EP2438149A1 - Enzymatic textile colour modification - Google Patents
Enzymatic textile colour modificationInfo
- Publication number
- EP2438149A1 EP2438149A1 EP10724053A EP10724053A EP2438149A1 EP 2438149 A1 EP2438149 A1 EP 2438149A1 EP 10724053 A EP10724053 A EP 10724053A EP 10724053 A EP10724053 A EP 10724053A EP 2438149 A1 EP2438149 A1 EP 2438149A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- enzymatic
- perhydrolase
- textile
- hydrogen peroxide
- treatment composition
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 239000004753 textile Substances 0.000 title claims abstract description 66
- 230000002255 enzymatic effect Effects 0.000 title claims abstract description 44
- 230000004048 modification Effects 0.000 title description 9
- 238000012986 modification Methods 0.000 title description 9
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 claims abstract description 116
- 238000000034 method Methods 0.000 claims abstract description 92
- 102000004190 Enzymes Human genes 0.000 claims abstract description 58
- 108090000790 Enzymes Proteins 0.000 claims abstract description 58
- 239000000203 mixture Substances 0.000 claims abstract description 52
- 239000000463 material Substances 0.000 claims abstract description 39
- 239000000758 substrate Substances 0.000 claims abstract description 31
- 150000002148 esters Chemical class 0.000 claims abstract description 29
- 235000019646 color tone Nutrition 0.000 claims abstract description 27
- 239000000835 fiber Substances 0.000 claims abstract description 8
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 19
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 claims description 12
- 102220500059 eIF5-mimic protein 2_S54V_mutation Human genes 0.000 claims description 12
- 239000004094 surface-active agent Substances 0.000 claims description 12
- 239000003795 chemical substances by application Substances 0.000 claims description 10
- UYAAVKFHBMJOJZ-UHFFFAOYSA-N diimidazo[1,3-b:1',3'-e]pyrazine-5,10-dione Chemical group O=C1C2=CN=CN2C(=O)C2=CN=CN12 UYAAVKFHBMJOJZ-UHFFFAOYSA-N 0.000 claims description 10
- 229940116423 propylene glycol diacetate Drugs 0.000 claims description 10
- 239000003995 emulsifying agent Substances 0.000 claims description 9
- 102000016938 Catalase Human genes 0.000 claims description 8
- 108010053835 Catalase Proteins 0.000 claims description 8
- UYXTWWCETRIEDR-UHFFFAOYSA-N Tributyrin Chemical compound CCCC(=O)OCC(OC(=O)CCC)COC(=O)CCC UYXTWWCETRIEDR-UHFFFAOYSA-N 0.000 claims description 8
- 239000013066 combination product Substances 0.000 claims description 8
- 229940127555 combination product Drugs 0.000 claims description 8
- URAYPUMNDPQOKB-UHFFFAOYSA-N triacetin Chemical compound CC(=O)OCC(OC(C)=O)COC(C)=O URAYPUMNDPQOKB-UHFFFAOYSA-N 0.000 claims description 8
- 230000007062 hydrolysis Effects 0.000 claims description 5
- 238000006460 hydrolysis reaction Methods 0.000 claims description 5
- 238000012545 processing Methods 0.000 claims description 5
- JTXMVXSTHSMVQF-UHFFFAOYSA-N 2-acetyloxyethyl acetate Chemical compound CC(=O)OCCOC(C)=O JTXMVXSTHSMVQF-UHFFFAOYSA-N 0.000 claims description 4
- 235000013773 glyceryl triacetate Nutrition 0.000 claims description 4
- 229960002622 triacetin Drugs 0.000 claims description 4
- 238000010011 enzymatic desizing Methods 0.000 claims description 3
- 238000010923 batch production Methods 0.000 claims description 2
- 230000002087 whitening effect Effects 0.000 claims description 2
- 230000003301 hydrolyzing effect Effects 0.000 claims 1
- 238000005282 brightening Methods 0.000 abstract description 9
- 229940088598 enzyme Drugs 0.000 description 51
- 238000006243 chemical reaction Methods 0.000 description 17
- 150000004965 peroxy acids Chemical class 0.000 description 17
- 230000000694 effects Effects 0.000 description 13
- 239000001488 sodium phosphate Substances 0.000 description 13
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 12
- 239000004744 fabric Substances 0.000 description 12
- 108091033319 polynucleotide Proteins 0.000 description 12
- 102000040430 polynucleotide Human genes 0.000 description 12
- 239000002157 polynucleotide Substances 0.000 description 12
- 108090000623 proteins and genes Proteins 0.000 description 12
- 238000005406 washing Methods 0.000 description 12
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 12
- 238000004061 bleaching Methods 0.000 description 11
- 239000000975 dye Substances 0.000 description 11
- 238000005259 measurement Methods 0.000 description 11
- 150000002978 peroxides Chemical class 0.000 description 10
- 102000004169 proteins and genes Human genes 0.000 description 10
- 239000000243 solution Substances 0.000 description 10
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 9
- 150000001413 amino acids Chemical class 0.000 description 9
- 239000002736 nonionic surfactant Substances 0.000 description 9
- 239000003381 stabilizer Substances 0.000 description 9
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 8
- 241000187480 Mycobacterium smegmatis Species 0.000 description 8
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 8
- 238000009990 desizing Methods 0.000 description 8
- 229920002643 polyglutamic acid Polymers 0.000 description 8
- 239000000126 substance Substances 0.000 description 8
- 102000004316 Oxidoreductases Human genes 0.000 description 7
- 108090000854 Oxidoreductases Proteins 0.000 description 7
- 125000002252 acyl group Chemical group 0.000 description 7
- -1 aromatic carboxylic acids Chemical class 0.000 description 7
- 239000000872 buffer Substances 0.000 description 7
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 7
- 229910000397 disodium phosphate Inorganic materials 0.000 description 7
- 235000019800 disodium phosphate Nutrition 0.000 description 7
- 238000011156 evaluation Methods 0.000 description 7
- XLYOFNOQVPJJNP-ZSJDYOACSA-N heavy water Substances [2H]O[2H] XLYOFNOQVPJJNP-ZSJDYOACSA-N 0.000 description 7
- 239000008363 phosphate buffer Substances 0.000 description 7
- 150000003839 salts Chemical class 0.000 description 7
- 229920000742 Cotton Polymers 0.000 description 6
- 108010029541 Laccase Proteins 0.000 description 6
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical group [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 6
- 239000002253 acid Substances 0.000 description 6
- 239000013065 commercial product Substances 0.000 description 6
- 238000004043 dyeing Methods 0.000 description 6
- 238000011534 incubation Methods 0.000 description 6
- 229910000403 monosodium phosphate Inorganic materials 0.000 description 6
- 235000019799 monosodium phosphate Nutrition 0.000 description 6
- 125000003729 nucleotide group Chemical group 0.000 description 6
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 6
- 238000005303 weighing Methods 0.000 description 6
- XUJLWPFSUCHPQL-UHFFFAOYSA-N 11-methyldodecan-1-ol Chemical compound CC(C)CCCCCCCCCCO XUJLWPFSUCHPQL-UHFFFAOYSA-N 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 229920001184 polypeptide Polymers 0.000 description 5
- 102000004196 processed proteins & peptides Human genes 0.000 description 5
- 108090000765 processed proteins & peptides Proteins 0.000 description 5
- 239000008262 pumice Substances 0.000 description 5
- 239000003352 sequestering agent Substances 0.000 description 5
- 229910001220 stainless steel Inorganic materials 0.000 description 5
- 239000010935 stainless steel Substances 0.000 description 5
- 239000004575 stone Substances 0.000 description 5
- 238000006467 substitution reaction Methods 0.000 description 5
- 238000012546 transfer Methods 0.000 description 5
- UFBJCMHMOXMLKC-UHFFFAOYSA-N 2,4-dinitrophenol Chemical compound OC1=CC=C([N+]([O-])=O)C=C1[N+]([O-])=O UFBJCMHMOXMLKC-UHFFFAOYSA-N 0.000 description 4
- INOIOAWTVPHTCJ-UHFFFAOYSA-N 6-acetamido-4-hydroxy-3-[[4-(2-sulfooxyethylsulfonyl)phenyl]diazenyl]naphthalene-2-sulfonic acid Chemical compound CC(=O)NC1=CC=C2C=C(C(N=NC3=CC=C(C=C3)S(=O)(=O)CCOS(O)(=O)=O)=C(O)C2=C1)S(O)(=O)=O INOIOAWTVPHTCJ-UHFFFAOYSA-N 0.000 description 4
- 108010065511 Amylases Proteins 0.000 description 4
- 102000013142 Amylases Human genes 0.000 description 4
- FERIUCNNQQJTOY-UHFFFAOYSA-N Butyric acid Chemical compound CCCC(O)=O FERIUCNNQQJTOY-UHFFFAOYSA-N 0.000 description 4
- 108010059892 Cellulase Proteins 0.000 description 4
- 235000019418 amylase Nutrition 0.000 description 4
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 4
- 229940106157 cellulase Drugs 0.000 description 4
- 150000001875 compounds Chemical class 0.000 description 4
- XBDQKXXYIPTUBI-UHFFFAOYSA-N dimethylselenoniopropionate Natural products CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 4
- 238000002845 discoloration Methods 0.000 description 4
- POULHZVOKOAJMA-UHFFFAOYSA-N dodecanoic acid Chemical compound CCCCCCCCCCCC(O)=O POULHZVOKOAJMA-UHFFFAOYSA-N 0.000 description 4
- IPCSVZSSVZVIGE-UHFFFAOYSA-N hexadecanoic acid Chemical compound CCCCCCCCCCCCCCCC(O)=O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 4
- FUZZWVXGSFPDMH-UHFFFAOYSA-N hexanoic acid Chemical compound CCCCCC(O)=O FUZZWVXGSFPDMH-UHFFFAOYSA-N 0.000 description 4
- 229910052742 iron Inorganic materials 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 4
- FBUKVWPVBMHYJY-UHFFFAOYSA-N nonanoic acid Chemical compound CCCCCCCCC(O)=O FBUKVWPVBMHYJY-UHFFFAOYSA-N 0.000 description 4
- WWZKQHOCKIZLMA-UHFFFAOYSA-N octanoic acid Chemical compound CCCCCCCC(O)=O WWZKQHOCKIZLMA-UHFFFAOYSA-N 0.000 description 4
- 239000001301 oxygen Substances 0.000 description 4
- 229910052760 oxygen Inorganic materials 0.000 description 4
- HFIYIRIMGZMCPC-YOLJWEMLSA-J remazole black-GR Chemical compound [Na+].[Na+].[Na+].[Na+].[O-]S(=O)(=O)C1=CC2=CC(S([O-])(=O)=O)=C(\N=N\C=3C=CC(=CC=3)S(=O)(=O)CCOS([O-])(=O)=O)C(O)=C2C(N)=C1\N=N\C1=CC=C(S(=O)(=O)CCOS([O-])(=O)=O)C=C1 HFIYIRIMGZMCPC-YOLJWEMLSA-J 0.000 description 4
- 229910000029 sodium carbonate Inorganic materials 0.000 description 4
- 235000017550 sodium carbonate Nutrition 0.000 description 4
- NQPDZGIKBAWPEJ-UHFFFAOYSA-N valeric acid Chemical compound CCCCC(O)=O NQPDZGIKBAWPEJ-UHFFFAOYSA-N 0.000 description 4
- 102000057234 Acyl transferases Human genes 0.000 description 3
- 108700016155 Acyl transferases Proteins 0.000 description 3
- 239000004382 Amylase Substances 0.000 description 3
- 235000000177 Indigofera tinctoria Nutrition 0.000 description 3
- 235000011054 acetic acid Nutrition 0.000 description 3
- 229960000583 acetic acid Drugs 0.000 description 3
- 230000000052 comparative effect Effects 0.000 description 3
- 235000014113 dietary fatty acids Nutrition 0.000 description 3
- 229930195729 fatty acid Natural products 0.000 description 3
- 239000000194 fatty acid Substances 0.000 description 3
- 150000002191 fatty alcohols Chemical class 0.000 description 3
- 229940097275 indigo Drugs 0.000 description 3
- COHYTHOBJLSHDF-UHFFFAOYSA-N indigo powder Natural products N1C2=CC=CC=C2C(=O)C1=C1C(=O)C2=CC=CC=C2N1 COHYTHOBJLSHDF-UHFFFAOYSA-N 0.000 description 3
- 102000039446 nucleic acids Human genes 0.000 description 3
- 108020004707 nucleic acids Proteins 0.000 description 3
- 150000007523 nucleic acids Chemical class 0.000 description 3
- 239000002773 nucleotide Substances 0.000 description 3
- 229920000642 polymer Polymers 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 102220294335 rs1554842938 Human genes 0.000 description 3
- 238000011179 visual inspection Methods 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 2
- GYSCBCSGKXNZRH-UHFFFAOYSA-N 1-benzothiophene-2-carboxamide Chemical compound C1=CC=C2SC(C(=O)N)=CC2=C1 GYSCBCSGKXNZRH-UHFFFAOYSA-N 0.000 description 2
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 2
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 2
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 2
- 108010025188 Alcohol oxidase Proteins 0.000 description 2
- 239000005635 Caprylic acid (CAS 124-07-2) Substances 0.000 description 2
- RGHNJXZEOKUKBD-SQOUGZDYSA-N D-gluconic acid Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)=O RGHNJXZEOKUKBD-SQOUGZDYSA-N 0.000 description 2
- GHVNFZFCNZKVNT-UHFFFAOYSA-N Decanoic acid Natural products CCCCCCCCCC(O)=O GHVNFZFCNZKVNT-UHFFFAOYSA-N 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- 108010015776 Glucose oxidase Proteins 0.000 description 2
- 239000004366 Glucose oxidase Substances 0.000 description 2
- 108010073450 Lactate 2-monooxygenase Proteins 0.000 description 2
- 239000005642 Oleic acid Substances 0.000 description 2
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 2
- 235000021314 Palmitic acid Nutrition 0.000 description 2
- 108091093037 Peptide nucleic acid Proteins 0.000 description 2
- KFSLWBXXFJQRDL-UHFFFAOYSA-N Peracetic acid Chemical compound CC(=O)OO KFSLWBXXFJQRDL-UHFFFAOYSA-N 0.000 description 2
- ABLZXFCXXLZCGV-UHFFFAOYSA-N Phosphorous acid Chemical compound OP(O)=O ABLZXFCXXLZCGV-UHFFFAOYSA-N 0.000 description 2
- 108091028664 Ribonucleotide Proteins 0.000 description 2
- 235000021355 Stearic acid Nutrition 0.000 description 2
- 102220477940 Triggering receptor expressed on myeloid cells 1_T25S_mutation Human genes 0.000 description 2
- 125000001931 aliphatic group Chemical group 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 125000002091 cationic group Chemical group 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 238000001816 cooling Methods 0.000 description 2
- 238000004042 decolorization Methods 0.000 description 2
- 238000000354 decomposition reaction Methods 0.000 description 2
- 239000005547 deoxyribonucleotide Substances 0.000 description 2
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 2
- 125000000664 diazo group Chemical group [N-]=[N+]=[*] 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N ethylene glycol Natural products OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- 235000019253 formic acid Nutrition 0.000 description 2
- 229940116332 glucose oxidase Drugs 0.000 description 2
- 235000019420 glucose oxidase Nutrition 0.000 description 2
- 108010090622 glycerol oxidase Proteins 0.000 description 2
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 2
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 2
- 125000005647 linker group Chemical group 0.000 description 2
- 238000011068 loading method Methods 0.000 description 2
- 238000002703 mutagenesis Methods 0.000 description 2
- 231100000350 mutagenesis Toxicity 0.000 description 2
- WQEPLUUGTLDZJY-UHFFFAOYSA-N n-Pentadecanoic acid Natural products CCCCCCCCCCCCCCC(O)=O WQEPLUUGTLDZJY-UHFFFAOYSA-N 0.000 description 2
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 2
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 2
- 229960002446 octanoic acid Drugs 0.000 description 2
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 2
- 235000021313 oleic acid Nutrition 0.000 description 2
- 150000007524 organic acids Chemical class 0.000 description 2
- 230000001590 oxidative effect Effects 0.000 description 2
- 125000004430 oxygen atom Chemical group O* 0.000 description 2
- BWHMMNNQKKPAPP-UHFFFAOYSA-L potassium carbonate Chemical compound [K+].[K+].[O-]C([O-])=O BWHMMNNQKKPAPP-UHFFFAOYSA-L 0.000 description 2
- 235000019260 propionic acid Nutrition 0.000 description 2
- IUVKMZGDUIUOCP-BTNSXGMBSA-N quinbolone Chemical compound O([C@H]1CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)CC[C@@]21C)C1=CCCC1 IUVKMZGDUIUOCP-BTNSXGMBSA-N 0.000 description 2
- 238000011084 recovery Methods 0.000 description 2
- KUIXZSYWBHSYCN-UHFFFAOYSA-L remazol brilliant blue r Chemical compound [Na+].[Na+].C1=C(S([O-])(=O)=O)C(N)=C2C(=O)C3=CC=CC=C3C(=O)C2=C1NC1=CC=CC(S(=O)(=O)CCOS([O-])(=O)=O)=C1 KUIXZSYWBHSYCN-UHFFFAOYSA-L 0.000 description 2
- 239000002336 ribonucleotide Substances 0.000 description 2
- 125000002652 ribonucleotide group Chemical group 0.000 description 2
- 102220243542 rs1239929428 Human genes 0.000 description 2
- 102220075010 rs796053096 Human genes 0.000 description 2
- 239000000344 soap Substances 0.000 description 2
- 239000001509 sodium citrate Substances 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000008117 stearic acid Substances 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- TUNFSRHWOTWDNC-HKGQFRNVSA-N tetradecanoic acid Chemical compound CCCCCCCCCCCCC[14C](O)=O TUNFSRHWOTWDNC-HKGQFRNVSA-N 0.000 description 2
- HRXKRNGNAMMEHJ-UHFFFAOYSA-K trisodium citrate Chemical compound [Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O HRXKRNGNAMMEHJ-UHFFFAOYSA-K 0.000 description 2
- 229940038773 trisodium citrate Drugs 0.000 description 2
- 229940005605 valeric acid Drugs 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- VZSRBBMJRBPUNF-UHFFFAOYSA-N 2-(2,3-dihydro-1H-inden-2-ylamino)-N-[3-oxo-3-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)propyl]pyrimidine-5-carboxamide Chemical compound C1C(CC2=CC=CC=C12)NC1=NC=C(C=N1)C(=O)NCCC(N1CC2=C(CC1)NN=N2)=O VZSRBBMJRBPUNF-UHFFFAOYSA-N 0.000 description 1
- IEORSVTYLWZQJQ-UHFFFAOYSA-N 2-(2-nonylphenoxy)ethanol Chemical compound CCCCCCCCCC1=CC=CC=C1OCCO IEORSVTYLWZQJQ-UHFFFAOYSA-N 0.000 description 1
- 102100038837 2-Hydroxyacid oxidase 1 Human genes 0.000 description 1
- LJCNDNBULVLKSG-UHFFFAOYSA-N 2-aminoacetic acid;butane Chemical compound CCCC.CCCC.NCC(O)=O LJCNDNBULVLKSG-UHFFFAOYSA-N 0.000 description 1
- NIPDVSLAMPAWTP-UHFFFAOYSA-N 2-methoxy-5-nitroaniline Chemical compound COC1=CC=C([N+]([O-])=O)C=C1N NIPDVSLAMPAWTP-UHFFFAOYSA-N 0.000 description 1
- JFGQHAHJWJBOPD-UHFFFAOYSA-N 3-hydroxy-n-phenylnaphthalene-2-carboxamide Chemical compound OC1=CC2=CC=CC=C2C=C1C(=O)NC1=CC=CC=C1 JFGQHAHJWJBOPD-UHFFFAOYSA-N 0.000 description 1
- 102220596352 CUGBP Elav-like family member 1_L12I_mutation Human genes 0.000 description 1
- 244000025254 Cannabis sativa Species 0.000 description 1
- 235000012766 Cannabis sativa ssp. sativa var. sativa Nutrition 0.000 description 1
- 235000012765 Cannabis sativa ssp. sativa var. spontanea Nutrition 0.000 description 1
- 101710128063 Carbohydrate oxidase Proteins 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 108010084185 Cellulases Proteins 0.000 description 1
- 102000005575 Cellulases Human genes 0.000 description 1
- 108010089254 Cholesterol oxidase Proteins 0.000 description 1
- 108010000659 Choline oxidase Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- RGHNJXZEOKUKBD-UHFFFAOYSA-N D-gluconic acid Natural products OCC(O)C(O)C(O)C(O)C(O)=O RGHNJXZEOKUKBD-UHFFFAOYSA-N 0.000 description 1
- QXNVGIXVLWOKEQ-UHFFFAOYSA-N Disodium Chemical compound [Na][Na] QXNVGIXVLWOKEQ-UHFFFAOYSA-N 0.000 description 1
- 108010015133 Galactose oxidase Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 108010004237 Glycine oxidase Proteins 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- 108010008292 L-Amino Acid Oxidase Proteins 0.000 description 1
- 102000007070 L-amino-acid oxidase Human genes 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- 241000186660 Lactobacillus Species 0.000 description 1
- 108090001060 Lipase Proteins 0.000 description 1
- 102000004882 Lipase Human genes 0.000 description 1
- 239000004367 Lipase Substances 0.000 description 1
- 229920000433 Lyocell Polymers 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 108010063734 Oxalate oxidase Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 108010059820 Polygalacturonase Proteins 0.000 description 1
- 108010042687 Pyruvate Oxidase Proteins 0.000 description 1
- 229920000297 Rayon Polymers 0.000 description 1
- 108010060059 Sarcosine Oxidase Proteins 0.000 description 1
- 102000008118 Sarcosine oxidase Human genes 0.000 description 1
- 239000004115 Sodium Silicate Substances 0.000 description 1
- 239000005708 Sodium hypochlorite Substances 0.000 description 1
- 239000004902 Softening Agent Substances 0.000 description 1
- 229920002334 Spandex Polymers 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- UCKMPCXJQFINFW-UHFFFAOYSA-N Sulphide Chemical compound [S-2] UCKMPCXJQFINFW-UHFFFAOYSA-N 0.000 description 1
- 239000005864 Sulphur Substances 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical class OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 1
- 102000004357 Transferases Human genes 0.000 description 1
- 108090000992 Transferases Proteins 0.000 description 1
- 108010092464 Urate Oxidase Proteins 0.000 description 1
- 102100033220 Xanthine oxidase Human genes 0.000 description 1
- 108010093894 Xanthine oxidase Proteins 0.000 description 1
- WETWJCDKMRHUPV-UHFFFAOYSA-N acetyl chloride Chemical compound CC(Cl)=O WETWJCDKMRHUPV-UHFFFAOYSA-N 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 150000001263 acyl chlorides Chemical class 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 150000007933 aliphatic carboxylic acids Chemical class 0.000 description 1
- 239000003513 alkali Substances 0.000 description 1
- 229910052783 alkali metal Inorganic materials 0.000 description 1
- 229910000288 alkali metal carbonate Inorganic materials 0.000 description 1
- 229910052910 alkali metal silicate Inorganic materials 0.000 description 1
- 125000003342 alkenyl group Chemical group 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 150000008051 alkyl sulfates Chemical class 0.000 description 1
- 229940059260 amidate Drugs 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 229940025131 amylases Drugs 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 239000003945 anionic surfactant Substances 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 108010009043 arylesterase Proteins 0.000 description 1
- 102000028848 arylesterase Human genes 0.000 description 1
- 239000002585 base Substances 0.000 description 1
- 239000003637 basic solution Substances 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- MSWZFWKMSRAUBD-UHFFFAOYSA-N beta-D-galactosamine Natural products NC1C(O)OC(CO)C(O)C1O MSWZFWKMSRAUBD-UHFFFAOYSA-N 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 239000007844 bleaching agent Substances 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 150000001642 boronic acid derivatives Chemical class 0.000 description 1
- 102220411787 c.160T>C Human genes 0.000 description 1
- 102220351326 c.35T>A Human genes 0.000 description 1
- 235000009120 camo Nutrition 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-N carbonic acid Chemical compound OC(O)=O BVKZGUZCCUSVTD-UHFFFAOYSA-N 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 1
- 150000001733 carboxylic acid esters Chemical class 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 238000006555 catalytic reaction Methods 0.000 description 1
- 235000005607 chanvre indien Nutrition 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 238000010924 continuous production Methods 0.000 description 1
- 108010005400 cutinase Proteins 0.000 description 1
- 125000000392 cycloalkenyl group Chemical group 0.000 description 1
- 125000000753 cycloalkyl group Chemical group 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- GSPKZYJPUDYKPI-UHFFFAOYSA-N diethoxy sulfate Chemical compound CCOOS(=O)(=O)OOCC GSPKZYJPUDYKPI-UHFFFAOYSA-N 0.000 description 1
- 239000000982 direct dye Substances 0.000 description 1
- VTIIJXUACCWYHX-UHFFFAOYSA-L disodium;carboxylatooxy carbonate Chemical compound [Na+].[Na+].[O-]C(=O)OOC([O-])=O VTIIJXUACCWYHX-UHFFFAOYSA-L 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- NPUKDXXFDDZOKR-LLVKDONJSA-N etomidate Chemical compound CCOC(=O)C1=CN=CN1[C@H](C)C1=CC=CC=C1 NPUKDXXFDDZOKR-LLVKDONJSA-N 0.000 description 1
- 108010093305 exopolygalacturonase Proteins 0.000 description 1
- 238000013401 experimental design Methods 0.000 description 1
- 235000019387 fatty acid methyl ester Nutrition 0.000 description 1
- 239000000446 fuel Substances 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 230000005021 gait Effects 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 239000000174 gluconic acid Substances 0.000 description 1
- 235000012208 gluconic acid Nutrition 0.000 description 1
- 229960002442 glucosamine Drugs 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 108010062584 glycollate oxidase Proteins 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 239000011487 hemp Substances 0.000 description 1
- 108010018734 hexose oxidase Proteins 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 150000002484 inorganic compounds Chemical class 0.000 description 1
- 238000002743 insertional mutagenesis Methods 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000004310 lactic acid Substances 0.000 description 1
- 235000014655 lactic acid Nutrition 0.000 description 1
- 235000019421 lipase Nutrition 0.000 description 1
- 230000029226 lipidation Effects 0.000 description 1
- 159000000003 magnesium salts Chemical class 0.000 description 1
- 230000000873 masking effect Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 150000001455 metallic ions Chemical class 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 238000002887 multiple sequence alignment Methods 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229920000847 nonoxynol Polymers 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 150000002894 organic compounds Chemical class 0.000 description 1
- 125000000962 organic group Chemical group 0.000 description 1
- 239000011368 organic material Substances 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- JRKICGRDRMAZLK-UHFFFAOYSA-L peroxydisulfate Chemical compound [O-]S(=O)(=O)OOS([O-])(=O)=O JRKICGRDRMAZLK-UHFFFAOYSA-L 0.000 description 1
- 125000005342 perphosphate group Chemical group 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 150000004713 phosphodiesters Chemical class 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 229920000058 polyacrylate Polymers 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 229910000027 potassium carbonate Inorganic materials 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 108010001816 pyranose oxidase Proteins 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 239000000985 reactive dye Substances 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- DHHGSXPASZBLGC-VPMNAVQSSA-L remazole orange-3R Chemical compound [Na+].[Na+].OC=1C2=CC(NC(=O)C)=CC=C2C=C(S([O-])(=O)=O)C=1\N=N\C1=CC=C(S(=O)(=O)CCOS([O-])(=O)=O)C=C1 DHHGSXPASZBLGC-VPMNAVQSSA-L 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 102220037457 rs201443058 Human genes 0.000 description 1
- 102220083031 rs746990000 Human genes 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- SUKJFIGYRHOWBL-UHFFFAOYSA-N sodium hypochlorite Chemical compound [Na+].Cl[O-] SUKJFIGYRHOWBL-UHFFFAOYSA-N 0.000 description 1
- 229940045872 sodium percarbonate Drugs 0.000 description 1
- NTHWMYGWWRZVTN-UHFFFAOYSA-N sodium silicate Chemical compound [Na+].[Na+].[O-][Si]([O-])=O NTHWMYGWWRZVTN-UHFFFAOYSA-N 0.000 description 1
- 229910052911 sodium silicate Inorganic materials 0.000 description 1
- MWNQXXOSWHCCOZ-UHFFFAOYSA-L sodium;oxido carbonate Chemical compound [Na+].[O-]OC([O-])=O MWNQXXOSWHCCOZ-UHFFFAOYSA-L 0.000 description 1
- 108010038899 sorbitol oxidase Proteins 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 229920002994 synthetic fiber Polymers 0.000 description 1
- 238000006276 transfer reaction Methods 0.000 description 1
- AQLJVWUFPCUVLO-UHFFFAOYSA-N urea hydrogen peroxide Chemical compound OO.NC(N)=O AQLJVWUFPCUVLO-UHFFFAOYSA-N 0.000 description 1
- 239000000984 vat dye Substances 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
- 239000010457 zeolite Substances 0.000 description 1
- 239000002888 zwitterionic surfactant Substances 0.000 description 1
Classifications
-
- D—TEXTILES; PAPER
- D06—TREATMENT OF TEXTILES OR THE LIKE; LAUNDERING; FLEXIBLE MATERIALS NOT OTHERWISE PROVIDED FOR
- D06M—TREATMENT, NOT PROVIDED FOR ELSEWHERE IN CLASS D06, OF FIBRES, THREADS, YARNS, FABRICS, FEATHERS OR FIBROUS GOODS MADE FROM SUCH MATERIALS
- D06M16/00—Biochemical treatment of fibres, threads, yarns, fabrics, or fibrous goods made from such materials, e.g. enzymatic
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
- C11D3/39—Organic or inorganic per-compounds
- C11D3/3947—Liquid compositions
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D11/00—Special methods for preparing compositions containing mixtures of detergents
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
- C11D3/16—Organic compounds
- C11D3/20—Organic compounds containing oxygen
- C11D3/2093—Esters; Carbonates
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
- C11D3/16—Organic compounds
- C11D3/38—Products with no well-defined composition, e.g. natural products
- C11D3/386—Preparations containing enzymes, e.g. protease or amylase
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
- C11D3/16—Organic compounds
- C11D3/38—Products with no well-defined composition, e.g. natural products
- C11D3/386—Preparations containing enzymes, e.g. protease or amylase
- C11D3/38636—Preparations containing enzymes, e.g. protease or amylase containing enzymes other than protease, amylase, lipase, cellulase, oxidase or reductase
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
- C11D3/16—Organic compounds
- C11D3/38—Products with no well-defined composition, e.g. natural products
- C11D3/386—Preparations containing enzymes, e.g. protease or amylase
- C11D3/38654—Preparations containing enzymes, e.g. protease or amylase containing oxidase or reductase
-
- C—CHEMISTRY; METALLURGY
- C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
- C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
- C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
- C11D3/39—Organic or inorganic per-compounds
-
- D—TEXTILES; PAPER
- D06—TREATMENT OF TEXTILES OR THE LIKE; LAUNDERING; FLEXIBLE MATERIALS NOT OTHERWISE PROVIDED FOR
- D06M—TREATMENT, NOT PROVIDED FOR ELSEWHERE IN CLASS D06, OF FIBRES, THREADS, YARNS, FABRICS, FEATHERS OR FIBROUS GOODS MADE FROM SUCH MATERIALS
- D06M16/00—Biochemical treatment of fibres, threads, yarns, fabrics, or fibrous goods made from such materials, e.g. enzymatic
- D06M16/003—Biochemical treatment of fibres, threads, yarns, fabrics, or fibrous goods made from such materials, e.g. enzymatic with enzymes or microorganisms
-
- D—TEXTILES; PAPER
- D06—TREATMENT OF TEXTILES OR THE LIKE; LAUNDERING; FLEXIBLE MATERIALS NOT OTHERWISE PROVIDED FOR
- D06P—DYEING OR PRINTING TEXTILES; DYEING LEATHER, FURS OR SOLID MACROMOLECULAR SUBSTANCES IN ANY FORM
- D06P5/00—Other features in dyeing or printing textiles, or dyeing leather, furs, or solid macromolecular substances in any form
- D06P5/15—Locally discharging the dyes
-
- D—TEXTILES; PAPER
- D06—TREATMENT OF TEXTILES OR THE LIKE; LAUNDERING; FLEXIBLE MATERIALS NOT OTHERWISE PROVIDED FOR
- D06P—DYEING OR PRINTING TEXTILES; DYEING LEATHER, FURS OR SOLID MACROMOLECULAR SUBSTANCES IN ANY FORM
- D06P5/00—Other features in dyeing or printing textiles, or dyeing leather, furs, or solid macromolecular substances in any form
- D06P5/15—Locally discharging the dyes
- D06P5/158—Locally discharging the dyes with other compounds
Definitions
- the present invention relates to methods for the enzymatic colour modification of dyed cellulosic textile fibre material, in particular denim dyed with indigo or sulphide dyes.
- Some textile materials are washed after dyeing with the objective of adjusting the colour tone or shade on the dyed textile, also known as washdown effect.
- blue jeans made from indigo-dyed denim can be washed in the presence of pumice stones and enzymatic desizing agents, followed by an on tone-washdown process to obtain a desired worn appearance.
- Conventional washdown processes comprise treatment of the coloured denim with sodium hypochlorite, which is undesirable in view of the appearance of fibre damages and because of ecological reasons.
- Washdown with hydrogen peroxide is an alternative solution.
- the adjusting effect obtainable with hydrogen peroxide is rather limited.
- the required high pH is ecologically undesirable.
- the present invention accordingly relates to a method for adjusting the colour tone of dyed cellulosic textile fibre material comprising contacting said textile material with an enzymatic textile treatment composition comprising
- a hydrogen peroxide source (iii) a hydrogen peroxide source.
- the enzymatic treatment step of the present invention will employ, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, and biochemistry, which are within the skill of the art. Such techniques are explained fully in the literature, for example, Molecular Cloning: A Laboratory Manual, 2 nd ed., (Sambrook et al., 1989); Oligonucleotide Synthesis (MJ. Gait, ed., 1984); Current Protocols in Molecular Biology (F. M. Ausubel et al., eds., 1994); PCR: The Polymerase Chain Reaction (MuIMs et al., eds., 1994); and Gene Transfer and Expression: A Laboratory Manual (Kriegler, 1990).
- nucleic acids are written left to right in 5' to 3' orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively.
- adjusting means the process of treating a textile material for a sufficient length of time and under appropriate pH and temperature conditions to produce a lighter colour in said textile material by removal, modification or masking of colour-causing compounds in the textile material.
- adjusting refers to the treatment of a textile material to effect a brightening of the textile material.
- brightening is defined as a percentage of colour removal from the textile material.
- the amount of colour removal can be determined by comparing the colour level can be determined by comparing the colour level following treatment with an enzymatic textile treatment composition according to the invention (i.e. residual colour level) to the colour level of the starting textile material (i.e. original colour level) using known spectrophotometric or visual inspection methods.
- original colour level refers to the colour level of a dyed textile material prior to contact with an enzymatic textile treatment composition according to the invention.
- Original colour level may be measured using known spectrophotometric or visual inspection methods.
- residual colour level refers to the colour level of a dyed textile material after contact with an enzymatic textile treatment composition according to the invention. Residual colour level may be measured using known spectrophotometric or visual inspection methods.
- cellulosic textile fibre material refers to a material that comprises natural cellulosic fibres such as cotton, linen and hemp, semi-synthetic cellulosic fibres such as viscose and lyocell as well as blends of cellulosic fibres and synthetic fibres such as elastane.
- Suitable cellulosic textile fibre material substrates that can be treated with the method according to the invention are yarns, wovens, knits and garments.
- a perhydrolase refers to an enzyme that is capable of catalyzing a perhydrolysis reaction that results in the production of a sufficiently high amount of peracid suitable for use in an enzymatic textile adjusting composition according to the method described herein.
- a perhydrolase enzyme used in the methods described herein exhibits a high perhydrolysis to hydrolysis ratio.
- the perhydrolase comprises, consists of, or consists essentially of the Mycobacterium smegmatis perhydrolase amino acid sequence set forth in SEQ ID NO: 1 , or a variant or homolog thereof.
- the perhydrolase enzyme comprises acyl transferase activity and catalyzes an aqueous acyl transfer reaction.
- an "ester substrate” is a perhydrolase substrate that contains an ester linkage. Esters comprising aliphatic and/or aromatic carboxylic acids and alcohols may be utilized as substrates with perhydrolase enzymes.
- the ester source is selected from the esters of one or more of the following acids: formic acid, acetic acid, propionic acid, butyric acid, valeric acid, caproic acid, caprylic acid, nonanoic acid, decanoic acid, dodecanoic acid, myristic acid, palmitic acid, stearic acid, and oleic acid.
- the ester source is an acetate ester. In some embodiments, the ester source is selected from one or more of propylene glycol diacetate, ethylene glycol diacetate, glycerol triacetate, ethyl acetate, and glycerol tributyrate.
- perhydrolyzation As used here, the terms “perhydrolyzation,” “perhydrolyze” and “perhydrolysis” refer to a reaction wherein a peracid is generated from an ester substrate and a hydrogen peroxide source. The perhydrolyzation reaction is catalyzed with a perhydrolase, e.g., acyl transferase or aryl esterase, enzyme.
- -OR * is -OH.
- -OR * is replaced by -NH 2 .
- a peracid is produced by perhydrolysis of a carboxylic acid or amide substrate.
- peracid refers to a molecule derived from, or capable of being derived from, a carboxylic acid ester which has been reacted with hydrogen peroxide to form a highly reactive product that is able to transfer one of its oxygen atoms. It is this ability to transfer oxygen atoms that enables a peracid, for example, peracetic acid, to function as a brightening agent.
- perhydrolysis to hydrolysis ratio refers to the ratio of the amount of enzymatically produced peracid to the amount of enzymatically produced acid by a perhydrolase enzyme from an ester substrate under defined conditions and within a defined time.
- the assays provided in WO 05/056782 are used to determine the amounts of peracid and acid produced by the enzyme.
- an effective amount of perhydrolase enzyme refers to the quantity of perhydrolase enzyme necessary to achieve the enzymatic activity required in the processes or methods described herein. Such effective amounts are readily ascertained by one of ordinary skill in the art and are based on many factors, such as the particular enzyme variant used, the pH used, the temperature used and the like, as well as the results desired (e.g., level of brightening).
- transferase refers to an enzyme that catalyzes the transfer of a functional group from one substrate to another substrate.
- an acyl transferase may transfer an acyl group from an ester substrate to a hydrogen peroxide substrate to form a peracid.
- acyl refers to an organic group with the general formula RCO-, derived from an organic acid by removal of the -OH group.
- acyl group names end with the suffix "-oyl,” e.g., ethanoyl chloride, CH 3 CO-CI, is the acyl chloride formed from ethanoic acid, CH 3 CO-OH.
- acylation refers to a chemical transformation in which one of the substituents of a molecule is substituted by an acyl group, or the process of introduction of an acyl group into a molecule.
- an "oxidizing chemical” is a chemical capable of brightening a textile.
- the oxidizing chemical is present at an amount, pH and temperature suitable for brightening.
- the term includes, but is not limited to hydrogen peroxide and peracids.
- the terms “purified” and “isolated” refer to the removal of contaminants from a sample and/or to a material (e.g., a protein, nucleic acid, cell, etc.), such that the sample or material is removed from at least one component with which it is naturally associated.
- a material e.g., a protein, nucleic acid, cell, etc.
- these terms may refer to a material which is substantially or essentially free from components which normally accompany it as found in its native state, such as, for example, an intact biological system.
- polynucleotide refers to a polymeric form of nucleotides of any length and any three-dimensional structure and single- or multi-stranded (e.g., single-stranded, double-stranded, triple-helical, etc.), which contain deoxyribonucleotides, ribonucleotides, and/or analogs or modified forms of deoxyribonucleotides or ribonucleotides, including modified nucleotides or bases or their analogs. Because the genetic code is degenerate, more than one codon may be used to encode a particular amino acid, and the polynucleotides applied applied within the context of the present invention encode a particular amino acid sequence.
- any type of modified nucleotide or nucleotide analog may be used, so long as the polynucleotide retains the desired functionality under conditions of use, including modifications that increase nuclease resistance (e.g., deoxy, 2'-0-Me, phosphorothioates, etc.).
- Labels may also be incorporated for purposes of detection or capture, for example, radioactive or nonradioactive labels or anchors, e.g., biotin.
- polynucleotide also includes peptide nucleic acids (PNA). Polynucleotides may be naturally occurring or non-naturally occurring.
- Polynucleotide and “nucleic acid” and “oligonucleotide” are used herein interchangeably.
- Polynucleotides of the invention may contain RNA, DNA, or both, and/or modified forms and/or analogs thereof.
- a sequence of nucleotides may be interrupted by non-nucleotide components.
- One or more phosphodiester linkages may be replaced by alternative linking groups.
- linking groups include, but are not limited to, embodiments wherein phosphate is replaced by P(O)S ("thioate”), P(S)S ("dithioate”), (O)NR 2 ("amidate"), P(O)R, P(O)OR', CO or CH 2 ("formacetal"), in which each R or R' is independently H or substituted or unsubstituted alkyl (CrC 20 ) optionally containing an ether (-0-) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or araldyl. Not all linkages in a polynucleotide need be identical. Polynucleotides may be linear or circular or comprise a combination of linear and circular portions. Suitable polynucleotides are described in WO 2005/056782.
- polypeptide refers to any composition comprised of amino acids and recognized as a protein by those of skill in the art.
- the conventional one-letter or three-letter code for amino acid residues is used herein.
- polypeptide and protein are used interchangeably herein to refer to polymers of amino acids of any length.
- the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids.
- the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
- polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids, etc.
- homologous sequence As used herein, the terms "analogous sequence,” “homologous protein,” “wild-type or native proteins,” “wild-type sequence,” “native sequence,” “naturally-occuring sequence,” “wild-type gene,” “related proteins,” “derivative proteins,” “variant proteins” and the like, are familiar to those skilled in the art and are described in more detail in WO 2005/056782 on pages 12, 13 and 50 to 52, which are herein incorporated by reference. In some embodiments, homologous proteins are engineered to produce enzymes with desired activity(ies).
- the degree of homology between sequences may be determined using any suitable method known in the art.
- PILEUP is a useful program to determine sequence homology levels. PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments. It can also plot a tree showing the clustering relationships used to create the alignment.
- Another example of a useful algorithm is the BLAST algorithm. Useful methods and programs are referred to in WO 2005/056782 on pages 59 and 60, which are herein incorporated by reference.
- surfactant refers to a substance that reduces surface tension of a liquid.
- emulsifier refers to a substance that promotes the suspension of one liquid in another.
- the term “sequestering agent” refers to a substance capable of reacting with metallic ions by forming a water-soluble complex in which the metal is held in a non-ionizable form.
- the term “catalase” refers to an enzyme (i.e., a polypeptide having catalytic activity) that catalyzes the decomposition of hydrogen peroxide to water and oxygen.
- the term “batch process” or “batchwise process” or “discontinuous process” or “exhaust process” refers to processing of textiles as lots or batches in which the whole of each batch is subjected to a process or one stage of a process at a time.
- liquid ratio refers to the ratio of the weight of liquor (liquid) employed in a textile treatment process to the weight of the textile treated.
- the enzymatic colour tone adjusting composition used in accordance with the enzymatic textile adjusting method of the present invention contain a perhydrolase enzyme, an ester substrate for the perhydrolase enzyme suitable for production of a peracid upon catalytic reaction of the perhydrolase enzyme on the substrate in the presence of a hydrogen peroxide source and/or hydrogen peroxide.
- the enzymatic colour tone adjusting composition may, optionally, further contain a surfactant and/or an emulsifier, a peroxide stabilizer, a fluorescence whitening agent, an enzymatic desizing agent, a biopolishing agent, a combination product, a sequestering agent or a buffer which maintains a pH of about 6 to about 8 during a textile colour tone adjusting process.
- One or more perhydrolase enzymes may be used in the compositions according to the methods for enzymatic textile colour tone adjusting as described herein.
- the perhydrolase enzyme is naturally-occurring (i.e., a perhydrolase enzyme encoded by a genome of a cell).
- the perhydrolase enzyme comprises, consists of, or consists essentially of an amino acid sequence that is at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical to the amino acid sequence of a naturally-occurring perhydrolase enzyme.
- the perhydrolase enzyme is a naturally-occurring M. smegmatis perhydrolase enzyme.
- the perhydrolase enzyme comprises, consists of, or consists essentially of the amino acid sequence set forth in SEQ ID NO:1 or a variant or homologue thereof. In some embodiments, the perhydrolase enzyme comprises, consists of, or consists essentially of an amino acid sequence that is at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical to the amino acid sequence set forth in SEQ ID NO:1.
- M. smegmatis perhydrolase The amino acid sequence of M. smegmatis perhydrolase is shown below: MAKRILCFGDSLTWGWVPVEDGAPTERFAPDVRWTGVLAQQLGADFEVIEEGLSARTTNID DPTDPRLNGASYLPSCLATHLPLDLVIIMLGTNDTKAYFRRTPLDIALGMSVLVTQVLTSAGG VGTTYPAPKVLVVSPPPLAPMPHPWFQLIFEGGEQKTTELARVYSALASFMKVPFFDAGSVI STDGVDGIHFTEANNRDLGVALAEQVRSLL (SEQ ID NO:1 ).
- the perhydrolase enzyme comprises one or more substitutions at one or more amino acid positions equivalent to position(s) in the M. smegmatis perhydrolase amino acid sequence set forth in SEQ ID NO:1.
- the perhydrolase enzyme comprises any one or any combination of substitutions of amino acids selected from M1 , K3, R4, 15, L6, C7, D10, S11 , L12, T13, W14, W16, G15, V17, P18, V19, D21 , G22, A23, P24, T25, E26, R27, F28, A29, P30, D31 , V32, R33, W34, T35, G36, L38, Q40, Q41 , D45, L42, G43, A44, F46, E47, V48, I49, E50, E51 , G52, L53, S54, A55, R56, T57, T58, N59, I60, D61 , D62, P63, T
- the perhydrolase enzyme comprises one or more of the following substitutions at one or more amino acid positions equivalent to position(s) in the M. smegmatis perhydrolase amino acid sequence set forth in SEQ ID NO:1 : L12C, Q, or G; T25S, G, or P; L53H, Q, G, or S; S54V, L A, P, T, or R; A55G or T; R67T, Q, N, G, E, L, or F; K97R; V125S, G, R, A, or P; F154Y; F196G.
- the perhydrolase enzyme is the S54V variant of SEQ ID NO: 1 , which is shown, below as SEQ ID NO: 3, wherein the S54V substitution is underlined.
- M. smegmatis perhydrolase The amino acid sequence of M. smegmatis perhydrolase is shown below: MAKRILCFGDSLTWGWVPVEDGAPTERFAPDVRWTGVLAQQLGADFEVIEEGLVARTTNID DPTDPRLNGASYLPSCLATHLPLDLVIIMLGTNDTKAYFRRTPLDIALGMSVLVTQVLTSAGG VGTTYPAPKVLVVSPPPLAPMPHPWFQLIFEGGEQKTTELARVYSALASFMKVPFFDAGSVI STDGVDGIHFTEANNRDLGVALAEQVRSLL (SEQ ID NO: 3).
- the perhydrolase enzyme comprises a combination of amino acid substitutions at amino acid positions equivalent to amino acid positions in the M. smegmatis perhydrolase amino acid sequence set forth in SEQ ID NO:1 : L12I S54V; L12M S54T; L12T S54V; L12Q T25S S54V; L53H S54V; S54P V125R; S54V V125G; S54V F196G; S54V K97R V125G; or A55G R67T K97R V125G.
- the perhydrolase enzyme comprises a perhydrolysis to hydrolysis ratio of at least 1. In some embodiments, the perhydrolase enzyme comprises a perhydrolysis to hydrolysis ratio greater than 1.
- the perhydrolase enzyme is provided in the enzymatic textile colour tone adjusting composition used according to the textile colour tone adjusting method of the present invention at a concentration of about 0.5 to about 2.5 ppm, about 1.5 to about 2.0 ppm, for example, about 1.7 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
- the enzymatic colour tone adjusting compositions used in accordance with the method described herein include an ester which serves as a substrate for the perhydrolase enzyme for production of a peracid in the presence of hydrogen peroxide.
- the ester substrate is an ester of an aliphatic and/or aromatic carboxylic acid.
- the ester substrate is an ester of one or more of the following: formic acid, acetic acid, propionic acid, butyric acid, valeric acid, caproic acid, caprylic acid, nonanoic acid, decanoic acid, dodecanoic acid, myristic acid, palmitic acid, stearic acid, and oleic acid.
- glycerol triacetate, glycerol tributyrate, and other esters serve as acyl donors for peracid formation.
- the ester substrate is selected from propylene glycol diacetate, ethylene glycol diacetate, glycerol triacetate, ethyl acetate, and glycerol tributyrate.
- the ester substrate is propylene glycol diacetate, ethylene glycol diacetate, or ethyl acetate.
- the ester substrate is propylene glycol diacetate.
- the ester substrate for example, propylene glycol diacetate
- the ester substrate is provided at a concentration of about 2000 to about 4000 ppm, about 2500 to about 3500 ppm, about 2800 ppm to about 3200 ppm, or about 3000 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
- the enzymatic colour tone adjusting compositions used in accordance with the method described herein include a hydrogen peroxide source.
- Hydrogen peroxide can be either added directly in batch, or generated continuously “in situ” by chemical, electro-chemical, and/or enzymatic means.
- the hydrogen peroxide source is hydrogen peroxide.
- the hydrogen peroxide source is a solid compound that generates hydrogen peroxide spontaneously upon addition to water.
- Such compounds include adducts of hydrogen peroxide with various inorganic or organic compounds, of which the most widely employed is sodium carbonate perhydrate, also referred to as sodium percarbonate.
- Inorganic perhydrate salts are one embodiment of hydrogen peroxide source.
- Examples of inorganic perhydrate salts include perborate, percarbonate, perphosphate, persulfate and persilicate salts.
- the inorganic perhydrate salts are normally the alkali metal salts.
- hydrogen peroxide adducts useful in the compositions used in accordance with the method described herein include adducts of hydrogen peroxide with zeolites, or urea hydrogen peroxide.
- the hydrogen peroxide source compounds may be included as the crystalline and/or substantially pure solid without additional protection.
- the preferred executions of such granular compositions utilize a coated form of the material which provides better storage stability for the perhydrate salt in the granular product.
- Suitable coatings comprise inorganic salts such as alkali metal silicate, carbonate or borate salts or mixtures thereof, or organic materials such as waxes, oils, or fatty soaps.
- the hydrogen peroxide source is an enzymatic hydrogen peroxide generation system.
- the enzymatic hydrogen peroxide generation system comprises an oxidase and its substrate.
- Suitable oxidase enzymes include, but are not limited to: glucose oxidase, sorbitol oxidase, hexose oxidase, choline oxidase, alcohol oxidase, glycerol oxidase, cholesterol oxidase, pyranose oxidase, carboxyalcohol oxidase, L-amino acid oxidase, glycine oxidase, pyruvate oxidase, glutamate oxidase, sarcosine oxidase, lysine oxidase, lactate oxidase, vanillyl oxidase, glycolate oxidase, galactose oxidase, uri
- Perhydrolase H 2 O 2 + ester substrate -> alcohol + peracid It is not intended that the present invention be limited to any specific enzyme, as any enzyme that generates H 2 O 2 with a suitable substrate may be used in the present invention.
- any enzyme that generates H 2 O 2 with a suitable substrate may be used in the present invention.
- lactate oxidases from Lactobacillus species which are known to create H 2 O 2 from lactic acid and oxygen may be used.
- acid e.g., gluconic acid in the above example
- enzymes e.g., alcohol oxidase, ethylene glycol oxidase, glycerol oxidase, amino acid oxidase, etc.
- ester substrates in combination with the perhydrolase enzymes of the present invention to generate peracids.
- the hydrogen peroxide generating oxidase is a carbohydrate oxidase.
- Hydrogen peroxide may also be generated electrochemically, for example using a fuel cell fed oxygen and hydrogen gas.
- the hydrogen peroxide source is hydrogen peroxide provided at a concentration of about 1000 to about 3200 ppm, about 1500 to about 2800 ppm, about 2000 ppm to about 2200 ppm, or about 2100 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
- the enzymatic textile colour tone adjusting compositions used in accordance with the present method may contain one or more, i.e., at least one surfactant and/or at least one emulsifier.
- Surfactants suitable for use in practicing the present invention include, without limitation, nonionic (see, e.g., U.S. Pat. No. 4,565,647, which is herein incorporated by reference); anionic; cationic; and zwitterionic surfactants (see, e.g., U.S. Pat. No. 3,929,678 which is herein incorporated by reference).
- Anionic surfactants include, without limitation, linear alkylbenzenesulfonate, ⁇ -olefinsulfonate, alkyl sulfate (fatty alcohol sulfate), alcohol ethoxysulfate, secondary alkanesulfonate, alpha-sulfo fatty acid methyl ester, alkyl- or alkenylsuccinic acid, and soap.
- Non-ionic surfactants include, without limitation, fatty alcohol ethoxylate, isotridecanol ethoxylate, nonylphenol ethoxylate, alkylpolyglycoside, alkyldimethylamineoxide, ethoxylated fatty acid monoethanolamide, fatty acid monoethanolamide, polyhydroxy alkyl fatty acid amide, and N-acyl N-alkyl derivatives of glucosamine (“glucamides”).
- the surfactant and/or emulsifier comprises a non-ionic surfactant.
- the non-ionic surfactant is a fatty alcohol ethoxylate.
- the non-ionic surfactant is isotridecanol ethoxylate.
- the non-ionic surfactant is a fatty alcohol ethoxylate and isotridecanol ethoxylate.
- the composition used in accordance with the present method comprises a surfactant and an emulsifier.
- a surfactant may be present at a concentration of about 300 ppm to about 4800 ppm, about 600 ppm to about 3600 ppm, or about 300 ppm to about 1200 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
- the enzymatic colour tone adjusting composition contains isotridecanol ethoxylate at a concentration of about 300 ppm to about 3600 ppm, about 600 ppm to about 3000 ppm, or about 900 ppm to about 2400 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
- the enzymatic colour tone adjusting compositions used in accordance with the method described herein may contain a peroxide stabilizer.
- peroxide stabilizers include, but are not limited to, sodium silicate, sodium carbonate, acrylic polymers, magnesium salts, and phosphonic acid.
- the peroxide stabilizer is phosphonic acid.
- a peroxide stabilizer may be present in the enzymatic textile colour tone adjusting composition at a concentration of about 60 ppm to about 600 ppm, about 60 ppm to about 1200 ppm, or about 120 ppm to about 960 ppm based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
- At least one surfactant and/or emulsifier, at least one peroxide stabilizer and at least one sequestering agent are applied as a combination product containing each of at least one surfactant and/or emulsifier, at least one peroxide stabilizer and at least one sequestering agent.
- the said combination product is designated bleaching processor and is commercially available, for example, CLARITE ® LTC, CLARITE ® WIN or CLARITE ® ONE (products of Huntsman).
- a surfactant may be present at a concentration of about 5% to about 40%, about 20% to about 30%, or about 5% to about 10%, based on the total weight of the bleaching processor.
- a peroxide stabilizer may be present in the combination product at a concentration of about 1 % to about 5%, about 1 % to about 10%, or about 2% to about 8%, based on the total weight of the bleaching processor.
- a sequestering agent may be present in the bleaching processor at a concentration of about 1 % to about 15%, about 5% to about 10%, or about 3% to about 10%, based on the total weight of the bleaching processor.
- the bleaching processor contains isotridecanol ethoxylate at a concentration of about 5% to about 30%, about 10% to about 25%, or about 15% to about 20%, based on the total weight of the bleaching processor.
- the bleaching processor is suitably provided as an aqueous composition comprising the above indicated components.
- the enzymatic colour tone adjusting composition may contain a buffer that is capable of maintaining the pH of the composition at a pH of about 6 to about 8.
- the buffer may be, for example, a phosphate buffer, pH 7, or a sodium carbonate or potassium carbonate, pH 7.
- the method according to the invention is particularly suitable for the treatment of denim dyed with vat dyes, reactive dyes, direct dyes and sulphur dyes, most preferably for indigo-dyed denim and/or sulfur-dyed denim.
- the method provides textile material with a soft handle and very good crease recovery properties compared to textiles treated using conventional methods.
- the methods described herein are particularly carried out as a discontinuous process but can also be carried out as a semi-continuous process like pad-batch or pad-roll.
- the method of the invention utilizes a liquor ratio of about 2:1 to about 50:1 , about 5:1 to about 20:1 , for example, about 20:1 or 10:1.
- Textiles are contacted with the enzymatic colour tone adjusting composition at a temperature of about 55°C to about 75 0 C, about 60 0 C to about 70 0 C, for a processing time of about 20 to about 60 minutes at a pH of about 6 to about 8.
- the treatment temperature is about 65°C and the processing time is about 50 minutes.
- the temperature of the enzymatic colour tone adjusting composition is raised by about 2°C per minute from a starting temperature of about 20 0 C to about 50 0 C, for example, about 20 0 C to about 40°C, until the processing temperature for colour tone adjusting is reached.
- One or more rinsing steps are performed after treatment of the textile material with the enzymatic colour tone adjusting composition, to remove the colour tone adjusting composition.
- the textile is rinsed with an aqueous composition (water or a composition containing water).
- the rinsing temperature is about 40°C to about 60°C, for example, about 50°C.
- the aqueous rinsing composition contains a catalase enzyme to catalyze the decomposition of hydrogen peroxide to water and oxygen.
- the textile is rinsed twice with a catalase containing aqueous composition for about 10 minutes for each rinse.
- residual hydrogen peroxide is removed by rinsing twice with an aqueous composition containing catalase at about 50 0 C.
- catalase may be added directly to the liquor containing the perhydrolase enzyme without first dropping the bath.
- the enzymes that hydrolyze polyester substrates suitable for use in the present invention may be used, for example, pectinases, cutinases or lipases. These enzymes, their application as well as assays to determine enzyme activity are described and referred to in more detail in WO 2007/136469 on pages 21 and 22, which are herein incorporated by reference.
- amylases deizing agents
- cellulases biopolishing agents
- a comparison between the method of the present invention and conventional oxidation bleach with hydrogen peroxide is performed according to the procedures given below by treating the fabric in exhaust using a Mathis AG Labomat.
- Indigo dyed denim swatches (length: 11 cm, width: 9.5 cm), washed at 65 °C/5 min and cold in overflow/5 min, are treated in a bath containing the combination product, the buffer, propylene glycol diacetate, hydrogen peroxide and the perhydrolase enzyme in the amounts given in
- Table 1 using a liquor ratio of 10:1.
- the temperature is raised from ambient temperature to a target temperature of 65°C at a rate of 2°C per minute.
- the bath is then held at 65°C for 5 0 minutes and after cooling and draining the swatches are rinsed twice for 10 minutes each at
- Alkali colour tone adjusting (Comparative Example 3) carried out as a one-bath exhaustion method: The procedure described above is repeated, but perhydrolase enzyme and phosphate buffer are replaced with sodium hydroxide.
- CLARITE ® GS bleaching processor (commercial product supplied by Huntsman)
- Indigo dyed denim swatches (length: 1 1 cm, width: 9.5 cm), desized at 10:1 liquor ratio, 60
- non-ionic surfactant commercial product supplied by Huntsman
- INVAZYME ® LTE perhydrolase enzyme
- the denim is stonewashed in a rotary washing machine with 1 kg of pumice stones (60 °C/40 min). Subsequently, 1.0 g/l CLARITE ® LTC (combination product, supplied by Huntsman), 2.5 g/l of soda ash, 3.0 g/l of propylene glycol diacetate, 3.0 g/l of hydrogen peroxide and 1.0 g/l of INVAZYME ® LTE (perhydrolase enzyme) are added to the liquor.
- the bath is then held at 65°C for 50 minutes and after cooling and draining the swatches are rinsed twice for 15 minutes each at 50 0 C with a bath containing 0.5 g/l INVAZYME ® CAT (stabilized liquid catalase enzyme to remove residual peroxide) and afterwards for 15 min with a bath containing 1.0 g/l of a softening agent (Turpex CAN new) at room temperature, and then dried.
- the denim swatches thus obtained have a soft handle and very good crease recovery properties.
- Perhydrolase (PrimaGreen® EcoWhite 1 (321 U/g), available from Genencor Division, Danisco US, Inc.), is used in this experiment. H 2 O 2 analysis grade (30 wt %) and propylene glycol diacetate >99.7% (PDGA) were purchased from Sigma Aldrich.
- the denim is stonewashed in a Unimac UF 50 rotary washing machine according to the following program:
- the denim is dried in a household dryer and then used to make swatches (7 x 7 cm).
- Perhydrolase is added at concentrations of 0. 01 , 0. 05, 0. 3, 1.0, 3.0, or 10 ml/l.
- reaction vessels are closed and loaded into the launder-O-meter, which is pre-heated to 60 0 C.
- reaction vessels are closed and loaded into the Launder-O-Meter which was pre-heated to 6O 0 C
- Incubation is performed for 60 minutes, after which the swatches are rinsed by overflow, spun dry in an AEG IPX4 centrifuge, and dried with an Elna Press Electronic iron at program cotton, and evaluated.
- Denim, 12 legs (ACG denim style 80270) weighing approximately 3 kg, is desized and stonewashed as described in Example 5. After stonewashing, the experiments are performed in a Launder-O-meter (Rapid Laboratory Dyeing Machine type H 12) according to the following process.
- Denim, 12 legs (ACG denim style 80270) weighing approximately 3 kg, is desized and stonewashed as described in Example 5. After stonewashing, the experiments are performed in a Launder-O-meter (Rapid Laboratory Dyeing Machine type H 12) according to the following process.
- the denim is dried in a household dryer.
- UF 50 washing machine under the following conditions: • Desizing for 15 minutes at 10:1 liquor ratio 50 0 C with 0.5 g/l (15 g) of Optisize ® 160 amylase (Genencor) and 0.5 g/l (15 g) of a non-ionic surfactant (Ultravon ® RW (Huntsman).
- the denim is stonewashed in a Unimac UF 50 rotary washing machine according to the following procedure:
- laccase treatment is performed in a Unimac UF 50 washing machine according to the following process:
- the denim is dried in a household dryer.
- Perhydrolase S54V variant of M smegmatis, containing 1.5 mg/g active protein
- Hydrogen peroxide analytical grade; 30% w/w
- propylene glycol diacetate >99.7%
- Standard dyed fabrics are obtained from the Center for Test Materials, Vlaardingen, The Netherlands.
- the fabrics are dyed with one of the dyes (or combinations of dyes) listed in Table 15, which are identified by their Color Index (Cl) number according to the Society of Dyers and Colourists (UK) and by the American Association of Textile Chemists and Colorists (USA).
- each swatches of dyed fabric (see Table 9) of approximately 12.5 cm x 12.5 cm are treated in a Launder-O-Meter (Rapid Laboratory Dyeing Machine type H 12) according to the following procedure:
- TCD V ( ⁇ L) 2 + ( ⁇ a) 2 + ( ⁇ b) 2 .
- the ⁇ values are the difference between the fabric before treatment and the fabric after treatment.
- the TCD * values are the difference between the values obtained for the blank values and for the perhydrolase treatment.
Landscapes
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Organic Chemistry (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Wood Science & Technology (AREA)
- Textile Engineering (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Inorganic Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Emergency Medicine (AREA)
- Detergent Compositions (AREA)
- Chemical Or Physical Treatment Of Fibers (AREA)
- Enzymes And Modification Thereof (AREA)
- Coloring (AREA)
- Treatments For Attaching Organic Compounds To Fibrous Goods (AREA)
Abstract
A method for adjusting the colour tone of dyed cellulosic textile fibre material comprising contacting said textile material with an enzymatic textile treatment composition comprising (i) a perhydrolase enzyme, (ii) an ester substrate for said perhydrolase enzyme, and (iii) a hydrogen peroxide source, for a length of time and under conditions suitable to permit measurable brightening of the textile material.
Description
Enzymatic Textile Colour Modification
The present application claims priority to U.S. Provisional Application Serial No. 61/223,348, filed on July 7, 2009, U.S. Provisional Application Serial No. 61/322,743, filed on April 9, 2010, European Patent Application No. 09162047.6, filed on June 5, 2009 and European Patent Application No. 09163751.2, filed on June 25, 2009, which are hereby incorporated by reference in their entirety.
The present invention relates to methods for the enzymatic colour modification of dyed cellulosic textile fibre material, in particular denim dyed with indigo or sulphide dyes.
Some textile materials are washed after dyeing with the objective of adjusting the colour tone or shade on the dyed textile, also known as washdown effect. For instance, blue jeans made from indigo-dyed denim can be washed in the presence of pumice stones and enzymatic desizing agents, followed by an on tone-washdown process to obtain a desired worn appearance. Conventional washdown processes comprise treatment of the coloured denim with sodium hypochlorite, which is undesirable in view of the appearance of fibre damages and because of ecological reasons.
Washdown with hydrogen peroxide is an alternative solution. The adjusting effect obtainable with hydrogen peroxide, however, is rather limited. Furthermore, the required high pH is ecologically undesirable.
An enzymatic washdown process which does not show the above indicated disadvantages would be desirable.
There is a need for an effective enzymatic washdown process for coloured cotton textiles which provides the desired wash-out effect under mild conditions and minimizes the adverse environmental impact, when compared to conventional textile colour modification processes.
The present invention accordingly relates to a method for adjusting the colour tone of dyed cellulosic textile fibre material comprising contacting said textile material with an enzymatic textile treatment composition comprising
(i) a perhydrolase enzyme,
(ii) an ester substrate for said perhydrolase enzyme, and
(iii) a hydrogen peroxide source.
The enzymatic treatment step of the present invention will employ, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, and biochemistry, which are within the skill of the art. Such techniques are explained fully in the literature, for example, Molecular Cloning: A Laboratory Manual, 2nd ed., (Sambrook et al., 1989); Oligonucleotide Synthesis (MJ. Gait, ed., 1984); Current Protocols in Molecular Biology (F. M. Ausubel et al., eds., 1994); PCR: The Polymerase Chain Reaction (MuIMs et al., eds., 1994); and Gene Transfer and Expression: A Laboratory Manual (Kriegler, 1990).
Unless defined otherwise herein, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains.
Singleton, et al., Dictionary of Microbiology and Molecular Biology, 2nd ed., John Wiley and Sons, New York (1994), and Hale & Markham, The Harper Collins Dictionary of Biology, Harper Perennial, New York (1991 ) provide one of skill in the art with a general dictionary of many of the biotechnology related terms used in this invention. Any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention.
Numeric ranges provided herein are inclusive of the numbers defining the range.
Unless otherwise indicated, nucleic acids are written left to right in 5' to 3' orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively.
The following terms and phrases are defined for clarity:
As used here, the term "adjusting" means the process of treating a textile material for a sufficient length of time and under appropriate pH and temperature conditions to produce a lighter colour in said textile material by removal, modification or masking of colour-causing compounds in the textile material. Thus, "adjusting" refers to the treatment of a textile material to effect a brightening of the textile material.
In some embodiments, brightening is defined as a percentage of colour removal from the textile material. The amount of colour removal can be determined by comparing the colour
level can be determined by comparing the colour level following treatment with an enzymatic textile treatment composition according to the invention (i.e. residual colour level) to the colour level of the starting textile material (i.e. original colour level) using known spectrophotometric or visual inspection methods.
As used here, the term "original colour level" refers to the colour level of a dyed textile material prior to contact with an enzymatic textile treatment composition according to the invention. Original colour level may be measured using known spectrophotometric or visual inspection methods.
As used here, the term "residual colour level" refers to the colour level of a dyed textile material after contact with an enzymatic textile treatment composition according to the invention. Residual colour level may be measured using known spectrophotometric or visual inspection methods.
As used here, the term "cellulosic textile fibre material" refers to a material that comprises natural cellulosic fibres such as cotton, linen and hemp, semi-synthetic cellulosic fibres such as viscose and lyocell as well as blends of cellulosic fibres and synthetic fibres such as elastane. Suitable cellulosic textile fibre material substrates that can be treated with the method according to the invention are yarns, wovens, knits and garments.
As used here, a "perhydrolase" refers to an enzyme that is capable of catalyzing a perhydrolysis reaction that results in the production of a sufficiently high amount of peracid suitable for use in an enzymatic textile adjusting composition according to the method described herein. Generally, a perhydrolase enzyme used in the methods described herein exhibits a high perhydrolysis to hydrolysis ratio. In some embodiments, the perhydrolase comprises, consists of, or consists essentially of the Mycobacterium smegmatis perhydrolase amino acid sequence set forth in SEQ ID NO: 1 , or a variant or homolog thereof. In some embodiments, the perhydrolase enzyme comprises acyl transferase activity and catalyzes an aqueous acyl transfer reaction.
As used here, a "peracid" is an organic acid of the formula RC(=O)OOH, wherein R is an aliphatic, aromatic or araliphatic radical.
- A -
As used here, an "ester substrate" is a perhydrolase substrate that contains an ester linkage. Esters comprising aliphatic and/or aromatic carboxylic acids and alcohols may be utilized as substrates with perhydrolase enzymes. In some embodiments, the ester source is selected from the esters of one or more of the following acids: formic acid, acetic acid, propionic acid, butyric acid, valeric acid, caproic acid, caprylic acid, nonanoic acid, decanoic acid, dodecanoic acid, myristic acid, palmitic acid, stearic acid, and oleic acid. In some embodiments, the ester source is an acetate ester. In some embodiments, the ester source is selected from one or more of propylene glycol diacetate, ethylene glycol diacetate, glycerol triacetate, ethyl acetate, and glycerol tributyrate.
As used here, the terms "perhydrolyzation," "perhydrolyze" and "perhydrolysis" refer to a reaction wherein a peracid is generated from an ester substrate and a hydrogen peroxide source. The perhydrolyzation reaction is catalyzed with a perhydrolase, e.g., acyl transferase or aryl esterase, enzyme. In some embodiments, a peracid is produced by perhydrolysis of an ester substrate of the formula RC(=O)OR*, where R and R* are the same or different organic moieties, in the presence of hydrogen peroxide (H2O2). In one embodiment, -OR* is -OH. In one embodiment, -OR* is replaced by -NH2. In some embodiments, a peracid is produced by perhydrolysis of a carboxylic acid or amide substrate.
As used here, the term "peracid," as used herein, refers to a molecule derived from, or capable of being derived from, a carboxylic acid ester which has been reacted with hydrogen peroxide to form a highly reactive product that is able to transfer one of its oxygen atoms. It is this ability to transfer oxygen atoms that enables a peracid, for example, peracetic acid, to function as a brightening agent.
As used here, the phrase "perhydrolysis to hydrolysis ratio" refers to the ratio of the amount of enzymatically produced peracid to the amount of enzymatically produced acid by a perhydrolase enzyme from an ester substrate under defined conditions and within a defined time. In some embodiments, the assays provided in WO 05/056782 are used to determine the amounts of peracid and acid produced by the enzyme.
As used herein, "effective amount of perhydrolase enzyme" refers to the quantity of perhydrolase enzyme necessary to achieve the enzymatic activity required in the processes or methods described herein. Such effective amounts are readily ascertained by one of ordinary
skill in the art and are based on many factors, such as the particular enzyme variant used, the pH used, the temperature used and the like, as well as the results desired (e.g., level of brightening).
As used herein, the term "transferase" refers to an enzyme that catalyzes the transfer of a functional group from one substrate to another substrate. For example, an acyl transferase may transfer an acyl group from an ester substrate to a hydrogen peroxide substrate to form a peracid.
As used herein, the term "acyl" refers to an organic group with the general formula RCO-, derived from an organic acid by removal of the -OH group. Typically, acyl group names end with the suffix "-oyl," e.g., ethanoyl chloride, CH3CO-CI, is the acyl chloride formed from ethanoic acid, CH3CO-OH.
As used herein, the term "acylation" refers to a chemical transformation in which one of the substituents of a molecule is substituted by an acyl group, or the process of introduction of an acyl group into a molecule.
As used herein, an "oxidizing chemical" is a chemical capable of brightening a textile. The oxidizing chemical is present at an amount, pH and temperature suitable for brightening. The term includes, but is not limited to hydrogen peroxide and peracids.
As used herein, the terms "purified" and "isolated" refer to the removal of contaminants from a sample and/or to a material (e.g., a protein, nucleic acid, cell, etc.), such that the sample or material is removed from at least one component with which it is naturally associated. For example, these terms may refer to a material which is substantially or essentially free from components which normally accompany it as found in its native state, such as, for example, an intact biological system.
As used herein, the term "polynucleotide" refers to a polymeric form of nucleotides of any length and any three-dimensional structure and single- or multi-stranded (e.g., single-stranded, double-stranded, triple-helical, etc.), which contain deoxyribonucleotides, ribonucleotides, and/or analogs or modified forms of deoxyribonucleotides or ribonucleotides, including modified nucleotides or bases or their analogs. Because the genetic code is degenerate, more
than one codon may be used to encode a particular amino acid, and the polynucleotides applied applied within the context of the present invention encode a particular amino acid sequence. Any type of modified nucleotide or nucleotide analog may be used, so long as the polynucleotide retains the desired functionality under conditions of use, including modifications that increase nuclease resistance (e.g., deoxy, 2'-0-Me, phosphorothioates, etc.). Labels may also be incorporated for purposes of detection or capture, for example, radioactive or nonradioactive labels or anchors, e.g., biotin. The term polynucleotide also includes peptide nucleic acids (PNA). Polynucleotides may be naturally occurring or non-naturally occurring. The terms "polynucleotide" and "nucleic acid" and "oligonucleotide" are used herein interchangeably. Polynucleotides of the invention may contain RNA, DNA, or both, and/or modified forms and/or analogs thereof. A sequence of nucleotides may be interrupted by non-nucleotide components. One or more phosphodiester linkages may be replaced by alternative linking groups. These alternative linking groups include, but are not limited to, embodiments wherein phosphate is replaced by P(O)S ("thioate"), P(S)S ("dithioate"), (O)NR2 ("amidate"), P(O)R, P(O)OR', CO or CH2 ("formacetal"), in which each R or R' is independently H or substituted or unsubstituted alkyl (CrC20) optionally containing an ether (-0-) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or araldyl. Not all linkages in a polynucleotide need be identical. Polynucleotides may be linear or circular or comprise a combination of linear and circular portions. Suitable polynucleotides are described in WO 2005/056782.
As used herein, the term "polypeptide" refers to any composition comprised of amino acids and recognized as a protein by those of skill in the art. The conventional one-letter or three-letter code for amino acid residues is used herein. The terms "polypeptide" and "protein" are used interchangeably herein to refer to polymers of amino acids of any length. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids, etc.), as well as other modifications known in the art.
As used herein, the terms "analogous sequence," "homologous protein," "wild-type or native proteins," "wild-type sequence," "native sequence," "naturally-occuring sequence," "wild-type
gene," "related proteins," "derivative proteins," "variant proteins" and the like, are familiar to those skilled in the art and are described in more detail in WO 2005/056782 on pages 12, 13 and 50 to 52, which are herein incorporated by reference. In some embodiments, homologous proteins are engineered to produce enzymes with desired activity(ies).
Several methods are known in the art that are suitable for generating variants of the enzymes described herein, including but not limited to site-saturation mutagenesis, scanning mutagenesis, insertional mutagenesis, random mutagenesis, site-directed mutagenesis, and directed-evolution, as well as various other recombinatorial approaches.
The degree of homology between sequences may be determined using any suitable method known in the art. For example, PILEUP is a useful program to determine sequence homology levels. PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments. It can also plot a tree showing the clustering relationships used to create the alignment. Another example of a useful algorithm is the BLAST algorithm. Useful methods and programs are referred to in WO 2005/056782 on pages 59 and 60, which are herein incorporated by reference.
The terms "substantially similar" and "substantially identical" as generally used in the context of a polynucleotide or polypeptide sequence compared to a reference (i.e., wild-type) sequence as well as methods to determine sequence identity are described in more detail in WO 2005/056782 on pages 61 and 62, which are herein incorporated by reference.
As used herein, the term "surfactant" refers to a substance that reduces surface tension of a liquid.
As used herein, the term "emulsifier" refers to a substance that promotes the suspension of one liquid in another.
As used herein, the term "sequestering agent" refers to a substance capable of reacting with metallic ions by forming a water-soluble complex in which the metal is held in a non-ionizable form.
As used herein, the term "catalase" refers to an enzyme (i.e., a polypeptide having catalytic activity) that catalyzes the decomposition of hydrogen peroxide to water and oxygen.
As used herein, the term the term "batch process" or "batchwise process" or "discontinuous process" or "exhaust process" refers to processing of textiles as lots or batches in which the whole of each batch is subjected to a process or one stage of a process at a time.
As used herein, the term "liquor ratio" refers to the ratio of the weight of liquor (liquid) employed in a textile treatment process to the weight of the textile treated.
The enzymatic colour tone adjusting composition used in accordance with the enzymatic textile adjusting method of the present invention contain a perhydrolase enzyme, an ester substrate for the perhydrolase enzyme suitable for production of a peracid upon catalytic reaction of the perhydrolase enzyme on the substrate in the presence of a hydrogen peroxide source and/or hydrogen peroxide. The enzymatic colour tone adjusting composition may, optionally, further contain a surfactant and/or an emulsifier, a peroxide stabilizer, a fluorescence whitening agent, an enzymatic desizing agent, a biopolishing agent, a combination product, a sequestering agent or a buffer which maintains a pH of about 6 to about 8 during a textile colour tone adjusting process.
In the following the components applied in accordance with the method of the present invention along with information on the quantities of these components are described in more detail. Parts (ppm) are parts by weight, unless noted otherwise.
Perhvdrolase Enzyme
One or more perhydrolase enzymes may be used in the compositions according to the methods for enzymatic textile colour tone adjusting as described herein.
In some embodiments, the perhydrolase enzyme is naturally-occurring (i.e., a perhydrolase enzyme encoded by a genome of a cell). In some embodiments, the perhydrolase enzyme comprises, consists of, or consists essentially of an amino acid sequence that is at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical to the amino acid sequence of a naturally-occurring perhydrolase enzyme.
In some embodiments, the perhydrolase enzyme is a naturally-occurring M. smegmatis perhydrolase enzyme. In some embodiments, the perhydrolase enzyme comprises, consists of, or consists essentially of the amino acid sequence set forth in SEQ ID NO:1 or a variant or homologue thereof. In some embodiments, the perhydrolase enzyme comprises, consists of, or consists essentially of an amino acid sequence that is at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical to the amino acid sequence set forth in SEQ ID NO:1.
The amino acid sequence of M. smegmatis perhydrolase is shown below: MAKRILCFGDSLTWGWVPVEDGAPTERFAPDVRWTGVLAQQLGADFEVIEEGLSARTTNID DPTDPRLNGASYLPSCLATHLPLDLVIIMLGTNDTKAYFRRTPLDIALGMSVLVTQVLTSAGG VGTTYPAPKVLVVSPPPLAPMPHPWFQLIFEGGEQKTTELARVYSALASFMKVPFFDAGSVI STDGVDGIHFTEANNRDLGVALAEQVRSLL (SEQ ID NO:1 ).
The corresponding polynucleotide sequence encoding M. smegmatis perhydrolase is:
5'-ATGGCCAAGCGAATTCTGTGTTTCGGTGATTCCCTGACCTGGGGCTGGGTCC
CCGTCGAAGACGGGGCACCCACCGAGCGGTTCGCCCCCGACGTGCGCTGGACCGGTG
TGCTGGCCCAGCAGCTCGGAGCGGACTTCGAGGTGATCGAGGAGGGACTGAGCGCGC
GCACCACCAACATCGACGACCCCACCGATCCGCGGCTCAACGGCGCGAGCTACCTGC
CGTCGTGCCTCGCGACGCACCTGCCGCTCGACCTGGTGATCATCATGCTGGGCACCAA
CGACACCAAGGCCTACTTCCGGCGCACCCCGCTCGACATCGCGCTGGGCATGTCGGT
GCTCGTCACGCAGGTGCTCACCAGCGCGGGCGGCGTCGGCACCACGTACCCGGCACC
CAAGGTGCTGGTGGTCTCGCCGCCACCGCTGGCGCCCATGCCGCACCCCTGGTTCCA
GTTGATCTTCGAGGGCGGCGAGCAGAAGACCACTGAGCTCGCCCGCGTGTACAGCGC
GCTCGCGTCGTTCATGAAGGTGCCGTTCTTCGACGCGGGTTCGGTGATCAGCACCGAC
GGCGTCGACGGAATCCACTTCACCGAGGCCAACAATCGCGATCTCGGGGTGGCCCTC
GCGGAACAGGTGCGGAGCCTGCTGTAA-3' (SEQ ID NO:2).
In some embodiments, the perhydrolase enzyme comprises one or more substitutions at one or more amino acid positions equivalent to position(s) in the M. smegmatis perhydrolase amino acid sequence set forth in SEQ ID NO:1. In some embodiments, the perhydrolase enzyme comprises any one or any combination of substitutions of amino acids selected from M1 , K3, R4, 15, L6, C7, D10, S11 , L12, T13, W14, W16, G15, V17, P18, V19, D21 , G22, A23, P24, T25, E26, R27, F28, A29, P30, D31 , V32, R33, W34, T35, G36, L38, Q40, Q41 , D45, L42, G43, A44,
F46, E47, V48, I49, E50, E51 , G52, L53, S54, A55, R56, T57, T58, N59, I60, D61 , D62, P63, T64, D65, P66, R67, L68, N69, G70, A71 , S72, Y73, S76, C77, L78, A79, T80, L82, P83, L84, D85, L86, V87, N94, D95, T96, K97, Y99F100, R101 , R102, P104, L105, D106, 1107, A108, L109, G1 10, M11 1 , S1 12, V113, L1 14, V1 15, T1 16, Q1 17, V118, L119, T120, S121 , A122, G124, V125, G126, T127, T128, Y129, P146, P148, W149, F150, 1153, F154, 1194, and F196.
In some embodiments, the perhydrolase enzyme comprises one or more of the following substitutions at one or more amino acid positions equivalent to position(s) in the M. smegmatis perhydrolase amino acid sequence set forth in SEQ ID NO:1 : L12C, Q, or G; T25S, G, or P; L53H, Q, G, or S; S54V, L A, P, T, or R; A55G or T; R67T, Q, N, G, E, L, or F; K97R; V125S, G, R, A, or P; F154Y; F196G.
In some embodiments, the perhydrolase enzyme is the S54V variant of SEQ ID NO: 1 , which is shown, below as SEQ ID NO: 3, wherein the S54V substitution is underlined.
The amino acid sequence of M. smegmatis perhydrolase is shown below: MAKRILCFGDSLTWGWVPVEDGAPTERFAPDVRWTGVLAQQLGADFEVIEEGLVARTTNID DPTDPRLNGASYLPSCLATHLPLDLVIIMLGTNDTKAYFRRTPLDIALGMSVLVTQVLTSAGG VGTTYPAPKVLVVSPPPLAPMPHPWFQLIFEGGEQKTTELARVYSALASFMKVPFFDAGSVI STDGVDGIHFTEANNRDLGVALAEQVRSLL (SEQ ID NO: 3).
In some embodiments, the perhydrolase enzyme comprises a combination of amino acid substitutions at amino acid positions equivalent to amino acid positions in the M. smegmatis perhydrolase amino acid sequence set forth in SEQ ID NO:1 : L12I S54V; L12M S54T; L12T S54V; L12Q T25S S54V; L53H S54V; S54P V125R; S54V V125G; S54V F196G; S54V K97R V125G; or A55G R67T K97R V125G.
In some embodiments, the perhydrolase enzyme comprises a perhydrolysis to hydrolysis ratio of at least 1. In some embodiments, the perhydrolase enzyme comprises a perhydrolysis to hydrolysis ratio greater than 1.
In some embodiments, the perhydrolase enzyme is provided in the enzymatic textile colour tone adjusting composition used according to the textile colour tone adjusting method of the present invention at a concentration of about 0.5 to about 2.5 ppm, about 1.5 to about 2.0 ppm,
for example, about 1.7 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
Ester Substrate
The enzymatic colour tone adjusting compositions used in accordance with the method described herein include an ester which serves as a substrate for the perhydrolase enzyme for production of a peracid in the presence of hydrogen peroxide. In some embodiments, the ester substrate is an ester of an aliphatic and/or aromatic carboxylic acid. In some embodiments, the ester substrate is an ester of one or more of the following: formic acid, acetic acid, propionic acid, butyric acid, valeric acid, caproic acid, caprylic acid, nonanoic acid, decanoic acid, dodecanoic acid, myristic acid, palmitic acid, stearic acid, and oleic acid. In some embodiments, glycerol triacetate, glycerol tributyrate, and other esters serve as acyl donors for peracid formation. In some embodiments, the ester substrate is selected from propylene glycol diacetate, ethylene glycol diacetate, glycerol triacetate, ethyl acetate, and glycerol tributyrate. In some embodiments, the ester substrate is propylene glycol diacetate, ethylene glycol diacetate, or ethyl acetate. In one embodiment, the ester substrate is propylene glycol diacetate.
In some embodiments, the ester substrate, for example, propylene glycol diacetate, is provided at a concentration of about 2000 to about 4000 ppm, about 2500 to about 3500 ppm, about 2800 ppm to about 3200 ppm, or about 3000 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
Hydrogen Peroxide Source
The enzymatic colour tone adjusting compositions used in accordance with the method described herein include a hydrogen peroxide source. Hydrogen peroxide can be either added directly in batch, or generated continuously "in situ" by chemical, electro-chemical, and/or enzymatic means.
In some embodiments, the hydrogen peroxide source is hydrogen peroxide. In some embodiments, the hydrogen peroxide source is a solid compound that generates hydrogen peroxide spontaneously upon addition to water. Such compounds include adducts of
hydrogen peroxide with various inorganic or organic compounds, of which the most widely employed is sodium carbonate perhydrate, also referred to as sodium percarbonate.
Inorganic perhydrate salts are one embodiment of hydrogen peroxide source. Examples of inorganic perhydrate salts include perborate, percarbonate, perphosphate, persulfate and persilicate salts. The inorganic perhydrate salts are normally the alkali metal salts.
Other hydrogen peroxide adducts useful in the compositions used in accordance with the method described herein include adducts of hydrogen peroxide with zeolites, or urea hydrogen peroxide.
The hydrogen peroxide source compounds may be included as the crystalline and/or substantially pure solid without additional protection. For certain perhydrate salts however, the preferred executions of such granular compositions utilize a coated form of the material which provides better storage stability for the perhydrate salt in the granular product. Suitable coatings comprise inorganic salts such as alkali metal silicate, carbonate or borate salts or mixtures thereof, or organic materials such as waxes, oils, or fatty soaps.
In some embodiments, the hydrogen peroxide source is an enzymatic hydrogen peroxide generation system. In one embodiment, the enzymatic hydrogen peroxide generation system comprises an oxidase and its substrate. Suitable oxidase enzymes include, but are not limited to: glucose oxidase, sorbitol oxidase, hexose oxidase, choline oxidase, alcohol oxidase, glycerol oxidase, cholesterol oxidase, pyranose oxidase, carboxyalcohol oxidase, L-amino acid oxidase, glycine oxidase, pyruvate oxidase, glutamate oxidase, sarcosine oxidase, lysine oxidase, lactate oxidase, vanillyl oxidase, glycolate oxidase, galactose oxidase, uricase, oxalate oxidase, and xanthine oxidase.
The following equation provides an example of a coupled system for enzymatic production of hydrogen peroxide.
Glucose oxidase Glucose + H2O -^gluconic acid + H2O2
+
Perhydrolase H2O2 + ester substrate -> alcohol + peracid
It is not intended that the present invention be limited to any specific enzyme, as any enzyme that generates H2O2 with a suitable substrate may be used in the present invention. For example, lactate oxidases from Lactobacillus species which are known to create H2O2 from lactic acid and oxygen may be used. One advantage of the enzymatic generation of acid (e.g., gluconic acid in the above example) is that this reduces the pH of a basic solution to the pH range in which a peracid is most effective in colour tone adjusting (i.e., at or below the pKa). Other enzymes (e.g., alcohol oxidase, ethylene glycol oxidase, glycerol oxidase, amino acid oxidase, etc.) that can generate hydrogen peroxide also may be used with ester substrates in combination with the perhydrolase enzymes of the present invention to generate peracids.
In some embodiments, the hydrogen peroxide generating oxidase is a carbohydrate oxidase.
Hydrogen peroxide may also be generated electrochemically, for example using a fuel cell fed oxygen and hydrogen gas.
In some embodiments, the hydrogen peroxide source is hydrogen peroxide provided at a concentration of about 1000 to about 3200 ppm, about 1500 to about 2800 ppm, about 2000 ppm to about 2200 ppm, or about 2100 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
Surfactants and Emulsifier
The enzymatic textile colour tone adjusting compositions used in accordance with the present method may contain one or more, i.e., at least one surfactant and/or at least one emulsifier. Surfactants suitable for use in practicing the present invention include, without limitation, nonionic (see, e.g., U.S. Pat. No. 4,565,647, which is herein incorporated by reference); anionic; cationic; and zwitterionic surfactants (see, e.g., U.S. Pat. No. 3,929,678 which is herein incorporated by reference). Anionic surfactants include, without limitation, linear alkylbenzenesulfonate, α-olefinsulfonate, alkyl sulfate (fatty alcohol sulfate), alcohol ethoxysulfate, secondary alkanesulfonate, alpha-sulfo fatty acid methyl ester, alkyl- or alkenylsuccinic acid, and soap. Non-ionic surfactants include, without limitation, fatty alcohol ethoxylate, isotridecanol ethoxylate, nonylphenol ethoxylate, alkylpolyglycoside, alkyldimethylamineoxide, ethoxylated fatty acid monoethanolamide, fatty acid
monoethanolamide, polyhydroxy alkyl fatty acid amide, and N-acyl N-alkyl derivatives of glucosamine ("glucamides").
In some embodiments, the surfactant and/or emulsifier comprises a non-ionic surfactant. In one embodiment, the non-ionic surfactant is a fatty alcohol ethoxylate. In one embodiment, the non-ionic surfactant is isotridecanol ethoxylate. In one embodiment, the non-ionic surfactant is a fatty alcohol ethoxylate and isotridecanol ethoxylate.
In one embodiment, the composition used in accordance with the present method comprises a surfactant and an emulsifier.
A surfactant may be present at a concentration of about 300 ppm to about 4800 ppm, about 600 ppm to about 3600 ppm, or about 300 ppm to about 1200 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
In some embodiments, the enzymatic colour tone adjusting composition contains isotridecanol ethoxylate at a concentration of about 300 ppm to about 3600 ppm, about 600 ppm to about 3000 ppm, or about 900 ppm to about 2400 ppm, based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
Peroxide Stabilizer
The enzymatic colour tone adjusting compositions used in accordance with the method described herein may contain a peroxide stabilizer. Examples of peroxide stabilizers include, but are not limited to, sodium silicate, sodium carbonate, acrylic polymers, magnesium salts, and phosphonic acid. In one embodiment, the peroxide stabilizer is phosphonic acid.
A peroxide stabilizer may be present in the enzymatic textile colour tone adjusting composition at a concentration of about 60 ppm to about 600 ppm, about 60 ppm to about 1200 ppm, or about 120 ppm to about 960 ppm based on the total weight of the aqueous composition (bath) applied for treatment of the textile material.
Combination Product
Appropriately, at least one surfactant and/or emulsifier, at least one peroxide stabilizer and at least one sequestering agent are applied as a combination product containing each of at least one surfactant and/or emulsifier, at least one peroxide stabilizer and at least one sequestering agent. The said combination product is designated bleaching processor and is commercially available, for example, CLARITE® LTC, CLARITE® WIN or CLARITE® ONE (products of Huntsman).
A surfactant may be present at a concentration of about 5% to about 40%, about 20% to about 30%, or about 5% to about 10%, based on the total weight of the bleaching processor.
A peroxide stabilizer may be present in the combination product at a concentration of about 1 % to about 5%, about 1 % to about 10%, or about 2% to about 8%, based on the total weight of the bleaching processor.
A sequestering agent may be present in the bleaching processor at a concentration of about 1 % to about 15%, about 5% to about 10%, or about 3% to about 10%, based on the total weight of the bleaching processor.
In some embodiments, the bleaching processor contains isotridecanol ethoxylate at a concentration of about 5% to about 30%, about 10% to about 25%, or about 15% to about 20%, based on the total weight of the bleaching processor.
The bleaching processor is suitably provided as an aqueous composition comprising the above indicated components.
Buffer
The enzymatic colour tone adjusting composition may contain a buffer that is capable of maintaining the pH of the composition at a pH of about 6 to about 8. The buffer may be, for example, a phosphate buffer, pH 7, or a sodium carbonate or potassium carbonate, pH 7.
Enzymatic Textile Colour Tone Adjusting Method
The method according to the invention is particularly suitable for the treatment of denim dyed with vat dyes, reactive dyes, direct dyes and sulphur dyes, most preferably for indigo-dyed denim and/or sulfur-dyed denim. The method provides textile material with a soft handle and very good crease recovery properties compared to textiles treated using conventional methods. The methods described herein are particularly carried out as a discontinuous process but can also be carried out as a semi-continuous process like pad-batch or pad-roll.
Appropriately, the method of the invention utilizes a liquor ratio of about 2:1 to about 50:1 , about 5:1 to about 20:1 , for example, about 20:1 or 10:1.
Textiles are contacted with the enzymatic colour tone adjusting composition at a temperature of about 55°C to about 750C, about 600C to about 700C, for a processing time of about 20 to about 60 minutes at a pH of about 6 to about 8. In one embodiment, the treatment temperature is about 65°C and the processing time is about 50 minutes. In some embodiments, the temperature of the enzymatic colour tone adjusting composition is raised by about 2°C per minute from a starting temperature of about 200C to about 500C, for example, about 200C to about 40°C, until the processing temperature for colour tone adjusting is reached. One or more rinsing steps are performed after treatment of the textile material with the enzymatic colour tone adjusting composition, to remove the colour tone adjusting composition. Appropriately, the textile is rinsed with an aqueous composition (water or a composition containing water). In some embodiments, the rinsing temperature is about 40°C to about 60°C, for example, about 50°C.
In some embodiments, the aqueous rinsing composition contains a catalase enzyme to catalyze the decomposition of hydrogen peroxide to water and oxygen. In one embodiment, the textile is rinsed twice with a catalase containing aqueous composition for about 10 minutes for each rinse. In one embodiment residual hydrogen peroxide is removed by rinsing twice with an aqueous composition containing catalase at about 500C. In some embodiments, catalase may be added directly to the liquor containing the perhydrolase enzyme without first dropping the bath.
As the enzymes that hydrolyze polyester substrates suitable for use in the present invention may be used, for example, pectinases, cutinases or lipases. These enzymes, their application as well as assays to determine enzyme activity are described and referred to in more detail in WO 2007/136469 on pages 21 and 22, which are herein incorporated by reference.
Further suitable enzymes that may be used additionally in the method according to the invention are amylases (desizing agents) and cellulases (biopolishing agents).
The following examples are intended to illustrate, but not limit, the invention. Temperatures are in degrees Celsius, parts are parts by weight and the percentage data are percentages by weight, unless noted otherwise. Parts by weight bear the same relation to parts by volume as the kilogram to the litre.
Experimental Part
A comparison between the method of the present invention and conventional oxidation bleach with hydrogen peroxide is performed according to the procedures given below by treating the fabric in exhaust using a Mathis AG Labomat.
Examples 1 and 2 and Comparative Example 3
Enzymatic colour tone adjusting (Examples 1 and 2) carried out as a one-bath exhaustion method:
Indigo dyed denim swatches (length: 11 cm, width: 9.5 cm), washed at 65 °C/5 min and cold in overflow/5 min, are treated in a bath containing the combination product, the buffer, propylene glycol diacetate, hydrogen peroxide and the perhydrolase enzyme in the amounts given in
Table 1 using a liquor ratio of 10:1. The temperature is raised from ambient temperature to a target temperature of 65°C at a rate of 2°C per minute. The bath is then held at 65°C for 5 0 minutes and after cooling and draining the swatches are rinsed twice for 10 minutes each at
500C and then dried at 700C. 0.5 g/l of a 25% solution of Catalase T100 (available from
Genencor) is included in each rinse.
Alkali colour tone adjusting (Comparative Example 3) carried out as a one-bath exhaustion method:
The procedure described above is repeated, but perhydrolase enzyme and phosphate buffer are replaced with sodium hydroxide.
Table 1 : Examples 1 , 2 and Comparative Example 3
INVALOh EC: dispersing agent (commercial product supplied by Huntsman)
2) CLARITE® WIN: bleaching processor (commercial product supplied by Huntsman)
3) CLARITE® GS: bleaching processor (commercial product supplied by Huntsman)
4) CLARITE® ONE: bleaching processor (commercial product supplied by Huntsman)
5) Primagreen® EcoWhite (1x) (commercial product supplied by Genencor)
Example 4
Enzymatic on-tone washdown carried out as a one-bath exhaustion method:
Indigo dyed denim swatches (length: 1 1 cm, width: 9.5 cm), desized at 10:1 liquor ratio, 60
°C/10 min, with 0.5 g/l CLARITE® WIN, 0.5 g/l Albfluid C and 1.5 g/l ULTRAVON® RW
(non-ionic surfactant, commercial product supplied by Huntsman) are treated in the same bath with 1.5 g/l of INVAZYME® LTE (perhydrolase enzyme) at 10:1 liquor ratio, 60 °C/10 min.
Following desizing, the denim is stonewashed in a rotary washing machine with 1 kg of pumice stones (60 °C/40 min). Subsequently, 1.0 g/l CLARITE® LTC (combination product, supplied by Huntsman), 2.5 g/l of soda ash, 3.0 g/l of propylene glycol diacetate, 3.0 g/l of hydrogen peroxide and 1.0 g/l of INVAZYME® LTE (perhydrolase enzyme) are added to the liquor. The
bath is then held at 65°C for 50 minutes and after cooling and draining the swatches are rinsed twice for 15 minutes each at 50 0C with a bath containing 0.5 g/l INVAZYME® CAT (stabilized liquid catalase enzyme to remove residual peroxide) and afterwards for 15 min with a bath containing 1.0 g/l of a softening agent (Turpex CAN new) at room temperature, and then dried. The denim swatches thus obtained have a soft handle and very good crease recovery properties.
Example 5
Effect of Perhydrolase Concentration on Dye Discoloration on Indigo-dyed Denim
Materials
Perhydrolase (PrimaGreen® EcoWhite 1 (321 U/g), available from Genencor Division, Danisco US, Inc.), is used in this experiment. H2O2 analysis grade (30 wt %) and propylene glycol diacetate >99.7% (PDGA) were purchased from Sigma Aldrich.
Procedure
Denim, 12 legs (ACG denim style 80270) weighing approximately 3 kg, is desized in a Unimac
UF 50 washing machine under the following conditions:
• Desizing for 15 minutes at 10:1 liquor ratio 500C with 0.5 g/l (15 g) of Optisize® 160 amylase (Genencor) and 0.5 g/l (15 g) of a non-ionic surfactant (Ultravon® RW (Huntsman)).
• 2 cold rinse steps for 5 minutes at 30:1 liquor ratio.
Following desizing, the denim is stonewashed in a Unimac UF 50 rotary washing machine according to the following program:
• Cold rinsing for 5 minutes at 10:1 liquor ratio
• Stonewashing for 60 minutes at 10:1 liquor ratio 55°C with 1 kg of pumice stone, pH 6.5 - 7 (1 g/l of disodium phosphate 2H2O + 0.53 g/l of citric acid H2O) and 0.025 g/l of MEX-500 neutral cellulase (Meiji).
• 2 cold rinse steps of 5 min each
The denim is dried in a household dryer and then used to make swatches (7 x 7 cm).
After stonewashing, the experiments are performed in a Launder-O-meter (Rapid Laboratory
Dyeing Machine type H 12) according to the following process:
• 450 ml stainless steel reaction vessels are filled with 100 ml of pH 8 phosphate buffer (8.9 g/l of disodium phosphate 2H2O + 0.4 g/l of monosodium phosphate anhydrous).
• To each vessel five (7 x 7 cm) stonewashed denim swatches of 10 g weight are added.
• 6 ml/l of H2O2 solution (30% wt) and 2m I/I of PDGA (>99.7%) is added.
• Perhydrolase is added at concentrations of 0. 01 , 0. 05, 0. 3, 1.0, 3.0, or 10 ml/l.
• The reaction vessels are closed and loaded into the launder-O-meter, which is pre-heated to 600C.
• Incubation is performed for 60 minutes, after which the swatches are rinsed by overflow, spun dry in an AEG IPX4 centrifuge, and dried with an Elna Press Electronic iron at program cotton and evaluated.
Evaluation of denim swatches
The denim swatches are evaluated after perhydrolase treatment with a Minolta Chromameter CR 310 in the CIE Lab color space with a D 65 light source. Measurements are done before and after perhydrolase treatment and the results from five swatches are averaged. The total color difference (TCD) is calculated using the formula: TCD = V (ΔL)2 + (Δa)2 + (Δb)2. The results are shown in Table 2.
Table 2
Example 6
Effect of H2O2 and PDGA Concentrations on Dye Discoloration Performance of Perhydrolase on Indigo-dyed Denim
Procedure
Denim, 12 legs (ACG denim style 80270) weighing approximately 3 kg, is desized and stonewashed as described in Example 5. After stonewashing, the experiments are performed
in a Launder-O-meter (Rapid Laboratory Dyeing Machine type H 12) according to the following process:
• 450 ml stainless steel reaction vessels are filled with 100 ml of pH 8 phosphate buffer (8.9 g/l of disodium phosphate 2H2O + 0.4 g/l of monosodium phosphate anhydrous).
• To each vessel five (7 x 7 cm) stonewashed denim swatches of 10 g weight are added.
• H2O2 solution (30% wt) and PDGA (>99.7%) are added according to the experimental design as shown in Table 3
Table 3
1.0 ml/l of perhydrolase is added (PrimaGreen® EcoWhite 1 (321 IVg)).
The reaction vessels are closed and loaded into the Launder-O-Meter which was pre-heated to 6O0C
Incubation is performed for 60 minutes, after which the swatches are rinsed by overflow, spun dry in an AEG IPX4 centrifuge, and dried with an Elna Press Electronic iron at program cotton, and evaluated.
Evaluation of denim swatches
The denim swatches are evaluated after perhydrolase treatment with a Minolta Chromameter CR 310 in the CIE Lab color space with a D 65 light source. Measurements are done before
and after perhydrolase treatment and the results from five swatches are averaged. The total color difference (TCD) is calculated using the formula: TCD = V (ΔL)2 + (Δa)2 + (Δb)2. The results are shown in Table 4.
Example 7
Effect of Time on Dye Discoloration Performance of Perhydrolase on Indigo-dyed Denim
Procedure
Denim, 12 legs (ACG denim style 80270) weighing approximately 3 kg, is desized and stonewashed as described in Example 5. After stonewashing, the experiments are performed in a Launder-O-meter (Rapid Laboratory Dyeing Machine type H 12) according to the following process.
• 450 ml stainless steel reaction vessels are filled with 100 ml of pH 8 phosphate buffer (8.9 g/l Disodium phosphate 2H2O + 0.4 g/l Monosodium phosphate anhydrous)
• To each vessel five (7 x 7 cm) stonewashed denim swatches of 10 g weight are added.
• 6 ml/l of H2O2 solution (30% wt) and 0.2 ml/l of PDGA (>99.7%) are added.
• 1.0 g/l of perhydrolase is added (PrimaGreen® EcoWhite 1 (321 U/g)).
• The reaction vessels are closed and loaded into the Launder-O-Meter, which was pre-heated to 600C.
• Incubation is performed for 10, 20, 30, 40, 50, or 60 minutes, after which the swatches are rinsed by overflow, spun dry in an AEG IPX4 centrifuge, dried with an Elna Press Electronic iron at program cotton, evaluated. Evaluation of denim swatches
The denim swatches are evaluated after perhydrolase treatment with a Minolta Chromameter CR 310 in the CIE Lab color space with a D 65 light source. Measurements are done before and after perhydrolase treatment and the results from five swatches are averaged. The total color difference (TCD) is calculated using the formula: TCD = V (ΔL)2 + (Δa)2 + (Δb)2. [01] The results are shown in Table 5.
Table 5
Example 8
Effect of Temperature on Dye Discoloration Performance of Perhydrolase on Indigo-dyed
Denim
Procedure
Denim, 12 legs (ACG denim style 80270) weighing approximately 3 kg, is desized and stonewashed as described in Example 5. After stonewashing, the experiments are performed in a Launder-O-meter (Rapid Laboratory Dyeing Machine type H 12) according to the following process.
• 450 ml stainless steel reaction vessels are filled with 100 ml of pH 8 phosphate buffer (8.9 g/l of disodium phosphate 2H2O + 0.4 g/l of monosodium phosphate anhydrous).
• To each vessel five (7 x 7 cm) stonewashed denim swatches of 10 g weight are added.
• 6 ml/l of H2O2 solution (30% wt) and 2m I/I of PDGA (>99.7%) is added.
• 1.0 ml/l of perhydrolase is added (PrimaGreen® EcoWhite 1 (321 U/g)).
• The reaction vessels are closed and loaded into the Launder-O-Meter, which was pre-heated to 30, 40, 50 or 600C.
• Incubation is performed for 60 minutes, the swatches rinsed by overflow, spun dry in an AEG IPX4 centrifuge, dried with an Elna Press Electronic iron at program cotton, evaluated.
Evaluation of denim swatches
The denim swatches are evaluated after perhydrolase treatment with a Minolta Chromameter CR 310 in the CIE Lab color space with a D 65 light source. Measurements are done before and after perhydrolase treatment and the results from five swatches are averaged. The total color difference (TCD) is calculated using the formula: TCD = V (ΔL)2 + (Δa)2 + (Δb)2. The results are shown in Table 6.
Table 6
Example 9
Color Adjustment Performance with a Cellulase + Perhydrolase Sequential Process on
Indigo-dyed Denim in a Front Loading Washing Machine
Procedure
Denim, 12 legs (ACG denim style 80270) weighing approximately 3 kg, is desized in a Unimac
UF 50 washing machine under the following conditions:
• Desizing for 15 minutes at 10:1 liquor ratio 500C with 0.5 g/l (15 g) of Optisize® 160 amylase (Genencor) and 0.5 g/l (15 g) of a non-ionic surfactant (Ultravon® RW (Huntsman))
• 2 cold rinses for 5 minutes at 30:1 liquor ratio
Following desizing, the denim is stonewashed in a Unimac UF 50 rotary washing machine according to the following procedure:
• Cold rinse for 5 minutes at 10:1 liquor ratio
• Stonewashing for 60 minutes at 10:1 liquor ratio 55°C with 1 kg of pumice stone, pH 4.8 (1 g/l of trisodium citrate 2 H2O + 0.87g/l of citric acid H2O) 1.17g/l of Indiage® 2XL cellulase (Genencor)
• 2 cold rinse steps of 5 min each
• 4 legs taken out as a control
After stonewashing, treatment with perhydrolase is performed in a Unimac UF 50 washing machine according to the following process:
• 60 minutes at 10:1 liquor ratio, with 1 g/l perhydrolase (PrimaGreen® EcoWhite 1 (321 U/g)), 6 g/l of H2O2 solution (30%wt) and 3g/l of PDGA(>99.7%) at pH 7 (1 g/l of disodium phosphate 2 H2O and 0.17 g/l of citric acid) and temperature of 600C. The pH was kept at 7 by adding 4 M of sodium hydroxide solution
• 2 cold rinses for 5 minutes at 30:1 liquor ratio
• The denim is dried in a household dryer.
Evaluation of denim legs
Colour tone adjusting of denim legs is evaluated after treatment with a Minolta Chromameter CR 310 in the CIE Lab color space with a D 65 light source. For each denim leg, 8 measurements are taken and the results of the 12 legs (96 measurements) were averaged. The results are shown in Table 7.
Table 7
Example 10
Color Adjustment Performance of Cellulase + Laccase + Perhydrolase Sequential Process on
Indigo-dyed Denim in a Front Loading Washing Machine
Procedure
Denim, 12 legs (ACG denim style 80270) weighing approximately 3 kg, is desized in a Unimac
UF 50 washing machine under the following conditions:
• Desizing for 15 minutes at 10:1 liquor ratio 500C with 0.5 g/l (15 g) of Optisize® 160 amylase (Genencor) and 0.5 g/l (15 g) of a non-ionic surfactant (Ultravon® RW (Huntsman).
• 2 cold rinses for 5 minutes at 30:1 liquor ratio
Following desizing, the denim is stonewashed in a Unimac UF 50 rotary washing machine according to the following procedure:
• Cold rinse for 5 minutes at 10:1 liquor ratio
• Stonewashing for 60 minutes at 10:1 liquor ratio 55°C with 1 kg of pumice stone, pH 4.8 (1 g/l of trisodium citrate 2 H2O + 0.87g/l of citric acid H2O) and 1.17g/l of lndiage® 2XL (Genencor)
• 2 cold rinse steps of 5 min each
After stonewashing, laccase treatment is performed in a Unimac UF 50 washing machine according to the following process:
• 30 minutes at 10:1 liquor ratio, with 3 g/l of ready to use PrimaGreen® EcoFade LT 100 (Genencor) laccase and laccase mediator at pH 6 and temperature of 300C
• 2 cold rinses for 5 minutes at 30:1 liquor ratio
• The denim is dried in a household dryer.
After brightening with laccase, treatment with perhydrolase is performed in a Unimac UF 50 washing machine according to the following process:
• 60 minutes at 10:1 liquor ratio, with 1 g/l of perhydrolase (PrimaGreen® EcoWhite 1 (321 U/g)), 6 g/l of H2O2 solution (30%wt) and 3g/l of PDGA(>99.7%) at pH 8 (8.9 g/l disodium phosphate 2H2O + 0.4 g/l monosodium phosphate anhydrous) and temperature of 600C
• 2 cold rinses for 5 minutes at 30:1 liquor ratio The denim is dried in a household dryer
Evaluation of denim legs
Brightening of denim legs is evaluated after laccase treatment and after perhydrolase treatment with a Minolta Chromameter CR 310 in the CIE Lab color space with a D 65 light source. For each denim leg, 8 measurements are taken and the results of the 12 legs (96 measurements) are averaged. The results are shown in Table 8.
Table 8
Example 1 1
Effect of Perhydrolase Treatment on a Dyed Fabric
Materials
Perhydrolase (S54V variant of M smegmatis, containing 1.5 mg/g active protein) is used in this Example. Hydrogen peroxide (analytical grade; 30% w/w) and propylene glycol diacetate (>99.7%) are purchased from Sigma Aldrich. Standard dyed fabrics are obtained from the Center for Test Materials, Vlaardingen, The Netherlands. The fabrics are dyed with one of the dyes (or combinations of dyes) listed in Table 15, which are identified by their Color Index (Cl) number according to the Society of Dyers and Colourists (UK) and by the American Association of Textile Chemists and Colorists (USA).
Procedure
2 each swatches of dyed fabric (see Table 9) of approximately 12.5 cm x 12.5 cm are treated in a Launder-O-Meter (Rapid Laboratory Dyeing Machine type H 12) according to the following procedure:
• 3 each 450-ml stainless steel reaction vessels are filled with 100 ml of phosphate buffer (pH 8; 8.9 g/l of disodium phosphate-2H2O + 1.06 g/L of monosodium phosphate anhydrous).
• 2 each standard fabric swatches are added to each vessel.
• 6.0 ml/L H2O2 solution (30% wt/wt) and 3.0 ml/L of PGDA (>99.7%) are added to 2 each reaction vessels ("perhydrolase" and "blank"). Buffer only is added to the third reaction vessel.
• 1.0 ml/L perhydrolase is added to the "perhydrolase" reaction vessel.
• The reactions vessels are closed and placed in the Launder-O-Meter pre-heated to 600C.
Incubation is carried out for 30 minutes. Following incubation, the swatches are rinsed by overflow, spin dried in an AEG IPX4 centrifuge, and dried in a Novotronic T 494 C household type dryer.
The resulting experimental samples are designated "perhydrolase" (perhydrolase + H2O2 + PGDA), "blank" (H2O2 + PGDA), and "buffer only."
Table 9. Dyes applied to the different fabric swatches
Cl Sulphur Black 1
Cl Sulphur Black 1
Cl Diazo component 13 (Fast Scarlet R) and Cl Coupler 2 (Naphthol AS)
Cl Direct Black 22
Cl Direct Black 22
Cl Direct Black 22
Cl Reactive Black 5
Cl Reactive Black 5
Cl Reactive Orange 16
Cl Reactive Blue 71
Cl Reactive Blue 19
Mixture of Cl Reactive Orange 107, Reactive Red 198, and Reactive Black 5
Mixture of Cl Reactive Orange 107, Reactive Red 198, and Reactive Blue 220
Evaluation of standard fabric swatches
The effect of perhydrolase treatment on the standard fabric swatches is evaluated using a Minolta Chromameter CR 310 in the CIE Lab color space with a D 65 light source. Measurements are performed before and after perhydrolase (or control) treatment. Three measurements are performed on each swatch (6 measurements total for each experimental condition) and the results averaged. Total color difference (TCD) is calculated using the formula: TCD = V (ΔL)2 + (Δa)2 + (Δb)2. The Δ values are the difference between the fabric before treatment and the fabric after treatment. The TCD* values are the difference between the values obtained for the blank values and for the perhydrolase treatment. The results are shown, below, in the following Tables, which indicate the dyes applied to the fabrics.
Table 10. Cl Sulphur Black 1
Table 11. Cl Sulphur Black 1 + CR resin
Table 12. Mixture of Cl Diazo component 13 and Cl Coupler 2
Table 13. Cl Direct Black 22
Table 14. Cl Direct Black 22 + cationic finish
Table 20. Cl Reactive Blue 19
Table 21. Mixture of Cl Reactive Orange 107, Reactive Red 198, and Reactive Black 5
Table 22. Mixture of Cl Reactive Orange 107, Reactive Red 198, and Reactive Blue 220
Perhydrolase-mediated decolorization is observed for all the dyed swatches tested. These results demonstrate that enzymatic decolorization is effective for use with a wide range of dyes.
Although the foregoing invention has been described in some detail by way of illustration and examples for purposes of clarity of understanding, it will be apparent to those skilled in the art that certain changes and modifications may be practiced without departing from the spirit and scope of the invention. Therefore, the description should not be construed as limiting the scope of the invention, which is delineated by the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entireties for all purposes and to the same extent as if each individual publication, patent, or patent application were specifically and individually indicated to be so incorporated by reference.
Claims
1. A method for adjusting the colour tone of dyed cellulosic textile fibre material comprising contacting said textile material with an enzymatic textile treatment composition comprising
(i) a perhydrolase enzyme,
(ii) an ester substrate for said perhydrolase enzyme, and
(iii) a hydrogen peroxide source.
2. A method according to claim 1 , wherein said perhydrolase enzyme comprises the amino acid sequence set forth in SEQ ID NO:1 or a variant or homolog thereof.
3. A method according to either claim 1 or 2, wherein said perhydrolase enzyme is the S54V variant of SEQ ID NO:1.
4. A method according to any one of claims 1 to 3, wherein said perhydrolase enzyme comprises a perhydrolysis to hydrolysis ratio greater than 1.
5. A method according to any one of claims 1 to 4, wherein said ester substrate is selected from propylene glycol diacetate, ethylene glycol diacetate, glycerol triacetate, ethyl acetate, and glycerol tributyrate.
6. A method according to any one of claims 1 to 5, wherein said hydrogen peroxide source is hydrogen peroxide.
7. A method according to any one of claims 1 to 6, wherein said enzymatic textile treatment composition additionally comprises
(iv) a surfactant and/or emulsifier.
8. A method according to any one of claims 1 to 7, wherein said enzymatic textile treatment composition additionally comprises
(v) a fluorescence whitening agent.
9. A method according to any one of claims 1 to 8, wherein said enzymatic textile treatment composition additionally comprises (vi) an enzymatic desizing agent.
10. A method according to any one of claims 1 to 9, wherein said enzymatic textile treatment composition additionally comprises
(vii) a biopolishing agent.
1 1. A method according to any one of claims 1 to 10, wherein said enzymatic textile treatment composition additionally comprises
(viii) a combination product.
12. A method according to any one of claims 1 to 1 1 , further comprising hydrolyzing said hydrogen peroxide with a catalase enzyme after said bleached textile is produced.
13. A method according to any one of claims 1 to 12, wherein said method is performed in a process selected from a batch process, an exhaust process, and a discontinuous process.
14. A method according to any one of claims 1 to 13, wherein the textile material is contacted with the enzymatic textile treatment composition at a temperature of 600C to 75°C, for a processing time of 30 to 60 minutes.
15. A method according to any one of claims 1 to 14, wherein said dyed cellulosic textile fibre material is indigo-dyed denim.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP10724053A EP2438149A1 (en) | 2009-06-05 | 2010-05-27 | Enzymatic textile colour modification |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP09162047 | 2009-06-05 | ||
| EP09163751 | 2009-06-25 | ||
| US22334809P | 2009-07-06 | 2009-07-06 | |
| US32274310P | 2010-04-09 | 2010-04-09 | |
| PCT/EP2010/057332 WO2010139601A1 (en) | 2009-06-05 | 2010-05-27 | Enzymatic textile colour modification |
| EP10724053A EP2438149A1 (en) | 2009-06-05 | 2010-05-27 | Enzymatic textile colour modification |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP2438149A1 true EP2438149A1 (en) | 2012-04-11 |
Family
ID=42358645
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP10724053A Withdrawn EP2438149A1 (en) | 2009-06-05 | 2010-05-27 | Enzymatic textile colour modification |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US20120088291A1 (en) |
| EP (1) | EP2438149A1 (en) |
| JP (1) | JP2012528946A (en) |
| KR (1) | KR20120104508A (en) |
| CN (1) | CN102449129A (en) |
| AR (1) | AR076966A1 (en) |
| AU (1) | AU2010255863B2 (en) |
| CA (1) | CA2763882A1 (en) |
| MX (1) | MX2011012711A (en) |
| WO (1) | WO2010139601A1 (en) |
Families Citing this family (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2403809B1 (en) | 2009-03-03 | 2015-06-24 | Danisco US Inc. | Method of oxidative decolorization of dyes with enzymatically generated peracid |
| CN102782209A (en) * | 2009-08-27 | 2012-11-14 | 丹尼斯科美国公司 | Combined textile abrading and color modification |
| CN103476985A (en) * | 2011-03-17 | 2013-12-25 | 丹尼斯科美国公司 | Color modification of sized fabric |
| CN102561008B (en) * | 2012-01-10 | 2014-01-29 | 江门市宝发纺织服饰制造有限公司 | A kind of environment-friendly biological crude flower enzyme preparation and its application of washing denim instead of pumice |
| CN102899880A (en) * | 2012-11-08 | 2013-01-30 | 天津工业大学 | Method for improving bleaching effect of cotton and blended fabrics under multienzyme coupling action |
| CN104131476A (en) * | 2014-07-11 | 2014-11-05 | 芜湖富春染织有限公司 | Cheese white dyeing material formula |
| US10982381B2 (en) | 2014-10-06 | 2021-04-20 | Natural Fiber Welding, Inc. | Methods, processes, and apparatuses for producing welded substrates |
| US10011931B2 (en) | 2014-10-06 | 2018-07-03 | Natural Fiber Welding, Inc. | Methods, processes, and apparatuses for producing dyed and welded substrates |
| MX2018010421A (en) | 2016-03-25 | 2019-05-20 | Natural Fiber Welding Inc | Methods, processes, and apparatuses for producing welded substrates. |
| CN109196149B (en) | 2016-05-03 | 2021-10-15 | 天然纤维焊接股份有限公司 | Method, process and apparatus for producing dyed solder substrates |
| CN107524018B (en) * | 2017-06-14 | 2019-11-12 | 浙江银河印染有限公司 | A kind of method for repairing color with the dye of positive ion after cotton grey cloth reactive dyeing |
| TWI829660B (en) | 2017-11-11 | 2024-01-21 | 美商天然纖維焊接股份有限公司 | Yarn and welded yarn |
| FR3120238A1 (en) * | 2021-02-26 | 2022-09-02 | Induo | HYDROPHOBIC COTTON TEXTILE AND METHOD FOR MAKING FUNCTIONALIZED DYED TEXTILE |
| FR3120240A1 (en) * | 2021-02-26 | 2022-09-02 | Induo | METHOD FOR MANUFACTURING FUNCTIONALIZED DYED TEXTILE |
| US20240229347A9 (en) * | 2021-02-26 | 2024-07-11 | Induo | Method for manufacturing a functionalised dyed textile, use of a bleaching solution to increase the durability of a chemical functionalisation on a dyed textile, and dyed textile |
| WO2022271121A1 (en) * | 2021-06-25 | 2022-12-29 | Realkom Tekstil Urunleri Sanayi Pazarlama Ve Dis Ticaret Anonim Sirketi | A new enzyme mixture and a denim washing method using thereof |
| CN117143895B (en) * | 2023-08-30 | 2025-09-05 | 态创生物科技(广州)有限公司 | A cell-free synthesis system, kit and application of antimicrobial peptides |
Family Cites Families (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5296161A (en) * | 1986-06-09 | 1994-03-22 | The Clorox Company | Enzymatic perhydrolysis system and method of use for bleaching |
| DE10260903A1 (en) * | 2002-12-20 | 2004-07-08 | Henkel Kgaa | New perhydrolases |
| CN103333870A (en) * | 2003-12-03 | 2013-10-02 | 丹尼斯科美国公司 | Perhydrolase enzyme |
| US7754460B2 (en) * | 2003-12-03 | 2010-07-13 | Danisco Us Inc. | Enzyme for the production of long chain peracid |
| US7179779B1 (en) * | 2006-01-06 | 2007-02-20 | North Carolina State University | Cationic bleach activator with enhanced hydrolytic stability |
| EP1847599A1 (en) * | 2006-02-23 | 2007-10-24 | Cognis IP Management GmbH | Polypeptides with perhydrolase activity |
| PT2007942E (en) * | 2006-04-14 | 2014-10-07 | Danisco Us Inc | One-step treatment of textiles |
| ES2509877T3 (en) * | 2006-04-14 | 2014-10-20 | Danisco Us Inc. | Single stage textile treatment |
| BRPI0820503A2 (en) * | 2007-11-05 | 2015-06-16 | Danisco Us Inc | Bacillus licheniformis alpha amylase variants with increased thermostability and / or decreased calcium dependence |
| KR20110073439A (en) * | 2008-09-10 | 2011-06-29 | 다니스코 유에스 인크. | Enzymatic Fabric Bleaching Compositions and Methods of Use thereof |
-
2010
- 2010-05-27 KR KR1020127000277A patent/KR20120104508A/en not_active Withdrawn
- 2010-05-27 WO PCT/EP2010/057332 patent/WO2010139601A1/en not_active Ceased
- 2010-05-27 US US13/321,840 patent/US20120088291A1/en not_active Abandoned
- 2010-05-27 CN CN2010800233980A patent/CN102449129A/en active Pending
- 2010-05-27 AU AU2010255863A patent/AU2010255863B2/en not_active Ceased
- 2010-05-27 CA CA2763882A patent/CA2763882A1/en not_active Abandoned
- 2010-05-27 MX MX2011012711A patent/MX2011012711A/en active IP Right Grant
- 2010-05-27 EP EP10724053A patent/EP2438149A1/en not_active Withdrawn
- 2010-05-27 JP JP2012513551A patent/JP2012528946A/en active Pending
- 2010-06-03 AR ARP100101963A patent/AR076966A1/en unknown
Non-Patent Citations (1)
| Title |
|---|
| See references of WO2010139601A1 * |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2012528946A (en) | 2012-11-15 |
| CA2763882A1 (en) | 2010-12-09 |
| KR20120104508A (en) | 2012-09-21 |
| AU2010255863B2 (en) | 2013-10-03 |
| AU2010255863A1 (en) | 2011-11-17 |
| MX2011012711A (en) | 2011-12-14 |
| AR076966A1 (en) | 2011-07-20 |
| US20120088291A1 (en) | 2012-04-12 |
| CN102449129A (en) | 2012-05-09 |
| WO2010139601A1 (en) | 2010-12-09 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2010255863B2 (en) | Enzymatic textile colour modification | |
| US20110302724A1 (en) | Enzymatic textile bleach-whitening methods | |
| AU2009291795B2 (en) | Enzymatic textile bleaching compositions and methods of use thereof | |
| CN1046775C (en) | Dye transfer inhibition | |
| FI95596B (en) | Detergent additive for bleaching stained fabric | |
| US20140007356A1 (en) | Color modification of sized fabric | |
| US20120149269A1 (en) | Combined Textile Abrading And Color Modification | |
| EP2403809B1 (en) | Method of oxidative decolorization of dyes with enzymatically generated peracid | |
| EP2553160B1 (en) | Treatment of keratinous fibers with an enzyme having perhydrolase activity | |
| Tavčer | Biotechnology in textiles–an opportunity of saving water | |
| HK1159155B (en) | Enzymatic textile bleaching compositions and methods of use thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20111107 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO SE SI SK SM TR |
|
| DAX | Request for extension of the european patent (deleted) | ||
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20151201 |