARE complex can be tested to determine whether it is stable by using SDS-PAGE which is performed in the presence of denaturing SDS concentrations (> 0.02 %). If the complex is dissociated by the SDS in the gel so that it separates into its component parts, the SNARE complex may not be stable.
- the SNARE complex can be considered to be stable if it does not dissociate using SDS.
- the SNARE complex is stable when using a gel sample buffer for SDS-PAGE containing about 2% SDS. More preferably, the SNARE complex is stable when using a gel for SDS-PAGE containing about 0.1% SDS. This can be done using a gel for the SDS-PAGE which contains about 0.1% SDS.
- the stability of the SNARE complex can be verified by bead pull-down.
- the SNARE complex can be considered to be stable if one component of the complexing system will bring down all interacting partners in a stoichiometric manner. Bead pull-down is well-known to a skilled person (Rickman C. et al. (2004)).
- Another method of determining whether a SNARE complex is stable is to determine the dissociation constant of the complex. This is the dissociation constant for one helix dissociating from the complex.
- a stable SNARE complex should have a dissociation constant of less than 10 "7 M.
- the stable SNARE complex may have a dissociation constant of less than 10 "8 , 10 "9 , 10 "10 , 10 "11 , 10 "12 , 10 "13 , 10 "14 , or 10 "15 M.
- the dissociation constant may be 10 "7 M to 10 "11 M or 10 "7 M to 10 "10 M.
- the dissociation constant may be comparable to antibody dissociation constants (6-10 xlO "8 M).
- SNARE complex formation can also be assessed by binding to complexin which binds to the fully formed SNARE complex (Hu et al. (2002)).
- the polypeptide helices of the present invention are at least about 25 amino acids in length. SNARE complexes using such helices can form in solution. However, they may not be SDS resistant. Preferably, the polypeptide helices of the present invention are at least about 30 or about 35 amino acids in length.. More preferably, the polypeptide helices of the present invention are at least about 40 amino acids in length. SNARE complexes formed using such helices are generally SDS resistant. Alternatively, the polypeptide helices may be at least about 45 amino acids in length. In one embodiment, at least one of the polypeptide helices is less than 50 amino acids in length.
- the advantage of this is that it is much easier to artificially manufacture polypeptides which are less than 50 amino acids in length.
- the polypeptide helices which are less than 50 amino acids can be any of the polypeptide helices.
- at least two of the polypeptide helices are less than 50 amino acids in length.
- they are the polypeptide helices derived from syntaxin and synaptobrevin or a homolog thereof.
- three or four of the polypeptide helices may be less than 50 amino acids in length. In such embodiments, any combination of helices can be less than 50 amino acids in length.
- two of the polypeptide helices are less than 50 amino acids in length, preferably it is the helix derived from syntaxin and the helix derived from synaptobrevin or a homolog thereof which are less than 50 amino acids in length.
- the four polypeptide helices of the invention may be about the same length or may be different in length. For example, in one embodiment they may all be about 45 amino acids in length. Alternatively, the polypeptide helices may be different lengths.
- the polypeptide derived from syntaxin and/or the polypeptide derived from synaptobrevin or a homolog thereof may further comprise a membrane attachment sequence to allow immobilisation of the SNARE complex to membranes or lipid bilayers.
- membrane attachment sequences are well known to those skilled in the art.
- the native sequences of syntaxin and synaptobrevin contain transmembrane portions to allow attachment of the protein to vesicle and cellular membranes (Kasai and Akagawa (2001) and Laage et al. (2000)).
- the polypeptide helix derived from syntaxin may further comprise a membrane attachment sequence derived from the syntaxin transmembrane domain for immobilising the polypeptide helix to a membrane or lipid bilayer.
- the polypeptide helix derived from synaptobrevin or a homolog thereof may further comprise a membrane attachment sequence derived from the transmembrane domain of synaptobrevin or a homolog thereof for immobilising the polypeptide helix to a membrane or lipid bilayer.
- a stable SNARE complex is one which does not dissociate under adverse conditions which generally cause dissociation of protein complexes and protein-protein interactions. This may be measured, for example, using SDS- PAGE, bead pull-down, surface plasmon resonance of immobilised protein, the dissociation constant or complexin binding. This is discussed in more detail above.
- the one or more cargo moiety may be any moiety which a skilled person might want to attach to the polypeptide helices.
- the one or more cargo moiety is preferably attached to the end of the helices in the complexing system.
- the cargo moiety may be selected from a small molecule, a polymer containing a small molecule, a polypeptide, a protein, a nucleic acid or derivative, and a particle or nanoparticle.
- the cargo moiety may be:
- a small molecule or a polymer containing a small molecule such as:
- an affinity tag e.g. biotin
- a therapeutic e.g. a toxin or a drug
- a reactive group for further/downstream cross-linking, polymerisation and further derivatisation e.g. an amino group, carboxyl group, sulfhydryl group, guanidine group, phenolic group, thioether group, imidazol group, indol group, etc.;
- a spontaneously reactive group suitable for further modification e.g. a maleimide or derivative for cross-linking to SH groups, or any other chemistry suitable for cross-linking;
- molecule for direct attachment to surfaces e.g. an SH- containing molecule for attachment to metal surfaces
- an imaging reagent e.g. a fluorescent or absorbent moiety for UV, VIS, IR, Raman, NMR, MRI, PET, X-ray or other imaging;
- a biologically relevant ligand e.g. for receptor binding/targeting
- a biologically relevant substrate e.g. a phosphorylation or other PTM site
- a biologically relevant molecule e.g. a lipid or carbohydrate
- a protective group or molecule e.g. PEG
- polypeptide or protein such as:
- polypeptide or protein containing a functional site e.g. a protease digestion site
- a targeting functional peptide e.g. for different organelle targeting, nuclear targeting (for transfection), intracellular targeting (for drug delivery), etc.;
- peptide affinity tag e.g. Flag, Myc, VSV, HA, 6xHis, 8xhis, poly- His, etc.;
- polypeptide or protein capable of forming a protein-protein interaction e.g. PDZ, SH2/3;
- an enzyme e.g. for research, diagnostics (the complexing system can be used to immobilise enzymes for some applications) and therapeutic applications, for nucleic acid synthesis or amplification including promoters, polymerases, restriction endonucleases, or other modifying enzymes;
- nucleic acid or derivative such as:
- RNA, or PNA for detection, immobilisation, hybridisation, synthesis priming, synthesis and amplification, labelling, signal detection and signal amplification, transcription and translation; and 4. a particle or nanoparticle such as:
- a metallic particle or nanoparticle e.g. gold or silver for staining or labelling
- a semiconductor particle or nanoparticle e.g. quantum dots for labelling and detection
- a polymer micro or nanoparticle e.g. resins, gels, etc.
- a plurality of cargo moieties can be attached to the ends of the polypeptide helices.
- the number of cargo moieties that can be attached to the ends of polypeptide helices will depend on how many free ends are present on the helices. For example, where the complexing system comprises four separate polypeptide helices, the helices will have eight free ends (one at each end of each helix). Therefore, it is possible to attach a cargo moiety to each of the eight free ends. This means that 1, 2, 3, 4, 5, 6, 7 or 8 cargo moieties could be attached to the free ends of the helices.
- the number of free ends is reduced. This will reduce the number of cargo moieties that can be attached to the ends of the helices.
- two or more cargo moieties can be attached at an end of a helix.
- a first cargo moiety is attached to the end of a first helix and a second cargo moiety is attached to the end of a second helix.
- the first and second cargo moieties should not be attached together on the same helix or helix containing component. They should be attached to separate helices or helix containing components.
- the two cargo moieties may be attached to two single independent helices.
- the first cargo moiety may be attached to the synaptobrevin/syntaxin fusion protein and the second cargo moiety may be attached to one of the helices derived from a SNAP protein.
- the first cargo moiety should be attached to the first helix containing component and the second cargo moiety should be attached to the second helix containing component.
- the first cargo moiety is an enzymatic or imaging moiety.
- the second cargo moiety is a ligand for targeting the complexing system to a particular target, for example, a particular type of cell or a particular receptor.
- the first cargo moiety is an enzymatic or imaging moiety and the second cargo moiety is a ligand for targeting the complexing system to a particular target, for example, a particular type of cells or a particular receptor.
- the enzymatic or imaging agent may be any suitable agent.
- the imaging agent can be any agent which can be attached to a helix and which allows the position of the helix to be imaged, for example, a GFP fluorescent tag, fluorescently labelled peptides, and MRI contrast agents.
- the enzymatic agent can be any enzyme or functional portion thereof.
- the enzymatic or imaging agent is an enzymatic agent.
- the enzymatic agent comprises the light chain of a botulinum toxin or a functional portion thereof.
- the function of the light chain of a botulinum toxin is as an endopeptidase. Therefore, a functional portion of the light chain of a botulinum toxin is a portion which retains the endopeptidase activity.
- the enzymatic agent comprises the light chain of a botulinum toxin.
- the light chain of the botulinum toxin can be from any botulinum toxin.
- There are seven different types of botulinum toxin which are A, B, C, D, E, F and G.
- the light chain is from botulinum toxin A or E and, more preferably, the light chain is from botulinum toxin A.
- the enzymatic agent comprises the light chain of a botulinum toxin or a functional portion thereof and the translocation portion of the heavy chain of a botulinum toxin.
- the translocation portion of the heavy chain of the botulinum toxin allows the light chain associated with it to be released from a vesicle into the cytosol of a cell.
- a skilled person would readily understand what is meant by the term 'the translocation portion of the heavy chain of the botulinum toxin', which may also be referred to as the translocation domain.
- the translocation portion of the heavy chain of the botulinum toxin can be from any botulinum toxin.
- the translocation portion is from botulinum toxin A or E and, more preferably, from botulinum toxin A.
- the light chain or functional portion thereof and the translocation portion can be from the same or different botulinum toxins.
- the light chain or functional portion thereof and the translocation portion are from the same botulinum toxin.
- the light chain or functional portion thereof and translocation portion may be joined in any suitable way. Preferably, they are joined via a disulphide bond as in a naturally occurring botulinum toxin.
- the light chain of a botulinum toxin or a functional portion thereof and the translocation portion of the heavy chain of a botulinum toxin are joined by a peptide bond between the amino acid chains, preferably, there is a nicking site in the amino acid sequence between the light chain of a botulinum toxin or a functional portion thereof and the translocation portion of the heavy chain of a botulinum toxin which is recognised by a protease to cause cleavage of the amino acid sequence between the two parts.
- the nicking site is a thrombin site which can be cleaved by thrombin.
- the light chain of a botulinum toxin or a functional portion thereof and the translocation portion of the heavy chain of a botulinum toxin may be attached to one of the polypeptide helices derived from a SNAP protein.
- the sequence of the light chain of the botulinum toxin may comprise the sequence as shown in SEQ ID NO. 70.
- sequence of the translocation portion of the heavy chain of the botulinum toxin may comprise the sequence as shown in SEQ ID NO. 71.
- the cargo moiety when it is a ligand, it can be any suitable ligand for targeting the complexing system to a particular target, for example, a particular type of cell or a particular receptor.
- ligands are well known to those skilled in the art.
- the ligand may be capable of binding to a cell surface receptor.
- Such ligands could include neuropeptides such as substance P, neuropeptide Y and VIP, growth factors such as NGF and BDNF, and hormones such as pituitary hormones (e.g. ACTH, TSH, PRL, GH, endorphins, FSH, LH, oxytocin, ADH and AVP), GNRH and CGRP.
- the ligand is a somatostatin peptide or a functional portion thereof which allows the somatostatin peptide to bind to a somatostatin receptor.
- the ligand may be a substance P peptide or a functional portion thereof which allows the substance P peptide to bind to a neurokinin receptor or the ligand may be an AVP peptide or a functional portion thereof which allows the AVP peptide to bind to an AVP receptor.
- the ligand may be the receptor binding portion of the heavy chain of a botulinum toxin.
- the receptor binding portion of the heavy chain of a botulinum toxin is responsible for recognition of neuronal gangliosides and binds to synaptic vesicle receptor, SV2C, allowing the toxin to be endocytosed into the cell.
- the term 'receptor binding portion of the heavy chain of a botulinum toxin' would be readily understood by a skilled person and may also be referred to as the receptor binding domain.
- the receptor binding portion can be from any botulinum toxin.
- the receptor binding portion is from botulinum toxin A or E and, more preferably, the receptor binding portion is from botulinum toxin A.
- the receptor binding portion of the heavy chain of a botulinum toxin is attached to the polypeptide helix derived from synaptobrevin or a homolog thereof.
- the sequence of the receptor binding portion of the heavy chain of the botulinum toxin may comprise the sequence as shown in SEQ ID NO. 72.
- the present invention also provides the above complexes for use in therapy and/or diagnosis.
- the exact nature of the therapy and/or diagnosis will depend on the identity of the ligand and enzymatic agent/imaging agent.
- the first cargo moiety is an enzymatic agent comprising the light chain of a botulinum toxin or a functional portion thereof and the translocation portion of the heavy chain of a botulinum toxin
- the second cargo moiety is a ligand which is the receptor binding portion of the heavy chain of a botulinum toxin.
- the first cargo moiety is an enzymatic agent comprising the light chain of a botulinum toxin or a functional portion thereof and the translocation portion of the heavy chain of a botulinum toxin
- the second cargo moiety is a ligand which is a somatostatin peptide or a functional portion thereof.
- the one or more cargo moiety may be joined directly to the end of the helix or may be attached via a linker.
- Suitable linkers are well known to those skilled in the art. For example, this may be done chemically or, if the cargo moiety is a protein or polypeptide, recombinantly.
- the cargo moiety may be attached via a linker. Such linkers are well known to those skilled in the art.
- the four polypeptide helices may be four separate helices which are not joined together in any way until they form a SNARE complex.
- two of the helices may be joined together so that the complexing system comprises three separate components (referred to hereinafter as a three component system).
- the two helices may be joined together in any suitable way as long as the two helices can assemble into the same stable SNARE complex.
- the two helices may be joined together by recombinant means or chemically coupled.
- the two helices may be joined together via a linker.
- the term "join” means the linear linking of helices (this is in contrast to binding of helices which happens in parallel orientation akin to 'zippering'). Joining two helices together helps to simplify the complexing system. Any two helices may be joined together.
- the two polypeptide helices derived from a SNAP protein are joined together. The advantage of this is that a full length SNAP protein can be used which comprises two polypeptide SNARE helices in the protein, for example, a full length SNAP-25 protein.
- the polypeptide helix derived from syntaxin may be joined to the polypeptide helix derived from synaptobrevin or a homolog thereof.
- two of the helices are joined together whilst the other two helices are also joined together.
- the two sets of helices may be joined together in any suitable way as long as they can still form a stable SNARE complex.
- the two sets of helices may be joined together by recombinant means or chemically coupled.
- One or both sets of helices may be joined together via a linker. Any combination of helices can be joined together to form the two sets of two helices.
- the two polypeptide helices which are derived from a SNAP protein are joined together and the helices derived from syntaxin and synaptobrevin or a homolog thereof are joined together.
- three of the helices can be joined together.
- the three helices may be joined together in any suitable way as long as they can still form a stable SNARE complex with the fourth helix.
- the three helices may be joined together by recombinant means or chemically coupled.
- the three helices may be joined together with a linker between two of the helices or between all three helices. Any three helices can be joined together.
- the two polypeptide helices which are derived from a SNAP protein are joined together along with a third helix, i.e. the helix derived from syntaxin or the helix derived from synaptobrevin or a homolog thereof.
- the two polypeptide helices which are derived from a SNAP protein are joined together along with the polypeptide helix derived from synaptobrevin or a homolog thereof.
- the two polypeptide helices which are derived from a SNAP protein are joined together along with the polypeptide helix derived from syntaxin.
- the cargo moiety is attached to the fourth single helix, for example, to syntaxin when the two polypeptide helices which are derived from a SNAP protein are joined together along with the polypeptide helix derived from synaptobrevin or a homolog thereof.
- a FLAG epitope can be attached to a protein of interest and recognised by its cognate antibody much as a syntaxin-derived tag can be added to a protein of interest and recognised by a tri-helical construct of SNAP25 and synaptobrevin helices.
- the affinity of the interaction between the tri-helical SNARE construct and the lone SNARE tag may be such that is allows for immobilisation of the protein, or may be reversible for other applications. This is advantageous because the tri- helical construct is cheaper to produce than an antibody.
- the head domain of syntaxin 3 protects its SNARE motif from SNARE assembly but certain detergents and/or lipids can 'open' syntaxin for SNARE assembly (Darios and Davletov (2006); Rickman and Davletov (2005)). Therefore, in one embodiment in which the syntaxin derived helix has a syntaxin head domain attached to it, the system further comprises a detergent, preferably a mild detergent, such as octylglucopyranoside to open the syntaxin molecule to allow the formation of a stable SNARE complex. This allows the syntaxin SNARE motif to be controlled and, therefore, allows regulation of the formation of a SNARE complex.
- a detergent preferably a mild detergent, such as octylglucopyranoside to open the syntaxin molecule to allow the formation of a stable SNARE complex.
- the system may further comprise a detergent regardless of whether the head domain of syntaxin 3 is attached to the polypeptide derived from syntaxin.
- a detergent can help to promote the assembly of the SNARE complex in the present invention.
- the detergent is a mild detergent. Some assembly takes place in the absence of a detergent but the presence of a detergent promotes more efficient assembly of the SNARE complex.
- the detergent is at a concentration above the critical micellar concentration (CMC) which is the concentration at which the detergent starts to form micelles.
- the detergent has a carbon chain with a length of 7-12 carbon atoms.
- the detergent is not Triton X-IOO or Thesit.
- a suitable detergent can be selected from the group consisting of MEGA 8, C-HEGA 10, C-HEGA 11, HEGA 9, heptyl glucopyranoside, octylglucopyranoside, nonylglucopyranoside, zwittergent 3-08, zwittergent 3-10, and zwittergent 3-12.
- the detergent is octylglucopyranoside.
- one of the helices can be immobilised on a substrate.
- the helix is immobilised on a substrate.
- the helix can be immobilised in any suitable way and such ways are well known to those skilled in the art.
- the helix may be immobilised via a linker.
- the substrate can be any suitable substrate for immobilising the helix.
- the substrate may be a surface, a matrix, a bead, a quantum dot, a resin, glass, a metal, a polymer, a microscope slide, an array or a nanotube such as a carbon naotube.
- the helix that is immobilised on the substrate does not have a cargo moiety attached to it.
- the complexing system can further comprise one polypeptide helix derived from complexin.
- the complexin protein from which the polypeptide helix is derived can be any complexin protein which can bind to a SNARE complex.
- the skilled person is aware of the various complexin proteins which can bind to a SNARE complex.
- the complexin protein may be selected from mammalian complexin 1 or complexin 2 isoforms. Other preferable features and properties (e.g. size) of the helix derived from the complexin protein are the same as for the other helices.
- the helix derived from complexin may optionally carry one or two cargo moieties.
- the complexin moiety only binds to a formed SNARE complex, it can also be used to purify specifically an assembled complex.
- the helix derived from complexin may comprise the sequence as shown in SEQ ID NO. 63.
- the helix derived from complexin may consist of this sequence.
- An alternative embodiment of the invention is directed to a SNARE complex in which the polypeptide helix derived from syntaxin is joined to the polypeptide helix derived from synaptobrevin or a homolog thereof.
- a complexing system for forming a molecular scaffold comprising: two polypeptide helices derived from a SNAP protein;
- polypeptide helix derived from synaptobrevin or a homolog thereof
- polypeptide helices can form a stable SNARE complex and wherein the polypeptide helix derived from syntaxin is joined to the polypeptide helix derived from synaptobrevin or a homolog thereof.
- This embodiment of the invention is directed to the three component system described above in which the polypeptide helix derived from syntaxin is joined to the polypeptide helix derived from synaptobrevin or a homolog thereof. It will be apparent to one skilled in the art that virtually all the description above relating to limitations and preferable features of the complexing system containing a helix which is less than 50 amino acids in length is equally applicable to the above system containing a polypeptide helix derived from syntaxin joined to a polypeptide helix derived from synaptobrevin or a homolog thereof.
- the two helices derived from a SNAP protein in this system may also be joined together as described above to produce a two component system. The skilled person would appreciate that two of the helices do not need to be less than 50 amino acids in length.
- a complexing system for forming a molecular scaffold comprising:
- polypeptide helix derived from synaptobrevin or a homolog thereof
- polypeptide helices can form a stable SNARE complex and wherein the polypeptide helices are joined together to form two helix containing components.
- the two component system can be formed in two ways. First, two of the helices can be joined together and the other two helices can be joined together to form two components each comprising two helices.
- three of the helices can be joined together to give a component containing three helices which can form a SNARE complex with the single remaining helix.
- the invention provides a complexing system for forming a binary compound comprising two cargo moieties, the complexing system comprising:
- binary compound means a compound which is made up of two separate parts (cargo moieties) so that when the two parts are brought together, the compound is able to carry out its function. The function of the compound will depend on the functions or identities of the two separate parts of the compound.
- the first cargo moiety has a first function and the second cargo moiety has a second function.
- the first cargo moiety may have an enzymatic or imaging function and the second cargo moiety may have a targeting function. This enables the compound to be targeted to a particular location at which the enzymatic or imaging part is able to carry out its function.
- the binary compound may be a polypeptide which is formed from distinct units.
- the polypeptide may be a toxin which is formed from distinct units.
- Suitable toxins are botulinum toxin, diptheria toxin, tetanus toxin and ricin. It will be apparent to a skilled person which peptides and toxins are suitable for use in the system of the invention.
- the botulinum toxin is made up of three distinct portions: a receptor binding portion; a translocation portion; and an enzymatic portion.
- the enzymatic portion and the translocation portion can form one part (cargo moiety) and the receptor binding portion can form a second part (cargo moiety) so that when they are brought together by the complexing system, a functional botulinum toxin is formed.
- tetanus, ricin and diptheria toxin can be separated into two parts so that when they are brought together, a functional toxin is formed.
- the first cargo moiety has a first function and the second cargo moiety has a second function, which when brought together form a fully functional peptide, e.g. a toxin.
- peptides which are formed from distinct units and can be used in the way described above is well within the capability of a person skilled in the art.
- US2009/0035822 describes the formation of functional proteins from separate parts. Diptheria toxin, tetanus toxin and ricin can be used in therapy, for example, in the treatment of neoplastic disease. Therefore, complexing systems involving these polypeptides can be used in therapy and in the treatment of neoplastic disease. They can also be used in a method of treatment comprising administering an effective amount of a composition comprising the complexing system to a subject.
- the present invention also provides a method of forming a SNARE complex to form a binary compound comprising two cargo moieties, the method comprising:
- the invention provides a complexing system for forming a botulinum toxin comprising:
- polypeptide helix derived from synaptobrevin or a homolog thereof
- the four polypeptide helices can form a stable SNARE complex, wherein a first cargo moiety is attached to a first helix and a second cargo moiety is attached to a second separate helix, and wherein the first cargo moiety comprises the light chain of a botulinum toxin or a functional portion thereof and the translocation portion of the heavy chain of a botulinum toxin and the second cargo moiety comprises the receptor binding portion of the heavy chain of a botulinum toxin.
- This embodiment of the invention is directed to a particular application of the SNARE complex assembly in which a botulinum toxin can be produced in separate parts, thereby avoiding any risk associated with the complete toxin during the manufacturing process. The two parts can then be combined, using the formation of the SNARE complex, to form a functional botulinum toxin.
- the invention also provides the use of the complexing system described above. Further, the invention provides the complexing system described above for use in therapy and also for use in treating diseases or conditions which are alleviated by the inhibition of neural synapses.
- some of the diseases or conditions which are alleviated by the inhibition of neural synapses are selected from the group consisting of: excessive sweating, excessive salivation, dystonias, gastrointestinal disorders, urinary disorders, facial spasms, strabismus, cerebral palsy, stuttering, chronic tension headaches, hyperlacrymation, hyperhidrosis, spasms of the inferior constrictor of the pharynx, spastic bladder, pain, migraine, and cosmetic treatments such as reducing wrinkles, brow furrows, etc.
- a method of treatment comprising administering an effective amount of the complexing system described above to a subject.
- the present invention also provides a method of forming a SNARE complex to form a botulinum toxin, the method comprising:
- first cargo moiety is attached to a first helix and a second cargo moiety is attached to a second separate helix, wherein the first cargo moiety comprises the light chain of a botulinum toxin or a functional portion thereof and the translocation portion of the heavy chain of a botulinum toxin and the second cargo moiety comprises the receptor binding portion of the heavy chain of a botulinum toxin.
- This method causes the two parts of the botulinum toxin to be brought together thus producing a fully functional botulinum toxin.
- the present invention provides a component for forming a botulinum toxin, the component comprising: a polypeptide helix derived from: a SNAP protein; syntaxin; or synaptobrevin or a homolog thereof, wherein the polypeptide helix is attached to a cargo moiety comprising the light chain of a botulinum toxin or a functional portion thereof and the translocation portion of the heavy chain of a botulinum toxin.
- a component for forming a botulinum toxin comprising: a polypeptide helix derived from: a SNAP protein; syntaxin; or synaptobrevin or a homolog thereof, wherein the polypeptide helix is attached to a cargo moiety comprising the receptor binding portion of the heavy chain of a botulinum toxin.
- the invention provides the use of the above components as well as a kit comprising two polypeptide helices derived from a SNAP protein; one polypeptide helix derived from syntaxin; and one polypeptide helix derived from synaptobrevin or a homolog thereof, wherein the four polypeptide helices can form a stable SNARE complex, wherein a first cargo moiety is attached to a first helix and a second cargo moiety is attached to a second separate helix, and wherein the first cargo moiety comprises the light chain of a botulinum toxin or a functional portion thereof and the translocation portion of the heavy chain of a botulinum toxin and the second cargo moiety comprises the receptor binding portion of the heavy chain of a botulinum toxin.
- botulinum toxin can comprise further limitations and that the limitations described elsewhere with regard to other aspects and embodiments of the invention are equally applicable to these botulinum toxin embodiments.
- the invention provides a complexing system for forming a molecular scaffold, the system comprising:
- polypeptide helix derived from synaptobrevin or a homolog thereof
- the four polypeptide helices can form a stable SNARE complex and wherein the SNARE complex is formed in the presence of a detergent.
- Muncl ⁇ is thought to be a negative regulator of SNARE complex formation.
- the inventors have surprising found that a detergent allows better SNARE complex formation in the absence of Muncl ⁇ .
- the system does not contain a Muncl ⁇ protein.
- the system is a Muncl ⁇ free system.
- the present invention also provides the use of a detergent for promoting the assembly of a SNARE complex in the absence of Muncl ⁇ .
- the detergent is a mild detergent.
- the detergent is a synthetic detergent.
- the detergent has a carbon chain length of 7-12 carbon atoms.
- All the embodiments of the invention described above relate to a complexing system in which a single stable SNARE complex is produced with one or more cargo moieties attached to that SNARE complex. This is useful in a large number of applications, for example, diagnostics.
- the system also has application in tagging applications for affinity purification of labelled proteins, immobilisation of proteins or cells, or identification of labelled proteins
- affinity reagent assembly including combinatorial assembly, poly-, homo- and hetero- oligomerisation
- drug small molecules, nucleic acids, proteins
- targeting and internalisation signals with the cargo
- binary compounds e.g. functional proteins, enzymes, factors, co-factors, (and any other functional proteins), FRET labels, binary inorganic compounds and small molecules, binary organic compounds;
- the present invention provides the use of any of the embodiments of the complexing system described above and, in particular, in any of the applications described above.
- the present invention provides the use of the complexing system in diagnostics, such as an array, an assay, a micro fluidic device, an SPR instrument, a QCM instrument, a mass spectrometer, an electrophoresis instrument, a chromatography column, a scanning probe microscope, or a calorimetry instrument.
- the complexing system may be used in arrays to secure antibodies to a substrate.
- the present invention provides an apparatus having a stable SNARE complex immobilised thereon, the SNARE complex comprising:
- polypeptide helix derived from synaptobrevin or a homolog thereof
- the apparatus is selected from an array, an assay, a microfluidic device, an SPR instrument, a QCM instrument, a mass spectrometer, an electrophoresis instrument, a chromatography column, a scanning probe microscope, and a calorimetry instrument.
- the present invention also provides a method of forming a SNARE complex carrying one or more cargo moiety, the method comprising:
- polypeptide helix derived from syntaxin is joined to the polypeptide helix derived from synaptobrevin or a homolog thereof;
- At least two of the polypeptide helices are less than 50 amino acids in length.
- the present invention also provides a component comprising a polypeptide helix derived from syntaxin joined to a polypeptide helix derived from synaptobrevin or a homolog thereof and wherein the two joined helices can form part of a stable SNARE complex.
- the two helices are joined together so that they can assemble into the same stable SNARE complex.
- the two helices may be joined together so that they cannot assemble into the same stable SNARE complex.
- the two helices should be able to assemble into different stable SNARE complexes.
- the two helix component of the invention comprising a helix derived from syntaxin and a helix derived from synaptobrevin or a homolog thereof may comprise one of the following sequences shown in SEQ ID NO. 12, 13, 14 and 73.
- the two helix component of the invention comprising a helix derived from syntaxin and a helix derived from synaptobrevin or a homolog thereof may consist of one of the above sequences.
- the two helix component may further comprise one or more cargo moieties attached to the polypeptide helices.
- the present invention also provides a component comprising two polypeptide helices derived from a SNAP protein and either a polypeptide helix derived from synaptobrevin or a polypeptide helix derived from syntaxin, wherein the three helices are joined together to form a tri-helical component and wherein the three joined helices can form part of a stable SNARE complex.
- the third helix is derived from synaptobrevin.
- the three helices are joined together so that they can assemble into the same stable SNARE complex.
- a tri-helical component of the invention comprising SNAP-25 helices and a helix derived from synaptobrevin or a homolog thereof may comprise SEQ ID NO. 15. Further, the tri-helical component may consist of this sequence.
- the three helices may be joined together so that the two SNAP helices can assemble into the same stable SNARE complex but the third helix cannot assemble into the same stable SNARE complex as the two SNAP helices.
- the third helix should be able to assemble into a different stable SNARE complex compared to the two SNAP helices.
- the tri-helical component may further comprise one or more cargo moieties attached to the polypeptide helices.
- the present invention provides the use of the above components, for example, to form a stable SNARE complex for forming a molecular scaffold.
- the present invention further provides a kit comprising a component comprising a polypeptide helix derived from syntaxin joined to a polypeptide helix derived from synaptobrevin or a homolog thereof and wherein the two joined helices can form part of a stable SNARE complex.
- the kit may further comprise two polypeptide helices derived from a SNAP protein which can form a stable SNARE complex with the syntaxin/synaptobrevin derived helices. The two SNAP helices may be joined together.
- the present invention provides a kit comprising a component comprising two polypeptide helices derived from a SNAP protein and either a polypeptide helix derived from syntaxin or a polypeptide helix derived from synaptobrevin, wherein the three helices are joined together to form a tri-helical component and wherein the three joined helices can form part of a stable SNARE complex.
- the kit may further comprise a single polypeptide helix derived from the fourth SNARE protein.
- the kit may further comprise a single polypeptide helix derived from syntaxin which can form a stable SNARE complex with the joined SNAP/synaptobrevin derived helices.
- the kit may further comprise a single polypeptide helix derived from synaptobrevin or a homolog thereof which can form a stable SNARE complex with the joined SNAP/syntaxin derived helices.
- kits of the invention may further comprise suitable reagents for use with the kit. Further features of the helices and the SNARE complex of the kit are as described above.
- the complexing system can also be used to form multimers of SNARE complexes.
- This is a plurality of SNARE complexes joined together.
- two of the helices are joined together in such a way so that they cannot form a stable SNARE complex in the same complex.
- the two helices should be joined together in such a way so that they can each form a stable SNARE complex but in different SNARE complexes. This may be done by joining the helices directly together without any kind of linker so that the two helices cannot take up the correct conformation in the same SNARE complex. Instead, each helix in such a 2-helical joint construct can complex with the three other polypeptide helices to form two stable SNARE complexes.
- the two helices can be joined together in any suitable way, for example, by recombinant means or chemical coupling. Take, for example, a two component system in which the two helices derived from a SNAP protein are joined together and the two helices derived from syntaxin and synaptobrevin are joined in a restricted manner so that they cannot assemble in the same SNARE complex. Starting with a syntaxin-synaptobrevin fusion protein, the SNAP fusion protein will complex with the syntaxin helix. A synaptobrevin helix from another syntaxin-synaptobrevin fusion protein will then bind to the SNAP-syntaxin complex to form a four -helical SNARE complex.
- This complex will have a syntaxin helix and a synaptobrevin helix protruding from it, one from each of the syntaxin-synaptobrevin fusion proteins. These single helix protrusions can be the basis for the formation of further SNARE complexes. Therefore, a multimer of SNARE complexes is formed. In the above example, the SNAP helices do not have to be joined together. Further, any two helixes could be joined together for the system to work as long as they both cannot assemble in the same complex to form a stable SNARE complex. The present invention also provides a multimer produced by the above system.
- a multimer can be formed by controlling the reaction conditions of the system. Two of the helices of the system must be joined together. This can be done in any suitable way. The two helices do not need to be restricted in any way as in the above example although they can be, if desired.
- the system further comprises a single helix which is derived from the same SNARE protein as one of the two joined helices.
- the system further comprises a single syntaxin helix.
- the single syntaxin helix is introduced into a solution. This single helix may be free in the solution or immobilised on a substrate, as discussed above.
- Two helices derived from a SNAP protein (which may or may not be joined) are added to the solution. These bind to the syntaxin helix to form a syntaxin-SNAP tri- helical complex. After this, the syntaxin-synaptobrevin fusion protein is added to the solution. The synaptobrevin helix from this fusion protein binds to the tri-helical complex to form a stable SNARE complex whilst the syntaxin helix will remain unbound and will protrude from the SNARE complex. By going through the same steps as above repeatedly, this syntaxin protrusion can be used to form further SNARE complexes, thus producing a multimer. Since the above system requires the helices to be added in a particular order, it may be necessary to ensure that there are no unwanted molecules after a particular step. This can be done, for example, by immobilizing the single syntaxin helix and performing washing after each binding step.
- the present invention also provides a multimer produced by the above system.
- each SNARE complex comprises:
- polypeptide helix derived from synaptobrevin or a homolog thereof
- a helix from one SNARE complex is joined to a helix from another SNARE complex to join the SNARE complexes together, and wherein one or more cargo moiety is attached to the polypeptide helices.
- the multimer of the present invention can be linear. If it is linear, each SNARE complex will be attached to two other SNARE complexes on either side to form a long linear chain similar to a string of beads. Therefore, two of the helices in a SNARE complex will be attached to a helix in two different SNARE complexes. Obviously, the SNARE complexes at the end of the chain will only be attached to one other SNARE complex by one polypeptide helix.
- the multimer may be branched. This can be done, for example, by joining a synaptobrevin derived helix to two syntaxin derived helices in any order.
- synaptobrevin derived helix from this triple joined construct will attach to a syntaxin/SNAP derived tri-helical intermediate to form a SNARE complex with the two syntaxin derived helices left unbound.
- a SNAP derived helices are added, for example, SNAP-25
- two joint syntaxin/SNAP-25 intermediates will form.
- two joint SNARE complexes will form with two syntaxin derived helices protruding. This will seed two branches for further growth. Therefore, joining three helices allows branching (in contrast to two joint helices which are used for linear polymerization).
- one SNARE complex within the multimer will be attached to three other SNARE complexes to form a branch point rather than being attached to two other SNARE complexes, as in a linear chain.
- Three of the helices in the SNARE complex at the branch point will be attached to a helix in three different SNARE complexes.
- the multimer can have a cargo moiety attached to the end of each of the helices.
- the multimer may have a plurality of cargo moieties attached to the multimer at the end of the helices.
- the multimer may have a cargo moiety on each SNARE complex.
- the multimer may have a plurality of cargo moieties attached to each SNARE complex. If the multimer has a plurality of cargo moieties, these may be the same or different.
- the present invention also provides a method of producing a multimer, the method comprising the following steps: 1) providing a first polypeptide helix derived from a first SNARE helix;
- Steps 2) and 3) can be repeated as many times a necessary to produce a multimer of the required length.
- the above method refers to a first, second, third and fourth SNARE helix.
- the SNARE complex is formed from four helices. Two of these helices are provided by a SNAP protein, one is provided by syntaxin and one is provided by synaptobrevin or a homolog thereof. Therefore, in the above method, these four helices, in no particular order, are the first, second, third and fourth SNARE helices. This is because the identity of a particular helix is not important as long as the four helices are used in the SNARE complex.
- the SNARE complex may also be bound to complexin, as described above.
- the first helix is a syntaxin derived helix
- the second helix is a SNAP derived helix
- the third helix is a SNAP derived helix
- the fourth helix is a synaptobrevin derived helix
- the fifth helix is a syntaxin derived helix. Due to the fact that the four helices can be used in the SNARE complex in any order, the fifth polypeptide helix does not need to be derived from the same SNARE helix as the first polypeptide helix. Similarly, when forming the second, third, fourth, fifth, sixth, etc.
- the second, third and fourth polypeptide helices do not need to be derived from the same SNARE helix as the second, third and fourth polypeptide helices in the first SNARE complex.
- the only requirement is that all four SNARE helices are represented in each SNARE complex so that a stable SNARE complex forms.
- polypeptide helices in the first cycle of steps, one of the polypeptide helices derived from a SNAP protein could be a full length SNAP-25 helix whereas in the second cycle of steps, this polypeptide helix could be a SNAP-25 helix which is 45 amino acids in length.
- the important aspect is that both polypeptide helices are derived from the same SNARE helix, e.g. a particular SNAP helix, so that all four SNARE helices are represented in the SNARE complex.
- One or more cargo moiety is attached to the polypeptide helices so that the resulting multimer has a cargo moiety attached to it.
- This can be done by attaching a cargo moiety to the polypeptide helices before being used in the method.
- the cargo moiety is attached at the end of the polypeptide helix.
- a plurality of cargo moieties can be introduced into the multimer. This can be done by attaching a cargo moiety to a number of polypeptide helices which are then incorporated into the multimer using the above method.
- the cargo moieties may be the same or different.
- the identity of the first, second, third and fourth SNARE helices are maintained in the repeated steps. So, for example, if, in the first cycle of steps which produce the first SNARE complex, the first SNARE helix is syntaxin, the second and third SNARE helices are from a SNAP protein, and the fourth SNARE helix is synaptobrevin or a homolog thereof, in subsequent cycles of steps which produce further SNARE complexes, the first SNARE helix is always syntaxin, the second and third SNARE helices are always from a SNAP protein, and the fourth SNARE helix is always synaptobrevin or a homolog thereof.
- the identity of the second, third, fourth and fifth polypeptide helices are maintained in the repeated steps. So, for example, if, in the first cycle of steps which produce the first SNARE complex, the second and third SNARE helices are from a SNAP protein, the fourth SNARE helix is from a synaptobrevin
- the fifth polypeptide helix (which forms the first helix in the next SNARE complex) is always a syntaxin
- the second and third SNARE helices are always from SNAP-25
- the fourth SNARE helix is always a synaptobrevin SNARE helix.
- the second and third polypeptide helices are joined together so that they can assemble together in the same SNARE complex.
- the second and third polypeptide helices are a full length SNAP protein, e.g. SNAP-25.
- the first polypeptide helix is immobilised on a substrate.
- Suitable substrates are well known to those skilled in the art and are discussed above.
- the method may further comprise the step of washing after each binding step to remove any unbound helices. This ensures that these unbound helices cannot interfere with the formation of the multimer in subsequent steps.
- the multimer that is being formed by the method is immobilised before a washing step is used.
- the method may be modified to introduce a branch into the multimer.
- a sixth polypeptide helix derived from a first SNARE helix is joined to one of the second, third, fourth or fifth polypeptide helices to provide a helix upon which another stable SNARE complex can be formed.
- the sixth polypeptide helix is joined to the second or third polypeptide helices.
- the sixth polypeptide helix is joined to the fourth or fifth polypeptide helix. This allows two further SNARE complexes to originate from a particular SNARE complex, thereby introducing a branch in the multimer.
- a synaptobrevin derived helix can be joined to two syntaxin derived helices in any order, as discussed above.
- a syntaxin helix can be joined to SNAP-25 (being the second and third helix) to start the formation of a second SNARE complex from the originating SNARE complex, meaning that the originating SNARE complex will be attached to three other SNARE complexes overall to form a branch point.
- multiple branches can be introduced at a particular SNARE complex by introducing further helices in addition to the sixth helix which are joined to the other helices of the SNARE complex.
- a synaptobrevin derived helix can be joined to three or more syntaxin derived helices in any order.
- two or more syntaxin helices can be joined to SNAP-25 (being the second and third helix) to start the formation of a third, fourth, etc.
- SNARE complex from the originating SNARE complex meaning that the originating SNARE complex will be attached to four or more other SNARE complexes overall to form a multiple branch point.
- many branches as necessary can be introduced into the multimer at one particular point and over the length of the multimer.
- the present invention also provides a multimer produced by the above method.
- the multimer described above is useful in a large number of applications, for example, diagnostics and the applications described below:
- drug small molecules, nucleic acids, proteins
- multimeric compounds e.g. functional proteins, enzymes, factors, co-factors, (and any other functional proteins), FRET labels, multimeric inorganic compounds and small molecules, multimeric organic compounds;
- nanowires e.g. gold plated glass slides
- thin films e.g. gold plated glass slides
- wires e.g. nanowires
- nanotubes surface modifications e.g. nanotubes surface modifications.
- Figure 1 is a schematic representation of the molecular machinery which drives vesicle fusion in neurotransmitter release.
- the core SNARE complex is formed by four ⁇ -helices contributed by synaptobrevin, syntaxin and SNAP- 25.
- Synaptotagmin serves as a calcium sensor and regulates intimately SNARE zipping during vesicle fusion.
- Figure 2 is a schematic representation of linking of multiple functional units in an irreversible and site-specific manner as bundles or linear multimers. Arrows represent joining scaffold; functional units are represented by geometrical shapes.
- Figure 3A shows the four -helical SNARE bundle made of four polypeptides with length of at least 80 amino acids (Sutton et al., 1998).
- Fig. 3B shows SNARE motifs which were used for the design of 40 and 45 amino acid peptides. Shaded are hydrophobic layers, with the central layer highlighted in dark grey.
- Figure 4 is an SDS-PAGE gel showing that 45 amino acid polypeptides were able to form the irreversible SNARE complex (panel A), while 40 amino acids peptides did not (panel B).
- the inventors call this assembly TetriCS (Tetrahelical Combinatorial Scaffold).
- Figure 5 is a graph showing that streptavidin could bind 45 aa Tetrics peptides attached to either glutathione or Nickel beads in a highly specific manner.
- Figure 6 is a schematic representation of a 3 -component SNARE bundle comprising the full-length SNAP-25 molecule (amino acids 1-206) which has two SNARE helices and separate syntaxin and synaptobrevin SNARE helices.
- Figure 7 is an SDS-PAGE gel showing that both 40 (panel A) and 45aa (panel B) peptides can assemble with SNAP25B, demonstrating that in the 3 -component system, peptides of 40 aa length are sufficient for irreversible binding to full-length SNAP-25.
- Figure 8 is a graph showing that control reactions with GST-SNAP-25 alone on beads exhibited negligible binding, whereas addition of 40 aa syntaxin and synaptobrevin peptides, carrying Myc-tag and S-tag respectively, led to formation of 3 -component complex as evidenced by a robust binding of both anti-Myc antibody and S-protein to glutathione beads.
- Figure 9 is a sensogram showing binding of 40 aa syntaxin and synaptobrevin peptides to immobilized SNAP25B.
- Anti-myc antibody (Myc) binds to the syntaxin-myc epitope but can be eluted with 0.1% SDS. Bound syntaxin/synaptobrevin peptides cannot be dissociated by SDS.
- Figure 10 is a schematic representation of a 2-component SNARE bundle comprising a SNAP-25 molecule, which has two SNARE helices, and a syntaxin/synaptobrevin fusion protein.
- Figure 11 is a schematic representation showing the linkage of the rat syntaxinlA SNARE motif (amino acids 195- 254) with the rat synaptobrevin2 SNARE motif (aa 25-84) as illustrated by grey arrows.
- Figure 12 is an SDS-PAGE gel showing that a syntaxin3-synaptobrevin2 fusion protein and rat SNAP-25B quickly assemble into an irreversible complex.
- Figure 13 is a schematic representation showing the head domain and the SNARE motif of rat syntaxin3 (amino acids 1-260) fused via a short stretch of amino acids to rat synaptobrevin2 sequence 1-84.
- Figure 14A is an SDS-PAGE gel showing that octylglucopyranoside can 'open' the syntaxin 3 molecule to allow a 2-component assembly to form.
- Figure 14B is an SDS-PAGE gel showing that octylglucopyranoside detergent promotes the assembly of a tight SNARE complex at concentrations above CMC (critical micellar concentration - for this detergent, the CMC is 0.6%). Some assembly does take place in the absence of the detergent, but efficient assembly requires the detergent octylglucopyranoside to 'open' the syntaxin 3 molecule to allow a 2-component assembly to form.
- Figure 15 is a Surface Plasmon Resonance Sensogram showing binding of syntaxin-synaptobrevin fusion protein (*) and the unique resistance of the assembly between the syntaxin/synaptobrevin fusion protein and SNAP-25 immobilized on the CM5 chip. Washes using 2M NaCl (1), glycine pH 2.5 (2), 1% SDS (3), 0.1 M NaOH (4), 0.1 M phosphoric acid (5) cannot break the binary capture reagent. Note, step 3 was repeated twice.
- Figure 16A is a schematic representation of a 2-component SNARE bundle comprising a three-helical molecule (black) and a forth helix (grey).
- Figure 16B is an SDS-PAGE gel showing that both 40 and 45aa syntaxin IA peptides can assemble with the three- helical fusion protein composed of SNAP-25B and synaptobrevin 2 (SNAP-25B(22-206)/Syb2(l-84)) demonstrating that in a two- component system, peptides of 40 aa length are sufficient for irreversible SNARE complex formation.
- the SDS-resistant complex migrates faster than the tri-helical protein in the SDS-gel, possibly due to its compact structure.
- Figure 17 is an SDS-PAGE gel showing that GST-SNAP-25 can bind to the Sepharose beads carrying syntaxin3/synaptobrevin2 fusion protein in a highly specific manner.
- the syntaxin3/synaptobrevin2 fusion protein is covalently attached to BrCN-Sepharose beads and therefore cannot be eluted and visualised on the SDS_PAGE gel.
- lane 1 - bacterial extract produced using zwitergent 3-08.
- lane 2 - GST-SNAP-25 purified on beads carrying syntaxin3/synaptobrevin2 fusion protein.
- Figure 18 is a schematic representation of a supramolecular device in the form of strong linear multimers of unlimited length formed by SNARE proteins.
- Figure 19 is a schematic representation of the process of forming a long linear multimer using SNARE proteins.
- FIG. 20 (A) Coomassie-stained gel showing a step-wise increase in the amounts of both syntaxin3- synaptobrevin2 fusion and SNAP-25 bound to beads. Note, while the amount of GST-syntaxin3, used for attachment to beads, remains constant there is a gradual increase in the amounts of bound SNAP-25 and syntaxin3- synaptobrevin2 fusion protein. To show the amounts of bound material, the samples were boiled to disrupt SDS- resistant nature of the assemblies. (B) As in panel A, but samples were not boiled prior to SDS-PAGE. Note the increase in the molecular weight of SDS-resistant polymers in line with extra polymerization steps.
- Figure 21 is a schematic representation of a branched multimer formed from SNARE proteins.
- Figure 22 is a schematic representation of a fusion construct formed from syntaxin3 residues (1-253) directly fused to synaptobrevin2 residues (29-84) (no linker).
- Figure 23 is a SDS-PAGE gel showing that SNARE bundles can be multimerised in solution by simple mixing.
- Figure 24 shows that SNARE tagging allows He-mediated delivery of quantum dots to synaptic endings
- a Schematic showing SNARE linking of the LcHN part with the Hc part of BoNT/A. The individual subunits are shown as in the structural model (adapted from Lacy et al, 1998).
- b Schematic showing the SNARE tagging scheme for linking streptavidin-coated quantum dot with the SV2C-binding part of botulinum neurotoxin (Hc). Biotin(star)- syntaxin peptide (blue) allows SNARE-tagging of the quantum dot, whereas Hc is fused to synaptobrevin SNARE motif (purple).
- SNAP25 (green and red) allows linking of Q-dot to Hc.
- c Coomassie-stained SDS-gel showing an irreversible assembly of Hc-synaptobrevin, SNAP25 and biotinylated syntaxin3 peptide into an SDS-resistant complex, Hc-SNARE-biotin.
- d Hc-SNARE-Q-dots exhibit synaptic binding as evidenced by the immunostaining for the synaptic vesicle marker synaptophysin at axonal extensions of cultured hippocampal neurons. Omission of SNAP25 during assembly prevents targeting of Q-dots to synaptic terminals.
- Figure 25 shows that SNARE tagging allows a step-wise assembly of individual parts of BoNT/A into a single molecular entity
- a Diagram showing the position of the disulphide bond and SNARE tagging of LcHN and the Hc part of BoNT/A.
- b LcHN, tagged with SNAP25, can be purified and broken into Lc and HN-SNAP25 following treatment with 50 mM dithiotreitol (DTT). Coomassie-stained SDS-gel.
- c, LcHN, tagged with SNAP25 can be united with Hc, tagged with synaptobrevin, upon addition of the syntaxin3 peptide as evidenced by the Coomassie- stained and fluorescently-imaged SDS-gels.
- Figure 26 shows that SNARE-linked botulinum neurotoxin exhibits synaptic localization and cleaves its intrasynaptic target
- a Fluorescein-labelled LcHN-SNARE-Hc binds to axonal extensions of hippocampal neurons.
- Immunostaining with anti-synaptophysin antibody highlights presynaptic terminals of cultured hippocampal neurons
- b Immunoblot showing cleavage of intrasynaptic SNAP25 by the assembled neurotoxin in a similar fashion as the native BoNT/A.
- Figure 27 shows that SNARE-linked botulinum neurotoxin inhibits neurotransmitter release, a, Fluorometric measurements of glutamate release from isolated rat brain synaptic endings (synaptosomes) indicate a similar degree of inhibition between LcHN- SNARE-Hc and BoNT/A.
- Figure 28 shows LcHn was tagged by syntaxin3 (195-253) whereas Hc was tagged by synaptobrevin (25-84).
- the two botulinum parts were mixed in the presence of SNAP-25 and the toxin formation was visualised on Coomassie- stained SDS-gel.
- Figure 29 shows blockade of glutamate release from rat brain synaptosomes was assessed after 1 hour incubation with LcHnSyx3-SNAP25-synaptobrevinHc toxin from panel A.
- Figure 30 shows cleavage of intraneuronal target of the catalytic part Lc after application of toxin LcHnSyx3- SNAP25-synaptobrevinHcA from panel A on hippocampal neurons was assessed by immunoblotting using anti- SNAP-25 antibody.
- the reassembled toxin has similar activity in cleaving SNAP-25 as the native botulinum neurotoxin (BoNT/A).
- BoNT/A botulinum neurotoxin
- LcHnSyx3-SNAP25-synaptobrevinHcA is more efficient than LcHnSyx3-SNAP25- synaptobrevinHcD in this neuronal assay.
- Figure 31 shows SNARE tagging of synaptobrevin 40 amino acid motif with somatostatin peptide
- somatostatin peptide Ac- RLQQTQAQVDEWDIMRVNVDKVLERDQKLSELDDRADAL-Ahx-Ahx-AGCKNFFWKTFTSC-OH allows making of somatostatin-quantum dots. Streptavidin-coated quantum dots were incubated with biotynylated syntaxin peptide and then mixed with somatotostatin-synaptobrevin and SNAP-25.
- the assembled somatostatin-Q-dots were applied on cultured hippocampal neurons and their entry into neuronal somas was visualised by fluorescence of Q- dots and counterstaining with anti-SNAP-25 antibody which labels the abundant intraneuronal protein.
- Figure 32 shows SNARE tagging of synaptobrevin 40 amino acid motif with somatostatin peptide allows making of functional somatostatin-botulinum construct after mixing with LcHnsyntaxin3 and SNAP-25.
- the activity of the LcHnsyntaxin3-SNAP25-synaptobrevinSomatostatin (SS-LcHN) was assessed by cleavage of SNAP-25 in cultured hippocampal neurons after 20 hour application of the assembled toxin.
- Figure 33 is an SDS-gel showing formation of stable SDS-resistant complexes using SNARE motifs with N- terminal truncation.
- Figure 34 is an SDS-gel showing formation of stable SDS-resistant complexes using SNARE motifs with C-terminal truncation.
- Figure 35 is an SDS-gel showing formation of stable SDS-resistant complexes using a syntaxin SNARE peptide in which the internal methionines have been replaced with non-oxidizable norleucines.
- Figure 36 is a number of SDS-gels showing formation of stable SDS-resistant complexes using a variety of different SNARE peptides.
- Figure 37 is an SDS-gel showing formation of stable SDS-resistant complexes using three shortened SNARE peptides.
- Figure 38 is an SDS-gel showing formation of stable SDS-resistant complexes using three shortened SNARE peptides.
- Figure 39 is an SDS-gel showing formation of stable SDS-resistant complexes using three shortened SNARE peptides.
- Figure 40 is an SDS-gel showing formation of stable SDS-resistant complexes when a neuropeptide is complexed to one of the SNARE peptides.
- Figure 41 is an SDS-gel showing formation of stable SDS-resistant complexes when arginine/vasopressin peptide (AVP) is complexed to the N-terminus or C-terminus of the syntaxin peptide.
- AVP arginine/vasopressin peptide
- Figure 42 is an SDS-gel showing formation of stable complexes using SNARE peptides containing less than 40 amino acids.
- Figure 43 is an SDS-gel showing maleimide-based cross linking of a protein to the SNARE peptides.
- Figure 44 is a chart showing absorbance at 650nm for the TMB (3,3',5,5'-tetramethylbenzidine) substrate.
- Figure 45 is a portion of a film showing luminescence.
- Bundle- or linear-shaped scaffolds made of SNARE-derived polypeptides for controlled, irreversible, non- chemical linking of functional units.
- the inventors have developed a method for linking functional or structural units by simple mixing. Generation of well-defined, functional supramolecular architectures of nanometric size through self-assembly provide means for performing programmed engineering in life biosciences, medicine and nanotechnologies. Specifically, the invention relates to the unmet need for a controlled linking of multiple functional units in an irreversible and site-specific manner as bundles or linear multimers as depicted in Figure 2.
- SNARE proteins for linking protein domains, and in fact any conceivable chemical entities.
- these proteins drive fusion of vesicles to the plasma membrane by forming a tripartite complex composed of syntaxin, SNAP-25 and synaptobrevin (also known as VAMP - vesicle-associated membrane protein).
- This SNARE complex is a 4-helical coiled-coil bundle comprising two helices from SNAP-25, one helix from syntaxin and one helix from synaptobrevin (Fig. 3); the length of each helix being ⁇ 60-70 amino acids (Jahn and Scheller (2006)).
- This 4-helical bundle is unusually stable, even in SDS - a direct indication of the irreversible nature of SNARE assembly (Hu, K et al., 2002).
- coiled coils have attracted considerable interest as design templates for oligomerization in a wide range of applications including protein engineering, biotechnological, biomaterial, basic research and medicine (Engel and Kammerer, 2000; O'Shea et al., 1993; Scherr et al., 2007).
- useful oligomerization domains are the leucine zipper of GCN4 comprised of 33 residues which form a parallel coiled coil homodimer and 46 residue- homopentameric coiled coil COMPcc (Engel and Kammerer, 2000).
- a coiled coil for various applications depends on several characteristics: the length of the coiled coil polypeptides, their solubility, their ability to allow homo- or hetero-oligomerization; and the strength of the coiled coil, i.e. ability to withstand dissociation in normal and adverse conditions.
- the unique properties of the SNARE coiled-coil bundle such as hetero-tetramerization and the irreversible nature of SNARE assembly have not been considered yet for exploitation.
- the core idea of using the SNARE bundle relates to the means of producing diagnostic/therapeutic/biotechnological protein which must carry a combination of different cargoes (fluorescent, radioactive, immune, chemical, affinity, etc.).
- the inventors have proposed using engineered polypeptides, based on the syntaxin, SNAP-25 and synaptobrevin proteins, for production of well- defined, organised heterotetrameric supramolecular architectures capable of self-assembly from distinct individual components.
- the inventors first define the minimal core for the 4- and 3-component bundles; second, the inventors describe a 2-component capture system for irreversible binding; and, third, the inventors show the usefulness of the SNARE bundle to produce linear multimers.
- shortened SNARE helices can be used for assembly of functional units as a 4-component bundle.
- Use of shortened SNARE helices is essential for attachment of chemical entities to the SNARE peptides via a synthetic route.
- peptide synthesis is sufficiently reliable and financially feasible for ⁇ 50 amino acids. Therefore, it would be advantageous if SNARE helices are shortened allowing attachment of further peptide sequences or other chemical entities. It is known that shortening of a single SNARE motif can lead to disruption of irreversible SNARE assembly (Hao et al., 1997).
- the inventors have found that (1) truncation of all four helices to 45 amino acid peptides still allows a stable tetrahelical complex, and (2) various functional groups can be added to either terminus of these peptides. This allows a simple fabrication of multivalent complexes in a bundle for a variety of uses, including affinity reagents and kits, or multivalent therapeutics (where display of an array of ligands, or multimerisation of receptors, is desired).
- the free ends of the 4 distinct helices can be used for attachment, by synthetic or recombinant means, of up to 8 distinct entities in desirable spatial combinations.
- the inventors call the irreversible heterooligomeric protein complex - tetrahelical combinatorial scaffold (TetriCS).
- TetriCS peptides containing either 40 or 45 amino acids.
- Rat SNAP25A Helix 1 (amino acids 28-67) with biotin:
- Rat SNAP25A Helix 2 (amino acids 149-188) with 6-Histidine tag:
- Rat Synaptobrevin-2 (amino acids 31-70) with the S-tag epitope for monoclonal antibody recognition:
- Rat SNAP25A Helix 1 (amino acids 28-72) with biotin:
- biotin-STRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKC SEQ ID NO. 5
- Rat SNAP25A Helix 2 (amino acids 149-193) with a cysteine and 6-Histidine tag:
- Rat SyntaxinlA (amino acids 201-245) with an N-terminal antibody epitope and a cysteine:
- the functionality of the assembly was tested in pull-down experiments.
- the inventors used GST-tagged synaptobrevin (45 amino acid SNARE sequence, produced recombinantly in bacteria), biotin chemically linked to Helix 1 of SNAP-25 and 6-Histidine tag linked to Helix 2 of SNAP-25 as functional units.
- the inventors tested binding of the TetriCS assembly to glutathione beads (for GST binding) or Nickel beads (for binding the 6-Histidine tag) followed by binding of fluorescent streptavidin (for binding to biotin).
- Fig. 5 shows that streptavidin could bind 45 aa TetriCS attached to either glutathione or Nickel beads in a highly specific manner.
- TetriCS allows the development of functional supramolecular devices, defined as structurally organised and functionally integrated systems built from suitably designed molecular components performing a given action (Lehn, 2007).
- Fig. 7 shows that both 40 (panel A) and 45aa (panel B) peptides can assemble with SNAP25B, demonstrating that in the 3-component system, peptides of 40 aa length are sufficient for irreversible binding to full-length SNAP-25.
- EIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHA-GSGEQKLISEEDLC (SEQ ID NO. 9)
- Synthetic synaptobrevin-S-tag peptide (40 amino acids synaptobrevin sequence in bold)
- RLQQTQAQVDEWDIMRVNVDKVLERDQKLSELDDRADAL-GSKETAAAKFERQHMDS (SEQ ID NO. 9)
- the inventors next used Surface Plasmon Resonance technique to test the ability of the 40aa 3 -component TetriCS to withstand harsh treatment.
- the inventors chemically attached GST-tagged SNAP-25B to the Biacore CM5 chip, followed by binding of the 40 aa syntaxin and synaptobrevin peptides and then of the antibody.
- Fig. 9 shows that the binding of peptides is stable and allows attachment of anti-myc antibody to the surface of the chip. Addition of 0.1% SDS removed the antibody but not the peptides from the immobilised SNAP-25.
- Example 3 2-component bundle
- the inventors also simplified the irreversible SNARE assembly to a 2-component system.
- Two-component affinity- based tools underlie all basic research and are invaluable in the development of drugs and diagnostics (Uhlen, 2008).
- Applications include affinity chromatography, microarray technologies, microplate-based screens and many biotechnology processes.
- the main factor underlying successful outcome of these applications relies on a firm, irreversible immobilization of a protein in a defined orientation on either a solid surface or three-dimensional matrix.
- Several recent reviews highlighted a number of disadvantages of existing immobilization technologies (Kohn, 2009; Tomizaki et al., 2005).
- the inventors used a de-novo designed syntaxin/synaptobrevin fusion protein together with the 2-helical SNAP-25 (see Fig 10).
- the inventors linked rat syntaxinlA SNARE motif (amino acids 195-254) with the rat synaptobrevin2 SNARE motif (aa 25-84) as illustrated in Figure 11.
- the short stretch of amino acids between the syntaxin and synaptobrevin sequences (GILDSMGRLELKL (SEQ ID NO. 10), a small arrow) is due to a multiple cloning site in the hybrid plasmid.
- the inventors purified the fusion protein but found that it had a tendency to aggregate via the syntaxin 1 motif preventing formation of SNARE complexes with SNAP-25.
- the inventors produced a fusion of rat syntaxin3 with synaptobrevin2.
- the inventors fused the SNARE motif of rat syntaxin3 (amino acids 195-253) via a short stretch of amino acids to rat synaptobrevin2 sequence 1-84.
- the short stretch of amino acids between the syntaxin and synaptobrevin sequences (GILDSMGRLELKL) is due to a multiple cloning site in the hybrid plasmid allowing insertion of functional units between syntaxin3 and synaptobrevin2.
- this syntaxin3-synaptobrevin2 fusion protein quickly assembled into an irreversible complex as illustrated in Fig. 12.
- rat syntaxin3 amino acids 1 - 260 fused via a short stretch of amino acids to rat synaptobrevin2 sequence 1-84 (see Fig 13).
- the short stretch of amino acids between the syntaxin and synaptobrevin sequences (GILDSMGRLELKL (SEQ ID NO. 10)) is due to a multiple cloning site in the hybrid plasmid allowing insertion of functional units between syntaxin3 and synaptobrevin2.
- the inventors have also found that other detergents or similar lipid compounds have the same effect, such as MEGA 8, C-HEGA 10, C-HEGA 11, HEGA 9, heptylglucopyranoside, octylglucopyranoside, nonylglucopyranoside, zwittergent 3-08, zwittergent 3-10 and zwittergent 3-12.
- the inventors have produced a binary affinity reagent with one small tag in which a short syntaxin helix ( ⁇ 5 kDa) can bind irreversibly to a de novo-designed tri-helical SNARE fusion protein (-27-31 kDa) represented schematically in Fig. 16A.
- a short syntaxin helix ⁇ 5 kDa
- a de novo-designed tri-helical SNARE fusion protein represented schematically in Fig. 16A.
- the inventors fused the two SNAP-25 SNARE helices (22-206 amino acids) to the SNARE motif of synaptobrevin2 sequence 1-84.
- the linker GSGSEQKLISEEDLG SEQ ID NO. 11 between the SNAP-25 and synaptobrevin sequences carries a myc-tag epitope.
- the tri-helical fusion protein When mixed with syntaxin 40 or 45 amino acids peptides, described earlier, the tri-helical fusion protein quickly assembled into an irreversible complex as illustrated in Fig. 16B.
- These two-component systems are useful alternatives to current affinity tags (Terpe, 2003).
- Both tags in the binary capture systems can be expressed in bacteria and easily added, in a site-specific manner, to any protein for recombinant production - this is different from biotin/streptavidin or similar very high affinity systems (biotin can not be expressed as part of the protein).
- Fast capture from highly diluted solutions is now possible due to the irreversible nature of the binary affinity reagents - no other such system currently exists.
- either of the tags in the binary system can be chemically linked to surfaces of beads, chips, microarray plates, and modified by chemical or recombinant introduction of functional groups.
- the inventors first immobilized to BrCN-Sepharose beads the two-helical fusion protein containing the SNARE motif of rat syntaxin3 (amino acids 195-253) fused via a short stretch of amino acids to rat synaptobrevin2 sequence 1-84
- GST glutathione-S-transferase
- Fig. 17 shows that GST-SNAP-25 can bind to the Sepharose beads carrying syntaxin3/synaptobrevin2 fusion protein in a highly specific manner.
- SNARE proteins In addition to attaching multiple groups in a bundled fashion, SNARE proteins also offer a possibility of producing advanced supramolecular devices in the form of strong linear multimers of unlimited length as depicted in Figure 18.
- the inventors' assembly represents a unique approach in which biomaterials are assembled molecule by molecule to produce novel linear supramolecular architectures (for overview of possible applications (Hinman et al., 2000; Lehn, 2007; Ryadnov and Woolfson, 2003; Zhang, 2003)).
- the inventors used the syntaxin3-synaptobrevin2 fusion protein described above for the 2-component system (rat syntaxin 3 (amino acids 1-260) fused via a short stretch of amino acids to rat synaptobrevin2 sequence 1- 84).
- the inventors instead of mixing SNAP-25 and the syntaxin3-synaptobrevin2 fusion in solution, the inventors used a solid support with a single syntaxin3 polypeptide with the head domain (amino acids 1-260 fused to GST) to initiate the polymerization reaction. The inventors first immobilized the GST-syntaxin3 molecule alone on glutathione beads via a GST tag.
- Figure 2OA shows the step-wise increase in the amounts of both syntaxin3-synaptobrevin2 fusion and SNAP-25 over the course of the above process. While the amount of GST-syntaxin3, used for attachment to beads, remains constant there is a gradual increase in the amounts of bound SNAP-25 and syntaxin3-synaptobrevin2 fusion protein. To show the amounts of bound material, the samples were boiled to disrupt SDS-resistant nature of the assemblies.
- Figure 2OB shows the increase in the molecular weight of SDS-resistant polymers in line with extra polymerization steps as the samples were not boiled prior to SDS-PAGE.
- SNAP-25 and syntaxin3-synaptobrevin represent building blocks for controlled fabrication of diverse molecular structures.
- Applications include fabrication of functionalised nanofibers, multiple ligand mcroarrays, supermolecular enzyme assemblies, new electronic devices and biomaterials for use in biotechnology and medicine (for overview of possible applications (Zhang, 2003)).
- the 2-component system described above also allows multimerization in solution, which presents a way to link 1 to 4 protein functional domains in a linear fashion.
- the protein-based fabrication of fully SDS- resistant linear polymers can be used for creation of biodegradable fibres with properties superior to silk spider multi-component assemblies or current coiled-coil nanofibers.
- Example 5 SNARE tagging allows a step-wise assembly of botulinum neurotoxins
- Fusing the receptor-binding domain with synaptobrevin SNARE motif allowed delivery of the active part of botulinum neurotoxin, tagged with SNAP25, into neurons.
- the data show that SNARE-tagged toxin was able to cleave its intra-neuronal molecular target and inhibit release of neurotransmitters.
- SNARE Soluble N-ethylmaleimide sensitive factor Attachment protein REceptor
- the four SNARE motifs are 55 amino acids long carrying eight characteristic heptade repeats.
- the brain SNARE complex is extraordinary in its stability exhibiting resistance to chaotropic agents, strong detergents, proteases and elevated temperatures.
- the inventors decided to investigate whether fusing the SNAREs to recombinant proteins would allow a controlled building of a supramolecular entity.
- Botulinum NeuroToxin type A (BoNT/ A) has proven to be of great medical importance due to its ability to cause a very long neuromuscular paralysis upon local injections of minute amounts (1 pM concentration) (Montecucco, C. et al. (2009)).
- BoNT/A is a 150 kDa protein consisting of three main modules: 50 kDa catalytic part (Light chain, Lc) which is joined via a disulphide bridge to so-called Heavy chain which in turn made of the N-terminal 50 kDa translocation part (HN) and the C-terminal 50 kDa part (Hc), the latter being responsible for recognition of neuronal gangliosides and synaptic vesicle receptor, SV2C (Mahrhold, S. et al. (2006) & Dong, M. et al. (2006)).
- the three main modules can be recognized as separate structural units in an X-ray model (adapted from Lacy et al. (1998), Fig. 24a).
- the inventors first fused the SV2 -binding part (Hc) to synaptobrevin (Fig. 24b) and tested whether this fusion can deliver quantum dots (Q-dots) into neuronal endings.
- the Hc-synaptobrevin fusion was able to form the SNARE complex with SNAP25 and a 52 amino acid syntaxin3 peptide labelled with biotin for binding to streptavidin-coated Q-dots.
- the targeting part of BoNT/ A is still capable of recognizing its synaptic receptor and can deliver a large cargo following recombinant fusion with a SNARE tag.
- the inventors prepared a fusion of the enzymatic part, translocating part and SNAP25 (Fig. 25a).
- a thrombin cleavage instead of the native trypsin-sensitive site
- Lc enzymatic
- HN translocating parts
- the fluorescent molecule colocalised to a significant degree with the vesicular marker synaptophysin indicating its binding to the native target of the
- Fig. 27c shows that LcHN- SNARE-Hc paralysed the diaphragm muscle at subnanomolar concentrations (190 pM) within 72 min. No paralysis was observed in the absence of the linking syntaxin peptide (data not shown).
- BoNT/A commonly known as BOTOX
- the efficiency of the LcHN-SNARE-Hc in blocking neuromuscular junctions was less than the native BoNT/A (Mahrhold, S. et al. (2006)), this can be explained by either reduced ability of the extended toxin to reach distant active zones within long neuromuscular junctions or due to a large volume of the presynaptic ending at the diaphragm muscle leading to a compromised efficiency.
- SNARE- tagged Hc part it is also possible to utilize the SNARE- tagged Hc part to deliver imaging agents and future therapeutics by tagging them with SNARE counterparts (Binz, T et al. (2009)). Further, it is possible to oligomerise Hc part for eliciting a stronger immune response when producing anti-botulinum serum (Webb, R. P. et al. (2007)).
- the SNARE tagging of the LcHN part will also allow an easy- retargeting of the active portion of BoNT/A to specific neuroendocrine cells (Dolly, J. O. et al. (2009)). Here one can target neuropeptide or growth factor receptors by making corresponding SNARE-tagged ligands.
- Such SNARE tagging can allow a convenient combinatorial mixing of various functional units with the aim of finding the most beneficial combination(s) to silence specific subsets of neurons (Foster, K. A. (2009)).
- LcHN-SNAP25 The plasmid for expression of LcHN-SNAP25 was generated as follows: cDNA of BoNT/A Lc (amino acids 1-449) was amplified by PCR and inserted into Smal and EcoRI restrictions sites in the pGEX-KG vector (Guan, K. L. et al. (1991)). The codon optimised cDNA of BoNT/A translocation domain HN (amino acids 450-872, from ATG Biosynthetics, Germany) was inserted at the 3' end of light chain.
- the thrombin cleavage site (amino acids LVPRGS (SEQ ID NO. 16)) was inserted between the light chain and the translocation domain of BoNT/A.
- the cDNA of rat SNAP25B (aa 1-206) was inserted at the 3' end of HN.
- the plasmid allowing expression of Hc-Syb was generated as follows: cDNA of rat synaptobrevin (amino acids 25-84) was amplified by PCR and inserted into pGEX-KG vector between BamHI and EcoRI sites.
- the cDNA of the BoNT/A heavy chain (amino acids 876-1296) was amplified by PCR and inserted at the 3' end of synaptobrevin.
- a peptide of the syntaxin3 SNARE motif (amino acids 200-250) was synthesized chemically with either biotin or fluorescein (Peptide Synthetics, UK). Proteins fused to GST were purified on glutathione Sepharose beads (GE Healhcare, USA) and eluted from beads in 20 mM Hepes, pH 7.3, 100 mM NaCl using thrombin. The supramolecular complexes were assembled by mixing the SNARE-tagged proteins with the syntaxin peptide for 1 hr at 22 0 C.
- Mouse anti-synaptophysin antibody (clone 7.2) was from Synaptic Systems, and mouse anti-SNAP25 antibody (clone SMI81) was from Sternberger Monoclonals. Streptavidin- conjugated Q-dots 525 were from Invitrogen. Primary cultures of hippocampal neurons were prepared as described (Darios, F. et al. (2009)) and used after 7-10 days in vitro. Neurons were exposed to SNARE-tagged, or native toxin, for 2 hours, fixed with 4% PFA and then immunostained with anti-synaptophysin antibody.
- neurons were incubated for 20 hours with assembled toxin or native BoNT/A, lysed in 60 mM Tris, pH 6.8, 2 mM MgCL 2 , 2% SDS, benzonase (Novagen, 250 U/ml) and then SNAP25 cleavage was analysed by immunobloting using an anti-SNAP25 antibody.
- Rat brain synaptosomes were freshly isolated as described (Darios, F. et al. (2009)). Synaptosomes (0.5 mg/ml of proteins) were incubated in buffer A (in mM, 132 NaCl, 5 KCl, 20 HEPES, 1.2 NaH 2 PO 4 , 1.3 MgCl 2 , 0.15 Na 2 EGTA, 1 MgSO 4 , 5 NaHCO 3 , 10 D-glucose) with LcHN-SNARE-Hc at indicated concentrations for 1 hr at 37°C.
- buffer A in mM, 132 NaCl, 5 KCl, 20 HEPES, 1.2 NaH 2 PO 4 , 1.3 MgCl 2 , 0.15 Na 2 EGTA, 1 MgSO 4 , 5 NaHCO 3 , 10 D-glucose
- the phrenic nerve was continuously stimulated at 5-25 niA with a frequency of 1 Hz, 0.1 ms pulse duration. Isometric contractions were transformed using a force transducer and recorded with VitroDat Online software (FMI GmbH). The time required to decrease the amplitude to 50 % of the starting value (paralytic half- time) was determined. Additional Information
- Botulinum neurotoxins are the most potent toxins designed by nature. These toxins are produced by Clostridium bacteria to cause long-lasting paralysis and death. Over the last 30 years, some members of the botulinum family, e.g. botulinum neurotoxin type A (BoNT/ A) also known as BOTOX, have been successfully exploited for medicinal and cosmetic purposes. These toxins silence neuromuscular junctions and also can block neurotransmitter release from many types of neurons. Practically every part of the human body, with the exception of the brain, can be treated by BOTOX. Since the paralysis of neuromuscular junctions is reversible, the sustained relaxation of muscles requires repeat injections every three to four months.
- BoNT/ A botulinum neurotoxin type A
- BoNT/A can block innervation of not only striated muscles but also of smooth muscles. Furthermore, the cholinergic junctions of the autonomous nervous system that control sweating, salivation and other types of secretion are as sensitive to BOTOX as are the neuromuscular junctions. Therefore, BOTOX-based treatments have recently expanded to include a dazzling array of nearly a hundred conditions from dystonias to gastrointestinal and urinary disorders.
- BoNT/A has the longest paralysing effect among the seven immunologically distinct serotypes of BoNTs (A-G), thus underpinning the usefulness of specifically BoNT/A in the treatment of neurological disorders.
- All BoNTs are synthesised by the bacteria as single polypeptide chains with a molecular mass of 150 kDa. Following bacterial death and lysis, the toxins are 'nicked' by bacterial proteases to yield the 50 kDa light and the 100 kDa heavy chains that are kept together by a disulphide bond. The two chains, still linked through the disulphide bond, traverse the intestinal epithelial cells by transcytosis, enter the bloodstream and eventually bind to peripheral cholinergic nerve terminals.
- BoNTs The extreme toxicity of BoNTs indicates that the peripheral nerve endings carry molecules that can serve as BoNTs' high-affinity receptors. Indeed, several synaptic vesicle proteins have been shown to act as receptors for BoNTs. While the heavy chains are responsible for BoNTs' binding to nerve terminals, the light chains are potent endopeptidases that attack the vesicle fusion machinery and therefore have to get inside the nerve terminal. BoNTs accomplish this task by hijacking the vesicle endocytosis route. As the pH of the recycling vesicle's interior drops, the BoNTs undergo major conformational changes.
- translocating part (known as FIN) of the heavy chains to form putative channels across the vesicular membrane through which the partially unfolded light chains slip into the cytosol.
- FIN translocating part
- BoNT light chains are potent endopeptidases that attack a number of isoforms of the three SNARE proteins that mediate vesicle fusion and therefore neurotransmitter release. It is now known that BoNT/A and BoNT/E proteolyse
- BoNTs B, D, F and G cleave VAMP on the synaptic vesicles.
- SNAP-25 shortened by only nine amino acids by BoNT/A retains its ability to interact with the plasma membrane syntaxin and vesicular synaptobrevin but cannot mediate the normal vesicle fusion process.
- BoNTs botulinum neurotoxins
- BoNTs can stop the neurotransmitter release of not only acetylcholine but also glutamate, glycine, noradrenaline, dopamine, serotonin, ATP and various neuropeptides (Ashton et al. (1988), Capogna, M. et al. (1997), Sanchez-Prieto, J. et al. (1987), Verderio, C.
- BoNTs are naturally delivered by their partner heavy chains, but alternative means of delivery, such as liposomes or recombinant fusion constructs, are also effective (de Paiva, A. et al. (1990), Chaddock, J. A. et al. (2004), and Duggan, MJ. et al. (2002)). Recombinant chimeras of lectins with the BoNT/A light chain recently allowed delivery of the latter into nociceptive afferents or dorsal root ganglia (Chaddock, J.A. et al. (2004)).
- the delivery efficiency can be easily tracked if the light chain is fused to a GFP fluorescent tag, allowing marking of the silenced cells.
- the ability of the heavy chains of BoNTs to target synapses and transport their light chains into the nerve terminal offers another tool that can be utilised in neurobiology (Goodnough, M.C. et al. (2002) and Bade, S. et al. (2004)). Delivery of various molecules, especially enzymes, using BoNT heavy chains may be feasible for manipulation of synapse physiology. Indeed, it has recently been demonstrated that BoNT/D can deliver recombinantly attached enzymes into the nerve terminals (Bade, S. et al. (2004)).
- the inventors have shown that it is possible to obtain a functional botulinum neurotoxin by recombining the toxin from two parts:
- Receptor-binding part of the heavy chain (HC part) which carries on its N-terminus a SNARE tag (syntaxin, SNAP- 25 or synaptobrevin).
- SNARE tags allow irreversible linking of functional units.
- LCHN and HC can be produced separately in a protein-producing bacterial strain without health risks. Each part can be purified in a safe way. When the two parts are mixed they produce within 1 hour an active neurotoxin which can cleave its molecular target SNAP-25 in exposed neurons and also block neurotransmitter release from nerve endings. Since the LCHN part with a SNARE tag is functional (i.e. SNAP-25 neuronal cleavage and a blockade of neurotransmitter release is observed), it is possible to direct this active part to specific neurons or endocrine cells by adding a ligand with a SNARE tag for irreversible assembly of LCHN/ligand moiety.
- somatostatin peptide linked to a SNARE tag Binding of the ligand to the intended cells can result in the transport of LCHN into the cell with subsequent release of the light chain and therefore SNAP-25 damage with subsequent halt in neurotransmitter or hormone release.
- the HC part with a SNARE tag is functional (i.e. observation of a blockade of neurotransmitter release after attachment of LCHN/SNARE tagged), it is possible to use the SNARE tagged HC part for delivery of other enzymatic or imaging moieties into neurons. It is also possible to use other receptor-binding compounds (e.g. somatostatin neuropeptide) with a SNARE tag to deliver drugs, imaging reagents, etc. into specific cells that carry necessary receptors.
- receptor-binding compounds e.g. somatostatin neuropeptide
- Proteins were eluted in 20 mM Hepes, pH 7.3 , 100 mM NaCl from beads using thrombin.
- BoNT/A Hc 876-1296
- 0.8% octylglucoside was present in the elution buffer.
- LcHN-SNAP25 BoNT/A Lc(I -449) Thrombin HN(449-872)-SNAP25B (C to A) - SEQ ID NO. 18
- LcHN-Syb BoNT/A Lc(I -449) Thrombin HN(449-872)-Syb2 (1-96; WWK-AAA) - SEQ ID NO. 20
- Syx3 peptide (45aa, 52 aa-FITC)
- the inventors mixed for 1 hr the active part fused to one SNARE protein (LcHN-Syx, LcHN SNAP25 or LcHN-Syb) with the receptor binding part containing a second SNARE protein.
- the assembly was locked by the addition of the third SNARE partner. Examples of combinations are given in the table:
- Figure 33 shows that the synaptobrevin SNARE motif can be reduced to 42 amino acids and still forms an SDS- resistant complex with syntaxinl (stxl) and SNAP25 (S25).
- the 35 amino acid synaptobrevin SNARE motif also forms a complex but it 'melts' during gel-electrophoresis.
- EIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKA (SEQ ID NO. 32) The following synthetic syntaxin peptides were tested:
- Bio-NSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVEC (39 amino acids).
- SNARE motifs can be employed for the complexing system.
- Examples of stable, SDS- resistant complexes and their melting temperatures (Tm) are provided for SNARE complexes made of recombinant syntaxins 1 and 3, SNAP23 and SNAP25, and VAMPs 2, 4, 5, 7 and 8, as visualised in the SDS gels shown in Figure 36.
- the complexing system affords uniting of 3 separate shortened polypeptide SNARE motifs.
- VAMP2 Recombinant synaptobrevin fused to glutathione-S-transferase can be united with 40 and 45 amino acid syntaxinl and SNAP25 peptides.
- SNAP25 peptides are designated as helix 1 (S25H1) and helix 2 (S25H2).
- Syx 1 45 aa SEQ ID NO. 46;
- Syxl 40 aa SEQ ID NO. 47;
- S25H1 45 aa SEQ ID NO. 48;
- S25H1 40 aa SEQ ID NO. 49;
- S25H2 45 aa SEQ ID NO. 50;
- S25H2 40 aa SEQ ID NO. 51.
- Recombinant S25H2 protein can be united with 40 and 45 amino acid syntaxinl, VAMP2 and S25H1 peptides.
- S25H1 45 aa SEQ ID NO. 48;
- S25H1 40 aa SEQ ID NO. 49;
- Syxl 40 aa SEQ ID NO. 47;
- Syb2 45 aa SEQ ID NO. 52;
- Syb2 40 aa SEQ ID NO. 53.
- the results are shown in Figure 38 in which the lanes marked with + contain samples which were boiled in SDS and the lanes marked with - contain samples which were not boiled in SDS.
- Recombinant S25H1 protein can be united with 40 and 45 amino acid syntaxinl, VAMP2 and S25H2 peptides.
- S25H2 45 aa SEQ ID NO. 50;
- S25H2 40 aa SEQ ID NO. 51;
- Syxl 45 aa SEQ ID NO. 46;
- Syxl 40 aa SEQ ID NO. 47;
- Syb2 45 aa SEQ ID NO. 52;
- Syb2 40 aa SEQ ID NO. 53.
- Syntaxintag-SubstanceP (SEQ ID NO. 56)
- lane 1 and 2 Brevintag-SubstanceP was mixed with Syntaxintag-somatostatin in the presence of SNAP25.
- the stable complex contains both substanceP and somatostatin (heterodimeric peptide).
- Lane 3 and 4 Brevintag-somatostatin was mixed with Syntaxintag-somatostatin in the presence of SNAP25.
- the stable complex contains two somatostatins (homodimeric peptide). Note, lanes 1 and 3 show the stable complexes obtained using tagged neuropeptides.
- Example 11 shows the stable complexes obtained using tagged neuropeptides.
- Neuropeptides can be united with other functional groups, e.g. botulinum neurotoxin parts, in different orientations which could affect binding to cell surface receptors and translocation of peptides.
- functional groups e.g. botulinum neurotoxin parts
- Lanes 1 and 2 syntaxin-AVP was incubated with LcHn-brevin in the presence of SNAP-25 for 60 min.
- the stable complex contains LcHn-SNARE-AVP (AVP is on the C-terminal end of the SNARE linkers).
- Lanes 3 and 4 AVP-syntaxin was incubated with LcHn-brevin in the presence of SNAP-25 for 60 min.
- the stable complex contains LcHn-AVP-SNARE (AVP is on the N-terminal end of the SNARE linkers).
- Binding of the peptides was observed in a pull-down experiment using GST-SNAP251inkerSynaptobrevin protein (trihelical construct) immobilized on glutathione-beads. Binding was for 30 min at 25 degrees C, followed by extensive washing in buffer A (20 mM HEPES, 100 mM NaCl). Protein and peptides were visualised on SDS-gels ( Figure 42). Biotinylated peptides bound to beads are seen at the bottom of the SDS-gel.
- SNARE peptides can be chemically cross-linked to proteins when the proteins cannot be expressed recombinantly.
- the peptides retain their ability to form the SNARE complex and the modified proteins retain their activity. Sequences used:
- Figure 43 is an SDS-gel showing maleimide-based cross-linking.
- the cross-linked syntaxin-HRP can bind to GST-trihelix (Snap25-brevin, S-B) which was immobilized on glutathione beads.
- S-B GST-trihelix
- Figure 44 shows adsorbance at 650 nm of the TMB substrate.
- Figure 45 shows luminescence of luminal visualized on film. Note, control glutathione beads without GST-trihelix (S-B) show only background binding of syntaxin-HRP.
- a 29 amino acid complexin 1 peptide can interact with SNARE assemblies. This peptide can be used for purification following its immobilization or as an additional carrier in SNARE-based assemblies.
- Figure 46 is an SDS-gel showing pull down of the complexin peptide by the following proteins immobilized on Ni2+ beads.
- lane E represents a product where one recombinant protein binds three synthetic peptides one of which is the complexin peptide.
- SNARE assembly can be accomplished in the presence of blood serum. Certain applications will require de novo interaction of SNARE-based medicines following their injection into blood.
- the 45 amino acid syntaxinl peptide with FITC fluorescent tag was tested for binding to GST-trihelical protein (SNAP-25 linked to synaptobrevin, SB protein) immobilised on glutathione beads in the presence of 100% calf serum. The results are shown in Figure 47. Note, the presence of the trihelical protein on beads results in pull-down of the syntaxin fluorescent peptide in the presence of serum. The vertical axis represents relative fluorescence units.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Urology & Nephrology (AREA)
- Biochemistry (AREA)
- Cell Biology (AREA)
- Hematology (AREA)
- Analytical Chemistry (AREA)
- Toxicology (AREA)
- Biotechnology (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Pain & Pain Management (AREA)
- Ophthalmology & Optometry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Microbiology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Dermatology (AREA)
Abstract
Description
Claims
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GB0914121A GB0914121D0 (en) | 2009-08-12 | 2009-08-12 | Complexing systems |
| US31920410P | 2010-03-30 | 2010-03-30 | |
| PCT/GB2010/051336 WO2011018665A1 (en) | 2009-08-12 | 2010-08-12 | Complexing system |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP2464662A1 true EP2464662A1 (en) | 2012-06-20 |
Family
ID=45812299
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP10747066A Withdrawn EP2464662A1 (en) | 2009-08-12 | 2010-08-12 | Complexing system |
Country Status (6)
| Country | Link |
|---|---|
| EP (1) | EP2464662A1 (en) |
| JP (1) | JP2013501771A (en) |
| CN (1) | CN102625812A (en) |
| AU (1) | AU2010283595A1 (en) |
| CA (1) | CA2770357A1 (en) |
| WO (1) | WO2011018665A1 (en) |
Families Citing this family (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB201219024D0 (en) | 2012-10-23 | 2012-12-05 | Syntaxin Ltd | Assay |
| US10408837B2 (en) * | 2013-12-09 | 2019-09-10 | The United States Of America, As Represented By The Secretary, Department Of Health & Human Services | Peptide substrates recognizable by type E botulinum neurotoxin |
| GB201621111D0 (en) * | 2016-12-12 | 2017-01-25 | Univ Of Sheffield The | Neurotoxins |
| AU2018389104A1 (en) * | 2017-12-20 | 2020-07-30 | Allergan, Inc. | Botulinum toxin cell binding domain polypeptides and methods of use for skin rejuvenation |
| EP3758611B1 (en) | 2018-02-26 | 2024-07-24 | Ipsen Biopharm Limited | Ultrasound apparatus to guide injection of non-cytotoxic protease |
| CN112165955A (en) | 2018-05-21 | 2021-01-01 | 益普生生物制药有限公司 | Inhibiting allodynia caused by bone cancer |
| US20220016221A1 (en) | 2018-12-05 | 2022-01-20 | Ipsen Biopharm Limited | Treatment of symptoms of traumatic brain injury |
| WO2024064112A2 (en) * | 2022-09-19 | 2024-03-28 | The Rockefeller University | Affinity capturing and directly determining structures of proteins and other materials on superparamagnetic beads by cryo-electron microscopy single-particle analysis |
| EP4722232A1 (en) * | 2023-05-31 | 2026-04-08 | YSTE (Hainan) Aesthetic Medicine Health Technology Co., Ltd. | Single-chain polypeptide activated in use |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040033241A1 (en) * | 2000-06-02 | 2004-02-19 | Allergan, Inc. | Controlled release botulinum toxin system |
| US20050214327A1 (en) * | 2000-06-02 | 2005-09-29 | Allergan, Inc. | Neurotoxin-containing suppositories and related methods |
| CN1331101A (en) * | 2000-06-28 | 2002-01-16 | 上海博德基因开发有限公司 | Polypeptide-SNARE associated Golgi G527 Protein 20.68, and polynucleotide for coding it |
| US6903187B1 (en) * | 2000-07-21 | 2005-06-07 | Allergan, Inc. | Leucine-based motif and clostridial neurotoxins |
| CN101027047A (en) * | 2002-12-03 | 2007-08-29 | Ucb公司 | Methods for the identification of agents for the treatment of seizures, neurological diseases, endocrinopathies and hormonal diseases |
| CN100497626C (en) * | 2004-10-18 | 2009-06-10 | 国家海洋局第一海洋研究所 | Isolated 25KD synapse-associated protein and its application |
| US7659092B2 (en) | 2004-12-01 | 2010-02-09 | Syntaxin, Ltd. | Fusion proteins |
-
2010
- 2010-08-12 EP EP10747066A patent/EP2464662A1/en not_active Withdrawn
- 2010-08-12 JP JP2012524293A patent/JP2013501771A/en active Pending
- 2010-08-12 CA CA2770357A patent/CA2770357A1/en not_active Abandoned
- 2010-08-12 AU AU2010283595A patent/AU2010283595A1/en not_active Abandoned
- 2010-08-12 WO PCT/GB2010/051336 patent/WO2011018665A1/en not_active Ceased
- 2010-08-12 CN CN2010800444464A patent/CN102625812A/en active Pending
Non-Patent Citations (2)
| Title |
|---|
| See also references of WO2011018665A1 * |
| THOMAS WEBER ET AL: "SNAREpins: Minimal Machinery for Membrane Fusion", CELL, vol. 92, no. 6, 1 March 1998 (1998-03-01), pages 759 - 772, XP055068401, ISSN: 0092-8674, DOI: 10.1016/S0092-8674(00)81404-X * |
Also Published As
| Publication number | Publication date |
|---|---|
| CN102625812A (en) | 2012-08-01 |
| JP2013501771A (en) | 2013-01-17 |
| AU2010283595A1 (en) | 2012-02-23 |
| CA2770357A1 (en) | 2011-02-17 |
| WO2011018665A1 (en) | 2011-02-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2011018665A1 (en) | Complexing system | |
| US10527609B2 (en) | Peptide tag systems that spontaneously form an irreversible link to protein partners via isopeptide bonds | |
| Wu et al. | An intrinsically disordered peptide-peptide stapler for highly efficient protein ligation both in vivo and in vitro | |
| US5723584A (en) | Biotinylation of proteins | |
| Howarth et al. | Imaging proteins in live mammalian cells with biotin ligase and monovalent streptavidin | |
| US20090220455A1 (en) | Pharmaceutical compositions comprising elp fusion proteins | |
| CN109641941B (en) | Methods for purifying and activating botulinum neurotoxin | |
| JP2019506163A (en) | Split intein with exceptional splicing activity | |
| JP2023016842A (en) | Methods for protein ligation and uses thereof | |
| CN116199733A (en) | Methods and products for fusion protein synthesis | |
| US8759488B2 (en) | High stability streptavidin mutant proteins | |
| Ferrari et al. | Assembly of protein building blocks using a short synthetic peptide | |
| JP2003527561A (en) | Methods for site-specific labeling of proteins and uses therefor | |
| US20110038892A1 (en) | Complexing system | |
| Demircioglu et al. | Purification and structural analysis of SUN and KASH domain proteins | |
| Hong Lim et al. | Biotin‐assisted folding of streptavidin on the yeast surface | |
| Tang | Synthesis and Characterization of pH-Responsive Elastin-Like Polypeptides with Different Configurations | |
| CN120569398A (en) | Protein scaffolds for disordered regions | |
| Siddiqui | Developing Tools for Cavin-1 Purification and Binding Studies with Caveolin-1 | |
| Luisi | Identification of novel protein scaffolds for small molecules binding and for catalysis | |
| Rogers | Negative interference in systems of coupled kinesin: A study of self-assembling complexes with defined structure | |
| Elhebieshy et al. | Total Chemical Synthesis of a Functionalized GFP Nanobody | |
| HK40007330A (en) | Method for purification and activation of botulinum neurotoxin | |
| BR112017026042B1 (en) | FUSION PROTEIN AND ITS METHOD OF PRODUCTION, PEPTIDE LIGAND, PEPTIDE LIGAND PAIR AND USE THEREOF, RECOMBINANT OR SYNTHETIC POLYPEPTIDE, NUCLEIC ACID MOLECULE, VECTOR, RECOMBINANT HOST CELL AND KIT |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20120312 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO SE SI SK SM TR |
|
| RIN1 | Information on inventor provided before grant (corrected) |
Inventor name: DAVLETOV, BAZBEK Inventor name: SOLOVIEV, MIKHAIL Inventor name: DARIOS, FREDERIC Inventor name: FERRARI, ENRICO |
|
| REG | Reference to a national code |
Ref country code: HK Ref legal event code: DE Ref document number: 1166986 Country of ref document: HK |
|
| DAX | Request for extension of the european patent (deleted) | ||
| 17Q | First examination report despatched |
Effective date: 20130709 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20140819 |
|
| REG | Reference to a national code |
Ref country code: HK Ref legal event code: WD Ref document number: 1166986 Country of ref document: HK |