EP1999149A2 - Anti-igf-ir antibodies and uses thereof - Google Patents

Anti-igf-ir antibodies and uses thereof

Info

Publication number
EP1999149A2
EP1999149A2 EP07754217A EP07754217A EP1999149A2 EP 1999149 A2 EP1999149 A2 EP 1999149A2 EP 07754217 A EP07754217 A EP 07754217A EP 07754217 A EP07754217 A EP 07754217A EP 1999149 A2 EP1999149 A2 EP 1999149A2
Authority
EP
European Patent Office
Prior art keywords
seq
antibody
fragment
igf
polynucleotide
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP07754217A
Other languages
German (de)
French (fr)
Other versions
EP1999149A4 (en
Inventor
Kandasamy Hariharan
Christilyn Graff
Scott Glaser
Ellen Garber
Christopher L. Reyes
Stephen Demarest
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Biogen Inc
Biogen MA Inc
Original Assignee
Biogen Idec Inc
Biogen Idec MA Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=38656039&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=EP1999149(A2) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Application filed by Biogen Idec Inc, Biogen Idec MA Inc filed Critical Biogen Idec Inc
Publication of EP1999149A2 publication Critical patent/EP1999149A2/en
Publication of EP1999149A4 publication Critical patent/EP1999149A4/en
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/04Antineoplastic agents specific for metastasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/40Immunoglobulins specific features characterized by post-translational modification
    • C07K2317/41Glycosylation, sialylation, or fucosylation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/524CH2 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/53Hinge
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/77Internalization into the cell
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide

Definitions

  • IGF system plays an important role in regulating cell proliferation, differentiation, apoptosis and transformation (Jones et al, Endocrinology Rev. 1995. 16:3-34).
  • the IGF system comprises of two types of unrelated receptors, the insulin like growth factor receptor 1 (IGF-IR; CD221) and insulin like growth factor receptor 2 (IGF-2R; CD222); two ligands, insulin like growth factor 1 (IGF-I and IGF-2); several IGF binding proteins (IGFBP-I to IGFBP-6).
  • IGFBP proteases e.g.: caspases, metalloproteinases, prostate-specific antigen hydrolyze IGF bound IGFBP to release free IGFs, which then interact with IGF-IR and IGF-2R.
  • IGF system is also intimately connected to insulin and insulin receptor (InsR) (Moschos et al. Oncology 2002. 63:317- 32; Baserga et al., Int J. Cancer. 2003. 107:873-77; Pollak et al., Nature Reviews Cancer. 2004. 4:505-516).
  • InsR insulin and insulin receptor
  • TK receptor tyrosine kinases
  • IGF-IR insulin like growth factor receptor
  • RTK receptor tyrosine kinase family
  • IGF-I and IGF-2 play a significant role in pre- and postnatal development, growth hormone responsiveness, cell transformation, survival, and have been implicated in the acquisition of an invasive and metastatic tumor phenotype (Baserga, Cell. 1994. 79:927-30; Baserga et al., Exp. Cell Res. 1999. 253:1-6, Baserga et al., Int J. Cancer. 2003. 107:873-77).
  • Immunohistochemical studies have shown that a number of human tumors express higher levels of IGF-IR.
  • the molecular architecture of IGF-IR comprises, two extra-cellular ⁇ subunits
  • IGF-IR insulin receptor
  • IGF-IR like the insulin receptor (InsR)
  • IGF-IR differs from other RTK family members by having covalent dimeric ( ⁇ 2 ⁇ 2) structures. Structurally, IGF-IR is highly related to LnsR (Pierre De Meyts and Whittaker, Nature Reviews Drug Discovery. 2002, 1: 769-83).
  • IGF-IR contains 84% sequence identity to InsR at the kinase domain, whereas the juxta-membrane and the c-terminal regions share 61% and 44% sequence identity, respectively (Ulrich et al., EMBO J., 1986, 5:2503-12; Blakesley et al., Cytokine Growth Factor Rev., 1996. 7:153-56).
  • the IGF-I and IGF-2 are the two activating ligands of IGF-IR.
  • IGF-I and IGF-2 to the ⁇ chain induces conformational changes that result in auto- phosphorylation of each ⁇ -chain at specific tyrosine residues, converting the receptor from unphoshorylated state to the active state.
  • the activation of three tyrosine residues in the activation loop (Tyr residues at 1131,1135 and 1136) of the kinase domain leads to increase in catalytic activity that triggers docking and phosphorylation of the substrates such as IRS-I and She adaptor proteins.
  • Activation of these substrates leads to phosphorylation of additional proteins involved in the signaling cascade of survival (PI3K, AKT, TOR, S6) and/or proliferation (mitogen-activated protein kinase, p42/p44) (PoUak et al., Nature Reviews Cancer. 2004. 4:505-516; Baserga et al., Biochem Biophys Act. 1997. 1332:F105-F126; Baserga et al, Int. J. Cancer. 2003. 107:873-77).
  • IGF-IR insulin growth factor-IR
  • InsR is a key regulator of physiological functions such as glucose transport and biosynthesis of glycogen and fat
  • IGF-IR is a potent regulator of cell growth and differentiation.
  • IGF-IR is ubiquitously expressed in tissues where it plays a role in tissue growth, under the control of growth hormone (GH), which modulates IGF-I.
  • GH growth hormone
  • IGFs play a crucial role in regulating cell proliferation, differentiation and apoptosis. Inhibition of IGF-IR mediated signaling has been shown to reduce tumor growth rate, increase apoptosis, increase killing of tumors by chemotherapy and other molecular target therapies (reviewed in Pollak et al., Nature Reviews Cancer. 2004. 4:505-516; Zhang et al., Breast Cancer Res. 2000. 2:170-75; Chakravarti et al, Cancer Res.2002. 62:200-07).
  • mice [0009] Experimental approaches undertaken to inhibit IGF-IR function in tumors have provided encouraging but limited success, and their effectiveness in treating cancer is yet to be determined in the clinic.
  • the experimental approaches include; antibodies to IGF- IR (KuIl et al., J. Biol. Chem. 1983, 258:6561-66; Kalebic et al., Cancer Res. 1994. 54:5531-4), neutralizing antibodies to IGF-I or IGF-2 (Fang et al, MoI. Cancer Therapy. 2006. 5:114-20; Miyamoto et al, Clin. Cancer Res. 2005, 11:3494-502), small-molecule tyrosine kinase inhibitors (Garcia-Escheverria et al, Cancer Cell. 2004.
  • IGF-IR In a cancer cell, in addition to pro-survival and proliferative signaling, activation of IGF-IR has also been shown to be involved in motility and invasion (Ress et al., Oncogene 2001. 20:490-00, Nolan et al, Int. J. Cancer.1997.72:828-34, Stracke et al, J. Biol. Chem. 1989. 264:21544-49; Jackson et al, Oncogene, 2001. 20:7318-25).
  • Tumor cells have been shown to produce one or more of the components of the
  • IGF-I IGF-I
  • IGF-2 IGF-IR
  • IGF-2R IGF-BPs
  • LOI loss of imprinting
  • IGF-IR sensitive tumors receive receptor activation signals of IGF-I from the circulation (liver produced) and IGF-2 from the tumor, and thus approaches aimed at disrupting the biological activity mediated by both IGF-I and IGF-2 should provide a better anti- tumor response. Therefore, anti-IGF-lR antibody methods that effectively block the biological functions mediated by both IGF-I and IGF-2 may provide an improved 1 efficacy over other approaches that do not efficiently block the biological functions of both IGF- land IGF-2 mediated IGF-IR signaling in tumor microenvironment.
  • IGF-IR is ubiquitously expressed and thus antibodies targeting IGF-IR should have minimal or no effector functions to avoid toxicities resulting from ADCC and CDC activities in normal tissues.
  • One possibility of developing such antibodies is to have the non-glycosylated form of the human gamma 4 Fc region, which does not mediate ADCC or CDC functions.
  • IGF-IR is involved in oncogene mediated cellular transformation.
  • IGFAGF-IR activation mediates mitogenic and pro-survival signaling in cancer cell.
  • IGF-IR activation also promotes cell motility and metastasis.
  • IGF-IR is over expressed in many cancers. [0019] Individuals with higher than normal circulating IGF levels have increased risk for developing cancer.
  • IGF-IR antibodies with different or improved binding, efficacy, and safety characteristics for the treatment of various neoplastic diseases including cancer and metastases thereof.
  • the present invention is based on the important role of the IGF system in regulating cell proliferation, differentiation, apoptosis and transformation.
  • type I insulin like growth factor receptor (IGF-IR) and its ligands, IGF-I and IGF-2 play a significant role in pre- and post-natal development, growth hormone responsiveness, cell transformation, survival, and have been implicated in the acquisition of an invasive and metastatic tumor phenotype.
  • the invention relates generally to IGF-IR antibodies, antigen binding fragments or derivatives thereof. Certain IGF-IR antibodies and antigen- binding fragments inhibit IGF-IR function or block the biological functions of IGF- land IGF-2 mediated IGF-IR signaling. Additionally, the invention generally relates to methods for treating various neoplastic diseases including cancer and metastases, as well as various hyperproliferative disease, disorders or injuries associated with IGF-IR signaling.
  • the invention provides an isolated antibody or antigen- binding fragment thereof which specifically binds to the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of Ml 3- C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and PlG10.2B8.
  • a reference monoclonal Fab antibody fragment selected from the group consisting of Ml 3- C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11
  • the invention provides an isolated antibody or antigen- binding fragment thereof which specifically binds to IGF-Rl, where the antibody or fragment competitively inhibits a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8 from binding to IGF-Rl.
  • a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04
  • a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11,
  • the invention provides an isolated antibody or antigen- binding fragment thereof which specifically binds to IGF-Rl, where the antibody or fragment thereof comprises an antigen binding domain identical to that of a monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14- C03, M14-B01, M12-E01, and M12-G04, or a monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24Bll, PlE2.3B12, and PlG10.2B8.
  • a monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14- C03, M14-B01, M12-E01, and M12-G04
  • a monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8,
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the heavy chain variable region (VH) of the antibody or fragment thereof comprises an amino acid sequence at least 90% identical to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 9, SEQ ID NO: 14, SEQ ID NO: 20, SEQ ID NO: 26, SEQ ID NO: 32, SEQ ID NO: 38, SEQ ID NO: 43, SEQ ID NO: 48, SEQ ID NO: 53, SEQ ID NO: 58, and SEQ ID NO: 63.
  • VH heavy chain variable region
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the light chain variable region (VL) of the antibody or fragment thereof comprises an amino acid sequence at least 90% identical to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 68, SEQ ID NO: 73, SEQ ID NO: 78, SEQ ID NO: 83, SEQ ID NO: 88, SEQ ID NO: 93, SEQ ID NO: 98, SEQ ID NO: 103, SEQ ID NO: 108, SEQ ID NO: 113, and SEQ ID NO: 118.
  • VL light chain variable region
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH of the antibody or fragment thereof comprises an amino acid sequence identical, except for 20 or fewer conservative amino acid substitutions, to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 9, SEQ ID NO: 14, SEQ ID NO: 20, SEQ ID NO: 26, SEQ ID NO: 32, SEQ ID NO: 38, SEQ ID NO: 43, SEQ ID NO: 48, SEQ ID NO: 53, SEQ ID NO: 58, and SEQ ID NO: 63.
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VL of the antibody or fragment thereof comprises an amino acid sequence identical, except for 20 or fewer conservative amino acid substitutions, to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 68, SEQ ID NO: 73, SEQ ID NO: 78, SEQ ID NO: 83, SEQ ID NO: 88, SEQ ID NO: 93, SEQ ID NO: 98, SEQ ID NO: 103, SEQ ID NO: 108, SEQ ID NO: 113, and SEQ ID NO: 118.
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH of the antibody or fragment thereof comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 9, SEQ ID NO: 14, SEQ ED NO: 20, SEQ ID NO: 26, SEQ ID NO: 32, SEQ ID NO: 38, SEQ ID NO: 43, SEQ ID NO: 48, SEQ ID NO: 53, SEQ ID NO: 58, and SEQ ID NO: 63.
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VL of the antibody or fragment thereof comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 68, SEQ ID NO: 73, SEQ ID NO: 78, SEQ ID NO: 83, SEQ ID NO: 88, SEQ ID NO: 93, SEQ ID NO: 98, SEQ ID NO: 103, SEQ ID NO: 108, SEQ ID NO: 113, and SEQ ID NO: 118.
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH and VL of the antibody or fragment thereof comprise, respectively, amino acid sequences at least 90% identical to reference amino acid sequences selected from the group consisting of: SEQ ID NO: 4 and SEQ ID NO: 68; SEQ ID NO: 8 and SEQ ID NO: 73; SEQ ID NO: 14 and SEQ ID NO: 78; SEQ ID NO: 20 and SEQ ID NO: 83; SEQ ID NO: 26 and SEQ ID NO: 88; SEQ ID NO: 32 and SEQ ID NO: 93; SEQ ID NO: 38 and SEQ ID NO: 98; SEQ ID NO: 43 and SEQ ID NO: 103; SEQ ID NO: 48 and SEQ ID NO: 108; SEQ ID NO: 53 and SEQ ID NO: 103; SEQ TD NO: 58 and SEQ ID NO: 113; and SEQ ID NO: 63 and 118.
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH and VL of the antibody or fragment thereof comprise, respectively, amino acid sequences identical, except for 20 or fewer conservative amino acid substitutions each, to reference amino acid sequences selected from the group consisting of: SEQ ID NO: 4 and SEQ ID NO: 68; SEQ ID NO: 8 and SEQ ID NO: 73; SEQ ID NO: 14 and SEQ ID NO: 78; SEQ ID NO: 20 and SEQ ID NO: 83; SEQ ID NO: 26 and SEQ ID NO: 88; SEQ ID NO: 32 and SEQ ID NO: 93; SEQ ID NO: 38 and SEQ ID NO: 98; SEQ ID NO: 43 and SEQ ID NO: 103; SEQ ID NO: 48 and SEQ ID NO: 108; SEQ ID NO: 53 and SEQ ID NO: 103; SEQ ID NO: 58 and SEQ ID NO: 113; and SEQ ID NO: 63 and
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH and VL of the antibody or fragment thereof comprise, respectively, amino acid sequences selected from the group consisting of: SEQ ID NO: 4 and SEQ ID NO: 68; SEQ ID NO: 8 and SEQ ID NO: 73; SEQ ID NO: 14 and SEQ BD NO: 78; SEQ ID NO: 20 and SEQ ID NO: 83; SEQ ID NO: 26 and SEQ ID NO: 88; SEQ ED NO: 32 and SEQ ED NO: 93; SEQ DD NO: 38 and SEQ ID NO: 98; SEQ ID NO: 43 and SEQ ID NO: 103; SEQ ED NO: 48 and SEQ ID NO: 108; SEQ ID NO: 53 and SEQ ID NO: 103; SEQ ID NO: 58 and SEQ ID NO: 113; and SEQ ID NO: 63 and 118.
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH of the antibody or fragment thereof comprises a Kabat heavy chain complementarity determining region-1 (VH- CDRl) amino acid sequence identical, except for two or fewer amino acid substitutions, to a reference VH-CDRl amino acid sequence selected from the group consisting of: SEQ ID NO: 5, SEQ ED NO: 10, SEQ ED NO: 15, SEQ ID NO: 21, SEQ ID NO: 27, SEQ ID NO: 33, SEQ ID NO: 39, SEQ ID NO: 44, SEQ ID NO: 49, SEQ ID NO: 54, SEQ ID NO: 59, and SEQ ID NO: 64.
  • VH- CDRl Kabat heavy chain complementarity determining region-1
  • the VH-CDRl amino acid sequence is selected from the group consisting of: SEQ ID NO: 5, SEQ ID NO: 10, SEQ ID NO: 15, SEQ ID NO: 21, SEQ ED NO: 27, SEQ ED NO: 33, SEQ ID NO: 39, SEQ ED NO: 44, SEQ ID NO: 49, SEQ ID NO: 54, SEQ ED NO: 59, and SEQ ID NO: 64.
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH of the antibody or fragment thereof comprises a Kabat heavy chain complementarity determining region-2 (VH- CDR2) amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VH-CDR2 amino acid sequence selected from the group consisting of: SEQ ID NO: 6, SEQ ED NO: 11, SEQ ED NO: 16, SEQ ID NO: 22, SEQ ED NO: 28, SEQ ID NO: 34, SEQ ID NO: 40, SEQ ID NO: 45, SEQ ID NO: 50, SEQ ID NO: 55, SEQ ID NO: 60, and SEQ ID NO: 65.
  • VH- CDR2 Kabat heavy chain complementarity determining region-2
  • the VH-CDR2 amino acid sequence is selected from the group consisting of: SEQ ID NO: 6, SEQ ID NO: 11, SEQ ID NO: 16, SEQ ED NO: 22, SEQ ED NO: 28, SEQ ED NO: 34, SEQ ID NO: 40, SEQ ED NO: 45, SEQ ID NO: 50, SEQ ED NO: 55, SEQ ID NO: 60, and SEQ ID NO: 65.
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH of the antibody or fragment thereof comprises a Kabat heavy chain complementarity determining regjon-3 (VH- CDR3) amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VH-CDR3 amino acid sequence selected from the group consisting of: SEQ ID NO: 7, SEQ ID NO: 12, SEQ ID NO: 17, SEQ ID NO: 23, SEQ ID NO: 29, SEQ ID NO: 35, SEQ ID NO: 41, SEQ ID NO: 46, SEQ ID NO: 51, SEQ ID NO: 56, SEQ ID NO: 61, and SEQ ID NO: 66.
  • VH- CDR3 Kabat heavy chain complementarity determining regjon-3
  • the VH-CDR3 amino acid sequence is selected from the group consisting of: SEQ ID NO: 7, SEQ ID NO: 12, SEQ ID NO: 17, SEQ ID NO: 23, SEQ ID NO: 29, SEQ ID NO: 35, SEQ ID NO: 41, SEQ ID NO: 46, SEQ ED NO: 51, SEQ ID NO: 56, SEQ ID NO: 61, and SEQ ID NO: 66.
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl , where the VL of the antibody or fragment thereof comprises a Kabat light chain complementarity determining region- 1 (VL-CDRl) amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VL-CDRl amino acid sequence selected from the group consisting of: SEQ ID NO: 69, SEQ ID NO: 74, SEQ ED NO: 79, SEQ ED NO: 84, SEQ ID NO: 89, SEQ ID NO: 94, SEQ ID NO: 99, SEQ ID NO: 104, SEQ ID NO: 109, SEQ ID NO: 114, and SEQ ED NO: 119.
  • the VL-CDRl amino acid sequence is selected from the group consisting of: SEQ ID NO: 69, SEQ ID NO: 74, SEQ ED NO:
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VL of the antibody or fragment thereof comprises a Kabat light chain complementarity determining region-2 (VL-CDR2) amino acid sequence identical, except for two or fewer amino acid substitutions, to a reference VL-CDR2 amino acid sequence selected from the group consisting of: SEQ ED NO: 70, SEQ ID NO: 75, SEQ ID NO: 80, SEQ ID NO: 85, SEQ ID NO: 90, SEQ ED NO: 95, SEQ ID NO: 100, SEQ ID NO: 105, SEQ ID NO: 110, SEQ ID NO: 115, and SEQ ED NO: 120.
  • the VL-CDR2 amino acid sequence is selected from the group consisting of: SEQ ID NO: 70, SEQ ID NO: 75, SEQ ED NO:
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VL of the antibody or fragment thereof comprises a Kabat light chain complementarity determining region-3 (VL-CDR3) amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VL-CDR3 amino acid sequence selected from the group consisting of: SEQ ID NO: 71, SEQ ID NO: 76, SEQ ED NO: 81, SEQ ID NO: 86, SEQ ID NO: 91, SEQ ID NO: 96, SEQ ID NO: 101, SEQ ID NO: 106, SEQ ID NO: 111, SEQ ID NO: 116, and SEQ ID NO: 121.
  • VL-CDR3 Kabat light chain complementarity determining region-3
  • the VL-CDR3 amino acid sequence is selected from the group consisting of: SEQ ID NO: 71, SEQ ID NO: 76, SEQ ID NO: 81, SEQ ID NO: 86, SEQ ID NO: 91, SEQ ID NO: 96, SEQ ID NO: 101, SEQ ID NO: 106, SEQ ID NO: 111, SEQ ID NO: 116, and SEQ ID NO: 121.
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH of the antibody or fragment thereof comprises VH-CDRl, VH-CDR2, and VH-CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 5, 6, and 7; SEQ ID NOs: 10, 11, and 12; SEQ ID NOs: 15, 16, and 17; SEQ ED NOs: 21, 22, and 23; SEQ ID NOs: 27, 28, and 29; SEQ TD NOs: 33, 34, and 35; SEQ ID NOs: 39, 40, and 41;.
  • SEQ ID NOs: 44, 45, and 46 SEQ ID NOs: 49, 50, and 51; SEQ ID NOs: 54, 55, and 56; SEQ ID NOs: 59, 60, and 61; and SEQ ID NOs: 64, 65, and 66, except for one, two, three, or four amino acid substitutions in at least one of said VH-CDRs.
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH of the antibody or fragment thereof comprises VH-CDRl, VH-CDR2, and VH-CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 5, 6, and 7; SEQ ID NOs: 10, 11, and 12; SEQ ID NOs: 15, 16, and 17; SEQ ID NOs: 21, 22, and 23; SEQ ID NOs: 27, 28, and 29; SEQ ID NOs: 33, 34, and 35; SEQ ID NOs: 39, 40, and 41 ;.
  • SEQ ID NOs: 44, 45, and 46 SEQ ID NOS: 49, 50, and 51; SEQ BD NOs: 54, 55, and 56; SEQ ID NOs: 59, 60, and 61; and SEQ ID NOs: 64, 65, and 66.
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VL of the antibody or fragment thereof comprises VL-CDRl, VL-CDR2, and VL-CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 69, 70, and 71; SEQ H) NOs: 74, 75, and 76; SEQ ID NOs: 79, 80, and 81; SEQ ID NOs: 84, 85, and 86; SEQ ID NOs: 89, 90, and 91;
  • the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl , where the VL of the antibody or fragment thereof comprises VL-CDRl, VL-CDR2, and VL-CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 69, 70, and 71; SEQ ID NOs: 74, 75, and 76;
  • the VH framework regions and/or VL framework regions are human, except for five or fewer amino acid substitutions.
  • the above-described antibodies or fragments thereof bind to a linear epitope or a non-linear conformation epitope
  • the above-described antibodies or fragments thereof are multivalent, and comprise at least two heavy chains and at least two light chains.
  • the above-described antibodies or fragments thereof are multispecific. In further embodiments, the above-described antibodies or fragments thereof are bispecific.
  • the heavy and light chain variable domains are fully human.
  • the heavy and light chain variable domains are from a monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-
  • the heavy and light chain variable domains are murine.
  • the heavy and light chain variable domains are from a monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11,
  • the above-described antibodies or fragments thereof are humanized.
  • the above-described antibodies or fragments thereof are chimeric.
  • the above-described antibodies or fragments thereof are primatized.
  • the above-described antibodies or fragments thereof are fully human.
  • Fab fragments Fab 1 fragments, F(ab) 2 fragments, or Fv fragments.
  • the above-described antibodies are single chain antibodies.
  • the above-described antibodies or fragments thereof comprise light chain constant regions selected from the group consisting of a human kappa constant region and a human lambda constant region.
  • the above-described antibodies or fragments thereof comprise a heavy chain constant region or fragment thereof.
  • the heavy chain constant region or fragment thereof is human IgG4.
  • the IgG4 is mutagenized to remove glycosylation sites.
  • the IgG4 mutations comprise S241P and T318A, using the Kabat numbering system.
  • the above-described antibodies or fragments thereof specifically bind to an IGF-Rl polypeptide or fragment thereof, or an IGF-Rl variant polypeptide, with an affinity characterized by a dissociation constant (K D ) which is less than the KD for said reference monoclonal antibody.
  • K D dissociation constant
  • the dissociation constant (K D ) is no greater than 5 x 10 ⁇ 2 M, 10 "2 M, 5 x 10 '3 M, 10 '3 M, 5 x Kr 4 M, It) "4 M, 5 x l(r 5 M, 10 5 M, 5 x 10 6 M, 10 "6 M, 5 x 1(T 7 M, 10 "7 M, 5 x 1(T 8 M, 10 " 8 M, 5 x 10 9 M, l(r 9 M, 5 x 10 "10 M, 10 10 M, 5 x 10 " " M, 1(T 11 M, 5 x 1(T 12 M, 1(T 12 M, 5 x 10 13 M, 10 13 M, 5 x 1(T 14 M, 10 14 M, 5 x 10 15 M, or 10 15 M.
  • the above-described antibodies or fragments thereof preferentially bind to a human IGF-Rl polypeptide or fragment thereof, relative to a murine IGF-Rl polypeptide or fragment thereof or a non-human primate IGF-Rl polypeptide or fragment thereof.
  • the above described antibodies or fragments thereof bind to human IGF-Rl polypeptide or fragment thereof, and also binds to a non-human primate IGF-Rl polypeptide or fragment thereof. [0064] In some embodiments, the above described antibodies or fragments thereof bind to
  • the cell is a malignant cell, a neoplastic cell, a tumor cell, or a metastatic cell.
  • the above described antibodies or fragments thereof block insulin growth factor from binding to IGF-Rl.
  • the insulin growth factor is insulin growth factor-1 (IGF-I) or insulin growth factor-2 (IGF-2).
  • IGF-I insulin growth factor-1
  • IGF-2 insulin growth factor-2
  • the above described antibodies or fragments thereof block both IGF-I and IGF-2 from binding to IGF-Rl .
  • IGF-Rl -mediated cell proliferation IGF-I or IGF-2-mediated IGF-Rl phosphorylation, tumor cell growth, or IGF-Rl internalization.
  • the above described antibodies or fragments thereof further comprise a heterologous polypeptide fused thereto.
  • the above described antibodies or fragments thereof are conjugated to an agent selected from the group consisting of cytotoxic agent, a therapeutic agent, cytostatic agent, a biological toxin, a prodrug, a peptide, a protein, an enzyme, a virus, a lipid, a biological response modifier, pharmaceutical agent, a lymphokine, a heterologous antibody or fragment thereof, a detectable label, polyethylene glycol (PEG), and a combination of two or more of any said agents.
  • an agent selected from the group consisting of cytotoxic agent, a therapeutic agent, cytostatic agent, a biological toxin, a prodrug, a peptide, a protein, an enzyme, a virus, a lipid, a biological response modifier, pharmaceutical agent, a lymphokine, a heterologous antibody or fragment thereof, a detectable label, polyethylene glycol (PEG), and a combination of two or more of any said agents.
  • PEG polyethylene glycol
  • the cytotoxic agent is selected from the group consisting of a radionuclide, a biotoxin, an enzymatically active toxin, a cytostatic or cytotoxic therapeutic agent, a prodrugs, an immunologically active ligand, a biological response modifier, or a combination of two or more of any said cytotoxic agents.
  • the detectable label is selected from the group consisting of an enzyme, a fluorescent label, a chemiluminescent label, a bioluminescent label, a radioactive label, or a combination of two or more of any said detectable labels.
  • the invention includes compositions comprising the above-described antibodies or fragments thereof, and a carrier.
  • the amino acid sequence of the VH polypeptide is selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 9, SEQ ED NO: 14, SEQ ID NO: 20, SEQ ID NO: 26, SEQ ID NO: 32, SEQ ID NO: 38, SEQ ID NO: 43, SEQ ED NO: 48, SEQ ID NO: 53, SEQ ID NO: 58, and SEQ ID NO: 63.
  • the nucleotide sequence encoding the VH polypeptide is optimized for increased expression without changing the amino acid sequence of the VH polypeptide.
  • the optimization comprises identification and removal of splice donor and splice acceptor sites and/or optimization of codon usage for the cells expressing the polynucleotide.
  • the nucleic acid comprises a nucleotide sequence selected from the group consisting of: SEQ ID NO: 3, SEQ ID NO: 8, SEQ ID NO: 13, SEQ ED NO: 18, SEQ ID NO: 19, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ED NO: 30, SEQ ID NO: 31, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ED NO: 42, SEQ ED NO: 47, SEQ ID NO: 52, SEQ ID NO: 57, and SEQ ID NO: 62.
  • the invention provides an isolated polynucleotide comprising a nucleic acid which encodes an antibody VL polypeptide, where the amino acid sequence of the VL polypeptide is at least 90% identical to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 68, SEQ ED NO: 73, SEQ ID NO: 78, SEQ ID NO: 83, SEQ ID NO: 88, SEQ ID NO: 93, SEQ ID NO: 98, SEQ ID NO: 103, SEQ ED NO: 108, SEQ ID NO: 113, and SEQ ID NO: 118; and where an antibody or antigen binding fragment thereof comprising the VL polypeptide specifically binds to IGF-Rl.
  • the amino acid sequence of the VL polypeptide is selected from the group consisting of: SEQ ID NO: 68, SEQ DD NO: 73, SEQ ID NO: 78, SEQ ID NO: 83, SEQ ID NO: 88, SEQ ID NO: 93, SEQ ID NO: 98, SEQ ID NO: 103, SEQ ED NO: 108, SEQ ID NO: 113, and SEQ ED NO: 118.
  • the nucleotide sequence encoding the VL polypeptide is optimized for increased expression without changing the amino acid sequence of said VL polypeptide.
  • the optimization comprises identification and removal of splice donor and splice acceptor sites and/or optimization of codon usage for the cells expressing the polynucleotide.
  • the nucleic acid comprises a nucleotide sequence selected from the group consisting of: SEQ ED NO: 67, SEQ ID NO: 72, SEQ ID NO: 77, SEQ ID NO: 82, SEQ ED NO: 87, SEQ ID NO: 92, SEQ ID NO: 97, SEQ ID NO: 102, SEQ ID NO: 107, SEQ ID NO: 112, and SEQ ID NO:
  • the invention provides an isolated polynucleotide comprising a nucleic acid which encodes an antibody VH polypeptide, where the amino acid sequence of the VH polypeptide is identical, except for 20 or fewer conservative amino acid substitutions, to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 9, SEQ ID NO: 14, SEQ ID NO: 20, SEQ ID NO: 26, SEQ ID NO: 32, SEQ ED NO: 38, SEQ ID NO: 43, SEQ ID NO: 48, SEQ ID NO: 53, SEQ ID NO: 58, and SEQ ID NO: 63; and where an antibody or antigen binding fragment thereof comprising said VH polypeptide specifically binds to IGF-Rl .
  • the invention provides an isolated polynucleotide comprising a nucleic acid which encodes an antibody VL polypeptide, where the amino acid sequence of the VL polypeptide is identical, except for 20 or fewer conservative amino acid substitutions, to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 68, SEQ ID NO: 73, SEQ ID NO: 78, SEQ ID NO: 83, SEQ ID NO: 88, SEQ ID NO: 93, SEQ ID NO: 98, SEQ ID NO: 103, SEQ ID NO: 108, SEQ ID NO: 113, and SEQ ID NO: 118; and wherein an antibody or antigen binding fragment thereof comprising said VL polypeptide specifically binds to IGF-Rl.
  • the invention provides an isolated polynucleotide comprising a nucleic acid which encodes a V ⁇ -CDR1 amino acid sequence identical, except for two or fewer amino acid substitutions, to a reference VH-CDRl amino acid sequence selected from the group consisting of: SEQ ID NO: 5, SEQ ID NO: 10, SEQ ID NO: 15, SEQ ID NO: 21, SEQ ID NO: 27, SEQ ID NO: 33, SEQ ID NO: 39, SEQ ID NO: 44, SEQ ID NO: 49, SEQ ID NO: 54, SEQ ID NO: 59, and SEQ ID NO: 64; and where an antibody or antigen binding fragment thereof comprising the VH-CDRl specifically binds to IGF-Rl.
  • the VH-CDRl amino acid sequence is selected from the group consisting of: SEQ ID NO: 5, SEQ ID NO: 10, SEQ ID NO: 15, SEQ ID NO: 21, SEQ BD NO: 27, SEQ ID NO: 33, SEQ ID NO: 39, SEQ ID NO: 44, SEQ DD NO: 49, SEQ ID NO: 54, SEQ ID NO: 59, and SEQ ID NO: 64.
  • the invention provides an isolated polynucleotide comprising a nucleic acid which encodes a VH-CDR2 amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VH-CDR2 amino acid sequence selected from the group consisting of: SEQ ID NO: 6, SEQ DD NO: 11, SEQ DD NO: 16, SEQ DD NO: 22, SEQ DD NO: 28, SEQ DD NO: 34, SEQ DD NO: 40, SEQ DD NO: 45, SEQ ID NO: 50, SEQ DD NO: 55, SEQ DD NO: 60, and SEQ DD NO: 65; and where an antibody or antigen binding fragment thereof comprising the VH-CDR2 specifically binds to IGF-Rl.
  • the VH-CDR2 amino acid sequence is selected from the group consisting of: SEQ ID NO: 6, SEQ ID NO: 11, SEQ ID NO: 16, SEQ ID NO: 22, SEQ ID NO: 28, SEQ ID NO: 34, SEQ ID NO: 40, SEQ ID NO: 45, SEQ ID NO: 50, SEQ ID NO: 55, SEQ ID NO: 60, and SEQ ID NO: 65.
  • the invention provides an isolated polynucleotide comprising a nucleic acid which encodes a VH-CDR3 amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VH-CDR3 amino acid sequence selected from the group consisting of: SEQ ID NO: 7, SEQ ID NO: 12, SEQ ID NO: 17, SEQ ID NO: 23, SEQ ID NO: 29, SEQ ID NO: 35, SEQ ID NO: 41, SEQ ID NO: 46, SEQ ID NO: 51, SEQ ID NO: 56, SEQ ID NO: 61, and SEQ ID NO: 66; and where an antibody or antigen binding fragment thereof comprising the VH-CDR3 specifically binds to IGF-Rl.
  • the VH-CDR3 amino acid sequence is selected from the group consisting of: SEQ ID NO: 7, SEQ ID NO: 12, SEQ ID NO: 17, SEQ ID NO: 23, SEQ ED NO: 29, SEQ ID NO: 35, SEQ ID NO: 41, SEQ ID NO: 46, SEQ ID NO: 51, SEQ ID NO: 56, SEQ ID NO: 61, and SEQ ID NO: 66.
  • the invention provides an isolated polynucleotide comprising a nucleic acid which encodes a VL-CDRl amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VL-CDRl amino acid sequence selected from the group consisting of: SEQ ID NO: 69, SEQ ID NO: 74, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 89, SEQ ID NO: 94, SEQ ID NO: 99, SEQ ID NO: 104, SEQ ID NO: 109, SEQ ID NO: 114, and SEQ ID NO: 119; and where an antibody or antigen binding fragment thereof comprising the VL-CDRl specifically binds to IGF-Rl .
  • the VL-CDRl amino acid sequence is selected from the group consisting of: SEQ ID NO: 69, SEQ ED NO: 74, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 89, SEQ ID NO: 94, SEQ ID NO: 99, SEQ ED NO: 104, SEQ ID NO: 109, SEQ DD NO: 114, and SEQ ED NO: 119.
  • the invention provides an isolated polynucleotide comprising a nucleic acid which encodes a VL-CDR2 amino acid sequence identical, except for two or fewer amino acid substitutions, to a reference VL-CDR2 amino acid sequence selected from the group consisting of: SEQ ID NO: 70, SEQ ED NO: 75, SEQ ID NO: 80, SEQ ID NO: 85, SEQ ID NO: 90, SEQ ID NO: 95, SEQ ID NO: 100, SEQ ID NO: 105, SEQ ID NO: 110, SEQ ED NO: 115, and SEQ ED NO: 120; and wherein an antibody or antigen binding fragment thereof comprising said VL-CDR2 specifically binds to IGF-Rl.
  • the VL-CDR2 amino acid sequence is selected fiom the group consisting of: SEQ ID NO: 70, SEQ ID NO: 75, SEQ ID NO: 80, SEQ ID NO: 85, SEQ ID NO: 90, SEQ ID NO: 95, SEQ ID NO: 100, SEQ ID NO: 105, SEQ ID NO: 110, SEQ ID NO: 115, and SEQ ID NO: 120.
  • the invention provides an isolated polynucleotide comprising a nucleic acid which encodes a VL-CDR3 amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VL-CDR3 amino acid sequence selected from the group consisting of: SEQ ID NO: 71, SEQ ID NO: 76, SEQ ID NO: 81, SEQ ID NO: 86, SEQ ED NO: 91, SEQ ID NO: 96, SEQ ID NO: 101, SEQ ID NO: 106, SEQ ID NO: 111, SEQ ID NO: 116, and SEQ ID NO: 121; and wherein an antibody or antigen binding fragment thereof comprising said VL-CDR3 specifically binds to IGF-Rl.
  • the VL-CDR3 amino acid sequence is selected from the group consisting of: SEQ ID NO: 71, SEQ ID NO: 76, SEQ ID NO: 81, SEQ DO NO: 86, SEQ ID NO: 91, SEQ ID NO: 96, SEQ ID NO: 101, SEQ ID NO: 106, SEQ ID NO: 111, SEQ ID NO: 116, and SEQ ID NO: 121.
  • the invention provides an isolated polynucleotide comprising a nucleic acid which encodes an antibody VH polypeptide, where the VH polypeptide comprises VH-CDRl, VH-CDR2, and VH-CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 5, 6, and 7; SEQ ID NOs: 10, 11, and 12; SEQ ID NOs: 15, 16, and 17; SEQ ID NOs: 21, 22, and 23; SEQ ID NOs: 27, 28, and 29; SEQ ID NOs: 33, 34, and 35; SEQ ID NOs: 39, 40, and 41;.
  • SEQ ID NOs: 44, 45, and 46 SEQ ID NOs: 49, 50, and 51; SEQ ID NOs: 54, 55, and 56; SEQ ID NOs: 59, 60, and 61; and SEQ ID NOs: 64, 65, and 66; and where an antibody or antigen binding fragment thereof comprising the VL-CDR3 specifically binds to IGF-Rl.
  • the invention provides an isolated polynucleotide comprising a nucleic acid which encodes an antibody VL polypeptide, wherein said VL polypeptide comprises VH-CDRl, VH-CDR2, and VH-CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 69, 70, and 71; SEQ DD NOs: 74, 75, and 76; SEQ ID NOs: 79, 80, and 81; SEQ ID NOs: 84, 85, and 86; SEQ ID NOs: 89, 90, and 91; SEQ ID NOs: 94, 95, and 96; SEQ ID NOs: 99, 100, and 101; SEQ ED NOs: 104, 105, and 106; SEQ ID NOs: 109, 110, and 111; SEQ ID NOs: 114, 115, and 116; and SEQ ID NOs: 119, 120, and 121; and wherein an antibody or
  • the above-described polynucleotides further comprise a nucleic acid encoding a heavy chain constant region CHl domain fused to the VH polypeptide, encoding a heavy chain constant region CH2 domain fused to the VH polypeptide, encoding a heavy chain constant region CH3 domain fused to the VH polypeptide, or encoding a heavy chain hinge region fused to said VH polypeptide.
  • the heavy chain constant region is human IgG4.
  • the IgG4 is mutagenized to remove glycosylation sites.
  • the IgG4 mutations comprise S241P and T318A using the Kabat numbering system.
  • the above-described polynucleotides comprise a nucleic acid encoding a light chain constant region domain fused to said VL polypeptide.
  • the light chain constant region is human kappa.
  • the antibody or antigen-binding fragment thereof comprising a polypeptide encoded by the nucleic acid specifically binds the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14- BOl, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8.
  • the antibody or antigen-binding fragment thereof comprising a polypeptide encoded by the nucleic acid competitively inhibits a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12- EOl, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8.
  • the framework regions of the VH polypeptide or VL polypeptide are human, except for five or fewer amino acid substitutions.
  • the invention provides an antibody or antigen-birring fragment thereof comprising the polypeptide encoded by the nucleic acid, that binds to a linear epitope or a non-linear conformational epitope.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is multivalent, and comprises at least two heavy chains and at least two light chains.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is multispecific. In further embodiments, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is bispecific.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid comprises heavy and light chain variable domains which are fully human.
  • the heavy and light chain variable domains are identical to those of a monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M 14- Gl 1, M14-C03, M14-B01, M12-E01, and M12-G04.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid comprises heavy and light chain variable domains which are murine.
  • the heavy and light chain variable domains are identical to those of a monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is primatized.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is chimeric.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is fully human.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is an Fab fragment, an Fab' fragment, an F(ab) 2 fragment, or an Fv fragment.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is a single chain antibody.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid specifically binds to an IGF-Rl polypeptide or fragment thereof, or an IGF-Rl variant polypeptide, with an affinity characterized by a dissociation constant (K D ) no greater than 5 x 10 "2 M, 10 "2 M, 5 x 10 "3 M, 10 "3 M, 5 x 1(T* M, 10 ⁇ M, 5 x 10 "5 M, 10 ⁇ 5 M, 5 x 10 "6 M, KT 6 M, 5 x 10 7 M, 1(T 7 M, 5 x 10 8 M, 10 "8 M, 5 x 10 9 M, 1(T 9 M, 5 x 10 "10 M, 10 10 M, 5 x 10 "u M, 10 " M, 5 x 10 12 M, 1(T 12 M, 5 x 10 13 M, 10 13 M, 5 x 10 "14 M
  • K D dissociation constant
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid preferentially binds to a human IGF-Rl polypeptide or fragment thereof, relative to a murine IGF-Rl polypeptide or fragment thereof or a non-human primate IGF-Rl polypeptide or fragment thereof.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid binds to a human IGF-Rl polypeptide or fragment thereof, and also binds to a non-human primate IGF-Rl polypeptide or fragment thereof.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid binds to IGF-Rl expressed on the surface of a cell.
  • the cell is a malignant cell, a neoplastic cell, a tumor cell, or a metastatic cell.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by said nucleic acid blocks insulin growth factor from binding to IGF-Rl.
  • the insulin growth factor is insulin growth factor- 1 (IGF-I) or insulin growth factor-2 (IGF- 2).
  • the antibody or antigen-binding fragment thereof blocks both IGF-I and IGF-2 from binding to IGF-Rl.
  • the an antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid inhibits IGF-Rl -mediated cell proliferation, inhibits IGF-I or IGF-2-mediated IGF-Rl phosphorylation, inhibits tumor cell growth or inhibits IGF-Rl internalization.
  • the above-described polynucleotides further comprise a nucleic acid encoding a heterologous polypeptide.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is conjugated to an agent selected from the group consisting of cytotoxic agent, a therapeutic agent, cytostatic agent, a biological toxin, a prodrug, a peptide, a protein, an enzyme, a virus, a lipid, a biological response modifier, pharmaceutical agent, a lymphokine, a heterologous antibody or fragment thereof, a detectable label, polyethylene glycol (PEG), and a combination of two or more of any said agents.
  • an agent selected from the group consisting of cytotoxic agent, a therapeutic agent, cytostatic agent, a biological toxin, a prodrug, a peptide, a protein, an enzyme, a virus, a lipid, a biological response modifier, pharmaceutical agent, a lymphokine, a heterologous antibody or fragment thereof, a detectable label, polyethylene glycol (PEG), and a combination of two or more of any said agents.
  • the cytotoxic agent is selected from the group consisting of a radionuclide, a biotoxin, an enzymatically active toxin, a cytostatic or cytotoxic therapeutic agent, a prodrugs, an immunologically active ligand, a biological response modifier, or a combination of two or more of any said cytotoxic agents.
  • the detectable label is selected from the group consisting of an enzyme, a fluorescent label, a chemiluminescent label, a bioluminescent label, a radioactive label, or a combination of two or more of any said detectable labels.
  • the invention provides compositions comprising the above- described polynucleotides.
  • the invention provides vectors comprising the above-described polynucleotides.
  • the polynucleotides are operably associated with a promoter.
  • the invention provides host cells comprising such vectors.
  • the invention provides vectors where the polynucleotide is operably associated with a promoter.
  • the invention provides a method of producing an antibody or fragment thereof which specifically binds IGF-IR, comprising culturing a host cell containing a vector comprising the above-described polynucleotides, and recovering said antibody, or fragment thereof.
  • the invention provides an isolated polypeptide produced by the above-described method.
  • the invention provides isolated polypeptides encoded by the above-described polynucleotides.
  • the antibody or fragment thereof comprising the polypeptide specifically binds to IGF-IR.
  • Other embodiments include the isolated antibody or fragment thereof comprising the above- described polypeptides.
  • the invention provides a composition comprising an isolated VH encoding polynucleotide and an isolated VL encoding polynucleotide, where the VH encoding polynucleotide and the VL encoding polynucleotide, respectively, comprise nucleic acids encoding amino acid sequences at least 90% identical to reference amino acid sequences selected from the group consisting of: SEQ ID NO: 4 and SEQ ID NO: 68; SEQ ID NO: 8 and SEQ ID NO: 73; SEQ ID NO: 14 and SEQ ID NO: 78; SEQ ID NO: 20 and SEQ ID NO: 83; SEQ ID NO: 26 and SEQ ID NO: 88; SEQ ID NO: 32 and SEQ ID NO: 93; SEQ ID NO: 38 and SEQ ID NO: 98; SEQ ID NO: 43 and SEQ ID NO: 103; SEQ ID NO: 48 and SEQ ID NO: 108; SEQ ID NO: 53 and SEQ ED NO
  • the VH encoding polynucleotide and said VL encoding polynucleotide comprise nucleic acids encoding amino acid sequences selected from the group consisting of: SEQ ID NO: 4 and SEQ ID NO: 68; SEQ ID NO: 8 and SEQ ID NO: 73; SEQ ID NO: 14 and SEQ ID NO: 78; SEQ ID NO: 20 and SEQ ID NO: 83; SEQ ID NO: 26 and SEQ ID NO: 88; SEQ ID NO: 32 and SEQ ID NO: 93; SEQ ID NO: 38 and SEQ ID NO: 98; SEQ ID NO: 43 and SEQ ID NO: 103; SEQ ID NO: 48 and SEQ ED NO: 108; SEQ ID NO: 53 and SEQ ID NO: 103; SEQ ED NO: 58 and SEQ ID NO: 113; and SEQ ID NO: 63 and 118.
  • the invention provides a composition comprising an isolated VH encoding polynucleotide and an isolated VL encoding polynucleotide, where the VH encoding polynucleotide and the VL encoding polynucleotide, respectively, comprise nucleic acids encoding amino acid sequences identical, except for less than 20 conservative amino acid substitutions, to reference amino acid sequences selected from the group consisting of: SEQ ID NO: 4 and SEQ ED NO: 68; SEQ ED NO: 8 and SEQ ID NO: 73; SEQ ED NO: 14 and SEQ ID NO: 78; SEQ ID NO: 20 and SEQ ID NO: 83; SEQ ID NO: 26 and SEQ DD NO: 88; SEQ ID NO: 32 and SEQ ID NO: 93; SEQ ED NO: 38 and SEQ ED NO: 98; SEQ ED NO: 43 and SEQ ID NO: 103; SEQ DD NO: 48 and SEQ
  • the VH encoding polynucleotide encodes a VH polypeptide comprising VH-CDRl, VH-CDR2, and VH-CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 5, 6, and 7; SEQ ID NOs: 10, 11, and 12; SEQ ID NOs: 15, 16, and 17; SEQ ID NOs: 21, 22, and 23; SEQ ID NOs: 27, 28, and 29; SEQ ID NOs: 33, 34, and 35; SEQ ID NOs: 39, 40, and 41;.
  • VL encoding polynucleotide encodes a VL polypeptide comprising VL-CDRl, VL-CDR2, and VL-CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 69, 70, and 71; SEQ ID NOs: 74, 75, and 76; SEQ ID NOs: 79, 80, and 81; SEQ ID NOs: 84, 85, and 86; SEQ ID NOs: 89, 90, and 91; SEQ ID NOs: 94, 95, and 96; SEQ ID NOs: 99, 100, and 101; SEQ ID NOs: 104, 105, and 106; SEQ ID NOs: 109, 110
  • the VH encoding polynucleotide further comprises a nucleic acid encoding a signal peptide fused to the antibody VH polypeptide.
  • the VL encoding polynucleotide further comprises a nucleic acid encoding a signal peptide fused to the antibody VL polypeptide.
  • the VH encoding polynucleotide further comprises a nucleic acid encoding a heavy chain constant region CHl domain fused to the VH polypeptide, further comprises a nucleic acid encoding a heavy chain constant region CH2 domain fused to the VH polypeptide, further comprises a nucleic acid encoding a heavy chain constant region CH3 domain fused to the VH polypeptide, or further comprises a nucleic acid encoding a heavy chain hinge region fused to the VH polypeptide.
  • the heavy chain constant region is human IgG4.
  • the IgG4 is mutagenized to remove glycosylation sites.
  • the IgG4 mutations comprise S 24 IP and T318 A using the Kabat numbering system.
  • the VL encoding polynucleotide further comprises a nucleic acid encoding a light chain constant region domain fused to the VL polypeptide.
  • the light chain constant region is human kappa.
  • the antibody or fragment thereof encoded by the VH and VL encoding polynucleotides specifically binds the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12- G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8.
  • the antibody or fragment thereof encoded by the VH and VL encoding polynucleotides competitively inhibits a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8 from binding to IGF-Rl.
  • the framework regions of the VH and VL polypeptides are human, except for five or fewer amino acid substitutions.
  • the antibody or fragment thereof encoded by the VH and VL encoding polynucleotides binds to a linear epitope or a non-linear conformational epitope.
  • the antibody or fragment thereof encoded by the VH and VL encoding polynucleotides is multivalent, and comprises at least two heavy chains and at least two light chains.
  • the antibody or fragment thereof encoded by the VH and VL encoding polynucleotides is multispecific. In further embodiments, the antibody or fragment thereof encoded by the VH and VL encoding polynucleotides is bispecific.
  • the antibody or fragment thereof encoded by the VH and VL encoding polynucleotides comprises heavy and light chain variable domains which are fully human.
  • the heavy and light chain variable domains are identical to those of a monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04.
  • the antibody or fragment thereof encoded by the VH and VL encoding polynucleotides comprises heavy and light chain variable domains which are murine.
  • the heavy and light chain variable domains are identical to those of a monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and PlG10.2B8.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is humanized.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is primatized.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is chimeric.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is fully human.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is an Fab fragment, an Fab' fragment, an F(ab) 2 fragment, or an Fv fragment.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is a single chain antibody.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid specifically binds to an IGF-Rl polypeptide or fragment thereof, or an IGF-Rl variant polypeptide, with an affinity characterized by a dissociation constant (K D ) no greater than 5 x 10 '2 M, 10 '2 M, 5 x 10° M, 10 3 M, 5 x 10 "4 M, 1(T 4 M, 5 x 10 '5 M, 10 ⁇ 5 M, 5 x 10 6 M, 10" 6 M, 5 x 10 '7 M, 10 ⁇ 7 M, 5 x 10 '8 M, 10 "8 M, 5 x 10 ⁇ 9 M, 10 ⁇ 9 M, 5 x 10 ⁇ 10 M, 10 ⁇ 10 M, 5 x 10 " ⁇ M, 10 11 M, 5 x 10 12 M, 10 12 M, 5 x 10 13 M, 10 13 M, 5 x 10
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid preferentially binds to a human IGF-Rl polypeptide or fragment thereof, relative to a murine IGF-Rl polypeptide or fragment thereof or a non-human primate IGF-Rl polypeptide or fragment thereof.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid binds to a human IGF-Rl polypeptide or fragment thereof, and also binds to a non-human primate IGF-Rl polypeptide or fragment thereof.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid binds to IGF-Rl expressed on the surface of a cell.
  • the cell is a malignant cell, a neoplastic cell, a tumor cell, or a metastatic cell.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by said nucleic acid blocks insulin growth factor from binding to IGF-Rl .
  • the insulin growth factor is insulin growth factor- 1 (IGF-I) or insulin growth factor-2 (IGF- 2).
  • the antibody or antigen-binding fragment thereof blocks both IGF-I and IGF-2 from binding to IGF-Rl .
  • the an antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid inhibits IGF-Rl -mediated cell proliferation, inhibits IGF-I or IGF-2-mediated IGF-Rl phosphorylation, inhibits tumor cell growth or inhibits IGF-Rl internalization.
  • compositions, the VH encoding polynucleotide, the VL encoding polynucleotide, or both the VH and the VL encoding polynucleotides further comprise a nucleic acid encoding a heterologous polypeptide.
  • the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is conjugated to an agent selected from the group consisting of cytotoxic agent, a therapeutic agent, cytostatic agent, a biological toxin, a prodrug, a peptide, a protein, an enzyme, a virus, a lipid, a biological response modifier, pharmaceutical agent, a lymphokine, a heterologous antibody or fragment thereof, a detectable label, polyethylene glycol (PEG), and a combination of two or more of any said agents.
  • an agent selected from the group consisting of cytotoxic agent, a therapeutic agent, cytostatic agent, a biological toxin, a prodrug, a peptide, a protein, an enzyme, a virus, a lipid, a biological response modifier, pharmaceutical agent, a lymphokine, a heterologous antibody or fragment thereof, a detectable label, polyethylene glycol (PEG), and a combination of two or more of any said agents.
  • the cytotoxic agent is selected from the group consisting of a radionuclide, a biotoxin, an enzymatically active toxin, a cytostatic or cytotoxic therapeutic agent, a prodrugs, an immunologically active ligand, a biological response modifier, or a combination of two or more of any said cytotoxic agents.
  • the detectable label is selected from the group consisting of an enzyme, a fluorescent label, a chemiluminescent label, a bioluminescent label, a radioactive label, or a combination of two or more of any said detectable labels.
  • the VH encoding polynucleotide is contained on a first vector and the VL encoding polynucleotide is contained on a second vector.
  • the VH encoding polynucleotide is operably associated with a first promoter and the VL encoding polynucleotide is operably associated with a second promoter.
  • the first and second promoters are copies of the same promoter, hi further embodiments, the first and second promoters non-identical.
  • the first vector and the second vector are contained in a single host cell.
  • the first vector and the second vector are contained in a separate host cells.
  • the invention provides a method of producing an antibody or fragment thereof which specifically binds IGF-IR, comprising culturing the above- described host cells, and recovering the antibody, or fragment thereof.
  • the invention provides a method of producing an antibody or fragment thereof which specifically binds IGF-IR, comprising co-culturing separate host cells, and recovering the antibody, or fragment thereof.
  • the invention provides combining the VH and VL encoding polypeptides, and recovering the antibody, or fragment thereof.
  • the invention provides an antibody or fragment thereof which specifically binds IGF-IR, produced by the above-described methods.
  • the invention provides compositions, where the VH encoding polynucleotide and the VL encoding polynucleotide are on the same vector, as well as the vectors therein.
  • the VH encoding polynucleotide and the VL encoding polynucleotide are each operably associated with a promoter.
  • the VH encoding polynucleotide and the VL encoding polynucleotide are fused in frame, are co-transcribed from a single promoter operably associated therewith, and are cotranslated into a single chain antibody or antigen-binding fragment thereof.
  • the VH encoding polynucleotide and said VL encoding polynucleotide are co-transcribed from a single promoter operably associated therewith, but are separately translated.
  • the vectors further comprise an IRES sequence disposed between the VH encoding polynucleotide and the VL encoding polynucleotide.
  • the polynucleotide encoding a VH and the polynucleotide encoding a VL are separately transcribed, each being operably associated with a separate promoter.
  • the separate promoters are copies of the same promoter or the separate promoters are non-identical.
  • the invention provides host cells comprising the above- described vectors.
  • the invention provides a method of producing an antibody or fragment thereof which specifically binds IGF-IR, comprising culturing the above- described host cells, and recovering the antibody, or fragment thereof.
  • the invention provides an antibody or fragment thereof which specifically binds IGF-IR, produced by the above-described methods.
  • the invention provides a method for treating a hyperproliferative disorder in an animal, comprising administering to an animal in need of treatment a composition comprising: a) an isolated antibody or fragment as described above; and b) a pharmaceutically acceptable carrier.
  • the hyperproliferative disease or disorder is selected from the group consisting of cancer, a neoplasm, a tumor, a malignancy, or a metastasis thereof.
  • the antibody or fragment thereof specifically binds to IGF-IR expressed on the surface of a malignant cell, hi further embodiments, the binding of the antibody or fragment thereof to the malignant cell results in growth inhibition of the malignant cell.
  • the antibody or fragment thereof inhibits IGF binding to the malignant cell.
  • the IGF is IGF-I or IGF-2.
  • the antibody or fragment thereof inhibits IGF-I from binding to said malignant cell but does not inhibit IGF-2. In certain other embodiments, the antibody or fragment thereof inhibits IGF-2 from binding to said malignant cell but does not inhibit IGF-I.
  • the antibody or fragment thereof promotes internalization of IGF-IR into the malignant cell.
  • the antibody or fragment thereof inhibits IGF-IR phosphorylation or inhibits tumor cell proliferation.
  • the tumor cell proliferation is inhibited through the prevention or retardation of metastatic growth.
  • the antibody or fragment thereof inhibits tumor cell migration.
  • the tumor cell proliferation is inhibited through the prevention or retardation of tumor spread to adjacent tissues.
  • the hyperproliferative disease or disorder is a neoplasm located in the: prostate, colon, abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, adrenal gland, parathyroid gland, pituitary gland, testicles, ovary, thymus, thyroid, eye, head, neck, central nervous system, peripheral nervous system, lymphatic system, pelvis, skin, soft tissue, spleen, thoracic region, or urogenital tract.
  • the hyperproliferative disease is cancer, said cancer selected from the group consisting of: epithelial squamous cell cancer, melanoma, leukemia, myeloma, stomach cancer, brain cancer, lung cancer, pancreatic cancer, cervical cancer, ovarian cancer, liver cancer, bladder cancer, breast cancer, colon cancer, renal cancer, prostate cancer, testicular cancer, thyroid cancer, and head and neck cancer.
  • the cancer is selected from the group consisting of stomach cancer, renal cancer, brain cancer, bladder cancer, colon cancer, lung cancer, breast cancer, pancreatic cancer, ovarian cancer, and prostate cancer.
  • the animal is a mammal.
  • the mammal is a human.
  • Figure 1 Binding activity of IGF-IR specific Fabs. (a) Binding of purified anti-
  • Figure 2 Binding activity of Fabs to IGF-IR expressed on MCF-7 cells.
  • FIG. 13 shows the single-stranded DNA sequence of heavy chain M13-C06.
  • (b) shows the single-stranded DNA sequence of light chain M13-C06.
  • (c) shows the amino acid sequence of heavy chain Ml 3- C06.
  • (d) shows the amino acid sequence of light chain M13-C06.
  • (e) shows the single-stranded DNA sequence of heavy chain M14-C03.
  • (f) (SEQ ID NO:87) shows the single-stranded DNA sequence of light chain M14-C03.
  • g (SEQ ID NO:26) shows the amino acid sequence of heavy chain M14-C03.
  • h (SEQ ID NO:88) shows the amino acid sequence of light chain M14-C03.
  • i (SEQ BD NO:31) shows the single-stranded DNA sequence of heavy chain M 14-Gl 1.
  • j (SEQ ID NO:92) shows the single-stranded DNA sequence of light chain M14-G11.
  • (k) (SEQ ID NO:32) shows the amino acid sequence of heavy chain M 14-Gl 1.
  • (1) (SEQ DD NO:93) shows the amino acid sequence of light chain M14-G11.
  • (m) (SEQ DD NO: 19) shows the single- stranded DNA sequence of heavy chain M14-B01.
  • (n) (SEQ DD NO:82) shows the single-stranded DNA sequence of light chain M14-B01.
  • (o) shows the amino acid sequence of heavy chain M14-B01.
  • (p) (SEQ DD NO:83) shows the amino acid sequence of light chain M14-B01.
  • (q) (SEQ DD NO:18) shows the single-stranded DNA sequence of sequence optimized heavy chain M13-C06.
  • (r) (SEQ DD NO:14) shows the amino acid sequence of sequence optimized heavy chain M13-C06.
  • (s) (SEQ DD NO:30) shows the single-stranded DNA sequence of sequence optimized heavy chain M14-C03.
  • (t) (SEQ DD NO:26) shows the amino acid sequence of sequence optimized heavy chain M14-C03.
  • (u) (SEQ DD NO:36) shows the single-stranded DNA sequence of sequence optimized heavy chain M14-G11.
  • (v) (SEQ DD NO:32) shows the amino acid sequence of sequence optimized heavy chain M14-G11.
  • (w) (SEQ DD NO:24) shows the single-stranded DNA sequence of sequence optimized heavy chain M14-B01.
  • (x) (SEQ DD NO:30) shows the single-stranded DNA sequence of sequence optimized heavy chain M14-C03.
  • (t) (SEQ DD NO:26) shows the amino acid sequence of sequence optimized heavy chain M14-C03.
  • (u) (SEQ DD NO:36) shows the single-stranded DNA sequence of sequence optimized heavy chain M14-G11.
  • DD NO:20 shows the amino acid seonence of sequence optimized heavy chain M14-B01.
  • y SEQ ID NO: 153 shows the single-stranded DNA sequence of light chain constant domain
  • z SEQ ID NO: 1514 shows the amino acid sequence of light chain constant domain
  • aa SEQ ID NO: 155 shows the single-stranded DNA sequence of heavy chain agly.IgG4.P constant domains
  • bb SEQ ID NO: 156) shows the amino acid sequence of heavy chain aglyIgG4.P constant domains.
  • Figure 6 Non-reduced and reduced SDA PAGE analysis of G4.P.agly versions of fully human M13-C06 and M14-C03 antibodies.
  • Figure 7 The binding activity of fully human G4.P (a) and G4.P.agly (b) versions of anti-IGF-lR antibodies as determined by ELISA.
  • Figure 8 The binding of fully human antibodies to IGF-IR expressed on MCF-7
  • IGF-1R/3T3 (8.b) cell was determined by flowcytometry.
  • the binding EC50 on MCF-7 ranged between 2.7-12 x 10-10 nM.
  • Figure 9 The ability of G4 versions of fully human antibodies to block IGF-I (a) and IGF-2 (b) binding to IGF-IR was determined by an RIA.
  • Figure 10 (a) Inhibition of H-23 tumor cell proliferation in response to IGF-I by
  • G4 versions of fully human antibodies (b) Inhibition of H-23 tumor cell proliferation in response to IGF-2 by G4 versions of fully human antibodies; (c) Inhibition of Calu-6 tumor cell proliferation in response to IGF-I by G4 versions of fully human antibodies.
  • Figure 11 Inhibition of IGF-I (a) and IGF-2 (b) driven receptor phosphorylation by M13.C06.G4.P.agly, M14.C03.G4.P.agly and M14.G11.P antibodies.
  • Figure 12 Inhibition of downstream signaling by M13.C06.G4.P.agly. (a).
  • FIG. 13 Internalization of IGF-IR by human anti-IGF-lR antibodies.
  • the internalization of IGF-IR by M13-C06.G4.P.agly antibody (a) was observed at time 0, 15 and 60 min by confocal microscopy.
  • Anti-mouse IGF-IR antibody clone 24-31 was the positive control (b) and mouse 7F2 antibody and a human G4.P antibody IDEC-151.G4.P were the isotype matched negative controls (c) for the experiment.
  • Figure 14 Inhibition of IGF-I mediated tumor cell growth by selected IGF-IR mAbs.
  • Figure 15 Inhibition of IGF-I and IGF-2 driven proliferation of H-23 cells by anti-IGF-lR antibodies.
  • Figure 16 Inhibition of BxPC3 cell proliferation (driven with recombinant human IGF-I and IGF-2) by M13-C06.G4.P.agly antibody.
  • Figure 17 Inhibition of NCI-H23 cell proliferation (driven with recombinant human IGF-I and IGF-2) by M13-C06.G4.P.agly antibody.
  • Figure 18 Inhibition of A549 cell proliferation (driven with recombinant human
  • Figure 22 Fully human M13.C06.G4.P.agly antibody administered in combination with gemcitabine exhibits increased efficacy in inhibiting tumor growth.
  • Figure 23 Fully human M13.C06.G4.P.agly antibody binds to IGF-IR expressed on an established cynomolgus fibroblast cell line.
  • Figure 24 Cross-competition binding analysis of IGF-IR antibody binding epitopes.
  • Figure 25 Co-immunoprecipitation of IRS-I and p85 (regulatory subunit of
  • PBK demonstrates M13-C06.G4.P.agly mediated inhibition of IGF- IR signal transduction.
  • Figure 26 Immunoprecipitation of IGF-IR and INSR in mammalian cells demonstrates M13.C06.G4.P.agly antibody binding to IGF-IR but not insulin receptor.
  • IGF-I R and INSR proteins were detected by immunoblot (Western blot) analysis with mouse anti-human IR (A) or mouse anti-human IGF-IR (B).
  • Figure 27 Relative binding affinity measurements of M 13-C06 Fab for (A) hlGF-
  • IR-Fc and B mIGF- IR-Fc.
  • the x- and y-axis scales are identical for (A) and (B).
  • IR-Fc controls in the SPR assay compared to antibody binding to IGF-IR mutant proteins
  • FIG. 29 Structural representations of IGF-IR and INSR: A) Schematic diagram of the structure of IGF-IR.
  • A) FnIII-2 contains loop structure that is proteolytically processed in vivo as shown on the diagram. The transmembrane region is shown as a helical loop that traverses a schematic of a phospholipid bilayer. The location of the IGF-l/IGF-2 binding site within IGF-IR is shown by a star. It has been demonstrated that only one IGF-l/IGF-2 molecule binds to each IGF-IR heterodimeric molecule.
  • M13-C06 IGF-IR binding epitope mapped to the surface of the structure of the homologous INSR.
  • the M13-C06 IGF-IR binding epitope was modeled based on the highly homologous INSR crystal structure.
  • the first three domains corresponding to IGF-IR i.e., L1-CR-L2 (such as are included in the truncated IGF-lR(l-462)-Fc construct described herein) are shaded grey.
  • Figure 30 Immunoblot (Western blot) analysis of in vivo IGF-IR expression in mouse tumors treated with M13.C06.G4.P.agly antibody.
  • Figure 31 In vivo anti-tumor activity of M13-C06.G4.P.agly in tumors generated from a primary human colon tumor.
  • Figure 32 In vivo anti-tumor activity of M13-C06.G4.P.agly in tumors generated from breast carcinoma (MCF-7) cells.
  • a or “an” entity refers to one or more of that entity; for example, “an IGF-IR antibody,” is understood to represent one or more IGF-IR antibodies.
  • the terms “a” (or “an”), “one or more,” and “at least one” can be used interchangeably herein.
  • polypeptide is intended to encompass a singular
  • polypeptide as well as plural “polypeptides,” and refers to a molecule composed of monomers (amino acids) linearly linked by amide bonds (also known as peptide bonds).
  • polypeptide refers to any chain or chains of two or more amino acids, and does not refer to a specific length of the product.
  • peptides, dipeptides, tripeptides, oligopeptides, "protein,” “amino acid chain,” or any other term used to refer to a chain or chains of two or more amino acids are included within the definition of "polypeptide,” and the term “polypeptide” may be used instead of, or interchangeably with any of these terms.
  • polypeptide is also intended to refer to the products of post-expression modifications of the polypeptide, including without limitation glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturally occurring amino acids.
  • a polypeptide may be derived from a natural biological source or produced by recombinant technology, but is not necessarily translated from a designated nucleic acid sequence. It may be generated in any manner, including by chemical synthesis.
  • a polypeptide of the invention may be of a size of about 3 or more, 5 or more, 10 or more, 20 or more, 25 or more, 50 or more, 75 or more, 100 or more, 200 or more, 500 or more, 1,000 or more, or 2,000 or more amino acids.
  • Polypeptides may have a defined three-dimensional structure, although they do not necessarily have such structure. Polypeptides with a defined three-dimensional structure are referred to as folded, and polypeptides which do not possess a defined three-dimensional structure, but rather can adopt a large number of different conformations, and are referred to as unfolded.
  • glycoprotein refers to a protein coupled to at least one carbohydrate moiety that is attached to the protein via an oxygen-containing or a nitrogen-containing side chain of an amino acid residue, e.g., a serine residue or an asparagine residue.
  • an "isolated" polypeptide or a fragment, variant, or derivative thereof is intended a polypeptide that is not in its natural milieu. No particular level of purification is required.
  • an isolated polypeptide can be removed from its native or natural environment.
  • Recombinantly produced polypeptides and proteins expressed in host cells are considered isolated for purposed of the invention, as are native or recombinant polypeptides which have been separated, fractionated, or partially or substantially purified by any suitable technique.
  • Also included as polypeptides of the present invention are fragments, derivatives, analogs, or variants of the foregoing polypeptides, and any combination thereof.
  • fragment when referring to IGF-IR antibodies or antibody polypeptides of the present invention include any polypeptides which retain at least some of the antigen-binding properties of the corresponding native antibody or polypeptide. Fragments of polypeptides of the present invention include proteolytic fragments, as well as deletion fragments, in addition to specific antibody fragments discussed elsewhere herein. Variants of IGF-IR antibodies and antibody polypeptides of the present invention include fragments as described above, and also polypeptides with altered amino acid sequences due to amino acid substitutions, deletions, or insertions. Variants may occur naturally or be non-naturally occurring Non- naturally occurring variants may be produced using art-known mutagenesis techniques.
  • Variant polypeptides may comprise conservative or non-conservative amino acid substitutions, deletions or additions.
  • Derivatives of IGF-IR antibodies and antibody polypeptides of the present invention are polypeptides which have been altered so as to exhibit additional features not found on the native polypeptide. Examples include fusion proteins.
  • Variant polypeptides may also be referred to herein as "polypeptide analogs.”
  • a "derivative" of an IGF-IR antibody or antibody polypeptide refers to a subject polypeptide having one or more residues chemically derivatized by reaction of a functional side group. Also included as “derivatives" are those peptides which contain one or more naturally occurring amino acid derivatives of the twenty standard amino acids.
  • 4-hydroxyproline may be substituted for proline; 5-hydroxylysine may be substituted for lysine; 3-methylhistidine may be substituted for histidine; homoserine may be substituted for serine; and ornithine may be substituted for lysine.
  • polynucleotide is intended to encompass a singular nucleic acid as well as plural nucleic acids, and refers to an isolated nucleic acid molecule or construct, e.g., messenger RNA (mRNA) or plasmid DNA (pDNA).
  • a polynucleotide may comprise a conventional phosphodiester bond or a non-conventional bond (e.g., an amide bond, such as found in peptide nucleic acids (PNA)).
  • PNA peptide nucleic acids
  • nucleic acid refer to any one or more nucleic acid segments, e.g., DNA or RNA fragments, present in a polynucleotide.
  • isolated nucleic acid or polynucleotide is intended a nucleic acid molecule, DNA or RNA, which has been removed from its native environment.
  • a recombinant polynucleotide encoding an IGF-IR antibody contained in a vector is considered isolated for the Durposes of the present invention.
  • Further examples of an isolated polynucleotide include recombinant polynucleotides maintained in heterologous host cells or purified (partially or substantially) polynucleotides in solution.
  • Isolated RNA molecules include in vivo or in vitro RNA transcripts of polynucleotides of the present invention.
  • Isolated polynucleotides or nucleic acids according to the present invention further include such molecules produced synthetically.
  • polynucleotide or a nucleic acid may be or may include a regulatory element such as a promoter, ribosome binding site, or a transcription terminator.
  • a "coding region” is a portion of nucleic acid which consists of codons translated into amino acids. Although a "stop codon" (TAG, TGA, or TAA) is not translated into an amino acid, it may be considered to be part of a coding region, but any flanking sequences, for example promoters, ribosome binding sites, transcriptional terminators, introns, and the like, are not part of a coding region. Two or more coding regions of the present invention can be present in a single polynucleotide construct, e.g., on a single vector, or in separate polynucleotide constructs, e.g., on separate (different) vectors.
  • any vector may contain a single coding region, or may comprise two or more coding regions, e.g., a single vector may separately encode an immunoglobulin heavy chain variable region and an immunoglobulin light chain variable region.
  • a vector, polynucleotide, or nucleic acid of the invention may encode heterologous coding regions, either fused or unfused to a nucleic acid encoding an IGF- IR antibody or fragment, variant, or derivative thereof.
  • Heterologous coding regions include without limitation specialized elements or motifs, such as a secretory signal peptide or a heterologous functional domain.
  • the polynucleotide or nucleic acid is DNA.
  • DNA In the case of
  • DNA a polynucleotide comprising a nucleic acid which encodes a polypeptide normally may include a promoter and/or other transcription or translation control elements operably associated with one or more coding regions.
  • An operable association is when a coding region for a gene product, e.g., a polypeptide, is associated with one or more regulatory sequences in such a way as to place expression of the gene product under the influence or control of the regulatory sequence(s).
  • Two DNA fragments are "operably associated" if induction of promoter function results in the transcription of mRNA encoding the desired gene product and if the nature of the linkage between the two DNA fragments does not interfere with the ability of the expression regulatory sequences to direct the expression of the gene product or interfere with the ability of the DNA template to be transcribed.
  • a promoter region would be operably associated with a nucleic acid encoding a polypeptide if the promoter was capable of effecting transcription of that nucleic acid.
  • the promoter may be a cell-specific promoter that directs substantial transcription of the DNA only in predetermined cells.
  • transcription control elements besides a promoter, for example enhancers, operators, repressors, and transcription termination signals, can be operably associated with the polynucleotide to direct cell-specific transcription.
  • Suitable promoters and other transcription control regions are disclosed herein.
  • transcription control regions which function in vertebrate cells, such as, but not limited to, promoter and enhancer segments from cytomegaloviruses (the immediate early promoter, in conjunction with intron-A), simian virus 40 (the early promoter), and retroviruses (such as Rous sarcoma virus).
  • Other transcription control regions include those derived from vertebrate genes such as actin, heat shock protein, bovine growth hormone and rabbit ⁇ -globin, as well as other sequences capable of controlling gene expression in eukaryotic cells. Additional suitable transcription control regions include tissue-specific promoters and enhancers as well as lymphokine-inducible promoters (e.g., promoters inducible by interferons or interleukins).
  • translation control elements include, but are not limited to ribosome binding sites, translation initiation and termination codons, and elements derived from picornaviruses (particularly an internal ribosome entry site, or IRES, also referred to as a CITE sequence).
  • a polynucleotide of the present invention is RNA, for example, in the form of messenger RNA (mRNA).
  • mRNA messenger RNA
  • Polynucleotide and nucleic acid coding regions of the present invention may be associated with additional coding regions which encode secretory or signal peptides, which direct the secretion of a polypeptide encoded by a polynucleotide of the present invention.
  • proteins secreted by mammalian cells have a signal peptide or secretory leader sequence which is cleaved from the mature protein once export of the growing protein chain across the rough endoplasmic reticulum has been initiated.
  • polypeptides secreted by vertebrate cells generally have a signal peptide fused to the N-terminus of the polypeptide, which is cleaved from the complete or "full length" polypeptide to produce a secreted or "mature” form of the polypeptide.
  • the native signal peptide e.g., an immunoglobulin heavy chain or light chain signal peptide is used, or a functional derivative of that sequence that retains the ability to direct the secretion of the polypeptide that is operably associated with it.
  • a heterologous mammalian signal peptide, or a functional derivative thereof may be used.
  • the wild- type leader sequence may be substituted with the leader sequence of human tissue plasminogen activator (TPA) or mouse ⁇ -glucuronidase.
  • the present invention is directed to certain IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof.
  • IGF-IR antibodies encompasses full-sized antibodies as well as antigen-binding fragments, variants, analogs, or derivatives of such antibodies, e.g., naturally occurring antibody or immunoglobulin molecules or engineered antibody molecules or fragments that bind antigen in a manner similar to antibody molecules.
  • antibody and "immunoglobulin” are used interchangeably herein.
  • An antibody or immunoglobulin comprises at least the variable domain of a heavy chain, and normally comprises at least the variable domains of a heavy chain and a light chain.
  • Basic immunoglobulin structures in vertebrate systems are relatively well understood. See, e.g., Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988).
  • immunoglobulin comprises various broad classes of polypeptides that can be distinguished biochemically.
  • heavy chains are classified as gamma, mu, alpha, delta, or epsilon, ( ⁇ , ⁇ , ⁇ , ⁇ , ⁇ ) with some subclasses among them (e.g., ⁇ l- ⁇ 4). It is the nature of this chain that determines the "class" of the antibody as IgG, IgM, IgA IgG, or IgE, respectively.
  • immunoglobulin subclasses e.g., IgGl, IgG2, IgG3, IgG4, IgAl, etc. are well characterized and are known to confer functional specialization. Modified versions of each of these classes and isotypes are readily discernable to the skilled artisan in view of the instant disclosure and, accordingly, are within the scope of the instant invention. All immunoglobulin classes are clearly within the scope of the present invention, the following discussion will generally be directed to the IgG class of immunoglobulin molecules.
  • IgG a standard immunoglobulin molecule comprises two identical light chain polypeptides of molecular weight approximately 23,000 Daltons, and two identical heavy chain polypeptides of molecular weight 53,000- 70,000. The four chains are typically joined by disulfide bonds in a "Y" configuration wherein the light chains bracket the heavy chains starting at the mouth of the "Y" and continuing through the variable region.
  • Light chains are classified as either kappa or lambda (K, ⁇ ). Each heavy chain class may be bound with either a kappa or lambda light chain.
  • the light and heavy chains are covalently bonded to each other, and the "tail" portions of the two heavy chains are bonded to each other by covalent disulfide linkages or non-covalent linkages when the immunoglobulins are generated either by hybridomas, B cells or genetically engineered host cells.
  • the amino acid sequences run from an N- terminus at the forked ends of the Y configuration to the C-terminus at the bottom of each chain.
  • variable domains of both the light (VL) and heavy (VH) chain portions determine antigen recognition and specificity.
  • the constant domains of the light chain (CL) and the heavy chain (CHl, CH2 or CH3) confer important biological properties such as secretion, transplacental mobility, Fc receptor binding, complement binding, and the like.
  • the N-terminal portion is a variable region and at the C- terminal portion is a constant region; the CH3 and CL domains actually comprise the carboxy-terminus of the heavy and light chain, respectively.
  • variable region allows the antibody to selectively recognize and specifically bind epitopes on antigens. That is, the VL domain and VH domain, or subset of the complementarity determining regions (CDRs), of an antibody combine to form the variable region that defines a three dimensional antigen binding site.
  • This quaternary antibody structure forms the antigen binding site present at the end of each arm of the Y. More specifically, the antigen binding site is defined by three CDRs on each of the VH and VL chains, hi some instances, e.g., certain immunoglobulin molecules derived from camelid species or engineered based on camelid immunoglobulins, a complete immunoglobulin molecule may consist of heavy chains only, with no light chains. See, e.g., Hamers-Casterman et al., Nature 363:446-448 (1993).
  • each antigen binding domain is short, non-contiguous sequences of amino acids that are specifically positioned to form the antigen binding domain as the antibody assumes its three dimensional configuration in an aqueous environment.
  • the remainder of the amino acids in the antigen binding domains referred to as "framework” regions, show less inter-molecular variability.
  • the framework regions largely adopt a ⁇ - sheet conformation and the CDRs form loops which connect, and in some cases form part of, the ⁇ -sheet structure.
  • framework regions act to form a scaffold that provides for positioning the CDRs in correct orientation by inter-chain, non-covalent interactions.
  • the antigen binding domain formed by the positioned CDRs defines a surface complementary to the epitope on the immunoreactive antigen. This complementary surface promotes the non-covalent binding of the antibody to its cognate epitope.
  • the amino acids comprising the CDRs and the framework regions, respectively can be readily identified for any given heavy or light chain variable region by one of ordinary skill in the art, since they have been precisely defined (see, "Sequences of Proteins of Immunological Interest,” Kabat, E., et al., U.S. Department of Health and Human Services, (1983); and Chothia and Lesk, J. MoI. Biol., 196:901-917 (1987), which are incorporated herein by reference in their entireties).
  • CDR complementarity determining region
  • Kabat et al. also defined a numbering system for variable domain sequences that is applicable to any antibody.
  • One of ordinary skill in the art can unambigously assign this system of "Kabat numbering" to any variable domain sequence, without reliance on any experimental data beyond the sequence itself.
  • Kabat numbering refers to the numbering system set forth by Kabat et al., U.S. Dept. of Health and Human Services, "Sequence of Proteins of Immunological Interest" (1983). Unless otherwise specified, references to the numbering of specific amino acid residue positions in an IGF- IR antibody or antigen-binding fragment, variant, or derivative thereof of the present invention are according to the Kabat numbering system.
  • VHH the heavy chain variable region
  • VHH variable regions include (a) more hydrophobic amino acids in the light chain contact surface of VH as compared to the corresponding region in VHH, (b) a longer CDR3 in VHH, and (c) the frequent occurrence of a disulfide bond between CDRl and CDR3 in VHH.
  • Antibodies or antigen-binding fragments, variants, or derivatives thereof of the invention include, but are not limited to, polyclonal, monoclonal, multispecific, human, humanized, primatized, or chimeric antibodies, single chain antibodies, epitope-binding fragments, e.g., Fab, Fab' and F(ab')2, Fd, Fvs, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (sdFv), fragments comprising either a VL or VH domain, fragments produced by a Fab expression library, and anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to IGF-IR antibodies disclosed herein).
  • anti-Id antigen-binding fragments, variants, or derivatives thereof of the invention
  • Immunoglobulin or antibody molecules of the invention can be of any type ⁇ e.g., IgG, IgE, IgM, IgD, IgA, and IgY), class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) or subclass of immunoglobulin molecule.
  • Antibody fragments may comprise the variable region(s) alone or in combination with the entirety or a portion of the following: hinge region, CHl, CH2, and CH3 domains. Also included in the invention are antigen-binding fragments also comprising any combination of variable region(s) with a hinge region, CHl, CH2, and CH3 domains.
  • Antibodies or immunospecific fragments thereof of the present invention may be from any animal origin including birds and mammals.
  • the antibodies are human, murine, donkey, rabbit, goat, guinea pig, camel, llama, horse, or chicken antibodies.
  • the variable region may be condricthoid in origin ⁇ e.g., from sharks).
  • human antibodies include antibodies having the amino acid sequence of a human immunoglobulin and include antibodies isolated from human immunoglobulin libraries or from animals transgenic for one or more human immunoglobulins and that do not express endogenous immunoglobulins, as described infra and, for example in, U.S. Pat. No. 5,939,598 by Kucherlapati et al.
  • heavy chain portion includes amino acid sequences derived from an immunoglobulin heavy chain.
  • a polypeptide comprising a heavy chain portion comprises at least one of: a CHl domain, a hinge ⁇ e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, or a variant or fragment thereof.
  • a binding polypeptide for use in the invention may comprise a polypeptide chain comprising a CHl domain; a polypeptide chain comprising a CHl domain, at least a portion of a hinge domain, and a CH2 domain; a polypeptide chain comprising a CHl domain and a CH3 domain; a polypeptide chain comprising a CHl domain, at least a portion of a hinge domain, and a CH3 domain, or a polypeptide chain comprising a CHl domain, at least a portion of a hinge domain, a CH2 domain, and a CH3 domain.
  • a polypeptide of the invention comprises a polypeptide chain comprising a CH3 domain.
  • a binding polypeptide for use in the invention may lack at least a portion of a CH2 domain ⁇ e.g., all or part of a CH2 domain).
  • a CH2 domain e.g., all or part of a CH2 domain.
  • the heavy chain portions of one polypeptide chain of a multimer are identical to those on a second polypeptide chain of the multimer.
  • heavy chain portion-containing monomers of the invention are not identical.
  • each monomer may comprise a different target binding site, forming, for example, a bispecific antibody.
  • the heavy chain portions of a binding polypeptide for use in the diagnostic and treatment methods disclosed herein may be derived from different immunoglobulin molecules.
  • a heavy chain portion of a polypeptide may comprise a CHl domain derived from an IgGl molecule and a hinge region derived from an IgG3 molecule.
  • a heavy chain portion can comprise a hinge region derived, in part, from an IgGl molecule and, in part, from an IgG3 molecule.
  • a heavy chain portion can comprise a chimeric hinge derived, in part, from an IgGl molecule and, in part, from an IgG4 molecule.
  • the term "light chain portion” includes amino acid sequences derived from an immunoglobulin light chain.
  • the light chain portion comprises at least one of a VL or CL domain.
  • IGF-IR antibodies or antigen-binding fragments, variants, or derivatives thereof disclosed herein may be described or specified in terms of the epitope(s) or portion(s) of an antigen, e.g., a target polypeptide (IGF-IR) that they recognize or specifically bind.
  • the portion of a target polypeptide which specifically interacts with the antigen binding domain of an antibody is an "epitope," or an "antigenic determinant.”
  • a target polypeptide may comprise a single epitope, but typically comprises at least two epitopes, and can include any number of epitopes, depending on the size, conformation, and type of antigen.
  • an "epitope" on a target polypeptide may be or include non-polypeptide elements, e.g., an "epitope may include a carbohydrate side chain.
  • the minimum size of a peptide or polypeptide epitope for an antibody is thought to be about four to five amino acids.
  • Peptide or polypeptide epitopes preferably contain at least seven, more preferably at least nine and most preferably between at least about 15 to about 30 amino acids. Since a CDR can recognize an antigenic peptide or polypeptide in its tertiary form, the amino acids comprising an epitope need not be contiguous, and in some cases, may not even be on the same peptide chain.
  • peptide or polypeptide epitope recognized by IGF-IR antibodies of the present invention contains a sequence of at least 4, at least 5, at least 6, at least 7, more preferably at least 8, at least 9, at least 10, at least 15, at least 20, at least 25, or between about 15 to about 30 contiguous or non-contiguous amino acids of IGF-IR.
  • an antibody binds to an epitope via its antigen binding domain, and that the binding entails some complementarity between the antigen binding domain and the epitope. According to this definition, an antibody is said to "specifically bind” to an epitope when it binds to that epitope, via its antigen binding domain more readily than it would bind to a random, unrelated epitope.
  • the term “specificity” is used herein to qualify the relative affinity by which a certain antibody binds to a certain epitope.
  • antibody “A” may be deemed to have a higher specificity for a given epitope than antibody "B,” or antibody “A” may be said to bind to epitope “C” with a higher specificity than it has for related epitope “D.”
  • preferentially binds it is meant that the antibody specifically binds to an epitope more readily than it would bind to a related, similar, homologous, or analogous epitope.
  • an antibody which "preferentially binds" to a given epitope would more likely bind to that epitope than to a related epitope, even though such an antibody may cross-react with the related epitope.
  • an antibody may be considered to bind a first epitope preferentially if it binds said first epitope with a dissociation constant (KD) that is less than the antibody's K D for the second epitope.
  • KD dissociation constant
  • an antibody may be considered to bind a first antigen preferentially if it binds the first epitope with an affinity that is at least one order of magnitude less than the antibody's K D for the second epitope.
  • an antibody may be considered to bind a first epitope preferentially if it binds the first epitope with an affinity that is at least two orders of magnitude less than the antibody's K D for the second epitope.
  • an antibody may be considered to bind a first epitope preferentially if it binds the first epitope with an off rate (k(off)) that is less than the antibody's k(of ⁇ ) for the second epitope.
  • an antibody may be considered to bind a first epitope preferentially if it binds the first epitope with an affinity that is at least one order of magnitude less than the antibody's k(off) for the second epitope.
  • an antibody may be considered to bind a first epitope preferentially if it binds the first epitope with an affinity that is at least two orders of magnitude less than the antibody's k(off) for the second epitope.
  • An antibody or antigen-binding fragment, variant, or derivative disclosed herein may be said to bind a target polypeptide disclosed herein or a fragment or variant thereof with an off rate (k(off)) of less than or equal to 5 X 10 2 sec 1 , 10 "2 sec “1 , 5 X 10 "3 sec 1 or 10 '3 sec “1 .
  • an antibody of the invention may be said to bind a target polypeptide disclosed herein or a fragment or variant thereof with an off rate (k(off)) less than or equal to 5 X 10 ⁇ sec “1 , 10 "4 sec “1 , 5 X 10 "5 sec “1 , or 10 "5 sec '1 5 X 10 "6 sec “1 , 10 “6 sec “1 , 5 X 10 "7 sec “1 or 10 "7 sec “1 .
  • An antibody or antigen-binding fragment, variant, or derivative disclosed herein may be said to bind a target polypeptide disclosed herein or a fragment or variant thereof with an on rate (k(on)) of greater than or equal to 10 3 M "1 sec “1 , 5 X 10 3 M “1 sec “1 , 10 4 M “1 sec “1 or 5 X 10 4 M “1 sec “1 .
  • an antibody of the invention may be said to bind a target polypeptide disclosed herein or a fragment or variant thereof with an on rate (k(on)) greater than or equal to 10 s M "1 sec 1 , 5 X 10 5 M “1 sec “1 , 10 6 M “1 sec “1 , or 5 X 10 6 M 1 SeC 1 Or IO 7 M- 1 SeC "1 .
  • An antibody is said to competitively inhibit binding of a reference antibody to a given epitope if it preferentially binds to that epitope to the extent that it blocks, to some degree, binding of the reference antibody to the epitope.
  • Competitive inhibition may be determined by any method known in the art, for example, competition ELISA assays.
  • An antibody may be said to competitively inhibit binding of the reference antibody to a given epitope by at least 90%, at least 80%, at least 70%, at least 60%, or at least 50%.
  • the term "affinity” refers to a measure of the strength of the binding of an individual epitope with the CDR of an immunoglobulin molecule. See, e.g., Harlow et ah. Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988) at pages 27-28.
  • the term “avidity” refers to the overall stability of the complex between a population of immunoglobulins and an antigen, that is, the functional combining strength of an immunoglobulin mixture with the antigen. See, e.g. , Harlow at pages 29-34.
  • Avidity is related to both the affinity of individual immunoglobulin molecules in the population with specific epitopes, and also the valencies of the immunoglobulins and the antigen. For example, the interaction between a bivalent monoclonal antibody and an antigen with a highly repeating epitope structure, such as a polymer, would be one of hi eh avidity.
  • IGF-IR antibodies or antigen-binding fragments, variants or derivatives thereof of the invention may also be described or specified in terms of their cross-reactivity. As used herein, the term "cross-reactivity" refers to the ability of an antibody, specific for one antigen, to react with a second antigen; a measure of relatedness between two different antigenic substances.
  • an antibody is cross reactive if it binds to an epitope other than the one that induced its formation.
  • the cross reactive epitope generally contains many of the same complementary structural features as the inducing epitope, and in some cases, may actually fit better than the original.
  • certain antibodies have some degree of cross-reactivity, in that they bind related, but non-identical epitopes, e.g., epitopes with at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 65%, at least 60%, at least 55%, and at least 50% identity (as calculated using methods known in the art and described herein) to a reference epitope.
  • epitopes e.g., epitopes with at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 65%, at least 60%, at least 55%, and at least 50% identity (as calculated using methods known in the art and described herein) to a reference epitope.
  • An antibody may be said to have little or no cross-reactivity if it does not bind epitopes with less than 95%, less than 90%, less than 85%, less than 80%, less than 75%, less than 70%, less than 65%, less than 60%, less than 55%, and less than 50% identity (as calculated using methods known in the art and described herein) to a reference epitope.
  • An antibody may be deemed "highly specific" for a certain epitope, if it does not bind any other analog, ortholog, or homolog of that epitope.
  • IGF-IR antibodies or antigen-binding fragments, variants or derivatives thereof of the invention may also be described or specified in terms of their binding affinity to a polypeptide of the invention.
  • Preferred binding affinities include those with a dissociation constant or Kd less than 5 x 10 "2 M, 10 2 M, 5 x 10 3 M, 10 "3 M, 5 x 10 ⁇ M, 1O -4 M, 5 x 10 "5 M, 10 "5 M, 5 x 10 "6 M, 10 "6 M, 5 x 10 "7 M, 10 7 M, 5 x 10- 8 M, W 8 M, 5 x 10 9 M, 10 "9 M, 5 x 10 "10 M, 10 "10 M, 5 x 10 "n M, 10 11 M, 5 x 10 "12 M, 10 "12 M, 5 x 10 "13 M, 10 "13 M, 5 x 10 " 14 M, 10 "14 M, 5 x 10 15 M, or 10 "15 M.
  • IGF-IR antibodies or antigen-binding fragments, variants or derivatives thereof of the invention may be "multispecific,” e.g., bispecific, trispecific or of greater multispecificity, meaning that it recognizes and binds to two or more different epitopes present on one or more different antigens ⁇ e.g., proteins) at the same time.
  • an IGF-IR antibody is "monospecific” or “multispecific,” e.g., "bispecific,” refers to the number of different epitopes with which a binding polypeptide reacts.
  • Multispecific antibodies may be specific for different epitopes of a target polypeptide described herein or may be specific for a target polypeptide as well as for a heterologous epitope, such as a heterologous polypeptide or solid support material.
  • valency refers to the number of potential binding domains, e.g., antigen binding domains, present in an IGF-IR antibody, binding polypeptide or antibody. Each binding domain specifically binds one epitope.
  • each binding domain may specifically bind the same epitope, for an antibody with two binding domains, termed “bivalent monospecific,” or to different epitopes, for an antibody with two binding domains, termed “bivalent bispecific.”
  • An antibody may also be bispecific and bivalent for each specificity (termed “bispecific tetravalent antibodies").
  • tetravalent minibodies or domain deleted antibodies can be made.
  • Bispecific bivalent antibodies, and methods of making them are described, for instance in U.S. Patent Nos. 5,731,168; 5,807,706; 5,821,333; and U.S. Appl. Publ. Nos. 2003/020734 and 2002/0155537, the disclosures of all of which are incorporated by reference herein.
  • Bispecific tetravalent antibodies, and methods of making them are described, for instance, in WO 02/096948 and WO 00/44788, the disclosures of both of which are incorporated by reference herein. See generally, PCT publications WO 93/17715; WO 92/08802; WO 91/00360; WO 92/05793; Tutt et al., J.
  • VH domain includes the amino terminal variable domain of an immunoglobulin heavy chain
  • CHl domain includes the first (most amino terminal) constant region domain of an immunoglobulin heavy chain.
  • the CHl domain is adjacent to the VH domain and is amino terminal to the hinge region of an immunoglobulin heavy chain molecule.
  • CH2 domain includes the portion of a heavy chain molecule that extends, e.g., from about residue 244 to residue 360 of an antibody using conventional numbering schemes (residues 244 to 360, Kabat numbering system; and residues 231-340, EU numbering system; see Kabat EA et al. op. cit.
  • the CH2 domain is unique in that it is not closely paired with another domain. Rather, two N-linked branched carbohydrate chains are interposed between the two CH2 domains of an intact native IgG molecule. It is also well documented that the CH3 domain extends from the CH2 domain to the C-terminal of the IgG molecule and comprises approximately 108 residues.
  • Hinge region includes the portion of a heavy chain molecule that joins the CHl domain to the CH2 domain. This hinge region comprises approximately 25 residues and is flexible, thus allowing the two N-terminal antigen binding regions to move independently. Hinge regions can be subdivided into three distinct domains: upper, middle, and lower hinge domains (Roux et al., J. Immunol. 757:4083 (1998)).
  • disulfide bond includes the covalent bond formed between two sulfur atoms.
  • the amino acid cysteine comprises a thiol group that can form a disulfide bond or bridge with a second thiol group.
  • the CHl and CL regions are linked by a disulfide bond and the two heavy chains are linked by two disulfide bonds at positions corresponding to 239 and 242 using the Kabat numbering system (position 226 or 229, EU numbering system).
  • chimeric antibody will be held to mean any antibody wherein the immunoreactive region or site is obtained or derived from a first species and the constant region (which may be intact, partial or modified in accordance with the instant invention) is obtained from a second species, hi preferred embodiments the target binding region or site will be from a non-human source ⁇ e.g. mouse or primate) and the constant region is human.
  • the term “engineered antibody” refers to an antibody in which the variable domain in either the heavy and light chain or both is altered by at least partial replacement of one or more CDRs from an antibody of known specificity and, if necessary, by partial framework region replacement and sequence changing.
  • the CDRs may be derived from an antibody of the same class or even subclass as the antibody from which the framework regions are derived, it is envisaged that the CDRs will be derived from an antibody of different class and preferably from an antibody from a different species.
  • An engineered antibody in which one or more "donor" CDRs from a non-human antibody of known specificity is grafted into a human heavy or light chain framework region is referred to herein as a "humanized antibody.” It may not be necessary to replace all of the CDRs with the complete CDRs from the donor variable region to transfer the antigen binding capacity of one variable domain to another. Rather, it may only be necessary to transfer those residues that are necessary to maintain the activity of the target binding site. Given the explanations set forth in, e.g., U. S. Pat. Nos. 5,585,089, 5,693,761, 5,693,762, and 6,180,370, it will be well within the competence of those skilled in the art, either by carrying out routine experimentation or by trial and error testing to obtain a functional engineered or humanized antibody.
  • polypeptides include polypeptides (e.g., amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids, amino acids
  • IGF-IR antibodies in which all of the functional domains comprising the polypeptide are distinctly active.
  • the term "improperly folded polypeptide" includes polypeptides in which at least one of the functional domains of the polypeptide is not active.
  • a properly folded polypeptide comprises polypeptide chains linked by at least one disulfide bond and, conversely, an improperly folded polypeptide comprises polypeptide chains not linked by at least one disulfide bond.
  • engineered includes manipulation of nucleic acid or polypeptide molecules by synthetic means (e.g. by recombinant techniques, in vitro peptide synthesis, by enzymatic or chemical coupling of peptides or some combination of these techniques).
  • an "in-frame fusion” refers to the joining of two or more polynucleotide open reading frames (ORFs) to form a continuous longer ORF, in a manner that maintains the correct translational reading frame of the original ORFs.
  • ORFs polynucleotide open reading frames
  • a recombinant fusion protein is a single protein containing two ore more segments that correspond to polypeptides encoded by the original ORFs (which segments are not normally so joined in nature.) Although the reading frame is thus made continuous throughout the fused segments, the segments may be physically or spatially separated by, for example, in-frame linker sequence.
  • polynucleotides encoding the CDRs of an immunoglobulin variable region may be fused, in-frame, but be separated by a polynucleotide encoding at least one immunoglobulin framework region or additional CDR regions, as long as the "fused" CDRs are co-translated as part of a continuous polypeptide.
  • a "linear sequence” or a “sequence” is an order of amino acids in a polypeptide in an amino to carboxyl terminal direction in which residues that neighbor each other in the sequence are contiguous in the primary structure of the polypeptide.
  • expression refers to a process by which a gene produces a biochemical, for example, an RNA or polypeptide. The process includes any manifestation of the functional presence of the gene within the cell including, without limitation, gene knockdown as well as both transient expression and stable expression.
  • RNA product can be either a nucleic acid, e.g., a messenger RNA produced by transcription of a gene, or a polypeptide which is translated from a transcript.
  • Gene products described herein further include nucleic acids with post transcriptional modifications, e.g., polyadenylation, or polypeptides with post translational modifications, e.g., methylation, glycosylation, the addition of lipids, association with other protein subunits, proteolytic cleavage, and the like.
  • post transcriptional modifications e.g., polyadenylation
  • polypeptides with post translational modifications e.g., methylation, glycosylation, the addition of lipids, association with other protein subunits, proteolytic cleavage, and the like.
  • the terms “treat” or “treatment” refer to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change or disorder, such as the development or spread of cancer.
  • Beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.
  • Treatment can also mean prolonging survival as compared to expected survival if not receiving treatment.
  • Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
  • subject or “individual” or “animal” or “patient” or “mammal,” is meant any subject, particularly a mammalian subject, for whom diagnosis, prognosis, or therapy is desired.
  • Mammalian subjects include humans, domestic animals, farm animals, and zoo, sports, or pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, cows, and so on.
  • phrases such as "a subject that would benefit from administration of a binding molecule” and "an animal in need of treatment” includes subjects, such as mammalian subjects, that would benefit from administration of a binding molecule used, e.g., for detection of an antigen recognized by a binding molecule (e.g., for a diagnostic procedure) and/or from treatment, i.e., palliation or prevention of a disease such as cancer, with a binding molecule which specifically binds a given target protein.
  • the binding molecule can be used in unconjugated form or can be conjugated, e.g., to a drug, prodrug, or an isotope.
  • hyperproliferative disease or disorder all neoplastic cell growth and proliferation, whether malignant or benign, including all transformed cells and tissues and all cancerous cells and tissues.
  • Hyperproliferative diseases or disorders include, but are not limited to, precancerous lesions, abnormal cell growths, benign tumors, malignant tumors, and "cancer.”
  • the hyperproliferative disease or disorder e.g., the precancerous lesion, abnormal cell growth, benign tumor, malignant tumor, or "cancer” comprises cells which express, over-express, or abnormally express IGF-IR.
  • hyperproliferative diseases, disorders, and/or conditions include, but are not limited to neoplasms, whether benign or malignant, located in the: prostate, colon, abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, endocrine glands (adrenal, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye- head and neck, nervous (central and peripheral), lymphatic system, pelvic, skin, soft tissue, spleen, thoracic, and urogenital tract.
  • neoplasms in certain embodiments, express, over-express, or abnormally express IGF-IR.
  • hyperproliferative disorders include, but are not limited to: hypergammaglobulinemia, lymphoproliferative disorders, paraproteinemias, purpura, sarcoidosis, Sezary Syndrome, Waldenstron's macroglobulinemia, Gaucher's Disease, histiocytosis, and any other hyperproliferative disease, besides neoplasia, located in an organ system listed above.
  • the diseases involve cells which express, over-express, or abnormally express IGF-IR.
  • tumor or tumor tissue refer to an abnormal mass of tissue that results from excessive cell division, in certain cases tissue comprising cells which express, over-express, or abnormally express IGF-IR.
  • a tumor or tumor tissue comprises “tumor cells” which are neoplastic cells with abnormal growth properties and no useful bodily function. Tumors, tumor tissue and tumor cells may be benign or malignant.
  • a tumor or tumor tissue may also comprise "tumor-associated non-tumor cells", e.g., vascular cells which form blood vessels to supply the tumor or tumor tissue.
  • Non-tumor cells may be induced to replicate and develop by tumor cells, for example, the induction of angiogenesis in a tumor or tumor tissue.
  • malignancy refers to a non-benign tumor or a cancer.
  • cancer connotes a type of hyperproliferative disease which includes a malignancy characterized by deregulated or uncontrolled cell growth.
  • examples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers are noted below and include: squamous cell cancer (e.g.
  • lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial cancer or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, as well as head and neck cancer.
  • lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer
  • cancer includes primary malignant cells or tumors ⁇ e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original malignancy or tumor) and secondary malignant cells or tumors (e.g., those arising from metastasis, the migration of malignant cells or tumor cells to secondary sites that are different from the site of the original tumor).
  • Cancers conducive to treatment methods of the present invention involves cells which express, over-express, or abnormally express IGF-IR.
  • cancers or malignancies include, but are not limited to: Acute
  • the method of the present invention may be used to treat premalignant conditions and to prevent progression to a neoplastic or malignant state, including but not limited to those disorders described above.
  • Such uses are indicated in conditions known or suspected of preceding progression to neoplasia or cancer, in particular, where nonneoplastic cell growth consisting of hyperplasia, metaplasia, or most particularly, dysplasia has occurred (for review of such abnormal growth conditions, see Robbins and Angell, Basic Pathology, 2d Ed., W. B. Saunders Co., Philadelphia, pp. 68-79 (1976).
  • Such conditions in which cells begin to express, over-express, or abnormally express IGF-IR are particularly treatable by the methods of the present invention.
  • Hyperplasia is a form of controlled cell proliferation, involving an increase in cell number in a tissue or organ, without significant alteration in structure or function.
  • Hyperplastic disorders which can be treated by the method of the invention include, but are not limited to, angiofollicular mediastinal lymph node hyperplasia, angiolymphoid hyperplasia with eosinophilic atypical melanocytic hyperplasia, basal cell hyperplasia, benign giant lymph node hyperplasia, cementum hyperplasia, congenital adrenal hyperplasia, congenital sebaceous hyperplasia, cystic hyperplasia, cystic hyperplasia of the breast, denture hyperplasia, ductal hyperplasia, endometrial hyperplasia, fibromuscular hyperplasia, focal epithelial hyperplasia, gingival hyperplasia, inflammatory fibrous hyperplasia, inflammatory papillary hyperplasia, intravascular papillary endothelial hyper
  • Metaplasia is a form of controlled cell growth in which one type of adult or fully differentiated cell substitutes for another type of adult cell.
  • Metaplastic disorders which can be treated by the method of the invention include, but are not limited to, agnogenic myeloid metaplasia, apocrine metaplasia, atypical metaplasia, autoparenchymatous metaplasia, connective tissue metaplasia, epithelial metaplasia, intestinal metaplasia, metaplastic anemia, metaplastic ossification, metaplastic polyps, myeloid metaplasia, primary myeloid metaplasia, secondary myeloid metaplasia, squamous metaplasia, squamous metaplasia of amnion, and symptomatic myeloid metaplasia.
  • Dysplasia is frequently a forerunner of cancer, and is found mainly in the epithelia; it is the most disorderly form of non-neoplastic cell growth, involving a loss in individual cell uniformity and in the architectural orientation of cells. Dysplastic cells often have abnormally large, deeply stained nuclei, and exhibit pleomorphism. Dysplasia characteristically occurs where there exists chronic irritation or inflammation.
  • Dysplastic disorders which can be treated by the method of the invention include, but are not limited to, anhidrotic ectodermal dysplasia, anterofacial dysplasia, asphyxiating thoracic dysplasia, atriodigital dysplasia, bronchopulmonary dysplasia, cerebral dysplasia, cervical dysplasia, chondroectodermal dysplasia, cleidocranial dysplasia, congenital ectodermal dysplasia, craniodiaphysial dysplasia, craniocarpotarsal dysplasia, craniometaphysial dysplasia, dentin dysplasia, diaphysial dysplasia, ectodermal dysplasia, enamel dysplasia, encephalo-ophthalmic dysplasia, dysplasia epiphysialis hemimelia, dysplasia epiphysialis multiplex, dysplasia epiphysiali
  • Additional pre-neoplastic disorders which can be treated by the method of the invention include, but are not limited to, benign dysproliferative disorders (e.g., benign tumors, fibrocystic conditions, tissue hypertrophy, intestinal polyps, colon polyps, and esophageal dysplasia), leukoplakia, keratoses, Bowen's disease, Farmer's Skin, solar cheilitis, and solar keratosis.
  • the method of the invention is used to inhibit growth, progression, arid/or metastasis of cancers, in particular those listed above.
  • Additional hyperproliferative diseases, disorders, and/or conditions include, but are not limited to, progression, and/or metastases of malignancies and related disorders such as leukemia (including acute leukemias ⁇ e.g., acute lymphocytic leukemia, acute myelocytic leukemia (including myeloblastic, promyelocytic, myelomonocytic, monocytic, and erythroleukemia)) and chronic leukemias (e.g., chronic myelocytic (granulocytic) leukemia and chronic lymphocytic leukemia)), polycythemia vera, lymphomas (e.g., Hodgkin's disease and non-Hodgkin's disease), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, and solid tumors including, but not limited to, sarcomas and carcinomas such as fibrosarcoma, myxosarcoma, lipo
  • IGF-IR insulin-like growth factor receptor-1
  • IGF-IR is a heterotetrameric plasma membrane glycoprotein composed of two ⁇ -subunits (130 kDa each) and two ⁇ -subunits (90 kDa each) linked by disulfide bonds. Massague ,J. and Czech,M.P. J. Biol. Chem. 257:5038-5045 (1992).
  • IGF-IR is also known in the art by the names CD221 and JTKl 3.
  • the nucleic acid sequence of the human IGF-IR mRNA is available under GenBank Accession Number NM_OOO875, and is presented herein as SEQ ID NO:!.
  • IGFlR insulin-like growth factor 1 receptor
  • the present invention is also directed to IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof which bind specifically, preferentially, or competitively to non-human IGF-IR proteins, e.g., IGF-IR from rodents or non-human primates.
  • IGF-IR is expressed in a large number of tumor cells, including, but not limited to certain of the following: bladder tumors (Hum. Pathol. 34:803 (2003)); brain tumors (Clinical Cancer Res. 8:1822 (2002)); breast tumors (Eur. J. Cancer 30:307 (1994) and Hum Pathol. 36:448-449 (2005)); colon tumors, e.g., adenocarcinomas, metastases, and adenomas (Human Pathol. 30:1128 (1999), Virchows. Arc. 443:139 (2003), and Clinical Cancer Res. 10:843 (2004)); gastric tumors (Clin. Exp.
  • kidney tumors e.g., clear cell, chromophobe and papillary RCC (Am. J. Clin. Pathol. 122:931- 937 (2004)); lung tumors (Hum. Pathol. 34:803-808 (2003) and J. Cancer Res. Clinical Oncol. 119:665-668 (1993)); ovarian tumors (Hum. Pathol. 34:803-808 (2003)); pancreatic tumors, e.g., ductal adenocarcinoma (Digestive Diseases. Sci. 48:1972-1978 (2003) and Clinical Cancer Res. 11:3233-3242 (2005)); and prostate tumors (Cancer Res. 62:2942-2950 (2002)).
  • IGF-IR ANTIBODIES e.g., clear cell, chromophobe and papillary RCC
  • the present invention is directed to IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof.
  • the present invention includes at least the antigen-binding domains of certain monoclonal antibodies, and fragments, variants, and derivatives thereof shown in Tables 3 and 4.
  • Table 3 lists human anti-human IGF-IR Fab regions identified from a phage display library and various binding properties of the antibodies, described in more detail in the Examples.
  • Table 4 lists murine anti-human IGF-IR monoclonal antibodies identified by hybridoma technology, and various binding properties of the antibodies, described in more detail in the Examples.
  • MCF-1 breast cancer cell
  • H-23 and Calu-6 lung cancer cells
  • Panc-1 pancr ⁇ atic cancer cell
  • Colo205 colon cancer cell
  • Hybridoma cell line which express full-length human antibodies P2A7.3E11,
  • the ATCC is located at 10801 University Boulevard, Manassas, VA 20110-2209,
  • the term "antigen binding domain” includes a site that specifically binds an epitope on an antigen ⁇ e.g., an epitope of IGF-IR).
  • the antigen binding domain of an antibody typically includes at least a portion of an immunoglobulin heavy chain variable region and at least a portion of an immunoglobulin light chain variable region. The binding site formed by these variable regions determines the specificity of the antibody.
  • the present invention is more specifically directed to an IGF-IR antibody, or antigen-binding fragment, variant or derivatives thereof, where the IGF-IR antibody specifically binds to the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14- BOl, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 2OD8.24B11, P1E2.3B12, and PlG10.2B8.
  • a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14- BOl, M12-E01, and M12-G04
  • a reference monoclonal antibody produced by a hybridoma selected from the group consist
  • the invention is further drawn to an IGF-IR antibody, or antigen-binding fragment, variant or derivatives thereof, where the IGF-IR antibody competitively inhibits a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8 from binding to IGF-IR.
  • a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04
  • a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3
  • the invention is also drawn to an IGF-IR antibody, or antigen-binding fragment, variant or derivatives thereof, where the IGF-IR antibody comprises an antigen binding domain identical to that of a monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8.
  • a monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04
  • a monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C
  • determining which amino acids, or epitope, of IGF- IR to which the antibody or antigen binding fragment binds can be determined by epitope mapping protocols as described herein as well as methods known in the art (e.g. double antibody-sandwich ELISA as described in "Chapter 11 - Immunology," Current Protocols in Molecular Biology, Ed. Ausubel et al., v.2, John Wiley & Sons, Inc. (1996)). Additional epitope mapping protocols may be found in Morris, G. Epitope Mapping Protocols, New Jersey: Humana Press (1996), which are both incorporated herein by reference in their entireties. Epitope mapping can also be performed by commercially available means (i.e. ProtoPROBE, Inc. (Milwaukee, Wisconsin)).
  • antibodies produced which bind to any portion of IGF-IR can then be screened for their ability to act as an antagonist of IGF-IR for example, to inhibit binding of insulin growth factor, e.g., IGF-I, IGF-2, or both IGF-I and IGF-2 to IGF-IR, to promote internalization of IGF-IR, to inhibit phosphorylation of IGF-IR, to inhibit downstream phosphorylation, e.g., of Akt or p42/44 MAPK, or to inhibit tumor cell proliferation, motility or metastasis.
  • Antibodies can be screened for these and other properties according to methods described in detail in the Examples. Other functions of antibodies of the present invention can be tested using other assays as described in the Examples herein.
  • the present invention includes an antibody, or antigen- binding fragment, variant, or derivative thereof which specifically or preferentially binds to at least one epitope of IGF-IR, where the epitope comprises, consists essentially of, or consists of at least about four to five amino acids of SEQ ID NO:2, at least seven, at least nine, or between at least about 15 to about 30 amino acids of SEQ ID NO:2.
  • the amino acids of a given epitope of SEQ ID NO:2 as described may be, but need not be contiguous or linear.
  • At least one epitope of IGF-IR comprises, consists essentially of, or consists of a non-linear epitope formed by the extracellular domain of IGF-IR as expressed on the surface of a cell or as a soluble fragment, e.g., fused to an IgG Fc region.
  • At least one epitope of IGF-IR comprises, consists essentially of, or consists of at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20, at least 25, between about 15 to about 30, or at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 contiguous or non-contiguous amino acids of SEQ ID NO:2, where non-contiguous amino acids form an epitope through protein folding.
  • the present invention includes an antibody, or antigen- binding fragment, variant, or derivative thereof which specifically or preferentially binds to at least one epitope of IGF-IR, where the epitope comprises, consists essentially of, or consists of, in addition to one, two, three, four, five, six or more contiguous or noncontiguous amino acids of SEQ ID NO:2 as described above, and an additional moiety which modifies the protein, e.g., a carbohydrate moiety may be included such that the IGF-IR antibody binds with higher affinity to modified target protein than it does to an unmodified version of the protein. Alternatively, the IGF-IR antibody does not bind the unmodified version of the target protein at all.
  • the present invention is directed to an antibody, or antigen- binding fragment, variant, or derivative thereof which specifically binds to a IGF-IR polypeptide or fragment thereof, or an IGF-IR variant polypeptide, with an affinity characterized by a dissociation constant (KD) which is less than the K D for a given reference monoclonal antibody.
  • KD dissociation constant
  • an antibody, or antigen-binding fragment, variant, or derivative thereof of the invention binds specifically to at least one epitope of IGF-IR or fragment or variant described above, i.e., binds to such an epitope more readily than it would bind to an unrelated, or random epitope; binds preferentially to at least one epitope of IGF-IR or fragment or variant described above, i.e., binds to such an epitope more readily than it would bind to a related, similar, homologous, or analogous epitope; competitively inhibits binding of a reference antibody which itself binds specifically or preferentially to a certain epitope of IGF-IR or fragment or variant described above; or binds to at least one epitope of IGF-IR or fragment or variant described above with an affinity characterized by a dissociation constant K D of less than about 5 x 10 "2 M, about 10 "2 M, about 5 x 10 3 M, about 10 "3 M
  • the antibody or fragment thereof preferentially binds to a human IGF-IR polypeptide or fragment thereof, relative to a murine IGF-IR polypeptide or fragment thereof.
  • the antibody or fragment thereof preferentially binds to one or more IGF-IR polypeptides or fragments thereof, e.g., one or more mammalian IGF-IR polypeptides, but does not bind to insulin receptor (InsR) polypeptides.
  • insulin receptor polypeptides are known to have some sequence similarity with IGF-IR polypeptides, and antibodies which cross react with InsR may produce unwanted side effects in vivo, e.g., interfering with glucose metabolism.
  • an antibody, or antigen-binding fragment, variant, or derivative thereof of the invention binds IGF-IR polypeptides or fragments or variants thereof with an off rate (k(off)) of less than or equal to 5 X 10 "2 sec 1 , 10 "2 sec '1 , 5 X 10 '3 sec “1 or 10 "3 sec “1 .
  • an antibody, or antigen-binding fragment, variant, or derivative thereof of the invention binds IGF-IR polypeptides or fragments or variants thereof with an off rate (k(off)) of less than or equal to 5 X 10"* sec '1 , W 4 sec 1 , 5 X 10 '5 sec '1 , or 10 "5 sec "1 5 X lO "6 sec 1 , 10 '6 sec "1 , 5 X 10 '7 sec '1 or 10 '7 sec '1 .
  • an antibody, or antigen-binding fragment, variant, or derivative thereof of the invention binds IGF-IR polypeptides or fragments or variants thereof with an on rate (k(on)) of greater than or equal to 10 3 M "1 sec “1 , 5 X 10 3 M “1 sec “1 , 10 4 M “1 sec “1 or 5 X 10 4 M “1 sec “1 .
  • an antibody, or antigen-binding fragment, variant, or derivative thereof of the invention binds IGF-IR polypeptides or fragments or variants thereof with an on rate (k(on)) greater than or equal to 10 5 M “1 sec “1 , 5 X 10 5 M “1 sec “1 , 10 6 M “1 sec “1 , or 5 X 106 M “1 sec “1 or 10 7 M “1 sec “1 .
  • an IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof as described herein is an antagonist of IGF-IR activity.
  • binding of an antagonist IGF-IR antibody to IGF-IR as expressed on a tumor cell inhibits binding of insulin growth factor, e.g., IGF-I, IGF-2, or both IGF-I and IGF-2 to IGF-IR, promotes internalization of IGF-IR thereby inhibiting its signal transduction capability, inhibits phosphorylation of IGF-IR, inhibits phosphorylation of molecules downstream in the signal transduction pathway, e.g., Akt or p42/44 MAPK, or inhibits tumor cell proliferation, motility or metastasis.
  • an IGF-IR antibody e.g., an antibody of the invention is a bispecif ⁇ c IGF-IR antibody, e.g., a bispecific antibody, minibody, domain deleted antibody, or fusion protein having binding specificity for more than one epitope, e.g., more than one antigen or more than one epitope on the same antigen.
  • a bispecific IGF-IR antibody has at least one binding domain specific for at least one epitope on a target polypeptide disclosed herein, e.g., IGF-IR.
  • a bispecific IGF-IR antibody has at least one binding domain specific for an epitope on a target polypeptide and at least one target binding domain specific for a drug or toxin.
  • a bispecific IGF-IR antibody has at least one binding domain specific for an epitope on a target polypeptide disclosed herein, and at least one binding domain specific for a prodrug.
  • a bispecific IGF-IR antibody may be a tetravalent antibody that has two target binding domains specific for an epitope of a target polypeptide disclosed herein and two target binding domains specific for a second target.
  • a tetravalent bispecific IGF-IR antibody may be bivalent for each specificity.
  • IGF-IR antibodies or antigen-binding fragments, variants, or derivatives thereof of the invention, as known by those of ordinary skill in the art, can comprise a constant region which mediates one or more effector functions.
  • binding of the Cl component of complement to an antibody constant region may activate the complement system.
  • Activation of complement is important in the opsonisation and lysis of cell pathogens.
  • the activation of complement also stimulates the inflammatory response and may also be involved in autoimmune hypersensitivity.
  • antibodies bind to receptors on various cells via the Fc region, with a Fc receptor binding site on the antibody Fc region binding to a Fc receptor (FcR) on a cell.
  • FcR Fc receptor
  • Fc receptors which are specific for different classes of antibody, including IgG (gamma receptors), IgE (epsilon receptors), IgA (alpha receptors) and IgM (mu receptors). Binding of antibody to Fc receptors on cell surfaces triggers a number of important and diverse biological responses including engulfment and destruction of antibody-coated particles, clearance of immune complexes, lysis of antibody-coated target cells by killer cells (called antibody-dependent cell-mediated cytotoxicity, or ADCC), release of inflammatory mediators, placental transfer and control of immunoglobulin production.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • certain embodiments of the invention include an IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof, in which at least a fraction of one or more of the constant region domains has been deleted or otherwise altered so as to provide desired biochemical characteristics such as reduced effector functions, the ability to non-covalently dimerize, increased ability to localize at the site of a tumor, reduced serum half-life, or increased serum half-life when compared with a whole, unaltered antibody of approximately the same immunogenicity.
  • certain antibodies for use in the diagnostic and treatment methods described herein are domain deleted antibodies which comprise a polypeptide chain similar to an immunoglobulin heavy chain, but which lack at least a portion of one or more heavy chain domains.
  • one entire domain of the constant region of the modified antibody will be deleted, for example, all or part of the CH2 domain will be deleted.
  • certain antibodies for use in the diagnostic and treatment methods described herein have s constant region, e.g., an IgG4 heavy chain constant region, which is altered to eliminate glycosylation, referred to elsewhere herein as "agly" antibodies. While not being bound by theory, it is believed that "agly" antibodies may have an improved safety and stability profile in vivo.
  • the Fc portion may be mutated to decrease effector function using techniques known in the art.
  • the deletion or inactivation (through point mutations or other means) of a constant region domain may reduce Fc receptor binding of the circulating modified antibody thereby increasing tumor localization.
  • constant region modifications consistent with the instant invention moderate complement binding and thus reduce the serum half life and nonspecific association of a conjugated cytotoxin.
  • modifications of the constant region may be used to modify disulfide linkages or oligosaccharide moieties that allow for enhanced localization due to increased antigen specificity or antibody flexibility.
  • the resulting physiological profile, bioavailability and other biochemical effects of the modifications such as tumor localization, biodistribution and serum half- life, may easily be measured and quantified using well know immunological techniques without undue experimentation.
  • Modified forms of IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention can be made from whole precursor or parent antibodies using techniques known in the art. Exemplary techniques are discussed in more detail herein.
  • both the variable and constant regions of IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof are fully human.
  • Fully human antibodies can be made using techniques that are known in the art and as described herein. For example, fully human antibodies against a specific antigen can be prepared by administering the antigen to a transgenic animal which has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled. Exemplary techniques that can be used to make such antibodies are described in US patents: 6,150,584; 6,458,592; 6,420,140. Other techniques are known in the art. Fully human antibodies can likewise be produced by various display technologies, e.g., phage display or other viral display systems, as described in more detail elsewhere herein.
  • IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention can be made or manufactured using techniques that are known in the art.
  • antibody molecules or fragments thereof are "recombinantly produced," i.e., are produced using recombinant DNA technology. Exemplary techniques for making antibody molecules or fragments thereof are discussed in more detail elsewhere herein.
  • IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention also include derivatives that are modified, e.g., by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from specifically binding to its cognate epitope.
  • the antibody derivatives include antibodies that have been modified, e.g., by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc. Additionally, the derivative may contain one or more non-classical amino acids.
  • IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention will not elicit a deleterious immune response in the animal to be treated, e.g., in a human.
  • IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention are modified to reduce their immunogenicity using art-recognized techniques.
  • antibodies can be humanized, primatized, deimmunized, or chimeric antibodies can be made. These types of antibodies are derived from a non-human antibody, typically a murine or primate antibody, that retains or substantially retains the antigen-binding properties of the parent antibody, but which is less immunogenic in humans.
  • CDRs complementarity determining regions
  • De-immunization can also be used to decrease the immunogenicity of an antibody.
  • the term "de-immunization” includes alteration of an antibody to modify T cell epitopes (see, e.g., WO9852976A1, WO0034317A2).
  • VH and VL sequences from the starting antibody are analyzed and a human T cell epitope "map" from each V region showing the location of epitopes in relation to complementarity- determining regions (CDRs) and other key residues within the sequence.
  • CDRs complementarity- determining regions
  • VH and VL sequences are designed comprising combinations of amino acid substitutions and these sequences are subsequently incorporated into a range of binding polypeptides, e.g., IGF-lR-specific antibodies or immunospecific fragments thereof for use in the diagnostic and treatment methods disclosed herein, which are then tested for function.
  • a range of binding polypeptides e.g., IGF-lR-specific antibodies or immunospecific fragments thereof for use in the diagnostic and treatment methods disclosed herein, which are then tested for function.
  • Typically, between 12 and 24 variant antibodies are generated and tested.
  • Complete heavy and light chain genes comprising modified V and human C regions are then cloned into expression vectors and the subsequent plasmids introduced into cell lines for the production of whole antibody. The antibodies are then compared in appropriate biochemical and biological assays, and the optimal variant is identified.
  • IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention may be generated by any suitable method known in the art.
  • Polyclonal antibodies to an antigen of interest can be produced by various procedures well known in the art.
  • an IGF-IR antibody e.g., a binding polypeptide, e.g., an IGF-IR- specific antibody or immunospecific fragment thereof can be administered to various host animals including, but not limited to, rabbits, mice, rats, chickens, hamsters, goats, donkeys, etc., to induce the production of sera containing polyclonal antibodies specific for the antigen.
  • adjuvants may be used to increase the immunological response, depending on the host species, and include but are not limited to, Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanins, dinitrophenol, and potentially useful human adjuvants such as BCG (bacille Calmette-Guerin) and Corynebacterium parvum. Such adjuvants are also well known in the art.
  • Monoclonal antibodies can be prepared using a wide variety of techniques known in the art including the use of hybridoma, recombinant, and phage display technologies, or a combination thereof.
  • monoclonal antibodies can be produced using hybridoma techniques including those known in the art and taught, for example, in Harlow et al, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, 2nd ed. (1988); Hammerling et al., in: Monoclonal Antibodies and T-CeIl Hybridomas Elsevier, N.Y., 563-681 (1981) (said references incorporated by reference in their entireties).
  • the term "monoclonal antibody” as used herein is not limited to antibodies produced through hybridoma technology.
  • the term “monoclonal antibody” refers to an antibody that is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, and not the method by which it is produced. Thus, the term “monoclonal antibody” is not limited to antibodies produced through hybridoma technology.
  • Monoclonal antibodies can be prepared using IGF-IR knockout mice to increase the regions of epitope recognition.
  • Monoclonal antibodies can be prepared using a wide variety of techniques known in the art including the use of hybridoma and recombinant and phage display technology as described elsewhere herein.
  • antibodies are raised in mammals by multiple subcutaneous or intraperitoneal injections of the relevant antigen (e.g., purified IGF-IR or cells or cellular extracts comprising IGF-IR) and an adjuvant.
  • This immunization typically elicits an immune response that comprises production of antigen- reactive antibodies from activated splenocytes or lymphocytes.
  • the resulting antibodies may be harvested from the serum of the animal to provide polyclonal preparations, it is often desirable to isolate individual lymphocytes from the spleen, lymph nodes or peripheral blood to provide homogenous preparations of monoclonal antibodies (MAbs).
  • the lymphocytes are obtained from the spleen.
  • the relatively short-lived, or mortal, lymphocytes from a mammal which has been injected with antigen are fused with an immortal tumor cell line (e.g. a myeloma cell line), thus, producing hybrid cells or "hybridomas" which are both immortal and capable of producing the genetically coded antibody of the B cell.
  • an immortal tumor cell line e.g. a myeloma cell line
  • hybrid cells or "hybridomas" which are both immortal and capable of producing the genetically coded antibody of the B cell.
  • the resulting hybrids are segregated into single genetic strains by selection, dilution, and regrowth with each individual strain comprising specific genes for the formation of a single antibody. They produce antibodies which are homogeneous against a desired antigen and, in reference to their pure genetic parentage, are termed "monoclonal.”
  • Hybridoma cells thus prepared are seeded and grown in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells.
  • suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells.
  • reagents, cell lines and media for the formation, selection and growth of hybridomas are commercially available from a number of sources and standardized protocols are well established.
  • culture medium in which the hybridoma cells are growing is assayed for production of monoclonal antibodies against the desired antigen.
  • the binding specificity of the monoclonal antibodies produced by hybridoma cells is determined by in vitro assays such as immunoprecipitation, radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA).
  • in vitro assays such as immunoprecipitation, radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA).
  • RIA radioimmunoassay
  • ELISA enzyme-linked immunoabsorbent assay
  • the monoclonal antibodies secreted by the subclones may be separated from culture medium, ascites fluid or serum by conventional purification procedures such as, for example, protein-A, hydroxylapatite chromatography, gel electrophoresis, dialysis or affinity chromatography.
  • Antibody fragments that recognize specific epitopes may be generated by known techniques. For example, Fab and F(ab') 2 fragments may be produced recombinantly or by proteolytic cleavage of immunoglobulin molecules, using enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab') 2 fragments). F(ab') 2 fragments contain the variable region, the light chain constant region and the CHl domain of the heavy chain.
  • DNA encoding antibodies or antibody fragments ⁇ e.g., antigen binding sites may also be derived from antibody libraries, such as phage display libraries.
  • phage can be utilized to display antigen-binding domains expressed from a repertoire or combinatorial antibody library (e.g., human or murine).
  • Phage expressing an antigen binding domain that binds the antigen of interest can be selected or identified with antigen, e.g., using labeled antigen or antigen bound or captured to a solid surface or bead.
  • Phage used in these methods are typically filamentous phage including fd and Ml 3 binding domains expressed from phage with Fab, Fv OE DAB (individual Fv region from light or heavy chains)or disulfide stabilized Fv antibody domains recombinantly fused to either the phage gene III or gene VIII protein.
  • Exemplary methods are set forth, for example, in EP 368 684 Bl; U.S. patent. 5,969,108, Hoogenboom, H.R. and Chames, Immunol. Today 27:371 (2000); Nagy et al. Nat. Med. 5:801 (2002); Huie et ah, Proc. Natl. Acad. Sci.
  • Ribosomal display can be used to replace bacteriophage as the display platform (see, e.g., Hanes et al., Nat. Biotechnol. /5:1287 (2000); Wilson et al, Proc. Natl.
  • cell surface libraries can be screened for antibodies (Boder et al., Proc. Natl. Acad. Sci. USA 97:10701 (2000); Daugherty et al., J. Immunol. Methods 243:211 (2000)).
  • Such procedures provide alternatives to traditional hybridoma techniques for the isolation and subsequent cloning of monoclonal antibodies.
  • phage display methods functional antibody domains are displayed on the surface of phage particles which carry the polynucleotide sequences encoding them.
  • DNA sequences encoding VH and VL regions are amplified or otherwise isolated from animal cDNA libraries (e.g., human or murine cDNA libraries of lymphoid tissues) or synthetic cDNA libraries.
  • the DNA encoding the VH and VL regions are joined together by an scFv linker by PCR and cloned into a phagemid vector (e.g., p CANTAB 6 or pComb 3 HSS).
  • the vector is electroporated in E. coli and the E.
  • Phage used in these methods are typically filamentous phage including fd and Ml 3 and the VH or VL regions are usually recombinantly fused to either the phage gene in or gene VIH.
  • Phage expressing an antigen binding domain that binds to an antigen of interest i.e., an IGF-IR polypeptide or a fragment thereof
  • an antigen of interest i.e., an IGF-IR polypeptide or a fragment thereof
  • can be selected or identified with antigen e.g., using labeled antigen or antigen bound or captured to a solid surface or bead.
  • phage display methods that can be used to make the antibodies include those disclosed in Brinkman et al., J. Immunol. Methods 752:41-50 (1995); Ames et al., J. Immunol. Methods 754:177-186 (1995); Kettleborough et al., Eur. J. Immunol. 24:952-958 (1994); Persic et al, Gene 757:9-18 (1997); Burton et al, Advances in Immunology 57:191-280 (1994); PCT Application No.
  • the antibody coding regions from the phage can be isolated and used to generate whole antibodies, including human antibodies, or any other desired antigen binding fragment, and expressed in any desired host, including mammalian cells, insect cells, plant cells, yeast, and bacteria.
  • a chimeric antibody is a molecule in which different portions of the antibody are derived from different animal species, such as antibodies having a variable region derived from a murine monoclonal antibody and a human immunoglobulin constant region.
  • Methods for producing chimeric antibodies are known in the art. See, e.g., Morrison, Science 229:1202 (1985); Oi et al., BioTechniques 4:214 (1986); Gillies et al., J. Immunol. Methods 725:191-202 (1989); U.S. Pat. Nos. 5,807,715; 4,816,567; and 4,816397, which are incorporated herein by reference in their entireties.
  • Humanized antibodies are antibody molecules from non-human species antibody that binds the desired antigen having one or more complementarity determining regions (CDRs) from the non-human species and framework regions from a human immunoglobulin molecule.
  • CDRs complementarity determining regions
  • framework residues in the human framework regions will be substituted with the corresponding residue from the CDR donor antibody to alter, preferably improve, antigen binding.
  • These framework substitutions are identified by methods well known in the art, eg-., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions. ⁇ See, e.g., Queen et al., U.S. Pat. No.
  • Antibodies can be humanized using a variety of techniques known in the art including, for example, CDR- grafting (EP 239,400; PCT publication WO 91/09967; U.S. Pat. Nos. 5,225,539; 5,530,101; and 5,585,089), veneering or resurfacing (EP 592,106; EP 519,596; Padlan, Molecular Immunology 28(4/5):489-49S (1991); Studnicka et al., Protein Engineering 7 ⁇ :805-814 (1994); Roguska.
  • Completely human antibodies are particularly desirable for therapeutic treatment of human patients.
  • Human antibodies can be made by a variety of methods known in the art including phage display methods described above using antibody libraries derived from human immunoglobulin sequences. See also, U.S. Pat. Nos. 4,444,887 and 4,716,111; and PCT publications WO 98/46645, WO 98/50433, WO 98/24893, WO 98/16654, WO 96/34096, WO 96/33735, and WO 91/10741; each of which is incorporated herein by reference in its entirety.
  • Human antibodies can also be produced using transgenic mice which are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes.
  • the human heavy and light chain immunoglobulin gene complexes may be introduced randomly or by homologous recombination into mouse embryonic stem cells.
  • the human variable region, constant region, and diversity region may be introduced into mouse embryonic stem cells in addition to the human heavy and light chain genes.
  • the mouse heavy and light chain immunoglobulin genes may be rendered non-functional separately or simultaneously with the introduction of human immunoglobulin loci by homologous recombination. In particular, homozygous deletion of the JH region prevents endogenous antibody production.
  • the modified embryonic stem cells are expanded and microinjected into blastocysts to produce chimeric mice.
  • the chimeric mice are then bred to produce homozygous offspring that express human antibodies.
  • the transgenic mice are immunized in the normal fashion with a selected antigen, e.g., all or a portion of a desired target polypeptide.
  • Monoclonal antibodies directed against the antigen can be obtained from the immunized, transgenic mice using conventional hybridoma technology.
  • the human immunoglobulin transgenes harbored by the transgenic mice rearrange during B- cell differentiation, and subsequently undergo class switching and somatic mutation.
  • Completely human antibodies which recognize a selected epitope can be generated using a technique referred to as "guided selection.”
  • a selected non-human monoclonal antibody e.g., a mouse antibody
  • antibodies to target polypeptides of the invention can, in turn, be utilized to generate anti-idiotype antibodies that "mimic" target polypeptides using techniques well known to those skilled in the art. (See, e.g., Greenspan & Bona, FASEB J. 7(5):437- 444 (1989) and Nissinoff, J. Immunol. J47(8):2429-243S (1991)).
  • antibodies which bind to and competitively inhibit polypeptide multimerization and/or binding of a polypeptide of the invention to a ligand can be used to generate antiidiotypes that "mimic" the polypeptide multimerization and/or binding domain and, as a consequence, bind to and neutralize polypeptide and/or its ligand.
  • Such neutralizing antiidiotypes or Fab fragments of such anti-idiotypes can be used in therapeutic regimens to neutralize polypeptide ligand.
  • anti-idiotypic antibodies can be used to bind a desired target polypeptide and/or to bind its ligands/receptors, and thereby block its biological activity.
  • DNA encoding desired monoclonal antibodies may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies).
  • the isolated and subcloned hybridoma cells serve as a preferred source of such DNA.
  • the DNA may be placed into expression vectors, which are then transfected into prokaryotic or eukaryotic host cells such as, but not limited to, E. coli cells, simian COS cells, Chinese Hamster Ovary (CHO) cells or myeloma cells that do not otherwise produce immunoglobulins.
  • the isolated DNA (which may be synthetic as described herein) may be used to clone constant and variable region sequences for the manufacture antibodies as described in Newman et al, U.S. Pat. No. 5,658,570, filed January 25, 1995, which is incorporated by reference herein. Essentially, this entails extraction of RNA from the selected cells, conversion to cDNA, and amplification by PCR using Ig specific primers. Suitable primers for this purpose are also described in U.S. Pat. No. 5,658,570. As will be discussed in more detail below, transformed cells expressing the desired antibody may be grown up in relatively large quantities to provide clinical and commercial supplies of the immunoglobulin.
  • an IGF-IR antibody of the invention comprises at least one heavy or light chain CDR of an antibody molecule. In another embodiment, an IGF-IR antibody of the invention comprises at least two CDRs from one or more antibody molecules. In another embodiment, an IGF-IR antibody of the invention comprises at least three CDRs from one or more antibody molecules. In another embodiment, an IGF- IR antibody of the invention comprises at least four CDRs from one or more antibody molecules. In another embodiment, an IGF-IR antibody of the invention comprises at least five CDRs from one or more antibody molecules. In another embodiment, an IGF- IR antibody of the invention comprises at least six CDRs from one or more antibody molecules. Exemplary antibody molecules comprising at least one CDR that can be included in the subject IGF-IR antibodies are described herein.
  • the amino acid sequence of the heavy and/or light chain variable domains may be inspected to identify the sequences of the complementarity determining regions (CDRs) by methods that are well know in the art, e.g., by comparison to known amino acid sequences of other heavy and light chain variable regions to determine the regions of sequence hypervariability.
  • CDRs complementarity determining regions
  • one or more of the CDRs may be inserted within framework regions, e.g., into human framework regions to humanize a non-human antibody.
  • the framework regions may be naturally occurring or consensus framework regions, and preferably human framework regions ⁇ see, e.g., Chothia et al., J. MoI. Biol.
  • the polynucleotide generated by the combination of the framework regions and CDRs encodes an antibody that specifically binds to at least one epitope of a desired polypeptide, e.g., IGF-IR.
  • a desired polypeptide e.g., IGF-IR.
  • one or more amino acid substitutions may be made within the framework regions, and, preferably, the amino acid substitutions improve binding of the antibody to its antigen. Additionally, such methods may be used to make amino acid substitutions or deletions of one or more variable region cysteine residues participating in an intrachain disulfide bond to generate antibody molecules lacking one or more intrachain disulfide bonds.
  • Other alterations to the polynucleotide are encompassed by the present invention and within the skill of the art.
  • a chimeric antibody is a molecule in which different portions are derived from different animal species, such as those having a variable region derived from a murine monoclonal antibody and a human immunoglobulin constant region, e.g., humanized antibodies.
  • Single chain antibodies are formed by linking the heavy and light chain fragments of the Fv region via an amino acid bridge, resulting in a single chain antibody. Techniques for the assembly of functional Fv fragments in E coli may also be used (Skerra et al, Science 242:1038-1041 (1988)).
  • Yet other embodiments of the present invention comprise the generation of human or substantially human antibodies in transgenic animals (e.g., mice) that are incapable of endogenous immunoglobulin production (see e.g., U.S. Pat. Nos. 6,075,181, 5,939,598, 5,591,669 and 5,589,369 each of which is incorporated herein by reference).
  • transgenic animals e.g., mice
  • the homozygous deletion of the antibody heavy-chain joining region in chimeric and germ-line mutant mice results in complete inhibition of endogenous antibody production. Transfer of a human immunoglobulin gene array to such germ line mutant mice will result in the production of human antibodies upon antigen challenge.
  • Another preferred means of generating human antibodies using SCDD mice is disclosed in U.S. Pat. No. 5,811,524 which is incorporated herein by reference. It will be appreciated that the genetic material associated with these human antibodies may also be isolated and manipulated as described herein.
  • lymphocytes can be selected by micromanipulation and the variable genes isolated.
  • peripheral blood mononuclear cells can be isolated from an immunized mamma 1 *nd cultured for about 7 days in vitro. The cultures can be screened for specific IgGs that meet the screening criteria. Cells from positive wells can be isolated.
  • Individual Ig-producing B cells can be isolated by FACS or by identifying them in a complement-mediated hemolytic plaque assay.
  • Ig-producing B cells can be micromanipulated into a tube and the VH and VL genes can be amplified using, e.g., RT-PCR.
  • the VH and VL genes can be cloned into an antibody expression vector and transfected into cells (e.g., eukaryotic or prokaryotic cells) for expression.
  • antibody-producing cell lines may be selected and cultured using techniques well known to the skilled artisan. Such techniques are described in a variety of laboratory manuals and primary publications. In this respect, techniques suitable for use in the invention as described below are described in Current Protocols in Immunology, Coligan et al., Eds., Green Publishing Associates and Wiley-Interscience, John Wiley and Sons, New York (1991) which is herein incorporated by reference in its entirety, including supplements.
  • Antibodies of the present invention can be produced by any method known in the art for the synthesis of antibodies, in particular, by chemical synthesis or preferably, by recombinant expression techniques as described herein.
  • an IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof of the invention comprises a synthetic constant region wherein one or more domains are partially or entirely deleted ("domain-deleted antibodies")-
  • compatible modified antibodies will comprise domain deleted constructs or variants wherein the entire CH2 domain has been removed ( ⁇ CH2 constructs).
  • ⁇ CH2 constructs domain deleted constructs or variants wherein the entire CH2 domain has been removed
  • a short connecting peptide may be substituted for the deleted domain to provide flexibility and freedom of movement for the variable region.
  • Domain deleted constructs can be derived using a vector encoding an IgGi human constant domain (see, e.g., WO 02/060955 A2 and WO02/096948A2). This vector is engineered to delete the CH2 domain and provide a synthetic vector expressing a domain deleted IgG] constant region.
  • IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention are minibodies. Minibodies can be made using methods described in the art (see e.g., US patent 5,837,821 or WO 94/09817A1).
  • an IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof of the invention comprises an immunoglobulin heavy chain having deletion or substitution of a few or even a single amino acid as long as it permits association between the monomelic subunits.
  • the mutation of a single amino acid in selected areas of the CH2 domain may be enough to substantially reduce Fc binding and thereby increase tumor localization.
  • the constant regions of the disclosed antibodies may be synthetic through the mutation or substitution of one or more amino acids that enhances the profile of the resulting construct. In this respect it may be possible to disrupt the activity provided by a conserved binding site ⁇ e.g. Fc binding) while substantially maintaining the configuration and immunogenic profile of the modified antibody.
  • Yet other embodiments comprise the addition of one or more amino acids to the constant region to enhance desirable characteristics such as effector function or provide for more cytotoxin or carbohydrate attachment.
  • it may be desirable to insert or replicate specific sequences derived from selected constant region domains.
  • the present invention also provides antibodies that comprise, consist essentially of, or consist of, variants (including derivatives) of antibody molecules (e.g., the VH regions and/or VL regions) described herein, which antibodies or fragments thereof immunospecifically bind to an IGF-IR polypeptide or fragment or variant thereof.
  • Standard techniques known to those of skill in the art can be used to introduce mutations in the nucleotide sequence encoding an IGF-IR antibody, including, but not limited to, site-directed mutagenesis and PCR-mediated mutagenesis which result in amino acid substitutions.
  • the variants encode less than 50 amino acid substitutions, less than 40 amino acid substitutions, less than 30 amino acid substitutions, less than 25 amino acid substitutions, less than 20 amino acid substitutions, less than 15 amino acid substitutions, less than 10 amino acid substitutions, less than 5 amino acid substitutions, less than 4 amino acid substitutions, less than 3 amino acid substitutions, or less than 2 amino acid substitutions relative to the reference VH region, VH-CDRl, VH-CDR2, VH-CDR3, VL region, VL-CDRl, VL-CDR2, or VL-CDR3.
  • A amino acid substitutions relative to the reference VH region, VH-CDRl, VH-CDR2, VH-CDR3, VL region, VL-CDRl, VL-CDR2, or VL-CDR3.
  • “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a side chain with a similar charge.
  • Families of amino acid residues having side chains with similar charges have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagjne, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains ( e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, trypto
  • mutations can be introduced randomly along all or part of the coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for biological activity to identify mutants that retain activity (e.g., the ability to bind an IGF-IR polypeptide).
  • mutations can be introduced randomly along all or part of the coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for biological activity to identify mutants that retain activity (e.g., the ability to bind an IGF-IR polypeptide).
  • These types of mutations may be useful to optimize codon usage, or improve a. hybridoma's antibody production.
  • Codon-optimized coding regions encoding IGF-IR antibodies of the present invention are disclosed elsewhere herein.
  • non- neutral missense mutations may alter an antibody's ability to bind antigen.
  • the location of most silent and neutral missense mutations is likely to be in the framework regions, while the location of most non-neutral missense mutations is likely to be in CDR, though this is not an absolute requirement.
  • One of skill in the art would be able to design and test mutant molecules with desired properties such as no alteration in antigen binding activity or alteration in binding activity (e.g., improvements in antigen binding activity or change in antibody specificity).
  • the encoded protein may routinely be expressed and the functional and/or biological activity of the encoded protein, (e.g., ability to immunospecifically bind at least one epitope of an IGF-IR polypeptide) can be determined using techniques described herein or by routinely modifying techniques known in the art.
  • the present invention also provides for nucleic acid molecules encoding IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention.
  • the present invention provides an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid encoding an immunoglobulin heavy chain variable region (VH), where at least one of the CDRs of the heavy chain variable region or at least two of the VH-CDRs of the heavy chain variable region are at least 80%, 85%, 90% or 95% identical to reference heavy chain VH-CDRl, VH-CDR2, or VH-CDR3 amino acid sequences from monoclonal IGF-IR antibodies disclosed herein.
  • VH immunoglobulin heavy chain variable region
  • VH-CDRl, VH-CDR2, and VH-CDR3 regions of the VH are at least 80%, 85%, 90% or 95% identical to reference heavy chain VH-CDRl, VH-CDR2, and VH-CDR3 amino acid sequences from monoclonal IGF-IR antibodies disclosed herein.
  • a heavy chain variable region of the invention has VH-CDRl, VH-CDR2, or VH-CDR3 polypeptide sequences related to the polypeptide sequences shown in Table 5:
  • N nucleotide sequence
  • P polypeptide sequence
  • sequence identity between two polypeptides or two polynucleotides is determined by comparing the amino acid or nucleic acid sequence of one polypeptide or polynucleotide to the sequence of a second polypeptide or polynucleotide.
  • sequence identity is determined by comparing the amino acid or nucleic acid sequence of one polypeptide or polynucleotide to the sequence of a second polypeptide or polynucleotide.
  • whether any particular polypeptide is at least about 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or 95% identical to another polypeptide can be determined using methods and computer programs/software known in the art such as, but not limited to, the BESTFIT program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, WI 53711).
  • BESTFIT uses the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2:482-489 (1981), to find the best segment of homology between two sequences.
  • the parameters are set, of course, such that the percentage of identity is calculated over the full length of the reference polypeptide sequence and that gaps in homology of up to 5% of the total number of amino acids in the reference sequence are allowed.
  • an antibody or antigen-binding fragment comprising the
  • VH encoded by the polynucleotide specifically or preferentially binds to IGF-IR.
  • the nucleotide sequence encoding the VH polypeptide is altered without altering the amino acid sequence encoded thereby.
  • the sequence may be altered for improved codon usage in a given species, to remove splice sites, or the remove restriction enzyme sites. Sequence optimizations such as these are described in the examples and are well known and routinely carried out by those of ordinary skill in the art.
  • the present invention provides an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid encoding an immunoglobulin heavy chain variable region (VH) in which the VH-CDRl, VH-CDR2, and VH-CDR3 regions have polypeptide sequences which are identical to the VH-CDRl, VH-CDR2, and VH-CDR3 groups shown in Table 5.
  • VH immunoglobulin heavy chain variable region
  • an antibody or antigen-binding fragment comprising the VH encoded by the polynucleotide specifically or preferentially binds to IGF-IR.
  • an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VH encoded by one or more of the polynucleotides described above specifically or preferentially binds to the same IGF- Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8, or will competitively inhibit such a monoclonal antibody or fragment from binding to IGF-IR.
  • an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VH encoded by one or more of the polynucleotides described above specifically or preferentially binds to an IGF-IR polypeptide or fragment thereof, or a IGF-IR variant polypeptide, with an affinity characterized by a dissociation constant (KD) no greater than 5 x 10 "2 M, 10 "2 M, 5 x 10 '3 M, IO 3 M, 5 x 10 ⁇ M, 10 ⁇ M, 5 x 10 "5 M, 10 "5 M, 5 x 1(T 6 M, 1(T 6 M, 5 x 10 7 M, 1(T 7 M, 5 x 10 8 M, 10 8 M, 5 x 10 '9 M, 10 9 M, 5 x lO "10 M, lO "10 M, 5 x lO '11 M, l ⁇ " M, 5 x 10 12 M, 10 "12 M, 5
  • KD dissociation constant
  • the present invention provides an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid encoding an immunoglobulin light chain variable region (VL), where at least one of the VL-CDRs of the light chain variable region or at least two of the VL-CDRs of the light chain variable region are at least 80%, 85%, 90% or 95% identical to reference light chain VL-CDRl, VL-CDR2, or VL-CDR3 amino acid sequences from monoclonal IGF-IR antibodies disclosed herein.
  • VL immunoglobulin light chain variable region
  • VL-CDRl, VL-CDR2, and VL-CDR3 regions of the VL are at least 80%, 85%, 90% or 95% identical to reference light chain VL-CDRl, VL- CDR2, and VL-CDR3 amino acid sequences from monoclonal IGF-IR antibodies disclosed herein.
  • a light chain variable region of the invention has VL-CDRl, VL-CDR2, or VL-CDR3 polypeptide sequences related to the polypeptide sequences shown in Table 6: TABLE 6: Reference VL-CDRl, VL-CDR2, and VL-CDR3 amino acid sequences*
  • PN nucleotide sequence
  • PP polypeptide sequence
  • an antibody or antigen-binding fragment comprising the
  • VL encoded by the polynucleotide specifically or preferentially binds to IGF-IR.
  • the present invention provides an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid encoding an immunoglobulin light chain variable region (VL) in which the VL-CDRl , VL-CDR2, and VL-CDR3 regions have polypeptide sequences which are identical to the VL-CDRl, VL- CDR2, and VL-CDR3 groups shown in Table 6.
  • VL immunoglobulin light chain variable region
  • an antibody or antigen-binding fragment comprising the VL encoded by the polynucleotide specifically or preferentially binds to IGF-IR.
  • the present invention provides an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid encoding an immunoglobulin light chain variable region (VL) in which the VL-CDRl, VL-CDR2, and VL-CDR3 regions are encoded by nucleotide sequences which are identical to the nucleotide sequences which encode the VL-CDRl, VL-CDR2, and VL-CDR3 groups shown in Table 6.
  • an antibody or antigen-binding fragment comprising the VL encoded by the polynucleotide specifically or preferentially binds to IGF-IR.
  • an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VL encoded by one or more of the polynucleotides described above specifically or preferentially binds to the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8, or will competitively inhibit such a monoclonal antibody or fragment from binding to IGF-IR.
  • an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VL encoded by one or more of the polynucleotides described above specifically or preferentially binds to an IGF-IR polypeptide or fragment thereof, or a IGF-IR variant polypeptide, with an affinity characterized by a dissociation constant (K D ) no greater than 5 x 10 "2 M, 10 "2 M, 5 x 10 "3 M, 10 "3 M, 5 x 10 "4 M, KT 4 M, 5 x 10 s M, 1(T 5 M, 5 x 10 "6 M, 1O -6 M, 5 x 1(T 7 M, 10 '7 M, 5 x 10 "8 M, 10 8 M, 5 x 10 "9 M, 10 "9 M, 5 x 10 '10 M, 10 "10 M, 5 x 10 "u M, 10 n M, 5 x 10 " 12 M, Kr 12 M, 5 x 10 s M, 1(
  • the present invention includes an isolated polynucleotide comprising, consisting essentially of. or consisting of a nucleic acid encoding a VH at least 80%, 85%, 90% 95% or 100% identical to a reference VH polypeptide sequence selected from the group consisting of SEQ ID NOs: 4, 9, 14, 20, 26, 32, 38, 43, 48, 53, 58, and 63.
  • an antibody or antigen-binding fragment comprising the VH encoded by the polynucleotide specifically or preferentially binds to IGF-IR.
  • the present invention includes an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid sequence encoding a VH having a polypeptide sequence selected from the group consisting of SEQ ID NOs: 4, 9, 14, 20, 26, 32, 38, 43, 48, 53, 58, and 63.
  • an antibody or antigen-binding fragment comprising the VH encoded by the polynucleotide specifically or preferentially binds to IGF-IR.
  • the present invention includes an isolated polynucleotide comprising, consisting essentially of, or consisting of a VH-encoding nucleic acid at least 80%, 85%, 90% 95% or 100% identical to a reference nucleic acid sequence selected from the group consisting of SEQ ID NOs: 3, 8, 13, 18, 19, 24, 25, 30, 31, 36, 37, 42, 47, 52, 57, and 62.
  • an antibody or antigen-binding fragment comprising the VH encoded by such polynucleotides specifically or preferentially binds to IGF-IR.
  • the present invention includes an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid sequence encoding a VH of the invention, where the amino acid sequence of the VH is selected from the group consisting of SEQ ID NOs: 4, 9, 14, 20, 26, 32, 38, 43, 48, 53, 58, and 63.
  • the present invention further includes an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid sequence encoding a VH of the invention, where the sequence of the nucleic acid is selected from the group consisting of SEQ ID NOs: 3, 8, 13, 18, 19, 24, 25, 30, 31, 36, 37, 42, 47, 52, 57, and 62.
  • an antibody or antigen-binding fragment comprising the VH encoded by such polynucleotides specifically or preferentially binds to IGF-IR.
  • an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VH encoded by one or more of the polynucleotides described above specifically or preferentially binds to the same IGF- Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8, or will competitively inhibit such a monoclonal antibody or fragment from binding to IGF-IR, or will competitively inhibit such a monoclonal antibody from binding to IGF-IR.
  • an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VH encoded by one or more of the polynucleotides described above specifically or preferentially binds to an IGF-IR polypeptide or fragment thereof, or a IGF-IR variant polypeptide, with an affinity characterized by a dissociation constant (K D ) no greater than 5 x 10 "2 M, 10 '2 M, 5 x 10 "3 M, 10 '3 M, 5 x 10 ⁇ M, IO- 4 M, 5 x 1(T 5 M, 10 5 M, 5 x 1(T 6 M, 1(T 6 M, 5 x 10 '7 M, 10 7 M, 5 x 10 "8 M, 10 "8 M, 5 x 10 "9 M, 10 ⁇ 9 M, 5 x 10 '10 M, 10 "10 M, 5 x 10 "n M, l ⁇ " M, 5 x 10 " 12 M, 10- 12 M,
  • the present invention includes an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid encoding a VL at least 80%, 85%, 90% 95% or 100% identical to a reference VL polypeptide sequence having an amino acid sequence selected from the group consisting of SEQ ID NOs: 68, 73, 78, 83, 88, 93, 98, 103, 108, 113, and 118.
  • the present invention includes an isolated polynucleotide comprising, consisting essentially of, or consisting of a VL-encoding nucleic acid at least 80%, 85%, 90% 95% or 100% identical to a reference nucleic acid sequence selected from the group consisting of SEQ ID NOs:
  • an antibody or antigen-binding fragment comprising the VL encoded by such polynucleotides specifically or preferentially binds to IGF-IR.
  • the present invention includes an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid sequence encoding a VL having a polypeptide sequence selected from the group consisting of SEQ ID NOs:
  • the present invention further includes an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid sequence encoding a VL of the invention, where the sequence of the nucleic acid is selected from the group consisting of SEQ ID NOs: 67, 72, 77, 82, 87, 92, 97, 102, 107, 112, and 117.
  • an antibody or antigen-binding fragment comprising the VL encoded by such polynucleotides specifically or preferentially binds to IGF-IR.
  • an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VL encoded by one or more of the polynucleotides described above specifically or preferentially binds to the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8, or will competitively inhibit such a monoclonal antibody or fragment from binding to IGF-IR.
  • an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VL encoded by one or more of the polynucleotides described above specifically or preferentially binds to an IGF-IR polypeptide or fragment thereof, or a IGF-IR variant polypeptide, with an affinity characterized by a dissociation constant (K D ) no greater than 5 x 10 "2 M, 10 ⁇ 2 M, 5 x 10 "3 M, 10 ⁇ 3 M, 5 x 10 "4 M, 10 "4 M, 5 x 10 '5 M, 10 ⁇ 5 M, 5 x 10 "6 M, 10 "6 M, 5 x 10 "7 M, 10 ⁇ 7 M, 5 x 10 "8 M, 1(T 8 M, 5 x 10 ⁇ 9 M, 10 "9 M, 5 x 1(T 10 M, 10 10 M, 5 x 10 "u M, 10 ⁇ M, 5 x 10 " 12 M, 10 ⁇ 12
  • any of the polynucleotides described above may further include additional nucleic acids, encoding, e.g., a signal peptide to direct secretion of the encoded polypeptide, antibody constant regions as described herein, or other heterologous polypeptides as described herein.
  • the present invention includes compositions comprising the polynucleotides comprising one or more of the polynucleotides described above.
  • the invention includes compositions comprising a first polynucleotide and second polynucleotide wherein said first polynucleotide encodes a VH polypeptide as described herein and wherein said second polynucleotide encodes a VL polypeptide as described herein.
  • composition which comprises, consists essentially of, or consists of a VH polynucleotide, and a VL polynucleotide, wherein the VH polynucleotide and the VL polynucleotide encode polypeptides, respectively at least 80%, 85%, 90% 95% or 100% identical to reference VL and VL polypeptide amino acid sequences selected from the group consisting of SEQ ID NOs: 4 and 68, 8 and 73, 14 and 78, 20 and 83, 26 and 88, 32 and 93, 38 and 98, 43 and 103, 48 and 108, 53 and 103, 58 and 113, and 63 and 118.
  • compositions which comprises, consists essentially of, or consists of a VH polynucleotide, and a VL polynucleotide at least 80%, 85%, 90% 95% or 100% identical, respectively, to reference VL and VL nucleic acid sequences selected from the group consisting of SEQ ID NOs: 3 and 67, 8 and 72, 13 and 77, 18 and 77, 19 and 82, 24 and 82, 25 and 87, 30 and 87, 31 and 92, 36 and 92, 37 and 97, 42 and 102, 47 and 107, 58 and 102, 57 and 112, and 62 and 117.
  • an antibody or antigen- binding fragment comprising the VH and VL encoded by the polynucleotides in such compositions specifically or preferentially binds to IGF-IR.
  • the present invention also includes fragments of the polynucleotides of the invention, as described elsewhere. Additionally polynucleotides which encode fusion polynucleotides, Fab fragments, and other derivatives, as described herein, are also contemplated by the invention.
  • the polynucleotides may be produced or manufactured by any method known in the art.
  • a polynucleotide encoding the antibody may be assembled from chemically synthesized oligonucleotides (e.g., as described in Kutmeier et al., BioTechniques 17:242 (1994)), which, briefly, involves the synthesis of overlapping oligonucleotides containing portions of the sequence encoding the antibody, annealing and ligating of those oligonucleotides, and then amplification of the ligated oligonucleotides by PCR.
  • a polynucleotide encoding an IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof may be generated from nucleic acid from a suitable source. If a clone containing a nucleic acid encoding a particular antibody is not available, but the sequence of the antibody molecule is known, a nucleic acid encoding the antibody may be chemically synthesized or obtained from a suitable source (e.g., an antibody cDNA library, or a cDNA library generated from, or nucleic acid, preferably poly A+RNA, isolated from, any tissue or cells expressing the antibody or other IGF-IR antibody, such as hybridoma cells selected to express an antibody) by PCR amplification using synthetic primers hybridizable to the 3' and 5' ends of the sequence or by cloning using an oligonucleotide probe specific for the particular gene sequence to identify, e.g., a cDNA clone from a cDNA
  • IR antibody, or antigen-binding fragment, variant, or derivative thereof is determined, its nucleotide sequence may be manipulated using methods well known in the art for the manipulation of nucleotide sequences, e.g., recombinant DNA techniques, site directed mutagenesis, PCR, etc. (see, for example, the techniques described in Sambrook et al., Molecular Cloning, A Laboratory Manual, 2d Ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.
  • a polynucleotide encoding an IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof can be composed of any polyribonucleotide or polydeoxribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA.
  • a polynucleotide encoding IGF-IR antibody, or antigen-binding fragment," variant, or derivative thereof can be composed of single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and double- stranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that may be single-stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions.
  • a polynucleotide encoding an IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof can be composed of triple-stranded regions comprising RNA or DNA or both RNA and DNA.
  • a polynucleotide encoding an IGF-IR antibody, or antigen- binding fragment, variant, or derivative thereof may also contain one or more modified bases or DNA or RNA backbones modified for stability or for other reasons.
  • “Modified" bases include, for example, tritylated bases and unusual bases such as inosine. A variety of modifications can be made to DNA and RNA; thus, "polynucleotide” embraces chemically, enzymatically, or metabolically modified forms.
  • An isolated polynucleotide encoding a non-natural variant of a polypeptide derived from an immunoglobulin can be created by introducing one or more nucleotide substitutions, additions or deletions into the nucleotide sequence of the immunoglobulin such that one or more amino acid substitutions, additions or deletions are introduced into the encoded protein. Mutations may be introduced by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis. Preferably, conservative amino acid substitutions are made at one or more non-essential amino acid residues.
  • the present invention is further directed to isolated polypeptides which make up
  • IGF-IR antibodies and polynucleotides encoding such polypeptides.
  • IGF-IR antibodies of the present invention comprise polypeptides, e.g., amino acid sequences encoding IGF- lR-specific antigen binding regions derived from immunoglobulin molecules.
  • a polypeptide or amino acid sequence "derived from" a designated protein refers to the origin of the polypeptide having a certain amino acid sequence.
  • the polypeptide or amino acid sequence which is derived from a particular starting polypeptide or amino acid sequence has an amino acid sequence that is essentially identical to that of the starting sequence, or a portion thereof, wherein the portion consists of at least 10-20 amino acids, at least 20-30 amino acids, at least 30-50 amino acids, or which is otherwise identifiable to one of ordinary skill in the art as having its origin in the starting sequence.
  • the present invention provides an isolated polypeptide comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable region (VH), where at least one of VH-CDRs of the heavy chain variable region or at least two of the VH-CDRs of the heavy chain variable region are at least 80%, 85%, 90% or 95% identical to reference heavy chain VH-CDRl, VH-CDR2 or VH-CDR3 amino acid sequences from monoclonal IGF-IR antibodies disclosed herein.
  • VH immunoglobulin heavy chain variable region
  • VH-CDRl, VH-CDR2 and VH-CDR3 regions of the VH are at least 80%, 85%, 90% or 95% identical to reference heavy chain VH-CDRl, VH-CDR2 and VH-CDR3 amino acid sequences from monoclonal IGF-IR antibodies disclosed herein.
  • a heavy chain variable region of the invention has VH-CDRl, VH-CDR2 and VH-CDR3 polypeptide sequences related to the groups shown in Table 5, supra. While Table 5 shows VH-CDRs defined by the Kabat system, other CDR definitions, e.g., VH-CDRs defined by the Chothia system, are also included in the present invention.
  • an antibody or antigen-binding fragment comprising the VH specifically or preferentially binds to IGF-IR.
  • the present invention provides an isolated polypeptide comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable region (VH) in which the VH-CDRl, VH-CDR2 and VH-CDR3 regions have polypeptide sequences which are identical to the VH-CDRl, VH-CDR2 and VH-CDR3 groups shown in Table 5.
  • VH immunoglobulin heavy chain variable region
  • an antibody or antigen-binding fragment comprising the VH specifically or preferentially binds to IGF-IR.
  • the present invention provides an isolated polypeptide comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable region (VH) in which the VH-CDRl, VH-CDR2 and VH-CDR3 regions have polypeptide sequences which are identical to the VH-CDRl, VH-CDR2 and VH-CDR3 groups shown in Table 5, except for one, two, three, four, five, or six amino acid substitutions in any one VH-CDR.
  • additional substitutions may be made in the CDR, as long as the a VH comprising the VH-CDR specifically or preferentially binds to IGF-IR.
  • the amino acid substitutions are conservative.
  • an antibody or antigen-binding fragment comprising the VH specifically or preferentially binds to IGF-IR are conservative.
  • the present invention includes an isolated polypeptide comprising, consisting essentially of, or consisting of a VH polypeptide at least 80%, 85%, 90% 95% or 100% identical to a reference VH polypeptide amino acid sequence selected from the group consisting of SEQ ID NOs: SEQ ED NOs: 4, 9, 14, 20, 26, 32, 38, 43, 48, 53, 58, and 63.
  • an antibody or antigen-binding fragment comprising the VH polypeptide specifically or preferentially binds to IGF-IR.
  • the present invention includes an isolated polypeptide comprising, consisting essentially of, or consisting of a VH polypeptide selected from the group consisting of SEQ ED NOs: SEQ DD NOs: 4, 9, 14, 20, 26, 32, 38, 43, 48, 53, 58, and 63.
  • an antibody or antigen-binding fragment comprising the VH polypeptide specifically or preferentially binds to IGF-IR.
  • an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a one or more of the VH polypeptides described above specifically or preferentially binds to the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8, or will competitively inhibit such a monoclonal antibody or fragment from binding to IGF-IR
  • an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of one or more of the VH polypeptides described above specifically or preferentially binds to an IGF-IR polypeptide or fragment thereof, or a IGF-IR variant polypeptide, with an affinity characterized by a dissociation constant (K D ) no greater than 5 x 10 '2 M, 10 2 M, 5 x 10 "3 M, 10 "3 M, 5 x 10 "4 M, 10 "4 M, 5 x 10 5 M, 10 "5 M, 5 x 10 "6 M, 10 “6 M, 5 x 10 7 M, 10 "7 M, 5 x 10 "8 M, 10 '8 M, 5 x lO '9 M, 1(F M, 5 x 10 10 M, 10 "10 M, 5 x 10 " “ M, 10 ⁇ M, 5 x 10 12 M, 10 12 M, 5 x 10 "13 M, 10 13 M, 5 x
  • the present invention provides an isolated polypeptide comprising, consisting essentially of, or consisting of an immunoglobulin light chain variable region (VL), where at least one of the VL-CDRs of the light chain variable region or at least two of the VL-CDRs of the light chain variable region are at least 80%, 85%, 90% or 95% identical to reference light chain VL-CDRl, VL-CDR2 or VL-CDR3 amino acid sequences from monoclonal IGF-IR antibodies disclosed herein.
  • VL immunoglobulin light chain variable region
  • VL-CDRl, VL-CDR2 and VL-CDR3 regions of the VL are at least 80%, 85%, 90% or 95% identical to reference light chain VL-CDRl, VL-CDR2 and VL- CDR3 amino acid sequences from monoclonal IGF-IR antibodies disclosed herein.
  • a light chain variable region of the invention has VL- CDRl, VL-CDR2 and VL-CDR3 polypeptide sequences related to the polypeptides shown in Table 6, supra. While Table 6 shows VL-CDRs defined by the Kabat system, other CDR definitions, e.g., VL-CDRs defined by the Chothia system, are also included in the present invention.
  • an antibody or antigen-binding fragment comprising the VL polypeptide specifically or preferentially binds to IGF-IR.
  • the present invention provides an isolated polypeptide comprising, consisting essentially of, or consisting of an immunoglobulin light chain variable region (VL) in which the VL-CDRl, VL-CDR2 and VL-CDR3 regions have polypeptide sequences which are identical to the VL-CDRl, VL-CDR2 and VL-CDR3 groups shown in Table 6.
  • VL immunoglobulin light chain variable region
  • an antibody or antigen-binding fragment comprising the VL polypeptide specifically or preferentially binds to IGF-IR.
  • the present invention provides an isolated polypeptide comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable region (VL) in which the VL-CDRl, VL-CDR2 and VL-CDR3 regions have polypeptide sequences which are identical to the VL-CDRl, VL-CDR2 and VL-CDR3 groups shown in Table 6, except for one, two, three, four, five, or six amino acid substitutions in any one VL-CDR. In larger CDRs, additional substitutions may be made in the VL-CDR, as long as the a VL comprising the VL-CDR specifically or preferentially binds to IGF-IR. In certain embodiments the amino acid substitutions are conservative.
  • an antibody or antigen-binding fragment comprising the VL specifically or preferentially binds to IGF-IR.
  • the present invention includes an isolated polypeptide comprising, consisting essentially of, or consisting of a VL polypeptide at least 80%, 85%, 90% 95% or 100% identical to a reference VL polypeptide sequence selected from the group consisting of SEQ ID NOs: 68, 73, 78, 83, 88, 93, 98, 103, 108, 113, and 118.
  • an antibody or antigen-binding fragment comprising the VL polypeptide specifically or preferentially binds to IGF-IR.
  • the present invention includes an isolated polypeptide comprising, consisting essentially of, or consisting of a VL polypeptide selected from the group consisting of S SEQ ID NOs: 68, 73, 78, 83, 88, 93, 98, 103, 108, 113, and 118.
  • an antibody or antigen-binding fragment comprising the VL polypeptide specifically or preferentially binds to IGF-IR.
  • an antibody or antigen-binding fragment thereof comprising, consisting essentially of, one or more of the VL polypeptides described above specifically or preferentially binds to the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M 14- GI l, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8, or will competitively inhibit such a monoclonal antibody or fragment from binding to IGF-IR
  • an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a one or more of the VL polypeptides described above specifically or preferentially binds to an IGF-IR polypeptide or fragment thereof, or a IGF-IR variant polypeptide, with an affinity characterized by a dissociation constant (K D ) no greater than 5 x 10 '2 M, 10 "2 M, 5 x 10° M, 10° M, 5 x W 4 M, W 4 M, 5 x 10 "5 M, 10 5 M, 5 x 1O -6 M, 10 "6 M, 5 x 10 "7 M, 10 7 M, 5 x 10 "8 M, 10 "8 M, 5 x 10 '9 M, 10 "9 M, 5 x 10 "10 M, 10 "10 M, 5 x 10 "n M, 10 "u M, 5 x 10 " 12 M, 10 12 M, 5 x 10 "13 M, 10 13 M, 5 x 10
  • an antibody or antigen-binding fragment thereof comprises, consists essentially of or consists of a VH polypeptide, and a VL polypeptide, where the VH polypeptide and the VL polypeptide, respectively are at least 80%, 85%, 90% 95% or 100% identical to reference VL and VL polypeptide amino acid sequences selected from the group consisting of SEQ ID NOs: 4 and 68, 8 and 73, 14 and 78, 20 and 83, 26 and 88, 32 and 93, 38 and 98, 43 and 103, 48 and 108, 53 and 103, 58 and 113, and 63 and 118.
  • an antibody or antigen-binding fragment comprising these VH and VL polypeptides specifically or preferentially binds to IGF-IR.
  • polypeptides described above may further include additional polypeptides, e.g., a signal peptide to direct secretion of the encoded polypeptide, antibody constant regions as described herein, or other heterologous polypeptides as described herein.
  • polypeptides of the invention include polypeptide fragments as described elsewhere.
  • polypeptides of the invention include fusion polypeptide, Fab fragments, and other derivatives, as described herein.
  • compositions comprising the polypeptides described above.
  • IGF-IR antibody polypeptides as disclosed herein may be modified such that they vary in amino acid sequence from the naturally occurring binding polypeptide from which they were derived.
  • a polypeptide or amino acid sequence derived from a designated protein may be similar, e.g., have a certain percent identity to the starting sequence, e.g., it may be 60%, 70%, 75%, 80%, 85%, 90%, or 95% identical to the starting sequence.
  • nucleotide or amino acid substitutions, deletions, or insertions leading to conservative substitutions or changes at "non-essential" amino acid regions may be made.
  • a polypeptide or amino acid sequence derived from a designated protein may be identical to the starting sequence except for one or more individual amino acid substitutions, insertions, or deletions, e.g., one, two, three, four, five, six, seven, eight, nine, ten, fifteen, twenty or more individual amino acid substitutions, insertions, or deletions
  • a polypeptide or amino acid sequence derived from a designated protein may be identical to the starting sequence except for one or more individual amino acid substitutions, insertions, or deletions, e.g., one, two, three, four, five, six, seven, eight, nine, ten, fifteen, twenty or more individual amino acid substitutions, insertions, or deletions.
  • a polypeptide or amino acid sequence derived from a designated protein may be identical to the starting sequence except for two or fewer, three or fewer, four or fewer, five or fewer, six or fewer, seven or fewer, eight or fewer, nine or fewer, ten or fewer, fifteen or fewer, or twenty or fewer individual amino acid substitutions, insertions, or deletions.
  • a polypeptide or amino acid sequence derived from a designated protein has one to five, one to ten, one to fifteen, or one to twenty individual amino acid substitutions, insertions, or deletions relative to the starting sequence.
  • Certain IGF-IR antibody polypeptides of the present invention comprise, consist essentially of, or consist of an amino acid sequence derived from a human amino acid sequence.
  • certain IGF-IR antibody polypeptides comprise one or more contiguous amino acids derived from another mammalian species.
  • an IGF- IR antibody of the present invention may include a primate heavy chain portion, hinge portion, or antigen binding region.
  • one or more murine-derived amino acids may be present in a non-murine antibody polypeptide, e.g., in an antigen binding site of an IGF-IR antibody.
  • the antigen binding site of an IGF-IR antibody is fully murine, hi certain therapeutic applications, IGF-lR-specific antibodies, or antigen-binding fragments, variants, or analogs thereof are designed so as to not be immunogenic in the animal to which the antibody is administered.
  • an IGF-IR antibody polypeptide comprises an amino acid sequence or one or more moieties not normally associated with an antibody. Exemplary modifications are described in more detail below.
  • a single-chain fv antibody fragment of the invention may comprise a flexible linker sequence, or may be modified to add a functional moiety (e.g., PEG, a drug, a toxin, or a label).
  • An IGF-IR antibody polypeptide of the invention may comprise, consist essentially of, or consist of a fusion protein.
  • Fusion proteins are chimeric molecules which comprise, for example, an immunoglobulin antigen-binding domain with at least one target binding site, and at least one heterologous portion, i.e., a portion with which it is not naturally linked in nature.
  • the amino acid sequences may normally exist in separate proteins that are brought together in the fusion polypeptide or they may normally exist in the same protein but are placed in a new arrangement in the fusion polypeptide. Fusion proteins may be created, for example, by chemical synthesis, or by creating and translating a polynucleotide in which the peptide regions are encoded in the desired relationship.
  • heterologous as applied to a polynucleotide or a polypeptide, means that the polynucleotide or polypeptide is derived from a distinct entity from that of the rest of the entity to which it is being compared.
  • a “heterologous polypeptide” to be fused to an IGF-IR antibody, or an antigen-binding fragment, variant, or analog thereof is derived from a non-immunoglobulin polypeptide of the same species, or an immunoglobulin or non-immunoglobulin polypeptide of a different species.
  • a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • basic side chains e
  • a nonessential amino acid residue in an immunoglobulin polypeptide is preferably replaced with another amino acid residue from the same side chain family.
  • a string of amino acids can be replaced with a structurally similar string that differs in order and/or composition of side chain family members.
  • mutations may be introduced randomly along all or part of the immunoglobulin coding sequence, such as by saturation mutagenesis, and the resultant mutants can be incorporated into IGF-IR antibodies for use in the diagnostic and treatment methods disclosed herein and screened for their ability to bind to the desired antigen, e.g., IGF-IR.
  • IGF-IR antibodies, or antigen- binding fragments, variants, or derivatives thereof of the invention may further be recombinantly fused to a heterologous polypeptide at the N- or C-terminus or chemically conjugated (including covalent and non-covalent conjugations) to polypeptides or other compositions.
  • IGF-lR-specific IGF-IR antibodies may be recombinantly fused or conjugated to molecules useful as labels in detection assays and effector molecules such as heterologous polypeptides, drugs, radionuclides, or toxins. See, e.g., PCT publications WO 92/08495; WO 91/14438; WO 89/12624; U.S. Patent No. 5,314,995; and EP 396,387.
  • IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention include derivatives that are modified, i.e., by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody binding IGF-IR.
  • the antibody derivatives include antibodies that have been modified, e.g., by glycosylation, acetylation, pegylation, phosphylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc.
  • IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention can be composed of amino acids joined to each other by peptide bonds or modified peptide bonds, i.e., peptide isosteres, and may contain amino acids other than the 20 gene-encoded amino acids.
  • IGF-lR-specfic antibodies may be modified by natural processes, such as posttranslational processing, or by chemical modification techniques which are well known in the art.
  • Modifications can occur anywhere in the IGF-lR-specific antibody, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini, or on moieties such as carbohydrates. It will be appreciated that the same type of modification may be present in the same or varying degrees at several sites in a given IGF-lR-specific antibody. Also, a given IGF-lR-specific antibody may contain many types of modifications. IGF-lR-specific antibodies may be branched, for example, as a result of ubiquitination, and they may be cyclic, with or without branching.
  • Cyclic, branched, and branched cyclic IGF-lR-specific antibodies may result from posttranslation natural processes or may be made by synthetic methods. Modifications include acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphotidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent cross-links, formation of cysteine, formation of pyroglutamate, formylation, gamma-carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, pegylation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation
  • the present invention also provides for fusion proteins comprising an IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof, and a heterologous polypeptide.
  • a fusion protein of the invention comprises, consists essentially of, or consists of, a polypeptide having the amino acid sequence of any one or more of the VH regions of an antibody of the invention or the amino acid sequence of any one or more of the VL regions of an antibody of the invention or fragments or variants thereof, and a heterologous polypeptide sequence.
  • a fusion protein for use in the diagnostic and treatment methods disclosed herein comprises, consists essentially of, or consists of a polypeptide having the amino acid sequence of any one, two, three of the VH-CDRs of an IGF-lR-specific antibody, or fragments, variants, or derivatives thereof, or the amino acid sequence of any one, two, three of the VL-CDRs of an IGF-lR-specific antibody, or fragments, variants, or derivatives thereof, and a heterologous polypeptide sequence.
  • the fusion protein comprises a polypeptide having the amino acid sequence of a VH-CDR3 of an IGF-lR-specific antibody of the present invention, or fragment, derivative, or variant thereof, and a heterologous polypeptide sequence, which fusion protein specifically binds to at least one epitope of IGF-IR.
  • a fusion protein comprises a polypeptide having the amino acid sequence of at least one VH region of an IGF-lR-specific antibody of the invention and the amino acid sequence of at least one VL region of an IGF-lR-specific antibody of the invention or fragments, derivatives or variants thereof, and a heterologous polypeptide sequence.
  • a fusion protein for use in the diagnostic and treatment methods disclosed herein comprises a polypeptide having the amino acid sequence of any one, two, three or more of the VH CDRs of an IGF-lR-specific antibody and the amino acid sequence of any one, two, three or more of the VL CDRs of an IGF- lR-specific antibody, or fragments or variants thereof, and a heterologous polypeptide sequence.
  • VH-CDR(s) or VL- CDR(s) correspond to single source antibody (or scFv or Fab fragment) of the invention.
  • Nucleic acid molecules encoding these fusion proteins are also encompassed by the invention.
  • Exemplary fusion proteins reported in the literature include fusions of the T cell receptor (Gascoigne et al, Proc. Natl. Acad. ScL USA 54:2936-2940 (1987)); CD4 (Capon et al., Nature 537:525-531 (1989); Traunecker et al., Nature 339:68-70 (1989); Zettmeissl et al., DNA Cell Biol. USA 9:347-353 (1990); and Bym et al., Nature 344:667- 670 (1990)); L-selectin (homing receptor) (Watson et al., J. Cell. Biol.
  • CD44 ArufTo et al., Cell 67:1303-1313 (1990)
  • CD28 and B7 Lisley et al, J. Exp. Med. 773:721-730 (1991)
  • CTLA-4 Lisley et al., J. Exp. Med. 774:561-569 (1991)
  • CD22 Stamenkovic et al., Cell 66:1133-1144 (1991)
  • TNF receptor Ashkenazi et al., Proc. Natl. Acad.
  • IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention may be fused to heterologous polypeptides to increase the in vivo half life of the polypeptides or for use in immunoassays using methods known in the art.
  • PEG can be conjugated to the IGF-IR antibodies of the invention to increase their half-life in vivo. Leong, S.R., et al., Cytokine 16:106 (2001); Adv. in Drug Deliv. Rev. 54:531 (2002); or Weir et al., Biochem. Soc. Transactions 30:512 (2002).
  • IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention can be fused to marker sequences, such as a peptide to facilitate their purification or detection
  • the marker amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector (QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, Calif, 91311), among others, many of which are commercially available.
  • pQE vector QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, Calif, 91311
  • hexa-histidine provides for convenient purification of the fusion protein.
  • peptide tags useful for purification include, but are not limited to, the "HA” tag, which corresponds to an epitope derived from the influenza hemagglutinin protein (Wilson et al., Cell 37:767 (1984)) and the "flag" tag.
  • Fusion proteins can be prepared using methods that are well known in the art (see for example US Patent Nos. 5,116,964 and 5,225,538). The precise site at which the fusion is made may be selected empirically to optimize the secretion or binding characteristics of the fusion protein. DNA encoding the fusion protein is then transfected into a host cell for expression.
  • IGF-IR antibodies of the present invention may be used in non-conjugated form or may be conjugated to at least one of a variety of molecules, e.g., to improve the therapeutic properties of the molecule, to facilitate target detection, or for imaging or therapy of the patient.
  • IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention can be labeled or conjugated either before or after purification, when purification is performed.
  • IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention may be conjugated to therapeutic agents, prodrugs, peptides, proteins, enzymes, viruses, lipids, biological response modifiers, pharmaceutical agents, or PEG.
  • conjugates may also be assembled using a variety of techniques depending on the selected agent to be conjugated.
  • conjugates with biotin are prepared e.g. by reacting a binding polypeptide with an activated ester of biotin such as the biotin N-hydroxysuccinimide ester.
  • conjugates with a fluorescent marker may be prepared in the presence of a coupling agent, e.g. those listed herein, or by reaction with an isothiocyanate, preferably fluorescein-isothiocyanate.
  • Conjugates of the IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention are prepared in an analogous manner.
  • the present invention further encompasses IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention conjugated to a diagnostic or therapeutic agent.
  • the IGF-IR antibodies can be used diagnostically to, for example, monitor the development or progression of a neurological disease as part of a clinical testing procedure to, e.g., determine the efficacy of a given treatment and/or prevention regimen. Detection can be facilitated by coupling the IGF-IR antibody, or antigen- binding fragment, variant, or derivative thereof to a detectable substance.
  • detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, radioactive materials, positron emitting metals using various positron emission tomographies, and nonradioactive paramagnetic metal ions. See, for example, U.S. Pat. No. 4,741,900 for metal ions which can be conjugated to antibodies for use as diagnostics according to the present invention.
  • suitable enzymes include horseradish peroxidase, alkaline phosphatase, ⁇ - galactosidase, or acetylcholinesterase;
  • suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin;
  • suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin;
  • an example of a luminescent material includes luminol;
  • examples of bioluminescent materials include luciferase, luciferin, and aequorin;
  • suitable radioactive material include 125 1, 131 1, 111 In or 99 Tc.
  • An IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof also can be detectably labeled by coupling it to a chemiluminescent compound.
  • the presence of the chemiluminescent-tagged IGF-IR antibody is then determined by detecting the presence of luminescence that arises during the course of a chemical reaction.
  • particularly useful chemiluminescent labeling compounds are luminol, isoluminol, theromatic acridinium ester, imidazole, acridinium salt and oxalate ester.
  • IGF-IR antibody or antigen-binding fragment, variant, or derivative thereof can be detectably labeled is by linking the same to an enzyme and using the linked product in an enzyme immunoassay (EIA) (Voller, A., "The Enzyme Linked Immunosorbent Assay (ELISA)" Microbiological Associates Quarterly Publication, Walkersville, Md., Diagnostic Horizons 2:1-7 (1978)); Voller et al., J. Clin. Pathol. 37:507-520 (1978); Butler, J. E., Meth. Enzymol. 73:482-523 (1981); Maggio, E.
  • EIA enzyme immunoassay
  • the enzyme which is bound to the IGF-IR antibody will react with an appropriate substrate, preferably a chromogenic substrate, in such a manner as to produce a chemical moiety which can be detected, for example, by spectrophotometric, fluorimetric or by visual means.
  • Enzymes which can be used to detectably label the antibody include, but are not limited to, malate dehydrogenase, staphylococcal nuclease, delta-5-steroid isomerase, yeast alcohol dehydrogenase, alpha-glycerophosphate, dehydrogenase, triose phosphate isomerase, horseradish peroxidase, alkaline phosphatase, asparaginase, glucose oxidase, beta- galactosidase, ribonuclease, urease, catalase, glucose-6-phosphate dehydrogenase, glucoamylase and acetylcholinesterase.
  • the detection can be accomplished by colorimetric methods which employ a chromogenic substrate for the enzyme. Detection may also be accomplished by visual comparison of the extent of enzymatic reaction of a substrate in comparison with similarly prepared standards. [0402] Detection may also be accomplished using any of a variety of other immunoassays.
  • radioactively labeling the IGF-IR antibody, or antigen- binding fragment, variant, or derivative thereof it is possible to detect the antibody through the use of a radioimmunoassay (RIA) (see, for example, Weintraub, B., Principles of Radioimmunoassays, Seventh Training Course on Radioligand Assay Techniques, The Endocrine Society, (March, 1986)), which is incorporated by reference herein).
  • RIA radioimmunoassay
  • the radioactive isotope can be detected by means including, but not limited to, a gamma counter, a scintillation counter, or autoradiography.
  • IGF-IR antibody or antigen-binding fragment, variant, or derivative thereof can also be detectably labeled using fluorescence emitting metals such as 152Eu, or others of the lanthanide series. These metals can be attached to the antibody using such metal chelating groups as diethylenetriaminepentacetic acid (DTPA) or ethylenediaminetetraacetic acid (EDTA).
  • DTPA diethylenetriaminepentacetic acid
  • EDTA ethylenediaminetetraacetic acid
  • binding molecules e.g., binding polypeptides, e.g., IGF-lR-specific antibodies or immunospeciflc fragments thereof for use in the diagnostic and treatment methods disclosed herein may be conjugated to cytotoxins (such as radioisotopes, cytotoxic drugs, or toxins) therapeutic agents, cytostatic agents, biological toxins, prodrugs, peptides, proteins, enzymes, viruses, lipids, biological response modifiers, pharmaceutical agents, immunologically active ligands (e.g., lymphokines or other antibodies wherein the resulting molecule binds to both the neoplastic cell and an effector cell such as a T cell), or PEG.
  • cytotoxins such as radioisotopes, cytotoxic drugs, or toxins
  • therapeutic agents such as radioisotopes, cytotoxic drugs, or toxins
  • cytostatic agents such as radioisotopes, cytotoxic drugs, or toxins
  • biological toxins such as radioisotopes, cytotoxic drugs
  • a binding molecule e.g., a binding polypeptide, e.g., a IGF-lR-specific antibody or immunospecific fragment thereof for use in the diagnostic and treatment methods disclosed herein can be conjugated to a molecule that decreases vascularization of tumors.
  • the disclosed compositions may comprise binding molecules, e.g., binding polypeptides, e.g., IGF-IR- specific antibodies or immunospecific fragments thereof coupled to drugs or prodrugs.
  • binding molecules e.g., binding polypeptides, e.g., IGF-lR-specific antibodies or immunospecific fragments thereof conjugated to specific biotoxins or their cytotoxic fragments such as ricin, gelonin, ps eudomonas exotoxin or diphtheria toxin.
  • binding molecules e.g., binding polypeptides, e.g., IGF-lR-specific antibodies or immunospecific fragments thereof conjugated to specific biotoxins or their cytotoxic fragments such as ricin, gelonin, ps eudomonas exotoxin or diphtheria toxin.
  • the selection of which conjugated or unconjugated binding molecule to use will depend on the type and stage of cancer, use of adjunct treatment (e.g., chemotherapy or external radiation) and patient condition. It will be appreciated that one skilled in the art could readily make such a selection in view of the teachings herein.
  • radioisotopes include: 90 Y, 125 I, 131 I, 123 I, 111 In, 105 Rh, 153 Sm, 67 Cu, 67 Ga, 166 Ho, 177 Lu, 186 Re and 188 Re.
  • the radionuclides act by producing ionizing radiation which causes multiple strand breaks in nuclear DNA, leading to cell death.
  • the isotopes used to produce therapeutic conjugates typically produce high energy ⁇ - or ⁇ -particles which have a short path length. Such radionuclides kill cells to which they are in close proximity, for example neoplastic cells to which the conjugate has attached or has entered. They have little or no effect on non-localized cells. Radionuclides are essentially non-immunogenic.
  • binding molecules e.g., binding polypeptides, e.g., IGF-lR-specific antibodies or immunospecific fragments thereof may be directly labeled (such as through iodination) or may be labeled indirectly through the use of a chelating agent.
  • the phrases "indirect labeling” and “indirect labeling approach” both mean that a chelating agent is covalently attached to a binding molecule and at least one radionuclide is associated with the chelating agent.
  • Such chelating agents are typically referred to as bifunctional chelating agents as they bind both the polypeptide and the radioisotope.
  • Particularly preferred chelating agents comprise l-isothiocycmatobenzyl-3- methyldiothelene triaminepentaacetic acid ("MX-DTPA”) and cyclohexyl diethylenetriamine pentaacetic acid (“CHX-DTPA”) derivatives.
  • Other chelating agents comprise P-DOTA and EDTA derivatives.
  • Particularly preferred radionuclides for indirect labeling include ' 11 In and 90 Y.
  • direct labeling and “direct labeling approach” both mean that a radionuclide is covalently attached directly to a polypeptide (typically via an amino acid residue). More specifically, these linking technologies include random labeling and site-directed labeling. In the latter case, the labeling is directed at specific sites on the polypeptide, such as the N-linked sugar residues present only on the Fc portion of the conjugates. Further, various direct labeling techniques and protocols are compatible with the instant invention.
  • Technetium-99 labeled polypeptides may be prepared by ligand exchange processes, by reducing pertechnate (TcO 4 " ) with stannous ion solution, chelating the reduced technetium onto a Sephadex column and applying the binding polypeptides to this column, or by batch labeling techniques, e.g. by incubating pertechnate, a reducing agent such as SnCl 2 , a buffer solution such as a sodium-potassium phthalate-solution, and the antibodies.
  • a reducing agent such as SnCl 2
  • a buffer solution such as a sodium-potassium phthalate-solution
  • preferred radionuclides for directly labeling antibodies are well known in the art and a particularly preferred radionuclide for direct labeling is 131 I covalently attached via tyrosine residues.
  • Binding molecules e.g., binding polypeptides, e.g., IGF-lR-specific antibodies or immunospecific fragments thereof for use in the diagnostic and treatment methods disclosed herein may be derived, for example, with radioactive sodium or potassium iodide and a chemical oxidizing agent, such as sodium hypochlorite, chloramine T or the like, or an enzymatic oxidizing agent, such as lactoperoxidase, glucose oxidase and glucose.
  • a chemical oxidizing agent such as sodium hypochlorite, chloramine T or the like
  • an enzymatic oxidizing agent such as lactoperoxidase, glucose oxidase and glucose.
  • Patents relating to chelators and chelator conjugates are known in the art.
  • U.S. Patent No. 4,831,175 of Gansow is directed to polysubstituted diethylenetriaminepentaacetic acid chelates and protein conjugates containing the same, and methods for their preparation.
  • U.S. Patent Nos. 5,099,069, 5,246,692, 5,286,850, 5,434,287 and 5,124,471 of Gansow also relate to polysubstituted DTPA chelates. These patents are incorporated herein by reference in their entireties.
  • compatible metal chelators are ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid (DPTA), 1,4,8,11-tetraazatetradecane, 1,4,8,11- tetraazatetradecane- 1 ,4,8, 11 -tetraacetic acid, 1 -oxa-4,7, 12, 15-tetraazaheptadecane-
  • EDTA ethylenediaminetetraacetic acid
  • DPTA diethylenetriaminepentaacetic acid
  • 1,4,8,11-tetraazatetradecane 1,4,8,11- tetraazatetradecane- 1 ,4,8, 11 -tetraacetic acid, 1 -oxa-4,7, 12, 15-tetraazaheptadecane-
  • Cyclohexyl-DTPA or CHX-DTPA is particularly preferred and is exemplified extensively below. Still other compatible chelators, including those yet to be discovered, may easily be discerned by a skilled artisan and are clearly within the scope of the present invention.
  • Compatible chelators including the specific bifunctional chelator used to facilitate chelation U.S. Patent Nos. 6,682,134, 6,399,061, and 5,843,439, incorporated herein by reference in their entireties, are preferably selected to provide high affinity for trivalent metals, exhibit increased tumor-to-non-tumor ratios and decreased bone uptake as well as greater in vivo retention of radionuclide at target sites, i.e., B-cell lymphoma tumor sites.
  • target sites i.e., B-cell lymphoma tumor sites.
  • other bifunctional chelators that may or may not possess all of these characteristics are known in the art and may also be beneficial in rumor therapy.
  • binding molecules may be conjugated to different radiolabels for diagnostic and therapeutic purposes.
  • U.S. Patent Nos. 6,682,134, 6,399,061, and 5,843,439 disclose radiolabeled therapeutic conjugates for diagnostic "imaging" of tumors before administration of therapeutic antibody.
  • “In2B8" conjugate comprises a murine monoclonal antibody, 2B8, specific to human CD20 antigen, that is attached to 111 In via a bifunctional chelator, i.e., MX-DTPA (diethylenetriaminepentaacetic acid), which comprises a 1:1 mixture of l-isothiocyanatobenzyl-3-methyl-DTPA and 1-methyl- 3-isothiocyanatobenzyl-DTPA.
  • MX-DTPA diethylenetriaminepentaacetic acid
  • 111 In is particularly preferred as a diagnostic radionuclide because between about 1 to about 10 mCi can be safely administered without detectable toxicity; and the imaging data is generally predictive of subsequent 90 Y-labeled antibody distribution.
  • 131 I is a well known radionuclide used for targeted immunotherapy.
  • the clinical usefulness of 131 I can be limited by several factors including: eight-day physical half-life; dehalogenation of iodinated antibody both in the blood and at tumor sites; and emission characteristics (e.g., large gamma component) which can be suboptimal for localized dose deposition in tumor.
  • 90 Y provides several benefits for utilization in radioimmunotherapeutic applications: the 64 hour half-life of 90 Y is long enough to allow antibody accumulation by tumor and, unlike e.g., 131 I, 90 Y is a pure beta emitter of high energy with no accompanying gamma irradiation in its decay, with a range in tissue of 100 to 1,000 cell diameters. Furthermore, the minimal amount of penetrating radiation allows for outpatient administration of ⁇ 'V-labeled antibodies. Additionally, internalization of labeled antibody is not required for cell killing, and the local emission of ionizing radiation should be lethal for adjacent tumor cells lacking the target molecule.
  • cytotoxic drugs particularly those which are used for cancer therapy.
  • a cytotoxin or cytotoxic agent means any agent that is detrimental to the growth and proliferation of cells and may act to reduce, inhibit or destroy a cell or malignancy.
  • cytotoxins include, but are not limited to, radionuclides, biotoxins, enzymatically active toxins, cytostatic or cytotoxic therapeutic agents, prodrugs, immunologically active ligands and biological response modifiers such as cytokines. Any cytotoxin that acts to retard or slow the growth of immunoreactive cells or malignant cells is within the scope of the present invention.
  • Exemplary cytotoxins include, in general, cytostatic agents, alkylating agents, anti-metabolites, antiproliferative agents, tubulin binding agents, hormones and hormone antagonists, and the like.
  • Exemplary cytostatics that are compatible with the present invention include alkylating substances, such as mechlorethamine, triethylenephosphoramide, cyclophosphamide, ifosfamide, chlorambucil, busulfan, melphalan or triaziquone, also nitrosourea compounds, such as carmustine, lomustine, or semustine.
  • alkylating substances such as mechlorethamine, triethylenephosphoramide, cyclophosphamide, ifosfamide, chlorambucil, busulfan, melphalan or triaziquone
  • nitrosourea compounds such as carmustine, lomustine, or semustine.
  • Other preferred classes of cytotoxic agents include, for example, the maytansinoid family of
  • cytotoxic agents include, for example, the anthracycline family of drugs, the vinca drugs, the mitomycins, the bleomycins, the cytotoxic nucleosides, the pteridine family of drugs, diynenes, and the podophyllotoxins.
  • Particularly useful members of those classes include, for example, adriamycin, carminomycin, daunorubicin (daunomycin), doxorubicin, aminopterin, methotrexate, methopterin, mithramycin, streptonigrin, dichloromethotrexate, mitomycin C, actinomycin-D, porfiromycin, 5-fluorouracil, floxuridine, ftorafur, 6-mercaptopurine, cytarabine, cytosine arabinoside, podonhyllotoxin, or podophyllotoxin derivatives such as etoposide or etoposide phosphate, melphalan, vinblastine, vincristine, leurosidine, vindesine, leurosine and the like.
  • cytotoxins that are compatible with the teachings herein include taxol, taxane, cytochalasin B, gramicidin D, ethidium bromide, emetine, tenoposide, colchicin, dihydroxy anthracin dione, mitoxantrone, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof.
  • Hormones and hormone antagonists such as corticosteroids, e.g. prednisone, progestins, e.g. hydroxyprogesterone or medroprogesterone, estrogens, e.g. diethylstilbestrol, antiestrogens, e.g.
  • tamoxifen, androgens e.g. testosterone
  • aromatase inhibitors e.g. aminogluthetimide
  • One skilled in the art may make chemical modifications to the desired compound in order to make reactions of that compound more convenient for purposes of preparing conjugates of the invention.
  • cytotoxins comprise members or derivatives of the enediyne family of anti-tumor antibiotics, including calicheamicin, esperamicins or dynemicins. These toxins are extremely potent and act by cleaving nuclear DNA, leading to cell death. Unlike protein toxins which can be cleaved in vivo to give many inactive but immunogenic polypeptide fragments, toxins such as calicheamicin, esperamicins and other enediynes are small molecules which are essentially non-immunogenic. These non-peptide toxins are chemically-linked to the dimers or tetramers by techniques which have been previously used to label monoclonal antibodies and other molecules. These linking technologies include site-specific linkage via the N-linked sugar residues present only on the Fc portion of the constructs. Such site- directed linking methods have the advantage of reducing the possible effects of linkage on the binding properties of the constructs.
  • compatible cytotoxins for preparation of conjugates may comprise a prodrug.
  • prodrug refers to a precursor or derivative form of a pharmaceutically active substance that is less cytotoxic to tumor cells compared to the parent drug and is capable of being enzymatically activated or converted into the more active parent form.
  • Prodrugs compatible with the invention include, but are not limited to, phosphate-containing prodrugs, thiophosphate-containing prodrugs, sulfate containing prodrugs, peptide containing prodrugs, ⁇ -lactam-containing prodrugs, optionally substituted phenoxyacetamide-containing prodrugs or optionally substituted phenylacetamide-containing prodrugs, 5-fluorocytosine and other 5-fluorouridine prodrugs that can be converted to the more active cytotoxic free drug.
  • Further examples of cytotoxic drugs that can be derivatized into a prodrug form for use in the present invention comprise those chemotherapeutic agents described above.
  • binding molecules e.g., binding polypeptides, e.g., IGF-lR-specific antibodies or immunospecific fragments thereof disclosed herein can also be associated with or conjugated to a biotoxin such as ricin subunit A, abrin, diptheria toxin, botulinum, cyanginosins, saxitoxin, shigatoxin, tetanus, tetrodotoxin, trichothecene, verrucologen or a toxic enzyme.
  • a biotoxin such as ricin subunit A, abrin, diptheria toxin, botulinum, cyanginosins, saxitoxin, shigatoxin, tetanus, tetrodotoxin, trichothecene, verrucologen or a toxic enzyme.
  • a biotoxin such as ricin subunit A, abrin, diptheria toxin, botulinum,
  • binding molecules e.g., binding polypeptides, e.g., IGF-IR- specific antibodies or immunospecific fragments thereof disclosed herein comprise cytokines such as Iymphokines and interferons.
  • cytokines such as Iymphokines and interferons.
  • Another class of compatible cytotoxins that may be used in association with or conjugated to the disclosed binding molecules, e.g., binding polypeptides, e.g., IGF-IR- specific antibodies or immunospecific fragments thereof, are radiosensitizing drugs that may be effectively directed to tumor or immunoreactive cells. Such drugs enhance the sensitivity to ionizing radiation, thereby increasing the efficacy of radiotherapy.
  • An antibody conjugate internalized by the tumor cell would deliver the radiosensitizer nearer the nucleus where radiosensitization would be maximal.
  • the unbound radiosensitizer linked binding molecules of the invention would be cleared quickly from the blood, localizing the remaining radiosensitization agent in the target tumor and providing minimal uptake in normal tissues.
  • adjunct radiotherapy would be administered in one of three ways: 1.) external beam radiation directed specifically to the tumor, 2.) radioactivity directly implanted in the tumor or 3.) systemic radioimmunotherapy with the same targeting antibody.
  • a potentially attractive variation of this approach would be the attachment of a therapeutic radioisotope to the radiosensitized immunoconjugate, thereby providing the convenience of administering to the patient a single drug.
  • a moiety that enhances the stability or efficacy of a binding molecule e.g., a binding polypeptide, e.g., a IGF- lR-speci fie antibody or immunospecific fragment thereof can be conjugated.
  • a binding polypeptide e.g., a IGF- lR-speci fie antibody or immunospecific fragment thereof.
  • PEG can be conjugated to the binding molecules of the invention to increase their half- life in vivo.
  • the present invention further encompasses the use of binding molecules, e.g., binding polypeptides, e.g., IGF-lR-specific antibodies or immunospecific fragments conjugated to a diagnostic or therapeutic agent.
  • the binding molecules can be used diagnostically to, for example, monitor the development or progression of a tumor as part of a clinical testing procedure to, e.g., determine the efficacy of a given treatment and/or prevention regimen. Detection can be facilitated by coupling the binding molecule, e.g., binding polypeptide, e.g., IGF-lR-specific antibody or immunospecific fragment thereof to a detectable substance.
  • detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, radioactive materials, positron emitting metals using various positron emission tomographies, and nonradioactive paramagnetic metal ions. See, for example, U.S. Pat. No. 4,741,900 for metal ions which can be conjugated to antibodies for use as diagnostics according to the present invention.
  • suitable enzymes include horseradish peroxidase, alkaline phosphatase, ⁇ -galactosidase, or acetylcholinesterase;
  • suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin;
  • suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin;
  • an example of a luminescent material includes luminol;
  • examples of bioluminescent materials include luciferase, luciferin, and aequorin;
  • suitable radioactive material include 125 I, 131 I, 111 In or 99 Tc.
  • a binding molecule e.g., a binding polypeptide, e.g., a IGF-lR-specific antibody or immunospecific fragment thereof also can be detectably labeled by coupling it to a chemiluminescent compound.
  • the presence of the chemiluminescent-tagged binding molecule is then determined by detecting the presence of luminescence that arises during the course of a chemical reaction.
  • particularly useful chemiluminescent labeling compounds are luminol, isoluminol, theromatic acridinium ester, imidazole, acridinium salt and oxalate ester.
  • binding molecule e.g., a binding polypeptide, e.g., a binding polypeptide
  • IGF-lR-specific antibody or immunospecific fragment thereof can be detectably labeled is by linking the same to an enzyme and using the linked product in an enzyme immunoassay (EIA) (Voller, A., "The Enzyme Linked Immunosorbent Assay (ELISA)"
  • EIA enzyme immunoassay
  • the enzyme which is bound to the binding molecule will react with an appropriate substrate, preferably a chromogenic substrate, in such a manner as to produce a chemical moiety which can be detected, for example, by spectrophotometric, fluorimetric or by visual means.
  • Enzymes which can be used to detectably label the antibody include, but are not limited to, malate dehydrogenase, staphylococcal nuclease, delta-5-steroid isomerase, yeast alcohol dehydrogenase, alpha-glycerophosphate, dehydrogenase, triose phosphate isomerase, horseradish peroxidase, alkaline phosphatase, asparaginase, glucose oxidase, beta-galactosidase, ribonuclease, urease, catalase, glucose- 6-phosphate dehydrogenase, glucoamylase and acetylcholinesterase. Additionally, the detection can be accomplished by colorimetric methods which employ a chromogenic substrate for the enzyme. Detection may also be accomplished by visual comparison of the extent of enzymatic reaction of a substrate in comparison with similarly prepared standards.
  • Detection may also be accomplished using any of a variety of other immunoassays.
  • the binding molecule e.g., binding polypeptide, e.g., IGF-lR-specific antibody or immunospecific fragment thereof
  • a radioimmunoassay RIA
  • the radioactive isotope can be detected by means including, but not limited to, a gamma counter, a scintillation counter, or autoradiography.
  • a binding molecule e.g., a binding polypeptide, e.g., a IGF-lR-specific antibody or immunospecific fragment thereof can also be detectably labeled using fluorescence emitting metals such as 152Eu, or others of the lanthanide series. These metals can be attached to the antibody using such metal chelating groups as diethylenetriaminepentacetic acid (DTPA) or ethylenediaminetetraacetic acid (EDTA).
  • DTPA diethylenetriaminepentacetic acid
  • EDTA ethylenediaminetetraacetic acid
  • a binding molecule e.g., a binding polypeptide, e.g., a IGF-lR-specific antibody or immunospecific fragment thereof are well known, see, e.g., Arnon et al., "Monoclonal Antibodies For Immunotargeting Of
  • RNA may be isolated from the original hybridoma cells or from other transformed cells by standard techniques, such as guanidinium isothiocyanate extraction and precipitation followed by centrifugation or chromatography. Where desirable, mRNA may be isolated from total RNA by standard techniques such as chromatography on oligo dT cellulose. Suitable techniques are familiar in the art.
  • cDNAs that encode the light and the heavy chains of the antibody may be made, either simultaneously or separately, using reverse transcriptase and DNA polymerase in accordance with well known methods.
  • PCR may be initiated by consensus constant region primers or by more specific primers based on the published heavy and light chain DNA and amino acid sequences.
  • PCR also may be used to isolate DNA clones encoding the antibody light and heavy chains. In this case the libraries may be screened by consensus primers or larger homologous probes, such as mouse constant region probes.
  • DNA typically plasmid DNA
  • DNA may be isolated from the cells using techniques known in the art, restriction mapped and sequenced in accordance with standard, well known techniques set forth in detail, e.g., in the foregoing references relating to recombinant DNA techniques.
  • the DNA may be synthetic according to the present invention at any point during the isolation process or subsequent analysis.
  • the polynucleotides encoding the IGF-IR antibodies are typically inserted in an expression vector for introduction into host cells that may be used to produce the desired quantity of IGF-IR antibody.
  • Recombinant expression of an antibody, or fragment, derivative or analog thereof, e.g., a heavy or light chain of an antibody which binds to a target molecule described herein, e.g., IGF-IR requires construction of an expression vector containing a polynucleotide that encodes the antibody.
  • the vector for the production of the antibody molecule may be produced by recombinant DNA technology using techniques well known in the art.
  • methods for preparing a protein by expressing a polynucleotide containing an antibody encoding nucleotide sequence are described herein. Methods which are well known to those skilled in the art can be used to construct expression vectors containing antibody coding sequences and appropriate transcriptional and translational control signals. These methods include, for example, in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination.
  • the invention thus, provides replicable vectors comprising a nucleotide sequence encoding an antibody molecule of the invention, or a heavy or light chain thereof, or a heavy or light chain variable domain, operably linked to a promoter.
  • Such vectors may include the nucleotide sequence encoding the constant region of the antibody molecule (see, e.g., PCT Publication WO 86/05807; PCT Publication WO 89/01036; and U.S. Pat. No. 5,122,464) and the variable domain of the antibody may be cloned into such a vector for expression of the entire heavy or light chain.
  • the host cell may be co-transfected with two expression vectors of the invention, the first vector encoding a heavy chain derived polypeptide and the second vector encoding a light chain derived polypeptide.
  • the two vectors may contain identical selectable markers which enable equal expression of heavy and light chain polypeptides.
  • a single vector may be used which encodes both heavy and light chain polypeptides.
  • the light chain is advantageously placed before the heavy chain to avoid an excess of toxic free heavy chain (Proudfoot, Nature 322:52 (1986); Kohler, Proc. Natl. Acad. ScL USA 77:2197 (1980)).
  • the coding sequences for the heavy and light chains may comprise cDNA or genomic DNA.
  • vectors used in accordance with the present invention as a vehicle for introducing into and expressing a desired gene in a host cell.
  • vectors may easily be selected from the group consisting of plasmids, phages, viruses and retroviruses.
  • vectors compatible with the instant invention will comprise a selection marker, appropriate restriction sites to facilitate cloning of the desired gene and the ability to enter and/or replicate in eukaryotic or prokaryotic cells.
  • vector systems may be employed.
  • one class of vector utilizes DNA elements which are derived from animal viruses such as bovine papilloma virus, polyoma virus, adenovirus, vaccinia virus, baculovirus, retroviruses (RSV, MMTV or MOMLV) or SV40 virus.
  • Others involve the use of polycistronic systems with internal ribosome binding sites.
  • cells which have integrated the DNA into their chromosomes may be selected by introducing one or more markers which allow selection of transfected host cells. The marker may provide for prototrophy to an auxotrophic host, biocide resistance (e.g., antibiotics) or resistance to heavy metals such as copper.
  • the selectable marker gene can either be directly linked to the DNA sequences to be expressed, or introduced into the same cell by cotransformation. Additional elements may also be needed for optimal synthesis of mRNA. These elements may include signal sequences, splice signals, as well as transcriptional promoters, enhancers, and termination signals.
  • the cloned variable region genes are inserted into an expression vector along with the heavy and light chain constant region genes (preferably human) synthetic as discussed above.
  • this is effected using a proprietary expression vector of Biogen IDEC, Inc., referred to as NEOSPLA (disclosed in U.S. patent 6,159,730).
  • NEOSPLA a proprietary expression vector of Biogen IDEC, Inc.
  • This vector contains the cytomegalovirus promoter/enhancer, the mouse beta globin major promoter, the SV40 origin of replication, the bovine growth hormone polyadenylation sequence, neomycin phosphotransferase exon 1 and exon 2, the dihydrofolate reductase gene and leader sequence.
  • This vector has been found to result in very high level expression of antibodies upon incorporation of variable and constant region genes, transfection in CHO cells, followed by selection in G418 containing medium and methotrexate amplification.
  • any expression vector which is capable of eliciting expression in eukaryotic cells may be used in the present invention.
  • Suitable vectors include, but are not limited to plasmids pcDNA3, pHCMV/Zeo, pCR3.1, pEFl/His, pIND/GS, pRc/HCMV2, pSV40/Zeo2, pTRACER-HCMV, pUB6/V5-His, pVAXl, and pZeoSV2 (available from Invitrogen, San Diego, CA), and plasmid pCI (available from Promega, Madison, WI).
  • screening large numbers of transformed cells for those which express suitably high levels if immunoglobulin heavy and light chains is routine experimentation which can be carried out, for example, by robotic systems. Vector systems are also taught in U.S. Pat. Nos.
  • the IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention may be expressed using polycistronic constructs such as those disclosed in United States Patent Application Publication No. 2003-0157641 Al, filed November 18, 2002 and incorporated herein in its entirety.
  • polycistronic constructs such as those disclosed in United States Patent Application Publication No. 2003-0157641 Al, filed November 18, 2002 and incorporated herein in its entirety.
  • multiple gene products of interest such as heavy and light chains of antibodies may be produced from a single polycistronic construct.
  • These systems advantageously use an internal ribosome entry site (IRES) to provide relatively high levels of IGF-IR antibodies, e.g., binding polypeptides, e.g., IGF- lR-specific antibodies or immunospecific fragments thereof in eukaryotic host cells.
  • IRES sequences are disclosed in U.S. Pat. No. 6,193,980 which is also incorporated herein. Those skilled in the art will appreciate that such
  • the expression vector may be introduced into an appropriate host cell.
  • Introduction of the plasmid into the host cell can be accomplished by various techniques well known to those of skill in the art. These include, but are not limited to, transfection (including electrophoresis and electroporation), protoplast fusion, calcium phosphate precipitation, cell fusion with enveloped DNA, microinjection, and infection with intact virus. See, Ridgway, A. A. G. "Mammalian Expression Vectors" Vectors, Rodriguez and Denhardt, Eds., Butterworths, Boston, Mass., Chapter 24.2, pp. 470-472 (1988).
  • plasmid introduction into the host is via electroporation.
  • the host cells harboring the expression construct are grown under conditions appropriate to the production of the light chains and heavy chains, and assayed for heavy and/or light chain protein synthesis.
  • Exemplary assay techniques include enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), or fluorescence-activated cell sorter analysis (FACS), immunohistochemistry and the like.
  • the expression vector is transferred to a host cell by conventional techniques and the transfected cells are then cultured by conventional techniques to produce an antibody for use in the methods described herein.
  • the invention includes host cells containing a polynucleotide encoding an antibody of the invention, or a heavy or light chain thereof, operably linked to a heterologous promoter.
  • vectors encoding both the heavy and light chains may be co-expressed in the host cell for expression of the entire immunoglobulin molecule, as detailed below.
  • host cells refers to cells which harbor vectors constructed using recombinant DNA techniques and encoding at least one heterologous gene.
  • the terms “cell” and “cell culture” are used interchangeably to denote the source of antibody unless it is clearly specified otherwise.
  • recovery of polypeptide from the “cells” may mean either from spun down whole cells, or from the cell culture containing both the medium and the suspended cells.
  • host-expression vector systems may be utilized to express antibody molecules for use in the methods described herein.
  • Such host-expression systems represent vehicles by which the coding sequences of interest may be produced and subsequently purified, but also represent cells which may, when transformed or transfected with the appropriate nucleotide coding sequences, express an antibody molecule of the invention in situ.
  • These include but are not limited to microorganisms such as bacteria ⁇ e.g., E. coli, B.
  • subtilis transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing antibody coding sequences; yeast (e.g., Saccharomyces, Pichi ⁇ ) transformed with recombinant yeast expression vectors containing antibody coding sequences; insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus) containing antibody coding sequences; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing antibody coding sequences; or mammalian cell systems (e.g., COS, CHO, BLK, 293, 3T3 cells) harboring recombinant expression constructs containing promoters derived from the genome of mammalian cells (e.g., metallothionein promoter) or from mamm
  • bacterial cells such as Escherichia coli, and more preferably, eukaryotic cells, especially for the expression of whole recombinant antibody molecule, are used for the expression of a recombinant antibody molecule.
  • mammalian cells such as Chinese hamster ovary cells (CHO), in conjunction with a vector such as the major intermediate early gene promoter element from human cytomegalovirus is an effective expression system for antibodies (Foecking et al., Gene 4.5:101 (1986); Cockett et ah, Bio/Technology 8:2 (1990)).
  • the host cell line used for protein expression is often of mammalian origin; those skilled in the art are credited with ability to preferentially determine particular host cell lines which are best suited for the desired gene product to be expressed therein.
  • Exemplary host cell lines include, but are not limited to, CHO (Chinese Hamster Ovary), DG44 and DUXBI l (Chinese Hamster Ovary lines, DHFR minus), HELA (human cervical carcinoma), CVI (monkey kidney line), COS (a derivative of CVI with SV40 T antigen), VERY, BHK (baby hamster kidney), MDCK, 293, WD8, R1610 (Chinese hamster fibroblast) BALBC/3T3 (mouse fibroblast), HAK (hamster kidney line), SP2/O (mouse myeloma), P3x63-Ag3.653 (mouse myeloma), BFA- IcI BPT (bovine endothelial cells), RAJI (human lymph
  • a host cell strain may be chosen which modulates the expression of the inserted sequences, or modifies and processes the gene product in the specific fashion desired. Such modifications (e.g., glycosylation) and processing (e.g., cleavage) of protein products may be important for the function of the protein.
  • Different host cells have characteristic and specific mechanisms for the post-translational processing and modification of proteins and gene products. Appropriate cell lines or host systems can be chosen to ensure the correct modification and processing of the foreign protein expressed.
  • eukaryotic host cells which possess the cellular machinery for proper processing of the primary transcript, glycosylation, and phosphorylation of the gene product may be used.
  • cell lines which stably express the antibody molecule may be engineered.
  • host cells can be transformed with DNA controlled by appropriate expression control elements (e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.), and a selectable marker.
  • appropriate expression control elements e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.
  • engineered cells may be allowed to grow for 1-2 days in an enriched media, and then are switched to a selective media.
  • the selectable marker in the recombinant plasmid confers resistance to the selection and allows cells to stably integrate the plasmid into their chromosomes and grow to form foci which in turn can be cloned and expanded into cell lines.
  • This method may advantageously be used to engineer cell lines which stably express the antibody molecule.
  • a number of selection systems may be used, including but not limited to the herpes simplex virus thymidine kinase (Wigler et al., Cell 11:223 (1977)), hypoxanthine- guanine phosphoribosyltransferase (Szybalska & Szybalski, Proc. Natl. Acad. ScL USA 48:202 (1992)), and adenine phosphoribosyltransferase (Lowy et al., Cell 22:817 1980) genes can be employed in tk-, hgprt- or aprt-cells, respectively.
  • anti-metabolite resistance can be used as the basis of selection for the following genes: dhfr, which confers resistance to methotrexate (Wigler et al., Natl. Acad. ScL USA 77:357 (1980); O ⁇ are et al, Proc. Natl. Acad. ScL USA 78:1527 (1981)); gpt, which confers resistance to mycophenolic acid (Mulligan & Berg, Proc. Natl. Acad.
  • the expression levels of an antibody molecule can be increased by vector amplification (for a review, see Bebbington and Hentschel, The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning, Academic Press, New York, Vol. 3. (1987)).
  • vector amplification for a review, see Bebbington and Hentschel, The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning, Academic Press, New York, Vol. 3. (1987)).
  • a marker in the vector system expressing antibody is amplifiable
  • increase in the level of inhibitor present in culture of host cell will increase the number of copies of the marker gene. Since the amplified region is associated with the antibody gene, production of the antibody will also increase (Crouse et al., MoI. Cell. Biol. 3:257 (1983)).
  • the solutions of polypeptides can be purified by the customary chromatography methods, for example gel filtration, ion-exchange chromatography, chromatography over DEAE-cellulose or (immuno-)affinity chromatography, e.g., after preferential biosynthesis of a synthetic hinge region polypeptide or prior to or subsequent to the HIC chromatography step described herein.
  • customary chromatography methods for example gel filtration, ion-exchange chromatography, chromatography over DEAE-cellulose or (immuno-)affinity chromatography, e.g., after preferential biosynthesis of a synthetic hinge region polypeptide or prior to or subsequent to the HIC chromatography step described herein.
  • IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention can also be expressed non-mammalian cells such as bacteria or insect or yeast or plant cells.
  • Bacteria which readily take up nucleic acids include members of the enterobacteriaceae, such as strains of Escherichia coli or Salmonella; Bacillaceae, such as Bacillus subtilis; Pneumococcus; Streptococcus, and Haemophilus influenzae. It will further be appreciated that, when expressed in bacteria, the heterologous polypeptides typically become part of inclusion bodies. The heterologous polypeptides must be isolated, purified and then assembled into functional molecules. Where terravalent forms of antibodies are desired, the subunits will then self- assemble into terravalent antibodies (WO02/096948A2).
  • a number of expression vectors may be advantageously selected depending upon the use intended for the antibody molecule being expressed.
  • vectors which direct the expression of high levels of fusion protein products that are readily purified may be desirable.
  • Such vectors include, but are not limited, to the E. coli expression vector pUR278 (Ruther et all, EMBO J. 2:1791 (1983)), in which the antibody coding sequence may be ligated individually into the vector in frame with the lacZ coding region so that a fusion protein is produced; pIN vectors (Inouye & Inouye, Nucleic Acids Res.
  • pGEX vectors may also be used to express foreign polypeptides as fusion proteins with glutathione S-transferase (GST).
  • GST glutathione S-transferase
  • fusion proteins are soluble and can easily be purified from lysed cells by adsorption and binding to a matrix glutathione- agarose beads followed by elution in the presence of free glutathione.
  • the pGEX vectors are designed to include thrombin or factor Xa protease cleavage sites so that the cloned target gene product can be released from the GST moiety.
  • eukaryotic microbes may also be used. Saccharomyces cerevisiae, or common baker's yeast, is the most commonly used among eukaryotic microorganisms although a number of other strains are commonly available, e.g., Pichia pastoris.
  • the plasmid YRp7 for example, (Stinchcomb et al., Nature 282:39 (1979); Kingsman et al., Gene 7:141 (1979); Tschemper et ah, Gene 70:157 (1980)) is commonly used.
  • This plasmid already contains the TRPl gene which provides a selection marker for a mutant strain of yeast lacking the ability to grow in tryptophan, for example ATCC No. 44076 or PEP4-1 (Jones, Genetics 85:12 (1977)).
  • the presence of the trpl lesion as a characteristic of the yeast host cell genome then provides an effective environment for detecting transformation by growth in the absence of tryptophan.
  • Autographa californica nuclear polyhedrosis virus (AcNPV) is typically used as a vector to express foreign genes.
  • the virus grows in Spodoptera frugiperda cells.
  • the antibody coding sequence may be cloned individually into nonessential regions (for example the polyhedrin gene) of the virus and placed under control of an AcNPV promoter (for example the polyhedrin promoter).
  • an antibody molecule of the invention may be purified by any method known in the art for purification of an immunoglobulin molecule, for example, by chromatography (e.g., ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
  • chromatography e.g., ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and sizing column chromatography
  • centrifugation e.g., ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and sizing column chromatography
  • differential solubility e.g., differential solubility
  • One embodiment of the present invention provides methods for treating a hyperproliferative disease or disorder, e.g., cancer, a malignancy, a tumor, or a metastasis thereof, in an animal suffering from such disease or predisposed to contract such disease, the method comprising, consisting essentially of, or consisting of administering to the animal an effective amount of an antibody or immunospecific fragment thereof, that binds to IGF-IR or a variant of IGF-IR.
  • Suitable antibodies include all antibodies and antigen- specific fragments thereof described herein.
  • Examples include, but are not limited to, an isolated antibody or antigen-binding fragment thereof which specifically binds to the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8, an isolated antibody or antigen-binding fragment thereof which specifically binds to IGF-Rl, where the antibody or fragment thereof competitively inhibits a reference monoclonal Fab antibody fragment selected from the group consisting of Ml 3- C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclo
  • an antibody of the present invention which specifically binds to IGF-IR or a variant thereof inhibits one or more insulin growth factors, e.g., IGF-I, IGF-2 or both IGF-I and IGF-I from binding to IGF-IR.
  • an antibody of the present invention which specifically binds to IGF-IR or a variant thereof inhibits phosphorylation of IGF-IR upon binding of one or more insulin growth factors.
  • an antibody of the present invention which specifically binds to IGF-IR or a variant thereof expressed on a cell, in particular, a tumor cell inhibits phosphorylation of downstream signal transduction molecules involved in cell proliferation, motility and/or metastasis.
  • Such molecules include, but are not limited to Akt and p42/44 MAPK.
  • an antibody of the present invention which specifically binds to IGF-IR or a variant thereof expressed on a cell promotes internalization of surface-expressed IGF-IR, limiting its availability to interact with IGF.
  • an antibody of the present invention which specifically binds to IGF-IR or a variant thereof expressed on a cell in particular, a tumor cell, inhibits cell proliferation, motility, and/or metastasis.
  • An antibody of the present invention which specifically binds to IGF-IR or a variant thereof, to be used in treatment methods disclosed herein can be prepared and used as a therapeutic agent that stops, reduces, prevents, or inhibits cellular activities involved in cellular hyperproliferation, e.g., cellular activities that induce the altered or abnormal pattern of vascularization that is often associated with hyperproliferative diseases or disorders.
  • Antibodies or immunospecif ⁇ c fragments thereof of the present invention include, but are not limited to monoclonal, chimeric or humanized antibodies, and fragments of antibodies that bind specifically to tumor-associated proteins such as IGF-IR.
  • the antibodies may be monovalent, bivalent, polyvalent, or bifunctional antibodies, and the antibody fragments include Fab F(ab')2, and Fv.
  • Therapeutic antibodies according to the invention can be used in unlabeled or unconjugated form, or can be coupled or linked to cytotoxic moieties such as radiolabels and biochemical cytotoxins to produce agents that exert therapeutic effects.
  • an antibody, or immunospecific fragment thereof of the invention includes an antigen binding domain.
  • An antigen binding domain is formed by antibody variable regions that vary from one antibody to another. Naturally occurring antibodies comprise at least two antigen binding domains, i.e., they are at least bivalent.
  • the term "antigen binding domain” includes a site that specifically binds an epitope on an antigen (e.g., a cell surface or soluble antigen).
  • the antigen binding domain of an antibody typically includes at least a portion of an immunoglobulin heavy chain variable region and at least a portion of an immunoglobulin light chain variable region. The binding site formed by these variable regions determines the specificity of the antibody.
  • the present invention provides methods for treating various hyperproliferative disorders, e.g., by inhibiting tumor growth, in a mammal, comprising, consisting essentially of, or consisting of administering to the mammal an effective amount of a antibody or antigen-binding fragment thereof which specifically or preferentially binds to IGF-Rl, e.g., human IGF-Rl.
  • the present invention is more specifically directed to a method of treating a hyperproliferative disease, e.g., inhibiting or preventing tumor formation, tumor growth, tumor invasiveness, and/or metastasis formation, in an animal, e.g., a mammal, e.g., a human, comprising, consisting essentially of, or consisting of administering to an animal in need thereof an effective amount of a an antibody or immunospecific fragment thereof, which specifically or preferentially binds to one or more epitopes of IGF-IR.
  • a hyperproliferative disease e.g., inhibiting or preventing tumor formation, tumor growth, tumor invasiveness, and/or metastasis formation
  • an animal e.g., a mammal, e.g., a human
  • an effective amount of a an antibody or immunospecific fragment thereof which specifically or preferentially binds to one or more epitopes of IGF-IR.
  • the present invention includes a method for treating a hyperproliferative disease, e.g., inhibiting tumor formation, tumor growth, tumor invasiveness, and/or metastasis formation in an animal, e.g., a human patient, where the method comprises administering to an animal in need of such treatment an effective • amount of a composition comprising, consisting essentially of, or consisting of, in addition to a pharmaceutically acceptable carrier, an antibody, or immunospecific fragment thereof, which specifically binds to at least one epitope of IGF-IR, where the epitope comprises, consists essentially of, or consists of at least about four to five amino acids amino acids of SEQ ID NO:2, at least seven, at least nine, or between at least about 15 to about 30 amino acids of SEQ ID NO:2.
  • the amino acids of a given epitope of SEQ ID NO:2 as described may be, but need not be contiguous.
  • the at least one epitope of IGF-IR comprises, consists essentially of, or consists of a non-linear epitope formed by the extracellular domain of IGF-IR as expressed on the surface of a cell.
  • the at least one epitope of IGF-IR comprises, consists essentially of, or consists of at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20, at least 25, between about 15 to about 30, or at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 contiguous or noncontiguous amino acids of SEQ ID NO:2, where non-contiguous amino acids form an epitope through protein folding.
  • the present invention includes a method for treating a hyperproliferative disease, e.g., inhibiting tumor formation, tumor growth, tumor invasiveness, and/or metastasis formation in an animal, e.g., a human patient, where the method comprises administering to an animal in need of such treatment an effective amount of a composition comprising, consisting essentially of, or consisting of, in addition to a pharmaceutically acceptable carrier, an antibody, or immunospecific fragment thereof, which specifically binds to at least one epitope of IGF-IR, where the epitope comprises, consists essentially of, or consists of, in addition to one, two, three, four, five, six or more contiguous or non-contiguous amino acids of SEQ ED NO:2 as described above, and an additional moiety which modifies the protein, e.g., a carbohydrate moiety may be included such that the binding molecule binds with higher affinity to modified target protein than it does to an unmodified version of the protein.
  • a composition comprising, consist
  • the present invention provides a method of treating cancer in a human, comprising administering to a human in need of treatment a composition comprising an effective amount of an IGF-lR-specific antibody or immunospecific fragment thereof, and a pharmaceutically acceptable carrier.
  • Types of cancer to be treated include, but are not limited to, stomach cancer, renal cancer, brain cancer, bladder cancer, colon cancer, lung cancer, breast cancer, pancreatic cancer, ovarian cancer, and prostate cancer.
  • an antibody or fragment thereof binds specifically to at least one epitope of IGF-IR or fragment or variant described above, i.e., binds to such an epitope more readily than it would bind to an unrelated, or random epitope; binds preferentially to at least one epitope of IGF-IR or fragment or variant described above, i.e., binds to such an epitope more readily than it would bind to a related, similar, homologous, or analogous epitope; competitively inhibits binding of a reference antibody which itself binds specifically or preferentially to a certain epitope of IGF-IR or fragment or variant described above; or binds to at least one epitope of IGF-IR or fragment or variant described above with an affinity characterized by a dissociation constant K D of less than about 5 x 10 '2 M, about 10 "2 M, about 5 x 10 '3 M, about 10 "3 M, about 5 X lO -4 M
  • antibodies and fragments thereof of the present invention cross-react with IGF-IR proteins of other species from which they were raised, e.g., an antibody or fragment thereof which specifically binds to human IGF-IR also binds to primate IGF-IR and/or murine IGF-IR.
  • Other suitable antibodies or fragments thereof of the present invention include those that are highly species specific.
  • antibodies or immunospecific fragments thereof disclosed herein bind IGF-IR polypeptides or fragments or variants thereof with an off rate (k(off)) of less than or equal to 5 X 10 '2 sec '1 , 10 "2 sec “1 , 5 X 10 ⁇ 3 sec “1 or 10 '3 sec “1 .
  • IGF-IR polypeptides or fragments or variants thereof bind IGF-IR polypeptides or fragments or variants thereof with an off rate (k(off)) of less than or equal to 5 X 10 ⁇ sec 1 , 10 "4 sec 1 , 5 X 10 "5 sec 1 , or 10 '5 sec “1 5 X 1(T 6 sec “1 , 10 “6 sec “1 , 5 X 10 "7 sec “1 or 10 "7 sec “1 .
  • antibodies or immunospecific fragments thereof disclosed herein bind IGF-IR polypeptides or fragments or variants thereof with an on rate (k(on)) of greater than or equal to 10 3 M "1 sec “1 , 5 X 10 3 M “1 sec “1 , 10 4 M “1 sec “1 or 5 X 10 4 M “1 sec '1 .
  • IGF-IR polypeptides or fragments or variants thereof bind IGF-IR polypeptides or fragments or variants thereof with an on rate (k(on)) greater than or equal to 10 5 M "1 sec *1 , 5 X 10 5 M “1 sec “1 , 10 6 M “1 sec “1 , or 5 X 10 6 M “1 sec '1 or 10 7 M 1 sec "1 .
  • one or more binding molecules as described above is an antagonist of IGF-IR activity, for example, binding of an antagonist IGF-IR antibody to IGF-IR as expressed on a tumor cell inhibits binding of insulin growth factor, e.g., IGF-I, IGF-2, or both IGF-I and IGF-2 to IGF-IR, promotes internalization of IGF-IR thereby inhibiting its signal transduction capability, inhibits phosphorylation of IGF-IR, inhibits phosphorylation of molecules downstream in the signal transduction pathway, e.g., Akt or p42/44 MAPK, or inhibits tumor cell proliferation, motility or metastasis.
  • insulin growth factor e.g., IGF-I, IGF-2, or both IGF-I and IGF-2
  • IGF-IR insulin growth factor
  • IGF-lR-specific antibodies, or fragments, derivatives, or analogs thereof, can be used for diagnostic purposes to detect, diagnose, or monitor diseases, disorders, and/or conditions associated with the aberrant expression and/or activity of IGF-IR.
  • IGF-IR expression is increased in tumor tissue and other neoplastic conditions.
  • IGF-lR-specific antibodies or fragments thereof are useful for diagnosis, treatment, prevention and/or prognosis of hyperproliferative disorders in mammals, preferably humans.
  • disorders include, but are not limited to, cancer, neoplasms, tumors and/or as described under elsewhere herein, especially IGF-lR-associated cancers such as stomach cancer, renal cancer, brain cancer, bladder cancer, colon cancer, lung cancer, breast cancer, pancreatic cancer, ovarian cancer, and prostate cancer.
  • IGF-IR expression is associated with at least stomach, renal, brain, bladder, colon, lung, breast, pancreatic, ovarian, and prostate tumor tissues.
  • antibodies (and antibody fragments) directed against IGF-IR may be used to detect particular tissues expressing increased levels of IGF-IR.
  • These diagnostic assays may be performed in vivo or in vitro, such as, for example, on blood samples, biopsy tissue or autopsy tissue.
  • the invention provides a diagnostic method useful during diagnosis of a cancers and other hyperproliferative disorders, which involves measuring the expression level of IGF-IR protein or transcript in tissue or other cells or body fluid from an individual and comparing the measured expression level with a standard IGF-IR expression levels in normal tissue or body fluid, whereby an increase in the expression level compared to the standard is indicative of a disorder.
  • One embodiment provides a method of detecting the presence of abnormal hyperproliferative cells, e.g., precancerous or cancerous cells, in a fluid or tissue sample, comprising assaying for the expression of IGF-IR in tissue or body fluid samples of an individual and comparing the presence or level of IGF-IR expression in the sample with the presence or level of IGF-IR expression in a panel of standard tissue or body fluid samples, where detection of IGF-IR expression or an increase in IGF-IR expression over the standards is indicative of aberrant hyperproliferative cell growth.
  • abnormal hyperproliferative cells e.g., precancerous or cancerous cells
  • the present invention provides a method of detecting the presence of abnormal hyperproliferative cells in a body fluid or tissue sample, comprising (a) assaying for the expression of IGF-IR in tissue or body fluid samples of an individual using IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention, and (b) comparing the presence or level of IGF-IR expression in the sample with a the presence or level of IGF-IR expression in a panel of standard tissue or body fluid samples, whereby detection of IGF-IR expression or an increase in IGF-IR expression over the standards is indicative of aberrant hyperproliferative cell growth.
  • IGF-lR-specific antibodies of the present invention can be used to assay protein levels in a biological sample using classical immunohistological methods known to those of skill in the art (e.g., see Jalkanen, et al., J. Cell.
  • antibody-based methods useful for detecting protein expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA).
  • ELISA enzyme linked immunosorbent assay
  • RIA radioimmunoassay
  • Suitable antibody assay labels include enzyme labels, such as, glucose oxidase; radioisotopes, such as iodine ( 125 I, 121 I), carbon ( 14 C), sulfur ( 35 S), tritium ( 3 H), indium ( 112 In), and technetium ( 99 Tc); luminescent labels, such as luminol; and fluorescent labels, such as fluorescein and rhodamine, and biotin. Suitable assays are described in more detail elsewhere herein.
  • O ne aspect of the invention is a method for the in vivo detection or diagnosis of a hyperproliferative disease or disorder associated with aberrant expression of IGF-IR in ah animal, preferably a mammal and most preferably a human.
  • diagnosis comprises: a) administering (for example, parenterally, subcutaneously, or intraperitoneally) to a subject an effective amount of a labeled antibody or fragment thereof of the present invention, which specifically binds to IGF-IR; b) waiting for a time interval following the administering for permitting the labeled binding molecule to preferentially concentrate at sites in the subject where IGF-IR is expressed (and for unbound labeled molecule to be cleared to background level); c) determining background level; and d) detecting the labeled molecule in the subject, such that detection of labeled molecule above the background level indicates that the subject has a particular disease or disorder associated with aberrant expression of IGF-IR.
  • Background level can be determined by various methods including comparing the amount of labeled molecule detected to a standard value previously determined for a particular system.
  • the size of the subject and the imaging system used will determine the quantity of imaging moiety needed to produce diagnostic images.
  • the quantity of radioactivity injected will normally range from about 5 to 20 millicuries of, e.g., 99 Tc.
  • the labeled binding molecule e.g., antibody or antibody fragment, will then preferentially accumulate at the location of cells which contain the specific protein.
  • In vivo tumor imaging is described in S.W. Burchiel et al., "Immunopharmacokinetics of Radiolabeled Antibodies and Their Fragments.” (Chapter 13 in Tumor Imaging: The Radiochemical Detection of
  • the time interval following the administration for permitting the labeled molecule to preferentially concentrate at sites in the subject and for unbound labeled molecule to be cleared to background level is 6 to 48 hours or 6 to 24 hours or 6 to 12 hours. In another embodiment the time interval following administration is 5 to 20 days or 7 to 10 days.
  • Presence of the labeled molecule can be detected in the patient using methods known in the art for in vivo scanning. These methods depend upon the type of label used. Skilled artisans will be able to determine the appropriate method for detecting a particular label. Methods and devices that may be used in the diagnostic methods of the invention include, but are not limited to, computed tomography (CT), whole body scan such as position emission tomography (PET), magnetic resonance imaging (MRI), and sonography.
  • CT computed tomography
  • PET position emission tomography
  • MRI magnetic resonance imaging
  • sonography sonography
  • the binding molecule is labeled with a radioisotope and is detected in the patient using a radiation responsive surgical instrument (Thurston et al., U.S. Pat. No. 5,441,050).
  • the binding molecule is labeled with a fluorescent compound and is detected in the patient using a fluorescence responsive scanning instrument.
  • the binding molecule is labeled with a positron emitting metal and is detected in the patent using positron emission-tomography.
  • the binding molecule is labeled with a paramagnetic label and is detected in a patient using magnetic resonance imaging (MRI).
  • MRI magnetic resonance imaging
  • Antibody labels or markers for in vivo imaging of IGF-IR expression include those detectable by X-radiography, nuclear magnetic resonance imaging (NMR), MRI, CAT-scans or electron spin resonance imaging (ESR).
  • suitable labels include radioisotopes such as barium or cesium, which emit detectable radiation but are not overtly harmful to the subject.
  • suitable markers for NMR and ESR. include those with a detectable characteristic spin, such as deuterium, which may be incorporated into the antibody by labeling of nutrients for the relevant hybridoma.
  • in vivo imaging is used to detect enhanced levels of IGF-IR expression for diagnosis in humans, it may be preferable to use human antibodies or "humanized" chimeric monoclonal antibodies as described elsewhere herein.
  • monitoring of an already diagnosed disease or disorder is carried out by repeating any one of the methods for diagnosing the disease or disorder, for example, one month after initial diagnosis, six months after initial diagnosis, one year after initial diagnosis, etc.
  • detection methods as disclosed herein are useful as a prognostic indicator, whereby patients continuing to exhibiting enhanced IGF- IR expression will experience a worse clinical outcome relative to patients whose expression level decreases nearer the standard level.
  • saying the expression level of the tumor associated IGF-IR polypeptide is intended qualitatively or quantitatively measuring or estimating the level of IGF-IR polypeptide in a first biological sample either directly (e.g., by determining or estimating absolute protein level) or relatively (e.g., by comparing to the cancer associated polypeptide level in a second biological sample).
  • IGF-IR polypeptide expression level in the first biological sample is measured or estimated and compared to a standard IGF-IR polypeptide level, the standard being taken from a second biological sample obtained from an individual not having the disorder or being determined by averaging levels from a population of individuals not having the disorder.
  • the "standard" IGF-IR polypeptide level is known, it can be used repeatedly as a standard for comparison.
  • biological sample any biological sample obtained from an individual, cell line, tissue culture, or other source of cells potentially expressing IGF-IR.
  • biological samples include body fluids (such as sera, plasma, urine, synovial fluid and spinal fluid), and other tissue sources which contain cells potentially expressing IGF-IR. Methods for obtaining tissue biopsies and body fluids from mammals are well known in the art.
  • antibodies, or immunospecific fragments of antibodies directed to a conformational epitope of IGF-IR may be used to quantitatively or qualitatively detect the presence of IGF-IR gene products or conserved variants or peptide fragments thereof. This can be accomplished, for example, by immunofluoresence techniques employing a fluorescently labeled antibody coupled with light microscopic, flow cytometric, or fluorimetric detection.
  • Cancers that may be diagnosed, and/or prognosed using the methods described above include but are not limited to, stomach cancer, renal cancer, brain cancer, bladder cancer, colon cancer, lung cancer, breast cancer, pancreatic cancer, ovarian cancer, and prostate cancer.
  • stomach cancer renal cancer
  • brain cancer bladder cancer
  • colon cancer lung cancer
  • breast cancer pancreatic cancer
  • ovarian cancer and prostate cancer.
  • IGF-lR-specific antibodies or immunospecific fragments thereof disclosed herein may be assayed for immunospecific binding by any method known in the art.
  • the immunoassays which can be used include but are not limited to competitive and noncompetitive assay systems using techniques such as western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay), "sandwich” immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays. complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, protein A immunoassays, to name but a few.
  • Immunoprecipitation protocols generally comprise lysing a population of cells in a lysis buffer such as RIPA buffer (1% NP-40 or Triton X-100, 1% sodium deoxycholate, 0.1% SDS, 0.15 M NaCl, 0.01 M sodium phosphate at pH 7.2, 1% Trasylol) supplemented with protein phosphatase and/or protease inhibitors (e.g., EDTA, PMSF, aprotinin, sodium vanadate), adding the antibody of interest to the cell lysate, incubating for a period of time (e.g., 1-4 hours) at 4.degree.
  • a lysis buffer such as RIPA buffer (1% NP-40 or Triton X-100, 1% sodium deoxycholate, 0.1% SDS, 0.15 M NaCl, 0.01 M sodium phosphate at pH 7.2, 1% Trasylol
  • protein phosphatase and/or protease inhibitors e.g.,
  • Western blot analysis generally comprises preparing protein samples, electrophoresis of the protein samples in a polyacrylamide gel (e.g., 8%-20% SDS-PAGE depending on the molecular weight of the antigen), transferring the protein sample from the polyacrylamide gel to a membrane such as nitrocellulose, PVDF or nylon, blocking the membrane in blocking solution (e.g., PBS with 3% BSA or non-fat milk), washing the membrane in washing buffer (e.g., PBS-Tween 20), blocking the membrane with primary antibody (the antibody of interest) diluted in blocking buffer, washing the membrane in washing buffer, blocking the membrane with a secondary antibody (which recognizes the primary antibody, e.g., an anti-human antibody) conjugated to an enzymatic substrate (e.g., horseradish peroxidase or alkaline phosphatase) or radioactive molecule (e.g., 32p or 1251) diluted in blocking buffer, washing the membrane in wash buffer, and detecting the presence of the antigen
  • ELISAs comprise preparing antigen, coating the well of a 96 well microtiter plate with the antigen, adding the antibody of interest conjugated to a detectable compound such as an enzymatic substrate (e.g., horseradish peroxidase or alkaline phosphatase) to the well and incubating for a period of time, and detecting the presence of the antigen.
  • a detectable compound such as an enzymatic substrate (e.g., horseradish peroxidase or alkaline phosphatase)
  • a detectable compound such as an enzymatic substrate (e.g., horseradish peroxidase or alkaline phosphatase)
  • a second antibody conjugated to a detectable compound may be added following the addition of the antigen of interest to the coated well.
  • ELISAs see, e.g., Ausubel et al., eds, Current Protocols in Molecular Biology, John Wiley & Sons, Inc., New York, Vol. 1 (1994) at 11.2.1.
  • the binding affinity of an antibody to an antigen and the off-rate of an antibody- antigen interaction can be determined by competitive binding assays.
  • a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen (e.g., 3 H or 125 I) with the antibody of interest in the presence of increasing amounts of unlabeled antigen, and the detection of the antibody bound to the labeled antigen.
  • the affinity of the antibody of interest for a particular antigen and the binding off-rates can be determined from the data by Scatchard plot analysis. Competition with a second antibody can also be determined using radioimmunoassays.
  • the antigen is incubated with antibody of interest is conjugated to a labeled compound (e.g., 3 H or 125 I) in the presence of increasing amounts of an unlabeled second antibody.
  • IGF-lR-specific antibodies may, additionally, be employed histologically, as in immunofluorescence, immunoelectron microscopy or non-immunological assays, for in situ detection of cancer antigen gene products or conserved variants or peptide fragments thereof.
  • In situ detection may be accomplished by removing a histological specimen from a patient, and applying thereto a labeled IGF-lR-specif ⁇ c antibody or fragment thereof, preferably applied by overlaying the labeled antibody (or fragment) onto a biological sample.
  • a labeled IGF-lR-specif ⁇ c antibody or fragment thereof preferably applied by overlaying the labeled antibody (or fragment) onto a biological sample.
  • Immunoassays and non-immunoassays for IGF-IR gene products or conserved variants or peptide fragments thereof will typically comprise incubating a sample, such as a biological fluid, a tissue extract, freshly harvested cells, or lysates of cells which have been incubated in cell culture, in the presence of a detectably labeled antibody capable of binding to IGF-IR or conserved variants or peptide fragments thereof, and detecting the bound antibody by any of a number of techniques well-known in the art.
  • the biological sample may be brought in contact with and immobilized onto a solid phase support or carrier such as nitrocellulose, or other solid support which is capable of immobilizing cells, cell particles or soluble proteins.
  • a solid phase support or carrier such as nitrocellulose, or other solid support which is capable of immobilizing cells, cell particles or soluble proteins.
  • the support may then be washed with suitable buffers followed by treatment with the detectably labeled IGF-IR- specific antibody.
  • the solid phase support may then be washed with the buffer a second time to remove unbound antibody.
  • the antibody is subsequently labeled.
  • the amount of bound label on solid support may then be detected by conventional means.
  • solid phase support or carrier any support capable of binding an antigen or an antibody.
  • supports or carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, gabbros, and magnetite.
  • the nature of the carrier can be either soluble to some extent or insoluble for the purposes of the present invention.
  • the support material may have virtually any possible structural configuration so long as the coupled molecule is capable of binding to an antigen or antibody.
  • the support configuration may be spherical, as in a bead, or cylindrical, as in the inside surface of a test tube, or the external surface of a rod.
  • the surface may be flat such as a sheet, test strip, etc.
  • Preferred supports include polystyrene beads. Those skilled in the art will know many other suitable carriers for binding antibody or antigen, or will be able to ascertain the same by use of routine experimentation.
  • the binding activity of a given lot of IGF-lR-specific antibody may be determined according to well known methods. Those skilled in the art will be able to determine operative and optimal assay conditions for each determination by employing routine experimentation.
  • SPR Surface plasmon resonance
  • SPR based binding studies require that one member of a binding pair be immobilized on a sensor surface.
  • the binding partner immobilized is referred to as the ligand.
  • the binding partner in solution is referred to as the analyte.
  • the ligand is attached indirectly to the surface through binding to another immobilized molecule, which is referred as the capturing molecule.
  • SPR response reflects a change in mass concentration at the detector surface as analytes bind or dissociate.
  • the equilibrium phase provides information on the affinity of the analyte- ligand interaction (K D )-
  • BIAevaluation software provides comprehensive facilities for curve fitting using both numerical integration and global fitting algorithms. With suitable analysis of the data, separate rate and affinity constants for interaction can be obtained from simple BIAcore investigations. The range of affinities measurable by this technique is very broad ranging from mM to pM.
  • Epitope specificity is an important characteristic of a monoclonal antibody.
  • Epitope mapping with BIAcore in contrast to conventional techniques using radioimmunoassay, ELISA or other surface adsorption methods, does not require labeling or purified antibodies, and allows multi-site specificity tests using a sequence of several monoclonal antibodies. Additionally, large numbers of analyses can be processed automatically.
  • Pair- wise binding experiments test the ability of two MAbs to bind simultaneously to the same antigen.
  • MAbs directed against separate epitopes will bind independently, whereas MAbs directed against identical or closely related epitopes will interfere with each other's binding.
  • binding experiments with BIAcore are straightforward to carry out.
  • a capture molecule for example, one can use a capture molecule to bind the first Mab, followed by addition of antigen and second MAb sequentially.
  • the sensorgrams will reveal: 1. how much of the antigen binds to first Mab, 2. to what extent the second MAb binds to the surface-attached antigen, 3. if the second MAb does not bind, whether reversing the order of the pair-wise test alters the results.
  • Peptide inhibition is another technique used for epitope mapping. This method can complement pair-wise antibody binding studies, and can relate functional epitopes to structural features when the primary sequence of the antigen is known. Peptides or antigen fragments are tested for inhibition of binding of different MAbs to immobilized antigen. Peptides which interfere with binding of a given MAb are assumed to be structurally related to the epitope defined by that MAb.
  • Methods of preparing and administering IGF-lR-specific antibodies or imrnunospecif ⁇ c fragments thereof to a subject in need thereof are well known to or are readily determined by those skilled in the art.
  • the route of administration of the binding molecule, e.g., binding polypeptide, e.g., IGF-lR-specific antibody or immunospecific fragment thereof may be, for example, oral, parenteral, by inhalation or topical.
  • parenteral as used herein includes, e.g., intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, rectal or vaginal administration.
  • a form for administration would be a solution for injection, in particular for intravenous or intraarterial injection or drip.
  • a suitable pharmaceutical composition for injection may comprise a buffer ⁇ e.g. acetate, phosphate or citrate buffer), a surfactant ⁇ e.g. polysorbate), optionally a stabilizer agent ⁇ e.g. human albumin), etc.
  • binding molecules e.g., binding polypeptides, e.g., IGF-lR-specific antibodies or immunospecific fragments thereof can be delivered directly to the site of the adverse cellular population thereby increasing the exposure of the diseased tissue to the therapeutic agent.
  • Preparations for parenteral administration includes sterile aqueous or non-aqueous solutions, suspensions, and emulsions.
  • non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
  • Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
  • pharmaceutically acceptable carriers include, but are not limited to, 0.01-0. IM and preferably 0.05M phosphate buffer or 0.8% saline.
  • Intravenous vehicles include sodium phosphate solutions, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils.
  • Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers, such as those based on Ringer's dextrose, and the like. Preservatives and other additives may also be present such as for example, antimicrobials, antioxidants, chelating agents, and inert gases and the like.
  • compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
  • the composition must be sterile and should be fluid to the extent that easy syringability exists. It should be stable under the conditions of manufacture and storage and will preferably be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
  • the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
  • the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • a coating such as lecithin
  • surfactants Suitable formulations for use in the therapeutic methods disclosed herein are described in Remington's Pharmaceutical Sciences, Mack Publishing Co., 16th ed. (1980).
  • Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal and the like, hi many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols, such as mannitol, sorbitol, or sodium chloride in the composition.
  • isotonic agents for example, sugars, polyalcohols, such as mannitol, sorbitol, or sodium chloride in the composition.
  • Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
  • sterile injectable solutions can be prepared by incorporating an active compound (e.g., a binding molecule, e.g., a binding polypeptide, e.g., a IGF-lR-specific antibody or immunospecific fragment thereof, by itself or in combination with other active agents) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated herein, as required, followed by filtered sterilization.
  • an active compound e.g., a binding molecule, e.g., a binding polypeptide, e.g., a IGF-lR-specific antibody or immunospecific fragment thereof, by itself or in combination with other active agents
  • dispersions are prepared by incorporating the active compound into a sterile vehicle, which contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • the preferred methods of preparation are vacuum drying and freeze- drying, which yields a powder of an active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • the preparations for injections are processed, filled into containers such as ampoules, bags, bottles, syringes or vials, and sealed under aseptic conditions according to methods known in the art. Further, the preparations may be packaged and sold in the form of a kit such as those described in co-pending U.S.S.N. 09/259,337 (US-2002-0102208 Al), which is incorporated herein by reference in its entirety.
  • Such articles of manufacture will preferably have labels or package inserts indicating that the associated compositions are useful for treating a subject suffering from, or predisposed to autoimmune or neoplastic disorders.
  • compositions of the present invention for treatment of hyperproliferative disorders as described herein vary depending upon many different factors, including means of administration, target site, physiological state of the patient, whether the patient is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic.
  • the patient is a human but non-human mammals including transgenic mammals can also be treated.
  • Treatment dosages may be titrated using routine methods known to those of skill in the art to optimize safety and efficacy.
  • the dosage can range, e.g., from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 mg/kg (e.g., 0.02 mg/kg, 0.25 mg/kg, 0.5 mg/kg, 0.75 mg/kg, 1 mg/kg, 2 mg/kg, etc.), of the host body weight.
  • dosages can be 1 mg/kg body weight or 10 mg/kg body weight or within the range of 1-10 mg/kg, preferably at least 1 mg/kg.
  • Doses intermediate in the above ranges are also intended to be within the scope of the invention.
  • Subjects can be administered such doses daily, on alternative days, weekly or according to any other schedule determined by empirical analysis.
  • An exemplary treatment entails administration in multiple dosages over a prolonged period, for example, of at least six months. Additional exemplary treatment regimes entail administration once per every two weeks or once a month or once every 3 to 6 months. Exemplary dosage schedules include 1-10 mg/kg or 15 mg/kg on consecutive days, 30 mg/kg on alternate days or 60 mg/kg weekly. In some methods, two or more monoclonal antibodies with different binding specificities are administered simultaneously, in which case the dosage of each antibody administered falls within the ranges indicated.
  • IGF-lR-specific antibodies or immunospecific fragments thereof disclosed herein can be administered on multiple occasions. Intervals between single dosages can be weekly, monthly or yearly. Intervals can also be irregular as indicated by measuring blood levels of target polypeptide or target molecule in the patient. In some methods, dosage is adjusted to achieve a plasma polypeptide concentration of 1-1000 ⁇ g/ml and in some methods 25-300 ⁇ g/ml. Alternatively, binding molecules can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the antibody in the patient. The half-life of a binding molecule can also be prolonged via fusion to a stable polypeptide or moiety, e.g., albumin or PEG.
  • a stable polypeptide or moiety e.g., albumin or PEG.
  • the binding molecules of the invention can be administered in unconjugated form.
  • the binding molecules e.g., binding polypeptides, e.g., IGF-lR-speciflc antibodies or immunospecific fragments thereof for use in the methods disclosed herein can be administered multiple times in conjugated form.
  • the binding molecules of the invention can be administered in unconjugated form, then in conjugated form, or vise versa.
  • compositions comprising antibodies or a cocktail thereof are administered to a patient not already in the disease state or in a pre-disease state to enhance the patient's resistance. Such an amount is defined to be a "prophylactic effective dose.”
  • prophylactic effective dose the precise amounts again depend upon the patient's state of health and general immunity, but generally range from 0.1 to 25 mg per dose, especially 0.5 to 2.5 mg per dose.
  • a relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives.
  • a relatively high dosage e.g., from about 1 to 400 mg/kg of binding molecule, e.g., antibody per dose, with dosages of from 5 to 25 mg being more commonly used for radioimmunoconjugates and higher doses for cytotoxin- drug conjugated molecules
  • dosages of from 5 to 25 mg being more commonly used for radioimmunoconjugates and higher doses for cytotoxin- drug conjugated molecules
  • the patent can be administered a prophylactic regime.
  • a subject can be treated with a nucleic acid molecule encoding an IGF-lR-specific antibody or immunospecific fragment thereof (e.g., in a vector).
  • Doses for nucleic acids encoding polypeptides range from about 10 ng to 1 g, 100 ng to 100 mg, 1 ⁇ g to 10 mg, or 30-300 ⁇ g DNA per patient.
  • Doses for infectious viral vectors vary from 10-100, or more, virions per dose.
  • Therapeutic agents can be administered by parenteral, topical, intravenous, oral, subcutaneous, intraarterial, intracranial, intraperitoneal, intranasal or intramuscular means for prophylactic and/or therapeutic treatment.
  • agents are injected directly into a particular tissue where IGF-lR-expressing cells have accumulated, for example intracranial injection.
  • Intramuscular injection or intravenous infusion are preferred for administration of antibody.
  • particular therapeutic antibodies are injected directly into the cranium.
  • antibodies are administered as a sustained release composition or device, such as a MedipadTM device.
  • IGF-IR antibodies or fragments thereof of the invention can optionally be administered in combination with other agents that are effective in treating the disorder or condition in need of treatment (e.g., prophylactic or therapeutic).
  • Effective single treatment dosages i.e., therapeutically effective amounts
  • Y- labeled binding polypeptides range from between about 5 and about 75 mCi, more preferably between about 10 and about 40 mCi.
  • Effective single treatment non-marrow ablative dosages of 13l I-labeled antibodies range from between about 5 and about 70 mCi, more preferably between about 5 and about 40 mCi.
  • Effective single treatment ablative dosages (i.e., may require autologous bone marrow transplantation) of 131 I-labeled antibodies range from between about 30 and about 600 mCi, more preferably between about 50 and less than about 500 mCi.
  • an effective single treatment non-marrow ablative dosages of iodine-131 labeled chimeric antibodies range from between about 5 and about 40 mCi, more preferably less than about 30 mCi. Imaging criteria for, e.g., the U 1 m label, are typically less than about 5 mCi.
  • radioisotopes which are compatible with the scope of the instant invention include, but are not limited to, 123 I, 125 I, 32 P, 57 Co, 64 Cu, 67 Cu, 77 Br, 81 Rb, 81 Kr, 87 Sr, 113 In, 127 Cs, 129 Cs, 132 1, 197 Hg, 203 Pb, 206 Bi, 177 Lu, 186 Re, 212 Pb, 212 Bi, 47Sc, 105 Rh, 109 Pd, 153 Sm, 188 Re, 199 Au, 225 Ac, 211 At, and 213 Bi.
  • radionuclides are compatible with a selected course of treatment without undue experimentation.
  • additional radionuclides which have already been used in clinical diagnosis include 125 I, 123 I, 99 Tc, 43 K, 52 Fe, 67 Ga, 68 Ga, as well as 111 In.
  • Antibodies have also been labeled with a variety of radionuclides for potential use in targeted immunotherapy (Peirersz et al. Immunol. Cell Biol. 65: 111-125 (1987)).
  • These radionuclides include 188 Re and 186 Re as well as 199 Au and 67 Cu to a lesser extent.
  • U.S. Patent No. 5,460,785 provides additional data regarding such radioisotopes and is incorporated herein by reference.
  • IGF-lR-specific antibodies or immunospecific fragments thereof disclosed herein are used in a conjugated or unconjugated form, it will be appreciated that a major advantage of the present invention is the ability to use these molecules in myelosuppressed patients, especially those who are undergoing, or have undergone, adjunct therapies such as radiotherapy or chemotherapy. That is, the beneficial delivery profile (i.e. relatively short serum dwell time, high binding affinity and enhanced localization) of the molecules makes them particularly useful for treating patients that have reduced red marrow reserves and are sensitive to myelotoxicity. In this regard, the unique delivery profile of the molecules make them very effective for the administration of radiolabeled conjugates to myelosuppressed cancer patients.
  • binding molecules e.g., binding polypeptides, e.g., IGF-lR-specific antibodies or immunospecific fragments thereof (again in a conjugated or unconjugated form) may be used in a combined therapeutic regimen with chemotherapeutic agents.
  • chemotherapeutic agents e.g., chemotherapeutic agents, chemotherapeutic agents, and one or more chemotherapeutic agents.
  • therapeutic regimens may comprise the sequential, simultaneous, concurrent or coextensive administration of the disclosed antibodies or other binding molecules and one or more chemotherapeutic agents.
  • Particularly preferred embodiments of this aspect of the invention will comprise the administration of a radiolabeled binding polypeptide.
  • IGF-lR-specific antibodies or immunospecific fragments thereof may be administered as described immediately above, it must be emphasized that in other embodiments conjugated and unconjugated binding molecules may be administered to otherwise healthy patients as a first line therapeutic agent. In such embodiments binding molecules may be administered to patients having normal or average red marrow reserves and/or to patients that have not, and are not, undergoing adjunct therapies such as external beam radiation or chemotherapy.
  • selected embodiments of the invention comprise the administration of IGF-lR-specific antibodies or immunospecific fragments thereof to myelosuppressed patients or in combination or conjunction with one or more adjunct therapies such as radiotherapy or chemotherapy (i.e. a combined therapeutic regimen).
  • a combined therapeutic regimen such as radiotherapy or chemotherapy
  • the administration of IGF-lR-specific antibodies or immunospecific fragments thereof in conjunction or combination with an adjunct therapy means the sequential, simultaneous, coextensive, concurrent, concomitant or contemporaneous administration or application of the therapy and the disclosed binding molecules.
  • the administration or application of the various components of the combined therapeutic regimen may be timed to enhance the overall effectiveness of the treatment.
  • chemotherapeutic agents could be administered in standard, well known courses of treatment followed within a few weeks by radioimmunoconjugates described herein.
  • cytotoxin-conjugated binding molecules could be administered intravenously followed by tumor localized external beam radiation.
  • binding molecules may be administered concurrently with one or more selected chemotherapeutic agents in a single office visit.
  • a skilled artisan e.g. an experienced oncologist
  • the combination of a binding molecule e.g. an experienced oncologist
  • the chemotherapeutic agent may be administered in any order and within any time frame that provides a therapeutic benefit to the patient. That is, the chemotherapeutic agent and IGF-lR-specific antibody or immunospecific fragment thereof, may be administered in any order or concurrently. In selected embodiments IGF- lR-specific antibodies or immunospecific fragments thereof of the present invention will be administered to patients that have previously undergone chemotherapy. In yet other embodiments, IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention will be administered substantially simultaneously or concurrently with the chemotherapeutic treatment. For example, the patient may be given the binding molecule while undergoing a course of chemotherapy.
  • the binding molecule will be administered within 1 year of any chemotherapeutic agent or treatment. In other preferred embodiments the polypeptide will be administered within 10, 8, 6, 4, or 2 months of any chemotherapeutic agent or treatment. In still other preferred embodiments the binding molecule will be administered within 4, 3, 2 or 1 week of any chemotherapeutic agent or treatment. In yet other embodiments the binding molecule will be administered within 5, 4, 3, 2 or 1 days of the selected chemotherapeutic agent or treatment. It will further be aopreciated that the two agents or treatments may be administered to the patient within a matter of hours or minutes ⁇ i.e. substantially simultaneously).
  • a myelosuppressed patient shall be held to mean any patient exhibiting lowered blood counts.
  • blood count parameters conventionally used as clinical indicators of myelosuppression and one can easily measure the extent to which myelosuppression is occurring in a patient.
  • Examples of art accepted myelosuppression measurements are the Absolute Neutrophil Count (ANC) or platelet count.
  • ANC Absolute Neutrophil Count
  • Such myelosuppression or partial myeloablation may be a result of various biochemical disorders or diseases or, more likely, as the result of prior chemotherapy or radiotherapy.
  • patients who have undergone traditional chemotherapy typically exhibit reduced red marrow reserves.
  • cytotoxin i.e. radionuclides
  • IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention may be used to effectively treat patients having ANCs lower than about 2000/mm 3 or platelet counts lower than about 150,000/ mm 3 . More preferably IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention may be used to treat patients having ANCs of less than about 1500/ mm 3 , less than about 1000/mm 3 or even more preferably less than about 500/ mm 3 . Similarly, IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention may be used to treat patients having a platelet count of less than about 75,000/mm 3 , less than about 50,000/mm 3 or even less than about 10,000/mm 3 . In a more general sense, those skilled in the art will easily be able to determine when a patient is myelosuppressed using government implemented guidelines and procedures.
  • IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention may be used to treat disorders in patients exhibiting myelosuppression regardless of the cause.
  • IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention may be used in conjunction or combination with any chemotherapeutic agent or agents ⁇ e.g. to provide a combined therapeutic regimen) that eliminates, reduces, inhibits or controls the growth of neoplastic cells in vivo.
  • any chemotherapeutic agent or agents ⁇ e.g. to provide a combined therapeutic regimen
  • such agents often result in the reduction of red marrow reserves. This reduction may be offset, in whole or in part, by the diminished myelotoxicity of the compounds of the present invention that advantageously allow for the aggressive treatment of neoplasias in such patients.
  • radiolabeled immunoconjugates disclosed herein may be effectively used with radiosensitizers that increase the susceptibility of the neoplastic cells to radionuclides.
  • radiosensitizing compounds may be administered after the radiolabeled binding molecule has been largely cleared from the bloodstream but still remains at therapeutically effective levels at the site of the tumor or tumors.
  • exemplary chemotherapeutic agents that are compatible with the instant invention include alkylating agents, vinca alkaloids (e.g., vincristine and vinblastine), procarbazine, methotrexate and prednisone.
  • alkylating agents e.g., vincristine and vinblastine
  • procarbazine methotrexate
  • prednisone methotrexate
  • MOPP mechlethamine (nitrogen mustard), vincristine (Oncovin), procarbazine and prednisone
  • ABVD e.g., adriamycin, bleomycin, vinblastine and dacarbazine
  • ChIVPP chlorambucil, vinblastine, procarbazine and prednisone
  • CABS lastine, doxorubicin, bleomycin and streptozotocin
  • MOPP plus ABVD MOPP plus ABV (doxorubicin, bleomycin and vinblastine) or BCVPP (carmustine, cyclophosphamide, vinblastine, procarbazine and prednisone) combinations
  • Additional regimens that are useful in the context of the present invention include use of single alkylating agents such as cyclophosphamide or chlorambucil, or combinations such as CVP (cyclophosphamide, vincristine and prednisone), CHOP (CVP and doxorubicin), C-MOPP (cyclophosphamide, vincristine, prednisone and procarbazine), CAP-BOP (CHOP plus procarbazine and bleomycin), m-BACOD (CHOP plus methotrexate, bleomycin and leucovorin), ProMACE-MOPP (prednisone, methotrexate, doxorubicin, cyclophosphamide, etoposide and leucovorin plus standard MOPP), ProMACE-CytaBOM (prednisone, doxorubicin, cyclophosphamide, etoposide, cytarabine,
  • CHOP has also been combined with bleomycin, methotrexate, procarbazine, nitrogen mustard, cytosine arabinoside and etoposide.
  • Other compatible chemotherapeutic agents include, but are not limited to, 2-chlorodeoxyadenosine (2-CDA), 2*-deoxycoformycin and fludarabine.
  • Salvage therapies employ drugs such as cytosine arabinoside, cisplatin, carboplatin, etoposide and ifosfamide given alone or in combination.
  • IMVP-16 ifosfamide, methotrexate and etoposide
  • MIME methyl-gag, ifosfamide, methotrexate and etoposide
  • DHAP dexamethasone, high dose cytarabine and cisplatin
  • ESHAP etoposide, methylpredisolone, HD cytarabine, cisplatin
  • CEPP(B) cyclophosphamide, etoposide, procarbazine, prednisone and bleomycin
  • CAMP lomustine, mitoxantrone, cytarabine and prednisone
  • the amount of chemotherapeutic agent to be used in combination with the IGF- lR-specific antibodies or immunospecific fragments thereof of the present invention may vary by subject or may be administered according to what is known in the art. See for example, Bruce A Chabner et al., Antineoplastic Agents, in Goodman & Gilman's The Pharmacological Basis of Therapeutics 1233-1287 (Joel G. Hardman et al, eds., 9 th ed. (1996)).
  • an IGF-lR-specific antibody or immunospecific fragment thereof of the present invention is administered in conjunction with a biologic.
  • a biologic e.g., a binding molecule of the invention may be administered, for example, in conjunction with such known biologies.
  • the FDA has approved the following biologies for the treatment of breast cancer: Herceptin® (trastuzumab, Genentech Inc., South San Francisco, CA; a humanized monoclonal antibody that has anti-tumor activity in HER2-positive breast cancer); Faslodex® (fulvestrant, AstraZeneca Pharmaceuticals, LP, Wilmington, DE; an estrogen-receptor antagonist used to treat breast cancer); Arimidex® (anastrozole, AstraZeneca Pharmaceuticals, LP; a nonsteroidal aromatase inhibitor which blocks aromatase, an enzyme needed to make estrogen); Aromasin® (exemestane, Pfizer Inc., New York, NY; an irreversible, steroidal aromatase inactivator used in the treatment of breast cancer); Femara® (letrozole, Novartis Pharmaceuticals, East Hanover, NJ; a nonsteroidal aromatase inhibitor approved by the FDA to treat breast cancer); and Nolvadex
  • AvastinTM bevacizumab, Genentech Inc.; the first FDA-approved therapy designed to inhibit angiogenesis
  • Zevalin® ibritumomab tiuxetan, Biogen Stahl, Cambridge, MA; a radiolabeled monoclonal antibody currently approved for the treatment of B-cell lymphomas.
  • the FDA has approved the following biologies for the treatment of colorectal cancer: AvastinTM ;ErbituxTM (cetuximab, ImClone Systems Inc., New York, NY, and Bristol-Myers Squibb, New York, NY; is a monoclonal antibody directed against the epidermal growth factor receptor (EGFR)); Gleevec® (imatinib mesylate; a protein kinase inhibitor); and Ergamisol® (levamisole hydrochloride, Janssen Pharmaceutica Products, LP, Titusville, NJ; an immunomodulator approved by the FDA in 1990 as an adjuvant treatment in combination with 5-fluorouracil after surgical resection in patients with Dukes' Stage C colon cancer).
  • AvastinTM avastinTM
  • ErbituxTM cetuximab, ImClone Systems Inc., New York, NY, and Bristol-Myers Squibb, New York, NY
  • EGFR epidermal growth factor receptor
  • Non-Hodgkin's Lymphomas currently approved therapies include: Bexxar® (tositumomab and iodine 1-131 tositumomab, GlaxoSmithKline, Research Triangle Park, NC; a multi-step treatment involving a mouse monoclonal antibody (tositumomab) linked to a radioactive molecule (iodine 1-131)); Intron® A (interferon alfa-2b, Schering Corporation, Kenilworth, NJ; a type of interferon approved for the treatment of follicular non-Hodgkin's lymphoma in conjunction with anthracycline-containing combination chemotherapy (e.g., cyclophosphamide, doxorubicin, vincristine, and prednisone [CHOP])); Rituxan® (rituximab, Genentech Inc., South San Francisco, CA, and Biogen personal hygiene, MA; a monoclonal
  • exemplary biologies which may be used in combination with the binding molecules of the invention include Gleevec®; Campath®- IH (alemtuzumab, Berlex Laboratories, Richmond, CA; a type of monoclonal antibody used in the treatment of chronic Lymphocytic leukemia).
  • Genasense oblimersen, Genta Corporation, Berkley Heights, NJ; a BCL-2 antisense therapy under development to treat leukemia may be used (e.g., alone or in combination with one or more chemotherapy drugs, such as fludarabine and cyclophosphamide) may be administered with the claimed binding molecules.
  • exemplary biologies include TarcevaTM (erlotinib
  • HCL human epidermal growth factor receptor 1
  • exemplary biologies include Velcade®
  • Velcade (bortezomib, Millennium Pharmaceuticals, Cambridge MA; a proteasome inhibitor). Additional biologies include Thalidomid® (thalidomide, Clegene Corporation, Warren, NJ; an immunomodulatory agent and appears to have multiple actions, including the ability to inhibit the growth and survival of myeloma cells and anti-angiogenesis).
  • IGF-lR-specific antibodies or immunospeciflc fragments thereof of the present invention, or recombinants thereof may be administered in a pharmaceutically effective amount for the in vivo treatment of mammalian . hyperproliferative disorders, hi this regard, it will be appreciated that the disclosed antibodies will be formulated so as to facilitate administration and promote stability of the active agent.
  • pharmaceutical compositions in accordance with the present invention comprise a pharmaceutically acceptable, non-toxic, sterile carrier such as physiological saline, non-toxic buffers, preservatives and the like.
  • a pharmaceutically effective amount of IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention, or recombinant thereof, conjugated or unconjugated to a therapeutic agent shall be held to mean an amount sufficient to achieve effective binding to a target and to achieve a benefit, e.g., to ameliorate symptoms of a disease or disorder or to detect a substance or a cell.
  • the binding molecule will be preferably be capable of interacting with selected immunoreactive antigens on neoplastic or immunoreactive cells, or on non neoplastic cells, e.g., vascular cells associated with neoplastic cells, and provide for an increase in the death of those cells.
  • the pharmaceutical compositions of the present invention may be administered in single or multiple doses to provide for a pharmaceutically effective amount of the binding molecule.
  • IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention may be administered to a human or other animal in accordance with the aforementioned methods of treatment in an amount sufficient to produce a therapeutic or prophylactic effect.
  • the IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention can be administered to such human or other animal in a conventional dosage form prepared by combining the antibody of the invention with a conventional pharmaceutically acceptable carrier or diluent according to known techniques. It will be recognized by one of skill in the art that the form and character of the pharmaceutically acceptable carrier or diluent is dictated by the amount of active ingredient with which it is to be combined, the route of administration and other well-known variables. Those skilled in the art will further appreciate that a cocktail comprising one or more species of binding molecules according to the present invention may prove to be particularly effective.
  • IGFlR-Fc a biotinylated anti-Fc antibody was captured on the magnetic beads, followed by captured of the Fc fusion protein. Selections were performed as described in Hoet et al. After 3 rounds of panning, the 479 bp gene III stump was removed by MIuI digestion, and the vector was religated for soluble Fab expression in TGl cells.
  • ELISA analysis of 920 clones from the biotinylated IGFlR-his arm yielded 593 positive clones, containing 33 unique sequences.
  • ELISA analysis of 920 clones from the IGFlR-Fc arm yielded 163 positive clones, containing 12 unique sequences.
  • MCF-7 cells Human Breast Adenocarcinoma from NCI were split 24 hours prior to the setup of the assay to obtain 70% confluent monolayer. Routinely, MCF-7 cell line was maintained within 20 passages. Cells were lifted with cell dissociation buffer (Gibco catalog #13151-014), counted, washed and adjusted to IxIO 6 cells/ml and one ml of cells were then added to each tube (12x75mm tube Falcon catalog# 352054). Cells were pelleted and supernatant removed by centrifugation at 1200rpm for 5min and lOO ⁇ l of diluted antibodies were then added to the cell pellet.
  • cell dissociation buffer Gibco catalog #13151-014
  • Fabs were tested at a starting concentration of either 210 or 60 ⁇ g/ml with 1 :3 dilutions in FACS buffer, down to 0.001 ⁇ g/ml.
  • FACS buffer used throughout the assay was PBS (without Ca-H-ZMg++) containing 1% BSA (Sigma catalog# A-7906) and 0.1% Sodium Azide (Sigma catalog #S2002).
  • IR3 a murine antibody (Ab-I; Calbiochem #GR1 IL) was used. Samples were allowed to incubate on ice for lhour and 15 minutes then were washed with 2ml FACS buffer and centrifuged at 1200rpm for 5 minutes at 4°C.
  • AffiPure goat anti-human IgG, Fc ⁇ fragment specific antibodies (Cat #109-005-098, Jackson IrnmunoResearch, West Grove, PA) was used for IGF-IR-Fc capture.
  • detection antibody goat anti-mouse IgG HRP (Cat #1030-05, Southern Biotech Birmingham, AL) was used.
  • CD20.IgGi and 2B8 mkm.G 2a (murine ⁇ -CD20 MAb, IgG 23 , Biogen plec, Lot #NB3304-87, San Diego, CA) were used.
  • the negative control for Fabs was ROOl-IB provided by Christilyn Graff (Biogen personal, Cambridge, MA).
  • PBS used in buffers was from BioWhittaker (Cat. # 17-513F, Walkersville, MD).
  • Recombinant human IGF-IR Histidine tagged version
  • IGF-IR-Fc was coated onto IMMULON2 HB (high binding) Removawell strips (Dynex Technologies, Inc., cat. #6302) diluted with carbonate coating buffer pH 9.5 to a concentration of 250 ng/well. After overnight incubation at 4°C, the wells were washed three times with washing buffer (0.05% Tween 20/ PBS) then blocked with blocking buffer (3% BSA/ PBS) for one hour at room temperature. The blocking buffer was removed and the wells washed three more times.
  • Antibody, Fab, or ligand preparations were diluted to desired concentration with dilution buffer (1% BSA/0.05% Tween 20/ PBS) and plated at 50 ⁇ l per well in duplicate. After 45 minutes at room temperature, 100,000 cpm of either [1251] rhIGF-1 or [1251] rhIGF-2 in 50 ⁇ l dilution buffer was added per well. This was incubated at room temperature for one more hour. The wells were washed again three more times and left liquid free after the last wash. The air-dried wells were counted with the Isodata Gamma Counter.
  • Fabs were evaluated by a modified capture assay, where the IGF-
  • IR-Fc was captured using anti-human IgG immobilized to a plate. Immobilization was carried out by overnight incubation of goat anti-human IgG, Fc ⁇ fragment specific antibody (200 ng/well) in carbonate coating buffer. The wells were washed, blocked and 250 ng of IGF-IR-Fc was added per well.
  • IGFlR expressing human breast carcinoma cell line MCF-7 were maintained at 37°C and 5% CO 2 in MEM eagle (ATCC) containing 10% FBS, IX non-essential amino acids, 2mM L-glutamine, ImM sodium pyruvate and 1000U/ml penicillin and streptomycin. Cells were sub-cultured twice weekly for maintenance and assay, and used with a maximum of 12 passages.
  • MCF-7 cells were plated in 2ml growth media at 2 X 10 5 to 4.0 X lO 5 cells/well in
  • Ploy-D-Lysine coated 12 well plates (BD Biosciences, #35-6470) and cultured at 37°C, 5% CO 2 . At 48 hours, media removed and cells serum starved overnight at 37°C, 5% CO 2 . Serum free media was removed and control or test antibodies at indicated concentration were added in 350ul of fresh serum free media and incubated for 1 hour at room temperature, or alternately at 37°C. Fabs were tested at 20OnM, 2OnM and 2nM concentration and the mAbs were tested at 67, 6.7 and 0.67 nM. The commercial anti- IGF-IR control antibody used was ⁇ IR3 (EMD biosciences, Oncogene Research products, #D27249).
  • IGF-I Human recombinant IGF-I at 13nM or IGF-2 at 27nM (R & D Systems, #291-G1, #292-G2) added to wells in 35ul serum free media and incubated at 37°C for 15 minutes. Ligand was incubated at room temperature for 37°C antibody experiments. Cells were Iysed in IX cell lysis buffer (Cell Signal technologies, #9803) with ImM PMSF for 1 hour at room temperature.
  • Table 3 summarizes the inhibition of IGF-I and IGF-2 mediated phosphorylation of IGF-IR in MCF-7 cells by Fabs.
  • a total of 16 IGF-IR Fabs were screened for inhibition of receptor phosphorylation by ELISA.
  • Nine antibodies showed positive response of "+” or better at a concentration of 200 nM against IGF-I, IGF-2 or both. These antibodies were selected for scale up quantities and tested again for dose dependent inhibitory response. Based on the ability to inhibit ligand binding and receptor phosphorylation, four Fabs were selected as lead candidates for full-length antibody conversion (see, Example 6).
  • Figure 3 shows the Inhibition of IGF-IR phosphorylation of the scaled up material of the top 6 IGF-IR Fabs.
  • Part I Analysis of antibody binding to soluble IGF-IR versus soluble INSR using Enzyme-Linked Immunosorbent Assays (ELISA) [0568] ELISA assays were performed to determine specific binding of the Fab fragment antibodies to soluble IGF-IR over the insulin receptor. Plates were coated with lOug/ml of rh-IGF-lR (R & D Systems, #305-GR) or rh-INSR (R & D Systems, #1544-IR) overnight and blocked with 5% milk.
  • rh-IGF-lR R & D Systems, #305-GR
  • rh-INSR R & D Systems, #1544-IR
  • the antibodies were added at a range of 2 ⁇ M — 0.2nM for Fabs or 667 — 0.067nM for murine MAbs in a 1:10 serial dilution and incubated 1 hour at room temperature. Bound antibody was detected with HRPO labeled goat ⁇ -human kappa (Southern Biotechnology Associates, #2060-05) for Fabs and goat ⁇ -mouse IgG Fc ⁇ (Jackson Immunoresearch, # 115-035-164) for murine MAbs. Color development was stopped by addition of 4N H 2 SO4 and optical density is measured at 450nm using a Molecular Devices plate reader and binding curves are generated.
  • IGF-IR Fabs showed no specific binding to soluble insulin receptor at any concentration (Table 3) while, as expected they showed good binding to IGF-IR-Fc.
  • Figure 4 illustrates the representative binding curves obtained with Fabs
  • Binding affinities of M13-C06, M14-C03, and M14-G11 antibodies to soluble human IGF-IR and insulin receptor ectodomains were compared using surface plasmon resonance (Biacore) and time-resolved fluorescence resonance energy transfer (tr-FRET); further demonstrating that M13-C06 antibody does not exhibit significant cross-reactivity with insulin receptor, murine IGF-IR, or a truncated version of human IGF-IR (i.e., hIGF-lR amino acid residues 1-462 containing only the first and second leucine rich repeat domains as well as the cysteine rich repeat domain, but lacking IGF-lR's three fibronectin type in domains).
  • Biacore surface plasmon resonance
  • tr-FRET time-resolved fluorescence resonance energy transfer
  • MGF-IR-Hisio and M13-C06 were covalently conjugated to Cy5 and a Europium chelate, respectively, using standard NHS chemistry according to the dye manufacturer's protocols.
  • Serial dilutions of several unlabeled soluble ectodomain receptor competitors (1) hIGF-lR-Hisio, (2) human IGF-lR(l-903)-FlagHis 10 (hIGF-lR-FlagHis 10 , Biogen personal), (3) human IGF-IR(I -903)-Fc (hIGF-lR-Fc, Biogen personal), (4) human IGF-IR(I- 462)-Fc (hIGF-lR(l-462)-Fc, Biogen pou), (5) murine IGF-1R(1-9O3)-Fc (mIGF-lR-Fc, Biogen pou) or (6) INSR, starting at 6.25 ⁇ g (50 ⁇ l of 125 ⁇ g/ml stock solution) were mixed
  • the conjugation levels for hIGF-lR-HiS] 0 -Cy5 were 6.8:1 (Cy5:IGF-lR-Hisi 0 ), and for Eu-C06 were 10.3:1 (Eu:C06) as determined by the absorbance of each dye with respect to the protein concentration. The total volume was 100 ⁇ l for each sample. Plates were incubated for 1 hr at room temperature on a plate agitator. Fluorescence measurements were carried out on a Wallac Victor 2 fluorescent plate reader (Perkin Elmer) using the LANCE protocol with the excitation wavelength at 340 run and emission wavelength at 665 nm. All constructs were sampled with at least two replicates.
  • hIGF-lR-Hisio binding was strongest for the M13-C06 surface.
  • INSR demonstrated little activity towards the M13- C06 surface even at a concentration as high as 2 ⁇ M receptor (>1000 higher than what was observed for IGF-IR binding (data not shown: concentrations ranged from 1.0 nM to 2 ⁇ M and the receptor injection phase was 500-1000 seconds followed by a buffer dissociation phase).
  • concentrations ranged from 1.0 nM to 2 ⁇ M and the receptor injection phase was 500-1000 seconds followed by a buffer dissociation phase.
  • the M14-C03 and M14-G11 surfaces also demonstrated little binding activity towards INSR.
  • C06 were determined using a competition-based tr-FRET assay. Best fit binding curves for all recombinant receptor constructs (described below) were determined (data not shown). All data were fitted to a one-site binding model from which the corresponding IC50 values were determined. The three full-length human IGF-IR ectodomain constructs (hIGF-lR-Fc, hIGF-lR-Hisio, and hlGF-lR-FlagHisio) all competed in a concentration dependent manner with IC 50 values of 2.9, 2.0, 5.2 ⁇ g/ml, respectively.
  • the truncated human IGF- IR(I -462)-Fc construct, the full-length mouse IGF-IR-Fc construct, and the full-length human INSR-Hisio construct did not inhibit Cy5-labeled hIGF-lR-Hisio at concentrations 100-fold above the IC 50 of the recombinant full-length human IGF-IR constructs, suggesting these former constructs do not exhibit significant binding reactivity for M13-C06 compared to the latter full-length human IGF-IR.
  • Part III Relative binding affinity of M13-C06 antibody for soluble human versus murine IGF-IR.
  • mIGF-lR-Fc or hlGF-lR-Fc was captured on the chip surface by injecting 40 ⁇ L of 2OnM receptor at 3 ⁇ L/min. Following capture of receptor, 40 ⁇ L of M13-C06 Fab was injected at 3 ⁇ L/min. Dissociation of Fab was measured for ⁇ 27 minutes. Fab was serially diluted from 25 to 0.4 nM to obtain concentration dependent kinetic binding curves. Regeneration of the surface chip between each injection series was performed using 3x1 O ⁇ L injections of 100 mM glycine pH 2.0 at 60 ⁇ L/min.
  • Each curve was double referenced using (1) data obtained from a CM5 chip surface devoid of the anti-IgG antibody 2Cl 1 and (2) data from a primary injection of receptor followed by a secondary injection of HBS-EP buffer.
  • the concentration series of M13-C06 Fab for each receptor was fit to the 1:1 binding model provided within the BiaEvaluation software of the manufacturer.
  • M13-C06 Fab was applied to Biacore surfaces containing MGF- IR-Fc or mlGF-
  • IR-Fc to determine the relative affinity of the antibody to the two species of receptor.
  • the presence of the C-terminal IgGl-Fc tag results in additional multimerization of the IGF-IR-Fc receptor constructs (data not shown); therefore, the binding model fits provide a measure of the relative or apparent affinities of M13-C06 for each receptor.
  • the affinity of M13-C06 Fab for human and murine IGF-IR Fc was found to be 0.978 nM and 89.1 nM, respectively.
  • the 100-fold decrease in binding to murine IGF-IR is readily apparent when comparing Figure 27 A & B, which display the association and dissociation curves, kinetic rate constants, and equilibrium dissociation constants.
  • Part IV M13-C06 full-length antibody specifically binds IGF-IR but not
  • IGF-IR and insulin receptor (IR) were independently expressed in mammalian cells (3T3 or CHO). Cells were solubilized with 1% Triton X-100 and the receptor was immunoprecipitated with protein-A/G beads coupled to a negative control antibody (IDEC-151), M13.C06.G4.P.agly antibody (C06), M14-G1 l.G4.P.agly antibody (Gl 1), or an INSR antibody ( ⁇ -IR). Antibody/antigen complexes were released from the beads by acid treatment, applied to Tris-Glycine SDS-PAGE gels and blotted to nitrocellulose membranes.
  • IDEC-151 negative control antibody
  • M13.C06.G4.P.agly antibody (C06) M14-G1 l.G4.P.agly antibody (Gl 1)
  • INSR antibody ⁇ -IR
  • Detection was performed using mouse anti-human IR ( Figure 26A) or mouse anti-human IGF-IR ( Figure 26B) and goat ⁇ -mouse IgG. Results: M13.C06.G4.P.agly antibody binds to IGF-IR but not to INSR expressed in mammalian cells.
  • DNA sequences encoding four distinct anti-IGF-lR Fabs- M13-C06 were selected from a human antibody phage library (Dyax Corp) by biopanning against a recombinant human IGF-IR ectodomain-Fc fusion protein.
  • Each of the four anti-IGF-lR Fabs contained theV H 3-23 human heavy chain germline framework and were kappa light chains.
  • pV90AS is a modified pV90 expression vector designed to generate two transcripts from a single promoter through alternate splicing of a primary transcript (Reference: USPTO Application WO2005/089285).
  • the natural CMV splice donor is spliced either to a partially impaired splice acceptor to generate an antibody light chain-encoding transcript, or to a natural GMV splice acceptor to generate the antibody heavy chain-coding transcript.
  • the partially impaired splice acceptor has been engineered to result in similar amounts of both heavy and light chain transcripts.
  • VL Light chain Variable
  • CL Constant
  • the 5' light chain PCR primer IGFlR-FK included a Sfi I restriction endonuclease site followed by sequence encoding an immunoglobulin light chain signal peptide MDMRVPAQLLGLLLLWLPGARC (SEQ ID NO: 157) in frame to sequences corresponding to the amino-terminus of the VL region according to the methods described in Nakamura T, et ah, Int J Immunopharmacol. 22:131-41 (2000), which is incorporated herein by reference in its entirety. All four of the mature IGFlR light chain sequences had identical amino-termini.
  • the 3 f light chain PCR primer IGFlR-RK included sequence corresponding to the carboxyl-terminus of the CL region and an Asc I site.
  • the PCR product was purified by agarose gel electrophoresis and extraction using the QIAquick GelExtration kit protocol (QIAGEN CA), digested with restriction endonucleases Sfi I and Asc I and ligated with the Sfi I/ Asc I digested pHLP025 vector (Holly Prentice).
  • the pHLP025 vector contains Sfi I/ Asc I restriction endonuclease sites for receiving antibody light chain (signal peptide- VL-CL) as a Sfi I/Asc I digested PCR fragment in addition to the natural CMV splice donor site sequence, a partially impaired splice acceptor site sequence, and a poly A signal sequence (Reference: USPTO Application WO2005/089285).
  • the heavy chain Variable (VH) region of each anti-IGF-lR Fab (M13-C06; M14-
  • the 5' heavy chain VH PCR primer IGFlR-FH included a Nco I restriction endonuclease site followed by sequence encoding synthetic heavy chain signal peptide MGWSLILLFLVAVATRVLS (SEQ ID NO: 122)) in frame to sequences corresponding to the amino-terminus of the VH region as described above.
  • the 3' heavy chain VH PCR primer IGFlR-RH included sequence corresponding to the carboxyl-terminus of the VH region and an Sfi I site.
  • the PCR product was purified by agarose gel electrophoresis and extraction using the QIAquick GelExtration kit protocol (QIAGEN, CA), digested with restriction endonucleases Nco I and Sfi I and ligated with the Nco I/ Sfi I digested pHLP029 vector (Holly Prentice).
  • the pHLP029 vector contains Nco I/ Sfi I sites for receiving the antibody signal peptide- VH sequence as a Nco I/ Sfi I digested PCR fragment in addition to an upstream poly A signal sequence, a natural CMV splice acceptor site sequence, and a downstream poly A signal sequence (Reference: USPTO Application WO2005/089285).
  • pHLP025 and CL in pHLP025 and (heavy chain signal peptide- anti-IGF-lR VH- Sfi I site) in pHLP029 were assembled into a single DNA fragment by PCR amplification through common overlapping sequences present in both vectors using the 5' light chain IGFlR- FK and 3' heavy chain VH IGFlR-RH PCR primers described above.
  • the resulting PCR product was purified by agarose gel electrophoresis and extraction using the QIAquick GelExtration kit protocol (QIAGEN, CA), digested with restriction endonuclease Sfi I and Iigated with the Dra III digested pXWU007 vector.
  • pXWU007 was first constructed by subcloning an Age I/ BamHI human IgG4 constant region fragment containing a S228P mutation in the IgG4 hinge region and a T299A mutation in the C H 2 domain, EU numbering system (Kabat, E, Wu, TT, Perry, HM, Gottesman, KS, Foeller, C: Sequences of Proteins of Immunological Interest. Bethesda, US Department of Health and Human Services, NIH, 1991) (SEQ ID NOs:155 and 156, Figure 5 (AA)- (BB)) from plasmid pEAG1808 (provided by Ellen Garber) into Age I/ BamHI digested pHLP028 vector.
  • pHLP028 is a pV90 IgG4 vector modified to contain a Dra HI site for receiving the single Sfi I-digested PCR product described above (Reference: USPTO Application WO2005/089285).
  • the resulting plasmid produces a bi-cistronic precursor transcript that upon alternative splicing results in translationally active antibody heavy and light chain mRNAs in approximately stoichiometric quantities.
  • Intermediate and expression vectors for producing full— length aglycosylated human anti-IGF-lR IgG4.P antibodies are shown in Table 8. Correct sequences were confirmed by DNA sequence analysis. Expression of full-length antibodies from plasmids pXWU020, pXWU022, pXWU024, and pXWU025 in mammalian cells results in production of stable, aglycosylated human IgG4.P antibodies.
  • Forward 5' light chain PCR primer includes a Sfi I restriction endonuclease site (underlined) and sequence encoding the light chain signal peptide;
  • Reverse 3' light chain PCR primer includes an Asc I site (underlined).
  • Forward 5' heavy chain variable PCR primer includes a Nco I restriction endonuclease site (underlined) and sequence encoding the heavy chain signal peptide.
  • Reverse 3' heavy chain variable PCR primer includes an SiI I site (underlined).
  • DNA fragments encoding synthetic heavy chain leader in frame with sequence- optimized VH sequences of anti-IGF-lR Fabs- M13-C06 (SEQ ID NO: 18, Figure 5(Q)), M14-C03 (SEQ ID NO:30, Figure 5(S)), M14-G11 (SEQ ID NO:36, Figure 5(U)), and M14-B01 (SEQ ID NO:24, Figure 5(W)) were obtained as chemically synthesized double-stranded DNA sequences from a commercial provider (Blue Heron Biotechnology, Inc. Bothell WA).
  • the Nco I and Sfi I restriction endonuclease sites at 5 1 and 3' were included in the synthesized fragments.
  • the leader and anti-IGFlR sequence- optimized VH region fragments were cloned into the Nco I/Sfi I digested the pHLP029 vector as described in Example 6 above. Recombination with the appropriate corresponding light chains in pHLP025 and subsequent cloning of the single fragment into pXWU007 is as described in Example 6 above.
  • Expression constructs producing the sequence-optimized full— length aglycosylated human anti-IGF-lR IgG4.P antibodies are shown in Table 9. Correct sequences were confirmed by DNA sequence analysis. Expression of full-length antibodies from the plasmid series pXWU029-pXWU032 in mammalian cells results in production of stable, aglycosylated human IgG4.P antibodies.
  • Plasmid DNAs were used to transform CHO DG44 cells for transient production of antibody protein. 20 ⁇ g of plasmid DNA was combined with 4 x 10 6 cells in a volume of 0.4 mL of IX PBS. The mixture was added to a 0.4 cm cuvette (BioRad) and placed on, ice for 15 min. The cells were electroporated at 600 uF and 350 volts with a Gene Pulser electroporator (BioRad). The cells were placed into a T-25 flask containing CHO-SSFM II media plus lOOuM Hypoxanthine and 16uM Thymidine and incubated at 37° for 4 days. Supernatants were harvested and biochemically characterized by Western Blot and tested for antigen binding by ELISA.
  • selected Fabs also converted to full-length human IgG4.P version and expressed using a different vector system by a method described below.
  • DNA sequences encoding five distinct anti-IGFlR Fab antibodies, M12-E01, M12-G04, M13- C06, M14-C03, and M14-G11 were transferred into vectors for expression of full-length human IgG4.P. All five antibodies use the V H 3-23 human heavy chain germline fragment. The variable heavy chain was removed from the soluble Fab expression vector by digestion with restriction enzymes Mfel and BstEII.
  • the resulting fragment was purified by agarose gel electrophoresis using the QIAquick Gel Extraction Kit (Qiagen, CA) and ligated into the Mfel/BstEII digested pRR253 vector (Rachel Rennard).
  • the resulting plasmid contains the heavy chain signal peptide (MGWSCIILFLV AT ATGAHS, SEQ ID NO: 127) followed by the anti-IGFIR VH and constant regions for human IgG4.P.
  • variable light chain was amplified by PCR with primers to introduce an EcoRV site 5' and a Bsgl 3' to the variable region.
  • the resulting PCR fragment was purified by agarose gel electrophoresis using the QIAquick Gel Extraction Kit (Qiagen, CA) and ligated into TOPO2.1 TA vector (Invitrogen, CA).
  • the variable kappa light chain was removed from the TOPO vector by digestion with restriction enzymes EcoRV and Bsgl and purified.
  • the fragment was ligated into EcoRV/Bsgl digested pRR237 vector, which contains the immunoglobulin light chain signal peptide (MDMRVPAQLLGLLLLWLRGARC, SEQ ID NO: 128) and the constant kappa domain.
  • the resulting vector was digested with BamHI and Notl and the entire expression cassette (signal sequence, variable and constant kappa domains) was purified and ligated into BamHI/Notl digested pRR223.
  • the M12-E01 antibody contains a lambda light chain.
  • the variable light chain was amplified by PCR with primers to introduce an Agel site 5' of the variable region.
  • the resulting PCR fragment was purified by agarose gel electrophoresis using the QIAquick Gel Extraction Kit (Qiagen, CA) and ligated into TOPO2.1 TA vector (Invitrogen, CA).
  • the variable lambda light chain was removed from the TOPO vector by digestion with restriction enzymes Agel and Avrll and purified.
  • the fragment was ligated into Agel/Avrll digested pXW347 vector (Xin Wang), which contains the immunoglobulin light chain signal peptide (METDTLLLWVLLLWVPGSTG, SEQ ID NO: 129) and the constant lambda domain.
  • the resulting vector was digested with Notl and the entire expression cassette (signal sequence, variable and constant lambda domains) was purified and ligated into Notl digested pRR223.
  • Plasmid DNA was used to transfect 293E cells for transient expression of antibody protein. 1.2 ⁇ g of each (heavy and light) plasmid DNA was transfected into 2 x 10 6 cells with Qiagen' s Effectene Transfection Protocol (Qiagen, CA). Cells were incubated at 37°C for 3 days. Supernatant was harvested and full-length antibody confirmed by both Western Blot and ELISA methods. The ability of full.IgG4.P to bind to IGF-IR was confirmed by ELISA.
  • variable, as well as the light chain constant regions were subcloned into an alternate splice expression vector.
  • the alternate splice configuration links the light and heavy chain through the usage of a single splice donor with two splice acceptors where each splice acceptor generates a transcript encoding one of the two chains.
  • the expression vector DNA encoding the immunoglobulin genes was electroporated into insulin independent Chinese hamster ovary cells (CHO DG44i). A CHO transfectoma (cell line 40B5) was selected for production purposes.
  • pXWU007 - an "empty" expression vector contains a human gamma 4 constant region (heavy chain) as well as separate promoter-enhancers and polyadenylation regions for gene expression in mammalian cells, but does not contain variable domains.
  • the heavy chain polypeptide contains two amino acid substitutions, S228P and T299A, to reduce "half-antibody” formation and eliminate N- linked glycosylation, respectively.
  • variable (VL) and constant (CL) domains of the light chain gene of M13-C06 and the variable (VH) domain of the heavy chain gene of M13-C06 was cloned into the expression vector pXWU007.
  • the pXWU007 vector contains cloning sites for inserting the entire light chain and variable heavy cDNAs directly upstream of the human heavy chain constant region.
  • this expression vector contains a dihydrofolate reductase (DHFR) gene that can be used for selection in mammalian cells.
  • DHFR dihydrofolate reductase
  • the resulting expression vector was then transfected into CHO cells to initiate the generation of the anti-IGF-lR secreting CHO cell lines (40B5).
  • PXWU022 was electroporated into CHO cells.
  • Immunoglobulin light chain specific PCR primers were used to PCR amplify the Fab light chain cDNA.
  • the 5' specific oligo sequence included the native signal peptide from the light chain of the Biogen pou anti-CD23 molecule.
  • the 5' and 3' oligos contain Sfi I and Asc I restriction endonuclease recognition sequences, respectively, for subcloning into an intermediate vector (pHLP025).
  • the VH cDNA was PCR amplified using a 5' oligo that included a synthetic heavy chain signal peptide.
  • the 5' and 3' oligos contain Nco I and Sfi I restriction endonuclease recognition sequences, respectively, for subcloning into an intermediate vector (pHLP029).
  • the DNA vector (pXWU022) was prepared in HEBS buffer at a concentration of
  • DHFR expression began immediately as the cells were inoculated in nucleoside free medium. Cells were eventually expanded to 125 mL shake flasks in CHOM24 ( ⁇ 3 weeks). To isolate clonal cell lines, the transfected stable pools were diluted and plated at 1 cell/well in 200 ⁇ L CHOM 16 on four 96-well plates. Plates were maintained at 36°C until they were screened for antibody titer.
  • CHO colonies were screened for immunoglobulin production by assaying cell supematants using an ELISA specific for the human kappa chain (day 21 to day 28 after plating).
  • the capture antibody used in the ELISA was a polyclonal goat anti-human IgG (SouthernBiotech) and the detection antibody was a polyclonal goat anti-human kappa conjugated to horseradish peroxidase (SouthernBiotech). Colonies secreting the highest amount of immunoglobulin were expanded.
  • a total of 381 nearly confluent wells of the 1920 wells seeded were assayed. Of the 381 wells, 60 were expanded for further study and of these 60, 4 were selected for amplification (15A7, 40B3, 40B5, 40F6).
  • SUPERDEX 200 Size Exclusion aggregate removal step involved equilibration of SUPERDEXTM 200 with IX PBS with 1.5 column volumes at a flow rate of 36 cm/hr followed by loading of protein and collecting desired fractions. Identity testing performed as follows
  • ABI protein sequencer equipped with an on-line PTH analyzer. The sequences for the initial amino acids of the light chain and heavy chain were identified.
  • Purity testing was performed by; 1) SDS-Page or CE-SDS: Reduced and non- reduced samples, this technique is used to measure antibody fragmentation, aggregation and impurities, 2) SEC-HPLC with LS and RI technique was used to measure aggregation and fragmentation and light scattering determines the molar mass of sample components. 3) SDS gel or capillary EEF method was used to determine the isoelectric focusing pattern and pi distribution of charge isoforms that can result from C- and N- terminal heterogeneity and/or deamidation.
  • Figure 6 shows non-reduced and reduced SDS PAGE analysis of G4.P.agly versions of fully human M13-C06 and M14-C03 antibodies. Both G4.P and G4.P.agly versions of antibodies M13-C06, M14-C03, M14-B01, and M14-G11 were produced. M12-E01 and M12-G04 were produced on as the G4.P version.
  • the plate was washed with phosphate-buffered saline (PBS, Irvine Scientif ⁇ c,Cat#9240), pH 7.4 plus 0.025% Tween 20 in the Skan Washer 300 (Skatron Instruments), blocked with buffer containing 1% nonfat milk, 0.05% Tween 20 in PBS, pH 7.4, and then incubated at room temperature for 1 hour. After incubation plate was washed with PBS plus 0.025% Tween 20 in the Skan Washer 300. For the assay, the soluble IGF-I receptor-coated plate was next incubated with the control and test antibodies of varied concentrations, diluted in 1% nonfat milk, 0.05% Tween 20 in PBS at 50 ⁇ l/well.
  • PBS phosphate-buffered saline
  • Skan Washer 300 Skatron Instruments
  • Figure 7 (A) shows the concentration dependent binding of G4 version of M13-
  • Figure 7 (B) shows the concentration dependent binding of G4.P.agly version of
  • Tumor cell lines MCF-7 and Calu-6 were cultured in Minimum Essential Medium Eagle (ATCC, Cat#30-2003) supplemented with 10% fetal bovine serum (FBS) (Irvine Scientific, Cat#3000A) and 50 ⁇ /ml gentamicin (Gibco Invitrogen, Cat#15750-060).
  • Panc-1, Colo-205, NCI-H23 and ZR-75 were cultured in RPMI-1640 (ATCC, Cat#30-2001) supplemented with 10% FBS and 50 ⁇ g/ml gentamicin. Trypsin-EDTA (Sigma, Cat#T4049) solution was used for removal of adherent cells from culture vessels.
  • Cells were rinsed twice with phosphate buffered saline (PBS) (Irvine Scientific,
  • Figure 8 shows the concentration dependent binding of M13-C06.G4.P.agly,
  • IGF-2 binding to soluble IGF-IR-Fc was determined.
  • the IgG4 versions of M13- C06, M14-G11, M14-B01, M12-E01 and M12-G04 blocked both IGF-I and IGF-2 binding to IGF-IR, whereas M14-C03 only blocked IGF-2 ( Figure 9 (A) and (B)).
  • the ligand blocking ability of the anti-IGF-lR antibody was determined by a solid phase RIA capture method as described in Example 3.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Oncology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Hematology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

The invention relates to antibodies which bind to insulin like growth factor receptor -1 (IGF-IR) and uses thereof, in particular in the diagnosis and treatment of cancer. Specific human and murine monoclonal antibodies which inhibit IGF-lR-mediated pro-survival and tumor proliferation pathways, and variants, fragments, and derivatives thereof are provided. Also provided are specific human and murine monoclonal antibodies which block the ability of the ligands, insulin like growth factor 1 (IGF-I) and insulin like growth factor 2 (IGF-2) to bind to IGF-IR, as well as fragments, variants and derivatives of such antibodies. The invention also includes polynucleotides encoding the above antibodies or fragments, variants or derivatives thereof, as well as vectors and host cells comprising such polynucleotides. The invention further includes methods of diagnosing and treating cancer using antibodies of the invention.

Description

ANTI-IGF-IR ANTIBODIES AND USES THEREOF
BACKGROUND OF THE INVENTION
[0001] A number of epidemiological studies have shown that higher than normal circulating levels of IGF-I are associated with increased risk for several common cancers, including breast (Hankinson et al, Lancet 1998.351:1393-6), prostate (Chan et al, Science. 1998. 279:563-6), lung (Yu et al, J. Natl. Cancer Inst.1999. 91:151-6) and colorectal cancers (Ma et al, J. Natl. Cancer Inst.1999. 91:620-5). Elevated circulating levels of IGF-2 also have been shown to be associated with increases risk for endometrial cancer (Jonathan et al, Cancer Biomarker & Prevention. 2004. 13:748-52). On the contrary, inverse correlation was observed with elevated levels of one of the IGF binding proteins, IGF-BP3, and cancer risk. Furthermore, elevated levels of IGFs have also been found in cancer patients (Peyrat et al Eur. J. Cancer. 1993. 351:1393-6; Jonathan et al, Cancer Biomarker & Prevention. 2004. 13:748-52).
[0002] IGF system plays an important role in regulating cell proliferation, differentiation, apoptosis and transformation (Jones et al, Endocrinology Rev. 1995. 16:3-34). The IGF system comprises of two types of unrelated receptors, the insulin like growth factor receptor 1 (IGF-IR; CD221) and insulin like growth factor receptor 2 (IGF-2R; CD222); two ligands, insulin like growth factor 1 (IGF-I and IGF-2); several IGF binding proteins (IGFBP-I to IGFBP-6). In addition, a large group of IGFBP proteases (e.g.: caspases, metalloproteinases, prostate-specific antigen) hydrolyze IGF bound IGFBP to release free IGFs, which then interact with IGF-IR and IGF-2R. The IGF system is also intimately connected to insulin and insulin receptor (InsR) (Moschos et al. Oncology 2002. 63:317- 32; Baserga et al., Int J. Cancer. 2003. 107:873-77; Pollak et al., Nature Reviews Cancer. 2004. 4:505-516).
[0003] m a cancer cell, receptor tyrosine kinases (TK) play important role in connecting the extra-cellular tumor microenvironment to the intracellular signaling pathways that control diverse cellular functions, such as, cell division cycle, survival, apoptosis, gene expression, cytoskeletal architecture, cell adhesion, and cell migration. As the mechanisms controlling cell signaling are better understood, therapeutic strategies of disrupting one or more of these cellular functions could be developed by targeting at the level of ligand binding, receptor expression/recycling, receptor activation and the proteins involved in the signaling events (Hanahan and Weinberg, Cell 2000. 100:57-70).
[0004] The type I insulin like growth factor receptor (IGF-IR, CD221) belongs to receptor tyrosine kinase (RTK) family, (Ullrich et al., Cell.1990., 61:203-12). IGF-IR is widely expressed and its ligands, IGF-I and IGF-2 play a significant role in pre- and postnatal development, growth hormone responsiveness, cell transformation, survival, and have been implicated in the acquisition of an invasive and metastatic tumor phenotype (Baserga, Cell. 1994. 79:927-30; Baserga et al., Exp. Cell Res. 1999. 253:1-6, Baserga et al., Int J. Cancer. 2003. 107:873-77). Immunohistochemical studies have shown that a number of human tumors express higher levels of IGF-IR.
[0005] The molecular architecture of IGF-IR comprises, two extra-cellular α subunits
(130-135 kD) and two membrane spanning β subunits (95 kD) that contain the cytoplasmic catalytic kinase domain. IGF-IR, like the insulin receptor (InsR), differs from other RTK family members by having covalent dimeric (α2β2) structures. Structurally, IGF-IR is highly related to LnsR (Pierre De Meyts and Whittaker, Nature Reviews Drug Discovery. 2002, 1: 769-83). IGF-IR contains 84% sequence identity to InsR at the kinase domain, whereas the juxta-membrane and the c-terminal regions share 61% and 44% sequence identity, respectively (Ulrich et al., EMBO J., 1986, 5:2503-12; Blakesley et al., Cytokine Growth Factor Rev., 1996. 7:153-56).
[0006] The IGF-I and IGF-2 are the two activating ligands of IGF-IR. The binding of
IGF-I and IGF-2 to the α chain induces conformational changes that result in auto- phosphorylation of each β-chain at specific tyrosine residues, converting the receptor from unphoshorylated state to the active state. The activation of three tyrosine residues in the activation loop (Tyr residues at 1131,1135 and 1136) of the kinase domain leads to increase in catalytic activity that triggers docking and phosphorylation of the substrates such as IRS-I and She adaptor proteins. Activation of these substrates leads to phosphorylation of additional proteins involved in the signaling cascade of survival (PI3K, AKT, TOR, S6) and/or proliferation (mitogen-activated protein kinase, p42/p44) (PoUak et al., Nature Reviews Cancer. 2004. 4:505-516; Baserga et al., Biochem Biophys Act. 1997. 1332:F105-F126; Baserga et al, Int. J. Cancer. 2003. 107:873-77).
[0007] Despite the high degree of homology between IGF-IR and InsR, evidence suggests that the two receptors have distinct biological roles; InsR is a key regulator of physiological functions such as glucose transport and biosynthesis of glycogen and fat, whereas the IGF-IR is a potent regulator of cell growth and differentiation. In contrast to InsR, IGF-IR is ubiquitously expressed in tissues where it plays a role in tissue growth, under the control of growth hormone (GH), which modulates IGF-I. Although IGF-IR activation has been shown to promote normal cell growth, experimental evidence suggests that IGF-IR is not an absolute requirement (Baserga et al, Exp Cell Res. 1999. 253:1-6; Baserga et al, Int. J. Cancer. 2003. 107:873-77).
[0008] IGFs play a crucial role in regulating cell proliferation, differentiation and apoptosis. Inhibition of IGF-IR mediated signaling has been shown to reduce tumor growth rate, increase apoptosis, increase killing of tumors by chemotherapy and other molecular target therapies (reviewed in Pollak et al., Nature Reviews Cancer. 2004. 4:505-516; Zhang et al., Breast Cancer Res. 2000. 2:170-75; Chakravarti et al, Cancer Res.2002. 62:200-07).
[0009] Experimental approaches undertaken to inhibit IGF-IR function in tumors have provided encouraging but limited success, and their effectiveness in treating cancer is yet to be determined in the clinic. The experimental approaches include; antibodies to IGF- IR (KuIl et al., J. Biol. Chem. 1983, 258:6561-66; Kalebic et al., Cancer Res. 1994. 54:5531-4), neutralizing antibodies to IGF-I or IGF-2 (Fang et al, MoI. Cancer Therapy. 2006. 5:114-20; Miyamoto et al, Clin. Cancer Res. 2005, 11:3494-502), small-molecule tyrosine kinase inhibitors (Garcia-Escheverria et al, Cancer Cell. 2004. 5:231-9; Scotlandi et al, Cancer Res. 2005. 65:3868-76), antisense oligonucleotides (Shapiro et al, J.Clin. Invest. 1994. 94:1235-42; Wraight et al. Nature Biotech. 2000. 18:521-26; Scotlandi et al, Cancer Gene Therapy. 2002. 9:296-07), dominant-negative mutants of IGF-IR (Prager et al , Proc. Natl. Acad. Sci.1994, 91:2181-85; Kalebic et al., Int. J. Cancer 1998. 76:223-7; Scotlandi et al., Int J. Cancer. 2002:101:11-6), analogues of the IGF ligand (Pietrzkowski et al, MoI. Cell. Biol. 1992. 12:3883-89), recombinant IGF binding proteins (Yee et al. Cell growth Differ. 1994. 5:73-77; Van Den Berg et al, Eur. J. Cancer. 1997, 33:1108- 1113; Jerome et al AACR 2004, Abstract # 5334), antagonists of GH-releasing hormone, GHRH (Szereday et al, Cancer Res. 2003. 63:7913-19; Letsh et al, Proc Natl. Acad. Sci. USA. 2003. 100:1250-55) and GH (Kopchick et al, 2002. Endocr. Rev. 23, 623-46).
[0010] The ability of an antibody to inhibit IGF-IR function was first demonstrated with a mouse monoclonal antibody (α -IR3) targeting an unknown epitope in the α subunit of IGF-IR (KuIl et al., J. Biol. Chem. 1983, 258:6561-66). Subsequently other antibodies developed to the α subunit of IGF-IR have been shown to inhibit IGF-IR function to varying degrees in different experimental cancer models (Maloney et al. Cancer Res. 2003. 63: 5073-83; Burtrum et al, Cancer Res. 2003. 63:8912-21; Sachdev D et al, Cancer Res.2003. 63, 627-35; Cohen et al, Clin. Cancer Res.2005. 11:3065-74; Goetsch et al, Intl. J. Cancer. 2005. 113:316-28. Lu et al, J. Biol. Chem. 2004. 280:19665-72).
[0011] In a cancer cell, in addition to pro-survival and proliferative signaling, activation of IGF-IR has also been shown to be involved in motility and invasion (Ress et al., Oncogene 2001. 20:490-00, Nolan et al, Int. J. Cancer.1997.72:828-34, Stracke et al, J. Biol. Chem. 1989. 264:21544-49; Jackson et al, Oncogene, 2001. 20:7318-25).
[0012] Tumor cells have been shown to produce one or more of the components of the
IGF system (IGF-I, IGF-2, IGF-IR, IGF-2R and IGF-BPs). Although in vitro studies have indicated that tumors can produce IGF-I or IGF-2, translational studies indicate that IGF-2 is the more relevant and commonly expressed IGF in the tumors. This is due to loss of imprinting (LOI) of the silenced IGF-2 allele in the tumor by epigenetic alterations, resulting in biallelic expression of the IGF-2 gene (Fienberg et al., Nat. Rev. Cancer 2004. 4:143-53; Giovannucci et al, Horm. Metab. Res. 2003. 35:694-04; De Souza et al, FASEB J. et al, 1997. 11:60-7). This in turn results in increased IGF-2 supply to cancer cells and to the microenvironment supporting tumor growth.
[0013] IGF-IR sensitive tumors receive receptor activation signals of IGF-I from the circulation (liver produced) and IGF-2 from the tumor, and thus approaches aimed at disrupting the biological activity mediated by both IGF-I and IGF-2 should provide a better anti- tumor response. Therefore, anti-IGF-lR antibody methods that effectively block the biological functions mediated by both IGF-I and IGF-2 may provide an improved 1 efficacy over other approaches that do not efficiently block the biological functions of both IGF- land IGF-2 mediated IGF-IR signaling in tumor microenvironment.
[0014] With regard to safety, IGF-IR is ubiquitously expressed and thus antibodies targeting IGF-IR should have minimal or no effector functions to avoid toxicities resulting from ADCC and CDC activities in normal tissues. One possibility of developing such antibodies is to have the non-glycosylated form of the human gamma 4 Fc region, which does not mediate ADCC or CDC functions.
[0015] IGF-IR is involved in oncogene mediated cellular transformation.
[0016] IGFAGF-IR activation mediates mitogenic and pro-survival signaling in cancer cell.
[0017] IGF-IR activation also promotes cell motility and metastasis.
[0018] IGF-IR is over expressed in many cancers. [0019] Individuals with higher than normal circulating IGF levels have increased risk for developing cancer.
[0020] Increased plasma levels of IGF 1 & 2 found in many cancer patients.
[0021] Human tumors produce IGF-2 as an autocrine growth factor.
[0022] Inhibition of tumor growth has been demonstrated as single agent and in combination with chemotherapeutic and biological agents. [0023] There remains a need in the art for IGF-IR antibodies with different or improved binding, efficacy, and safety characteristics for the treatment of various neoplastic diseases including cancer and metastases thereof.
BRIEF SUMMARY OF THE INVENTION
[0024] The present invention is based on the important role of the IGF system in regulating cell proliferation, differentiation, apoptosis and transformation. In particular, type I insulin like growth factor receptor (IGF-IR) and its ligands, IGF-I and IGF-2, play a significant role in pre- and post-natal development, growth hormone responsiveness, cell transformation, survival, and have been implicated in the acquisition of an invasive and metastatic tumor phenotype. The invention relates generally to IGF-IR antibodies, antigen binding fragments or derivatives thereof. Certain IGF-IR antibodies and antigen- binding fragments inhibit IGF-IR function or block the biological functions of IGF- land IGF-2 mediated IGF-IR signaling. Additionally, the invention generally relates to methods for treating various neoplastic diseases including cancer and metastases, as well as various hyperproliferative disease, disorders or injuries associated with IGF-IR signaling.
[0025] In some embodiments, the invention provides an isolated antibody or antigen- binding fragment thereof which specifically binds to the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of Ml 3- C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and PlG10.2B8.
[0026] In some embodiments, the invention provides an isolated antibody or antigen- binding fragment thereof which specifically binds to IGF-Rl, where the antibody or fragment competitively inhibits a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8 from binding to IGF-Rl.
[0027] In some embodiments, the invention provides an isolated antibody or antigen- binding fragment thereof which specifically binds to IGF-Rl, where the antibody or fragment thereof comprises an antigen binding domain identical to that of a monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14- C03, M14-B01, M12-E01, and M12-G04, or a monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24Bll, PlE2.3B12, and PlG10.2B8.
[0028] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the heavy chain variable region (VH) of the antibody or fragment thereof comprises an amino acid sequence at least 90% identical to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 9, SEQ ID NO: 14, SEQ ID NO: 20, SEQ ID NO: 26, SEQ ID NO: 32, SEQ ID NO: 38, SEQ ID NO: 43, SEQ ID NO: 48, SEQ ID NO: 53, SEQ ID NO: 58, and SEQ ID NO: 63.
[0029] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the light chain variable region (VL) of the antibody or fragment thereof comprises an amino acid sequence at least 90% identical to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 68, SEQ ID NO: 73, SEQ ID NO: 78, SEQ ID NO: 83, SEQ ID NO: 88, SEQ ID NO: 93, SEQ ID NO: 98, SEQ ID NO: 103, SEQ ID NO: 108, SEQ ID NO: 113, and SEQ ID NO: 118.
[0030] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH of the antibody or fragment thereof comprises an amino acid sequence identical, except for 20 or fewer conservative amino acid substitutions, to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 9, SEQ ID NO: 14, SEQ ID NO: 20, SEQ ID NO: 26, SEQ ID NO: 32, SEQ ID NO: 38, SEQ ID NO: 43, SEQ ID NO: 48, SEQ ID NO: 53, SEQ ID NO: 58, and SEQ ID NO: 63.
[0031] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VL of the antibody or fragment thereof comprises an amino acid sequence identical, except for 20 or fewer conservative amino acid substitutions, to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 68, SEQ ID NO: 73, SEQ ID NO: 78, SEQ ID NO: 83, SEQ ID NO: 88, SEQ ID NO: 93, SEQ ID NO: 98, SEQ ID NO: 103, SEQ ID NO: 108, SEQ ID NO: 113, and SEQ ID NO: 118.
[0032] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH of the antibody or fragment thereof comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 9, SEQ ID NO: 14, SEQ ED NO: 20, SEQ ID NO: 26, SEQ ID NO: 32, SEQ ID NO: 38, SEQ ID NO: 43, SEQ ID NO: 48, SEQ ID NO: 53, SEQ ID NO: 58, and SEQ ID NO: 63.
[0033] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VL of the antibody or fragment thereof comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 68, SEQ ID NO: 73, SEQ ID NO: 78, SEQ ID NO: 83, SEQ ID NO: 88, SEQ ID NO: 93, SEQ ID NO: 98, SEQ ID NO: 103, SEQ ID NO: 108, SEQ ID NO: 113, and SEQ ID NO: 118.
[0034] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH and VL of the antibody or fragment thereof comprise, respectively, amino acid sequences at least 90% identical to reference amino acid sequences selected from the group consisting of: SEQ ID NO: 4 and SEQ ID NO: 68; SEQ ID NO: 8 and SEQ ID NO: 73; SEQ ID NO: 14 and SEQ ID NO: 78; SEQ ID NO: 20 and SEQ ID NO: 83; SEQ ID NO: 26 and SEQ ID NO: 88; SEQ ID NO: 32 and SEQ ID NO: 93; SEQ ID NO: 38 and SEQ ID NO: 98; SEQ ID NO: 43 and SEQ ID NO: 103; SEQ ID NO: 48 and SEQ ID NO: 108; SEQ ID NO: 53 and SEQ ID NO: 103; SEQ TD NO: 58 and SEQ ID NO: 113; and SEQ ID NO: 63 and 118.
[0035] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH and VL of the antibody or fragment thereof comprise, respectively, amino acid sequences identical, except for 20 or fewer conservative amino acid substitutions each, to reference amino acid sequences selected from the group consisting of: SEQ ID NO: 4 and SEQ ID NO: 68; SEQ ID NO: 8 and SEQ ID NO: 73; SEQ ID NO: 14 and SEQ ID NO: 78; SEQ ID NO: 20 and SEQ ID NO: 83; SEQ ID NO: 26 and SEQ ID NO: 88; SEQ ID NO: 32 and SEQ ID NO: 93; SEQ ID NO: 38 and SEQ ID NO: 98; SEQ ID NO: 43 and SEQ ID NO: 103; SEQ ID NO: 48 and SEQ ID NO: 108; SEQ ID NO: 53 and SEQ ID NO: 103; SEQ ID NO: 58 and SEQ ID NO: 113; and SEQ ID NO: 63 and 118.
[0036] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH and VL of the antibody or fragment thereof comprise, respectively, amino acid sequences selected from the group consisting of: SEQ ID NO: 4 and SEQ ID NO: 68; SEQ ID NO: 8 and SEQ ID NO: 73; SEQ ID NO: 14 and SEQ BD NO: 78; SEQ ID NO: 20 and SEQ ID NO: 83; SEQ ID NO: 26 and SEQ ID NO: 88; SEQ ED NO: 32 and SEQ ED NO: 93; SEQ DD NO: 38 and SEQ ID NO: 98; SEQ ID NO: 43 and SEQ ID NO: 103; SEQ ED NO: 48 and SEQ ID NO: 108; SEQ ID NO: 53 and SEQ ID NO: 103; SEQ ID NO: 58 and SEQ ID NO: 113; and SEQ ID NO: 63 and 118.
[0037] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH of the antibody or fragment thereof comprises a Kabat heavy chain complementarity determining region-1 (VH- CDRl) amino acid sequence identical, except for two or fewer amino acid substitutions, to a reference VH-CDRl amino acid sequence selected from the group consisting of: SEQ ID NO: 5, SEQ ED NO: 10, SEQ ED NO: 15, SEQ ID NO: 21, SEQ ID NO: 27, SEQ ID NO: 33, SEQ ID NO: 39, SEQ ID NO: 44, SEQ ID NO: 49, SEQ ID NO: 54, SEQ ID NO: 59, and SEQ ID NO: 64. In further embodiments, the VH-CDRl amino acid sequence is selected from the group consisting of: SEQ ID NO: 5, SEQ ID NO: 10, SEQ ID NO: 15, SEQ ID NO: 21, SEQ ED NO: 27, SEQ ED NO: 33, SEQ ID NO: 39, SEQ ED NO: 44, SEQ ID NO: 49, SEQ ID NO: 54, SEQ ED NO: 59, and SEQ ID NO: 64.
[0038] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH of the antibody or fragment thereof comprises a Kabat heavy chain complementarity determining region-2 (VH- CDR2) amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VH-CDR2 amino acid sequence selected from the group consisting of: SEQ ID NO: 6, SEQ ED NO: 11, SEQ ED NO: 16, SEQ ID NO: 22, SEQ ED NO: 28, SEQ ID NO: 34, SEQ ID NO: 40, SEQ ID NO: 45, SEQ ID NO: 50, SEQ ID NO: 55, SEQ ID NO: 60, and SEQ ID NO: 65. In further embodiments, the VH-CDR2 amino acid sequence is selected from the group consisting of: SEQ ID NO: 6, SEQ ID NO: 11, SEQ ID NO: 16, SEQ ED NO: 22, SEQ ED NO: 28, SEQ ED NO: 34, SEQ ID NO: 40, SEQ ED NO: 45, SEQ ID NO: 50, SEQ ED NO: 55, SEQ ID NO: 60, and SEQ ID NO: 65. [0039] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH of the antibody or fragment thereof comprises a Kabat heavy chain complementarity determining regjon-3 (VH- CDR3) amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VH-CDR3 amino acid sequence selected from the group consisting of: SEQ ID NO: 7, SEQ ID NO: 12, SEQ ID NO: 17, SEQ ID NO: 23, SEQ ID NO: 29, SEQ ID NO: 35, SEQ ID NO: 41, SEQ ID NO: 46, SEQ ID NO: 51, SEQ ID NO: 56, SEQ ID NO: 61, and SEQ ID NO: 66. In further embodiments, the VH-CDR3 amino acid sequence is selected from the group consisting of: SEQ ID NO: 7, SEQ ID NO: 12, SEQ ID NO: 17, SEQ ID NO: 23, SEQ ID NO: 29, SEQ ID NO: 35, SEQ ID NO: 41, SEQ ID NO: 46, SEQ ED NO: 51, SEQ ID NO: 56, SEQ ID NO: 61, and SEQ ID NO: 66.
[0040] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl , where the VL of the antibody or fragment thereof comprises a Kabat light chain complementarity determining region- 1 (VL-CDRl) amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VL-CDRl amino acid sequence selected from the group consisting of: SEQ ID NO: 69, SEQ ID NO: 74, SEQ ED NO: 79, SEQ ED NO: 84, SEQ ID NO: 89, SEQ ID NO: 94, SEQ ID NO: 99, SEQ ID NO: 104, SEQ ID NO: 109, SEQ ID NO: 114, and SEQ ED NO: 119. In further embodiments, the VL-CDRl amino acid sequence is selected from the group consisting of: SEQ ID NO: 69, SEQ ID NO: 74, SEQ ED NO:
79, SEQ ID NO: 84, SEQ ID NO: 89, SEQ ID NO: 94, SEQ ID NO: 99, SEQ ID NO:
104, SEQ ID NO: 109, SEQ ID NO: 114, and SEQ ID NO: 119.
[0041] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VL of the antibody or fragment thereof comprises a Kabat light chain complementarity determining region-2 (VL-CDR2) amino acid sequence identical, except for two or fewer amino acid substitutions, to a reference VL-CDR2 amino acid sequence selected from the group consisting of: SEQ ED NO: 70, SEQ ID NO: 75, SEQ ID NO: 80, SEQ ID NO: 85, SEQ ID NO: 90, SEQ ED NO: 95, SEQ ID NO: 100, SEQ ID NO: 105, SEQ ID NO: 110, SEQ ID NO: 115, and SEQ ED NO: 120. In further embodiments, the VL-CDR2 amino acid sequence is selected from the group consisting of: SEQ ID NO: 70, SEQ ID NO: 75, SEQ ED NO:
80, SEQ ED NO: 85, SEQ ID NO: 90, SEQ ID NO: 95, SEQ ID NO: 100, SEQ ED NO:
105, SEQ ED NO: 110, SEQ ID NO: 115, and SEQ ED NO: 120. [0042] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VL of the antibody or fragment thereof comprises a Kabat light chain complementarity determining region-3 (VL-CDR3) amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VL-CDR3 amino acid sequence selected from the group consisting of: SEQ ID NO: 71, SEQ ID NO: 76, SEQ ED NO: 81, SEQ ID NO: 86, SEQ ID NO: 91, SEQ ID NO: 96, SEQ ID NO: 101, SEQ ID NO: 106, SEQ ID NO: 111, SEQ ID NO: 116, and SEQ ID NO: 121. In further embodiments, the VL-CDR3 amino acid sequence is selected from the group consisting of: SEQ ID NO: 71, SEQ ID NO: 76, SEQ ID NO: 81, SEQ ID NO: 86, SEQ ID NO: 91, SEQ ID NO: 96, SEQ ID NO: 101, SEQ ID NO: 106, SEQ ID NO: 111, SEQ ID NO: 116, and SEQ ID NO: 121.
[0043] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH of the antibody or fragment thereof comprises VH-CDRl, VH-CDR2, and VH-CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 5, 6, and 7; SEQ ID NOs: 10, 11, and 12; SEQ ID NOs: 15, 16, and 17; SEQ ED NOs: 21, 22, and 23; SEQ ID NOs: 27, 28, and 29; SEQ TD NOs: 33, 34, and 35; SEQ ID NOs: 39, 40, and 41;. SEQ ID NOs: 44, 45, and 46; SEQ ID NOs: 49, 50, and 51; SEQ ID NOs: 54, 55, and 56; SEQ ID NOs: 59, 60, and 61; and SEQ ID NOs: 64, 65, and 66, except for one, two, three, or four amino acid substitutions in at least one of said VH-CDRs.
[0044] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VH of the antibody or fragment thereof comprises VH-CDRl, VH-CDR2, and VH-CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 5, 6, and 7; SEQ ID NOs: 10, 11, and 12; SEQ ID NOs: 15, 16, and 17; SEQ ID NOs: 21, 22, and 23; SEQ ID NOs: 27, 28, and 29; SEQ ID NOs: 33, 34, and 35; SEQ ID NOs: 39, 40, and 41 ;. SEQ ID NOs: 44, 45, and 46; SEQ ID NOS: 49, 50, and 51; SEQ BD NOs: 54, 55, and 56; SEQ ID NOs: 59, 60, and 61; and SEQ ID NOs: 64, 65, and 66.
[0045] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl, where the VL of the antibody or fragment thereof comprises VL-CDRl, VL-CDR2, and VL-CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 69, 70, and 71; SEQ H) NOs: 74, 75, and 76; SEQ ID NOs: 79, 80, and 81; SEQ ID NOs: 84, 85, and 86; SEQ ID NOs: 89, 90, and 91;
SEQ ED NOs: 94, 95, and 96; SEQ ID NOs: 99, 100, and 101; SEQ ID NOs: 104, 105, and 106; SEQ ID NOs: 109, 110, and 111; SEQ ID NOs: 114, 115, and 116; and SEQ ID
NOs: 119, 120, and 121, except for one, two, three, or four amino acid substitutions in at least one of said VL-CDRs. [0046] In some embodiments, the invention provides an isolated antibody or fragment thereof which specifically binds to IGF-Rl , where the VL of the antibody or fragment thereof comprises VL-CDRl, VL-CDR2, and VL-CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 69, 70, and 71; SEQ ID NOs: 74, 75, and 76;
SEQ ID NOs: 79, 80, and 81; SEQ ID NOs: 84, 85, and 86; SEQ ID NOs: 89, 90, and 91;
SEQ ID NOs: 94, 95, and 96; SEQ ID NOs: 99, 100, and 101; SEQ ID NOs: 104, 105, and 106; SEQ ID NOs: 109, 110, and 111; SEQ ID NOs: 114, 115, and 116; and SEQ ID
NOs: 119, 120, and 121. [0047] In various embodiments of the above-described antibodies or fragments thereof, the VH framework regions and/or VL framework regions are human, except for five or fewer amino acid substitutions. [0048] In some embodiments, the above-described antibodies or fragments thereof bind to a linear epitope or a non-linear conformation epitope [0049] In some embodiments, the above-described antibodies or fragments thereof are multivalent, and comprise at least two heavy chains and at least two light chains. [0050] In some embodiments, the above-described antibodies or fragments thereof are multispecific. In further embodiments, the above-described antibodies or fragments thereof are bispecific. [0051] In various embodiments of the above-described antibodies or fragments thereof, the heavy and light chain variable domains are fully human. In further embodiments, the heavy and light chain variable domains are from a monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-
E01, and M12-G04. [0052] In various embodiments of the above-described antibodies or fragments thereof, the heavy and light chain variable domains are murine. In further embodiments, the heavy and light chain variable domains are from a monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11,
20D8.24B11, P1E2.3B12, and P1G10.2B8. [0053] In various embodiments, the above-described antibodies or fragments thereof are humanized. [0054] In various embodiments, the above-described antibodies or fragments thereof are chimeric.
[0055] In various embodiments, the above-described antibodies or fragments thereof are primatized.
[0056] In various embodiments, the above-described antibodies or fragments thereof are fully human.
[0057] In certain embodiments, the above-described antibodies or fragments thereof are
Fab fragments, Fab1 fragments, F(ab)2 fragments, or Fv fragments.
[0058] In certain embodiments, the above-described antibodies are single chain antibodies.
[0059] In certain embodiments, the above-described antibodies or fragments thereof comprise light chain constant regions selected from the group consisting of a human kappa constant region and a human lambda constant region.
[0060] In certain embodiments, the above-described antibodies or fragments thereof comprise a heavy chain constant region or fragment thereof. In further embodiments, the heavy chain constant region or fragment thereof is human IgG4. In certain other embodiments, the IgG4 is mutagenized to remove glycosylation sites. In further embodiments, the IgG4 mutations comprise S241P and T318A, using the Kabat numbering system.
[0061] In some embodiments, the above-described antibodies or fragments thereof specifically bind to an IGF-Rl polypeptide or fragment thereof, or an IGF-Rl variant polypeptide, with an affinity characterized by a dissociation constant (KD) which is less than the KD for said reference monoclonal antibody. In further embodiments, the dissociation constant (KD) is no greater than 5 x 10~2 M, 10"2 M, 5 x 10'3 M, 10'3 M, 5 x Kr4 M, It)"4 M, 5 x l(r5 M, 105 M, 5 x 106 M, 10"6 M, 5 x 1(T7 M, 10"7 M, 5 x 1(T8 M, 10" 8 M, 5 x 109 M, l(r9 M, 5 x 10"10 M, 10 10 M, 5 x 10"" M, 1(T11 M, 5 x 1(T12 M, 1(T12 M, 5 x 10 13 M, 10 13 M, 5 x 1(T14 M, 10 14 M, 5 x 10 15 M, or 10 15 M.
[0062] In some embodiments, the above-described antibodies or fragments thereof preferentially bind to a human IGF-Rl polypeptide or fragment thereof, relative to a murine IGF-Rl polypeptide or fragment thereof or a non-human primate IGF-Rl polypeptide or fragment thereof.
[0063] In certain other embodiments, the above described antibodies or fragments thereof bind to human IGF-Rl polypeptide or fragment thereof, and also binds to a non-human primate IGF-Rl polypeptide or fragment thereof. [0064] In some embodiments, the above described antibodies or fragments thereof bind to
IGF-Rl expressed on the surface of a cell. In further embodiments, the cell is a malignant cell, a neoplastic cell, a tumor cell, or a metastatic cell.
[0065] In some embodiments, the above described antibodies or fragments thereof block insulin growth factor from binding to IGF-Rl. In further embodiments, the insulin growth factor is insulin growth factor-1 (IGF-I) or insulin growth factor-2 (IGF-2). In certain embodiments, the above described antibodies or fragments thereof block both IGF-I and IGF-2 from binding to IGF-Rl .
[0066] In some embodiments, the above described antibodies or fragments thereof inhibit
IGF-Rl -mediated cell proliferation, IGF-I or IGF-2-mediated IGF-Rl phosphorylation, tumor cell growth, or IGF-Rl internalization.
[0067] hi further embodiments, the above described antibodies or fragments thereof further comprise a heterologous polypeptide fused thereto.
[0068] In some embodiments, the above described antibodies or fragments thereof are conjugated to an agent selected from the group consisting of cytotoxic agent, a therapeutic agent, cytostatic agent, a biological toxin, a prodrug, a peptide, a protein, an enzyme, a virus, a lipid, a biological response modifier, pharmaceutical agent, a lymphokine, a heterologous antibody or fragment thereof, a detectable label, polyethylene glycol (PEG), and a combination of two or more of any said agents. In further embodiments, the cytotoxic agent is selected from the group consisting of a radionuclide, a biotoxin, an enzymatically active toxin, a cytostatic or cytotoxic therapeutic agent, a prodrugs, an immunologically active ligand, a biological response modifier, or a combination of two or more of any said cytotoxic agents. In further embodiments, the detectable label is selected from the group consisting of an enzyme, a fluorescent label, a chemiluminescent label, a bioluminescent label, a radioactive label, or a combination of two or more of any said detectable labels.
[0069] In additional embodiments, the invention includes compositions comprising the above-described antibodies or fragments thereof, and a carrier.
[0070] Certain embodiments of the invention include an isolated polynucleotide comprising a nucleic acid which encodes an antibody VH polypeptide, where the amino acid sequence of the VH polypeptide is at least 90% identical to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ED NO: 9, SEQ ID NO: 14, SEQ ID NO: 20, SEQ ID NO: 26, SEQ ID NO: 32, SEQ ID NO: 38, SEQ ID
NO: 43, SEQ ID NO: 48, SEQ ID NO: 53, SEQ ID NO: 58, and SEQ ID NO: 63; and where an antibody or antigen binding fragment thereof comprising the VH polypeptide specifically binds to IGF-Rl. In further embodiments, the amino acid sequence of the VH polypeptide is selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 9, SEQ ED NO: 14, SEQ ID NO: 20, SEQ ID NO: 26, SEQ ID NO: 32, SEQ ID NO: 38, SEQ ID NO: 43, SEQ ED NO: 48, SEQ ID NO: 53, SEQ ID NO: 58, and SEQ ID NO: 63.
[0071] In certain embodiments, the nucleotide sequence encoding the VH polypeptide is optimized for increased expression without changing the amino acid sequence of the VH polypeptide. In further embodiments, the optimization comprises identification and removal of splice donor and splice acceptor sites and/or optimization of codon usage for the cells expressing the polynucleotide. In further embodiments, the nucleic acid comprises a nucleotide sequence selected from the group consisting of: SEQ ID NO: 3, SEQ ID NO: 8, SEQ ID NO: 13, SEQ ED NO: 18, SEQ ID NO: 19, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ED NO: 30, SEQ ID NO: 31, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ED NO: 42, SEQ ED NO: 47, SEQ ID NO: 52, SEQ ID NO: 57, and SEQ ID NO: 62.
[0072] In some embodiments, the invention provides an isolated polynucleotide comprising a nucleic acid which encodes an antibody VL polypeptide, where the amino acid sequence of the VL polypeptide is at least 90% identical to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 68, SEQ ED NO: 73, SEQ ID NO: 78, SEQ ID NO: 83, SEQ ID NO: 88, SEQ ID NO: 93, SEQ ID NO: 98, SEQ ID NO: 103, SEQ ED NO: 108, SEQ ID NO: 113, and SEQ ID NO: 118; and where an antibody or antigen binding fragment thereof comprising the VL polypeptide specifically binds to IGF-Rl. In further embodiments, the amino acid sequence of the VL polypeptide is selected from the group consisting of: SEQ ID NO: 68, SEQ DD NO: 73, SEQ ID NO: 78, SEQ ID NO: 83, SEQ ID NO: 88, SEQ ID NO: 93, SEQ ID NO: 98, SEQ ID NO: 103, SEQ ED NO: 108, SEQ ID NO: 113, and SEQ ED NO: 118.
[0073] In certain embodiments, the nucleotide sequence encoding the VL polypeptide is optimized for increased expression without changing the amino acid sequence of said VL polypeptide. In further embodiments, the optimization comprises identification and removal of splice donor and splice acceptor sites and/or optimization of codon usage for the cells expressing the polynucleotide. In further embodiments, the nucleic acid comprises a nucleotide sequence selected from the group consisting of: SEQ ED NO: 67, SEQ ID NO: 72, SEQ ID NO: 77, SEQ ID NO: 82, SEQ ED NO: 87, SEQ ID NO: 92, SEQ ID NO: 97, SEQ ID NO: 102, SEQ ID NO: 107, SEQ ID NO: 112, and SEQ ID NO:
117. [0074] In certain other embodiments, the invention provides an isolated polynucleotide comprising a nucleic acid which encodes an antibody VH polypeptide, where the amino acid sequence of the VH polypeptide is identical, except for 20 or fewer conservative amino acid substitutions, to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 9, SEQ ID NO: 14, SEQ ID NO: 20, SEQ ID NO: 26, SEQ ID NO: 32, SEQ ED NO: 38, SEQ ID NO: 43, SEQ ID NO: 48, SEQ ID NO: 53, SEQ ID NO: 58, and SEQ ID NO: 63; and where an antibody or antigen binding fragment thereof comprising said VH polypeptide specifically binds to IGF-Rl .
[0075] In some embodiments, the invention provides an isolated polynucleotide comprising a nucleic acid which encodes an antibody VL polypeptide, where the amino acid sequence of the VL polypeptide is identical, except for 20 or fewer conservative amino acid substitutions, to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 68, SEQ ID NO: 73, SEQ ID NO: 78, SEQ ID NO: 83, SEQ ID NO: 88, SEQ ID NO: 93, SEQ ID NO: 98, SEQ ID NO: 103, SEQ ID NO: 108, SEQ ID NO: 113, and SEQ ID NO: 118; and wherein an antibody or antigen binding fragment thereof comprising said VL polypeptide specifically binds to IGF-Rl.
[0076] In some embodiments, the invention provides an isolated polynucleotide comprising a nucleic acid which encodes a VΗ-CDR1 amino acid sequence identical, except for two or fewer amino acid substitutions, to a reference VH-CDRl amino acid sequence selected from the group consisting of: SEQ ID NO: 5, SEQ ID NO: 10, SEQ ID NO: 15, SEQ ID NO: 21, SEQ ID NO: 27, SEQ ID NO: 33, SEQ ID NO: 39, SEQ ID NO: 44, SEQ ID NO: 49, SEQ ID NO: 54, SEQ ID NO: 59, and SEQ ID NO: 64; and where an antibody or antigen binding fragment thereof comprising the VH-CDRl specifically binds to IGF-Rl. In further embodiments, the VH-CDRl amino acid sequence is selected from the group consisting of: SEQ ID NO: 5, SEQ ID NO: 10, SEQ ID NO: 15, SEQ ID NO: 21, SEQ BD NO: 27, SEQ ID NO: 33, SEQ ID NO: 39, SEQ ID NO: 44, SEQ DD NO: 49, SEQ ID NO: 54, SEQ ID NO: 59, and SEQ ID NO: 64.
[0077] In some embodiments, the invention provides an isolated polynucleotide comprising a nucleic acid which encodes a VH-CDR2 amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VH-CDR2 amino acid sequence selected from the group consisting of: SEQ ID NO: 6, SEQ DD NO: 11, SEQ DD NO: 16, SEQ DD NO: 22, SEQ DD NO: 28, SEQ DD NO: 34, SEQ DD NO: 40, SEQ DD NO: 45, SEQ ID NO: 50, SEQ DD NO: 55, SEQ DD NO: 60, and SEQ DD NO: 65; and where an antibody or antigen binding fragment thereof comprising the VH-CDR2 specifically binds to IGF-Rl. In further embodiments, the VH-CDR2 amino acid sequence is selected from the group consisting of: SEQ ID NO: 6, SEQ ID NO: 11, SEQ ID NO: 16, SEQ ID NO: 22, SEQ ID NO: 28, SEQ ID NO: 34, SEQ ID NO: 40, SEQ ID NO: 45, SEQ ID NO: 50, SEQ ID NO: 55, SEQ ID NO: 60, and SEQ ID NO: 65.
[0078] In some embodiments, the invention provides an isolated polynucleotide comprising a nucleic acid which encodes a VH-CDR3 amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VH-CDR3 amino acid sequence selected from the group consisting of: SEQ ID NO: 7, SEQ ID NO: 12, SEQ ID NO: 17, SEQ ID NO: 23, SEQ ID NO: 29, SEQ ID NO: 35, SEQ ID NO: 41, SEQ ID NO: 46, SEQ ID NO: 51, SEQ ID NO: 56, SEQ ID NO: 61, and SEQ ID NO: 66; and where an antibody or antigen binding fragment thereof comprising the VH-CDR3 specifically binds to IGF-Rl. In further embodiments, the VH-CDR3 amino acid sequence is selected from the group consisting of: SEQ ID NO: 7, SEQ ID NO: 12, SEQ ID NO: 17, SEQ ID NO: 23, SEQ ED NO: 29, SEQ ID NO: 35, SEQ ID NO: 41, SEQ ID NO: 46, SEQ ID NO: 51, SEQ ID NO: 56, SEQ ID NO: 61, and SEQ ID NO: 66.
[0079] In some embodiments, the invention provides an isolated polynucleotide comprising a nucleic acid which encodes a VL-CDRl amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VL-CDRl amino acid sequence selected from the group consisting of: SEQ ID NO: 69, SEQ ID NO: 74, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 89, SEQ ID NO: 94, SEQ ID NO: 99, SEQ ID NO: 104, SEQ ID NO: 109, SEQ ID NO: 114, and SEQ ID NO: 119; and where an antibody or antigen binding fragment thereof comprising the VL-CDRl specifically binds to IGF-Rl . In further embodiments, the VL-CDRl amino acid sequence is selected from the group consisting of: SEQ ID NO: 69, SEQ ED NO: 74, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 89, SEQ ID NO: 94, SEQ ID NO: 99, SEQ ED NO: 104, SEQ ID NO: 109, SEQ DD NO: 114, and SEQ ED NO: 119.
[0080] In some embodiments, the invention provides an isolated polynucleotide comprising a nucleic acid which encodes a VL-CDR2 amino acid sequence identical, except for two or fewer amino acid substitutions, to a reference VL-CDR2 amino acid sequence selected from the group consisting of: SEQ ID NO: 70, SEQ ED NO: 75, SEQ ID NO: 80, SEQ ID NO: 85, SEQ ID NO: 90, SEQ ID NO: 95, SEQ ID NO: 100, SEQ ID NO: 105, SEQ ID NO: 110, SEQ ED NO: 115, and SEQ ED NO: 120; and wherein an antibody or antigen binding fragment thereof comprising said VL-CDR2 specifically binds to IGF-Rl. In further embodiments, the VL-CDR2 amino acid sequence is selected fiom the group consisting of: SEQ ID NO: 70, SEQ ID NO: 75, SEQ ID NO: 80, SEQ ID NO: 85, SEQ ID NO: 90, SEQ ID NO: 95, SEQ ID NO: 100, SEQ ID NO: 105, SEQ ID NO: 110, SEQ ID NO: 115, and SEQ ID NO: 120.
[0081] In some embodiments, the invention provides an isolated polynucleotide comprising a nucleic acid which encodes a VL-CDR3 amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VL-CDR3 amino acid sequence selected from the group consisting of: SEQ ID NO: 71, SEQ ID NO: 76, SEQ ID NO: 81, SEQ ID NO: 86, SEQ ED NO: 91, SEQ ID NO: 96, SEQ ID NO: 101, SEQ ID NO: 106, SEQ ID NO: 111, SEQ ID NO: 116, and SEQ ID NO: 121; and wherein an antibody or antigen binding fragment thereof comprising said VL-CDR3 specifically binds to IGF-Rl. In further embodiments, the VL-CDR3 amino acid sequence is selected from the group consisting of: SEQ ID NO: 71, SEQ ID NO: 76, SEQ ID NO: 81, SEQ DO NO: 86, SEQ ID NO: 91, SEQ ID NO: 96, SEQ ID NO: 101, SEQ ID NO: 106, SEQ ID NO: 111, SEQ ID NO: 116, and SEQ ID NO: 121.
[0082] In some embodiments, the invention provides an isolated polynucleotide comprising a nucleic acid which encodes an antibody VH polypeptide, where the VH polypeptide comprises VH-CDRl, VH-CDR2, and VH-CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 5, 6, and 7; SEQ ID NOs: 10, 11, and 12; SEQ ID NOs: 15, 16, and 17; SEQ ID NOs: 21, 22, and 23; SEQ ID NOs: 27, 28, and 29; SEQ ID NOs: 33, 34, and 35; SEQ ID NOs: 39, 40, and 41;. SEQ ID NOs: 44, 45, and 46; SEQ ID NOs: 49, 50, and 51; SEQ ID NOs: 54, 55, and 56; SEQ ID NOs: 59, 60, and 61; and SEQ ID NOs: 64, 65, and 66; and where an antibody or antigen binding fragment thereof comprising the VL-CDR3 specifically binds to IGF-Rl.
[0083] In some embodiments, the invention provides an isolated polynucleotide comprising a nucleic acid which encodes an antibody VL polypeptide, wherein said VL polypeptide comprises VH-CDRl, VH-CDR2, and VH-CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 69, 70, and 71; SEQ DD NOs: 74, 75, and 76; SEQ ID NOs: 79, 80, and 81; SEQ ID NOs: 84, 85, and 86; SEQ ID NOs: 89, 90, and 91; SEQ ID NOs: 94, 95, and 96; SEQ ID NOs: 99, 100, and 101; SEQ ED NOs: 104, 105, and 106; SEQ ID NOs: 109, 110, and 111; SEQ ID NOs: 114, 115, and 116; and SEQ ID NOs: 119, 120, and 121; and wherein an antibody or antigen binding fragment thereof comprising said VL-CDR3 specifically binds to IGF-Rl. [0084] In some embodiments, the above-described polynucleotides further comprise a nucleic acid encoding a signal peptide fused to the antibody VH polypeptide or the antibody VL polypeptide.
[0085] In certain other embodiments, the above-described polynucleotides further comprise a nucleic acid encoding a heavy chain constant region CHl domain fused to the VH polypeptide, encoding a heavy chain constant region CH2 domain fused to the VH polypeptide, encoding a heavy chain constant region CH3 domain fused to the VH polypeptide, or encoding a heavy chain hinge region fused to said VH polypeptide. In further embodiments, the heavy chain constant region is human IgG4. In certain other embodiments, the IgG4 is mutagenized to remove glycosylation sites. In further embodiments, the IgG4 mutations comprise S241P and T318A using the Kabat numbering system.
[0086] In some embodiments, the above-described polynucleotides comprise a nucleic acid encoding a light chain constant region domain fused to said VL polypeptide. In further embodiments, the light chain constant region is human kappa.
[0087] In various embodiments of the above-described polynucleotides, the antibody or antigen-binding fragment thereof comprising a polypeptide encoded by the nucleic acid specifically binds the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14- BOl, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8.
[0088] In various other embodiments of the above-described polynucleotides, the antibody or antigen-binding fragment thereof comprising a polypeptide encoded by the nucleic acid competitively inhibits a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12- EOl, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8.
[0089] In various embodiments of the above-describe polynucleotides, the framework regions of the VH polypeptide or VL polypeptide are human, except for five or fewer amino acid substitutions.
[0090] In various embodiments of the above-described polynucleotides, the invention provides an antibody or antigen-birring fragment thereof comprising the polypeptide encoded by the nucleic acid, that binds to a linear epitope or a non-linear conformational epitope.
[00911 In various embodiments of the above-described polynucleotides, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is multivalent, and comprises at least two heavy chains and at least two light chains.
[0092J " In certain embodiments of the above-described polynucleotides, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is multispecific. In further embodiments, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is bispecific.
[0093J In various embodiments of the above-described polynucleotides, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid comprises heavy and light chain variable domains which are fully human. In further embodiments, the heavy and light chain variable domains are identical to those of a monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M 14- Gl 1, M14-C03, M14-B01, M12-E01, and M12-G04.
[0094J In certain other embodiments of the above-described polynucleotides, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid comprises heavy and light chain variable domains which are murine. In further embodiments, the heavy and light chain variable domains are identical to those of a monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8.
[0095] m various embodiments of the above-described polynucleotides, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is humanized.
[0096] In various embodiments of the above-described polynucleotides, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is primatized.
[0097J In various embodiments of the above-described polynucleotides, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is chimeric.
[00981 In some embodiments of the above-described polynucleotides, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is fully human. [0099J In various embodiments of the above-described polynucleotides, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is an Fab fragment, an Fab' fragment, an F(ab)2 fragment, or an Fv fragment. In certain embodiments of the above-described polynucleotides, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is a single chain antibody.
[0100] In some embodiments of the above-described polynucleotides, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid specifically binds to an IGF-Rl polypeptide or fragment thereof, or an IGF-Rl variant polypeptide, with an affinity characterized by a dissociation constant (KD) no greater than 5 x 10"2 M, 10"2 M, 5 x 10"3 M, 10"3 M, 5 x 1(T* M, 10^ M, 5 x 10"5 M, 10~5 M, 5 x 10"6 M, KT6 M, 5 x 107 M, 1(T7 M, 5 x 108 M, 10"8 M, 5 x 109 M, 1(T9 M, 5 x 10"10 M, 10 10 M, 5 x 10"u M, 10 " M, 5 x 10 12 M, 1(T12 M, 5 x 10 13 M, 10 13 M, 5 x 10"14 M, 10 14 M, 5 x 10'15 M, or 10-15 M.
[0101] In some embodiments of the above-described polynucleotides, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid preferentially binds to a human IGF-Rl polypeptide or fragment thereof, relative to a murine IGF-Rl polypeptide or fragment thereof or a non-human primate IGF-Rl polypeptide or fragment thereof.
[0102] In some embodiments of the above-described polynucleotides, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid binds to a human IGF-Rl polypeptide or fragment thereof, and also binds to a non-human primate IGF-Rl polypeptide or fragment thereof.
[0103] In some embodiments of the above-described polynucleotides, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid binds to IGF-Rl expressed on the surface of a cell. In further embodiments, the cell is a malignant cell, a neoplastic cell, a tumor cell, or a metastatic cell.
[0104] hi some embodiments of the above-described polynucleotides, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by said nucleic acid blocks insulin growth factor from binding to IGF-Rl. In further embodiments, the insulin growth factor is insulin growth factor- 1 (IGF-I) or insulin growth factor-2 (IGF- 2). In certain other embodiments of the above-described polynucleotide, the antibody or antigen-binding fragment thereof blocks both IGF-I and IGF-2 from binding to IGF-Rl. [0105] In some embodiments of the above-described polynucleotides, the an antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid inhibits IGF-Rl -mediated cell proliferation, inhibits IGF-I or IGF-2-mediated IGF-Rl phosphorylation, inhibits tumor cell growth or inhibits IGF-Rl internalization.
[0106] In some embodiments, the above-described polynucleotides further comprise a nucleic acid encoding a heterologous polypeptide.
[0107] In some embodiments of the above-described polynucleotides, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is conjugated to an agent selected from the group consisting of cytotoxic agent, a therapeutic agent, cytostatic agent, a biological toxin, a prodrug, a peptide, a protein, an enzyme, a virus, a lipid, a biological response modifier, pharmaceutical agent, a lymphokine, a heterologous antibody or fragment thereof, a detectable label, polyethylene glycol (PEG), and a combination of two or more of any said agents. In further embodiments, the cytotoxic agent is selected from the group consisting of a radionuclide, a biotoxin, an enzymatically active toxin, a cytostatic or cytotoxic therapeutic agent, a prodrugs, an immunologically active ligand, a biological response modifier, or a combination of two or more of any said cytotoxic agents. In certain other embodiments, the detectable label is selected from the group consisting of an enzyme, a fluorescent label, a chemiluminescent label, a bioluminescent label, a radioactive label, or a combination of two or more of any said detectable labels.
[0108] In some embodiments, the invention provides compositions comprising the above- described polynucleotides.
[0109] In certain other embodiments, the invention provides vectors comprising the above-described polynucleotides. In further embodiments, the polynucleotides are operably associated with a promoter. In additional embodiments, the invention provides host cells comprising such vectors. In further embodiments, the invention provides vectors where the polynucleotide is operably associated with a promoter.
[0110] In additional embodiments, the invention provides a method of producing an antibody or fragment thereof which specifically binds IGF-IR, comprising culturing a host cell containing a vector comprising the above-described polynucleotides, and recovering said antibody, or fragment thereof. In further embodiments, the invention provides an isolated polypeptide produced by the above-described method.
[0111] In some embodiments, the invention provides isolated polypeptides encoded by the above-described polynucleotides. [0112] In further embodiments of the above-described polypeptides, the antibody or fragment thereof comprising the polypeptide specifically binds to IGF-IR. Other embodiments include the isolated antibody or fragment thereof comprising the above- described polypeptides.
[0113] In some embodiments, the invention provides a composition comprising an isolated VH encoding polynucleotide and an isolated VL encoding polynucleotide, where the VH encoding polynucleotide and the VL encoding polynucleotide, respectively, comprise nucleic acids encoding amino acid sequences at least 90% identical to reference amino acid sequences selected from the group consisting of: SEQ ID NO: 4 and SEQ ID NO: 68; SEQ ID NO: 8 and SEQ ID NO: 73; SEQ ID NO: 14 and SEQ ID NO: 78; SEQ ID NO: 20 and SEQ ID NO: 83; SEQ ID NO: 26 and SEQ ID NO: 88; SEQ ID NO: 32 and SEQ ID NO: 93; SEQ ID NO: 38 and SEQ ID NO: 98; SEQ ID NO: 43 and SEQ ID NO: 103; SEQ ID NO: 48 and SEQ ID NO: 108; SEQ ID NO: 53 and SEQ ED NO: 103; SEQ ID NO: 58 and SEQ ID NO: 113; and SEQ ID NO: 63 and 118; and where an antibody or fragment thereof encoded by the VH and VL encoding polynucleotides specifically binds IGF-Rl. In further embodiments, the VH encoding polynucleotide and said VL encoding polynucleotide, respectively, comprise nucleic acids encoding amino acid sequences selected from the group consisting of: SEQ ID NO: 4 and SEQ ID NO: 68; SEQ ID NO: 8 and SEQ ID NO: 73; SEQ ID NO: 14 and SEQ ID NO: 78; SEQ ID NO: 20 and SEQ ID NO: 83; SEQ ID NO: 26 and SEQ ID NO: 88; SEQ ID NO: 32 and SEQ ID NO: 93; SEQ ID NO: 38 and SEQ ID NO: 98; SEQ ID NO: 43 and SEQ ID NO: 103; SEQ ID NO: 48 and SEQ ED NO: 108; SEQ ID NO: 53 and SEQ ID NO: 103; SEQ ED NO: 58 and SEQ ID NO: 113; and SEQ ID NO: 63 and 118.
[0114] In certain other embodiments, the invention provides a composition comprising an isolated VH encoding polynucleotide and an isolated VL encoding polynucleotide, where the VH encoding polynucleotide and the VL encoding polynucleotide, respectively, comprise nucleic acids encoding amino acid sequences identical, except for less than 20 conservative amino acid substitutions, to reference amino acid sequences selected from the group consisting of: SEQ ID NO: 4 and SEQ ED NO: 68; SEQ ED NO: 8 and SEQ ID NO: 73; SEQ ED NO: 14 and SEQ ID NO: 78; SEQ ID NO: 20 and SEQ ID NO: 83; SEQ ID NO: 26 and SEQ DD NO: 88; SEQ ID NO: 32 and SEQ ID NO: 93; SEQ ED NO: 38 and SEQ ED NO: 98; SEQ ED NO: 43 and SEQ ID NO: 103; SEQ DD NO: 48 and SEQ DD NO: 108; SEQ DD NO: 53 and SEQ DD NO: 103; SEQ DD NO: 58 and SEQ DD NO: 113; and SEQ DD NO: 63 and 118; and where an antibody or fragment thereof encoded by the VH and VL encoding polynucleotides specifically binds IGF-Rl. In further embodiments, the VH encoding polynucleotide encodes a VH polypeptide comprising VH-CDRl, VH-CDR2, and VH-CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 5, 6, and 7; SEQ ID NOs: 10, 11, and 12; SEQ ID NOs: 15, 16, and 17; SEQ ID NOs: 21, 22, and 23; SEQ ID NOs: 27, 28, and 29; SEQ ID NOs: 33, 34, and 35; SEQ ID NOs: 39, 40, and 41;. SEQ ID NOs: 44, 45, and 46; SEQ ID NOs: 49, 50, and 51; SEQ ID NOs: 54, 55, and 56; SEQ ID NOs: 59, 60, and 61; and SEQ ID NOs: 64, 65, and 66; where the VL encoding polynucleotide encodes a VL polypeptide comprising VL-CDRl, VL-CDR2, and VL-CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 69, 70, and 71; SEQ ID NOs: 74, 75, and 76; SEQ ID NOs: 79, 80, and 81; SEQ ID NOs: 84, 85, and 86; SEQ ID NOs: 89, 90, and 91; SEQ ID NOs: 94, 95, and 96; SEQ ID NOs: 99, 100, and 101; SEQ ID NOs: 104, 105, and 106; SEQ ID NOs: 109, 110, and 111; SEQ ID NOs: 114, 115, and 116; and SEQ ID NOs: 119, 120, and 121; and where an antibody or fragment thereof encoded by the VH and VL encoding polynucleotides specifically binds IGF-Rl.
[01151 In various embodiments of the above-described compositions, the VH encoding polynucleotide further comprises a nucleic acid encoding a signal peptide fused to the antibody VH polypeptide.
[01161 m various embodiments of the above-described compositions, the VL encoding polynucleotide further comprises a nucleic acid encoding a signal peptide fused to the antibody VL polypeptide.
[0117J hi some embodiments of the above-described compositions, the VH encoding polynucleotide further comprises a nucleic acid encoding a heavy chain constant region CHl domain fused to the VH polypeptide, further comprises a nucleic acid encoding a heavy chain constant region CH2 domain fused to the VH polypeptide, further comprises a nucleic acid encoding a heavy chain constant region CH3 domain fused to the VH polypeptide, or further comprises a nucleic acid encoding a heavy chain hinge region fused to the VH polypeptide. In further embodiments, the heavy chain constant region is human IgG4. In certain other embodiments, the IgG4 is mutagenized to remove glycosylation sites. In further embodiments, the IgG4 mutations comprise S 24 IP and T318 A using the Kabat numbering system.
[0118] In some embodiments of the above-described compositions, the VL encoding polynucleotide further comprises a nucleic acid encoding a light chain constant region domain fused to the VL polypeptide. In further embodiments, the light chain constant region is human kappa.
[0119} In some embodiments of the above-described compositions, the antibody or fragment thereof encoded by the VH and VL encoding polynucleotides specifically binds the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12- G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8.
[0120] In some embodiments of the above-described compositions, the antibody or fragment thereof encoded by the VH and VL encoding polynucleotides competitively inhibits a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8 from binding to IGF-Rl.
[0121] In some embodiments of the above-described compositions, the framework regions of the VH and VL polypeptides are human, except for five or fewer amino acid substitutions.
[0122] In some embodiments of the above-described compositions, the antibody or fragment thereof encoded by the VH and VL encoding polynucleotides binds to a linear epitope or a non-linear conformational epitope.
[0123] In some embodiments of the above-described compositions, the antibody or fragment thereof encoded by the VH and VL encoding polynucleotides is multivalent, and comprises at least two heavy chains and at least two light chains.
[0124] In some embodiments of the above-described compositions, the antibody or fragment thereof encoded by the VH and VL encoding polynucleotides is multispecific. In further embodiments, the antibody or fragment thereof encoded by the VH and VL encoding polynucleotides is bispecific.
[0125] In some embodiments of the above-described compositions, the antibody or fragment thereof encoded by the VH and VL encoding polynucleotides comprises heavy and light chain variable domains which are fully human. In further embodiments, the heavy and light chain variable domains are identical to those of a monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04.
[0126] In some embodiments of the above-described compositions, the antibody or fragment thereof encoded by the VH and VL encoding polynucleotides comprises heavy and light chain variable domains which are murine. In further embodiments, the heavy and light chain variable domains are identical to those of a monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and PlG10.2B8.
[0127] In various embodiments of the above-described compositions, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is humanized.
[0128] In various embodiments of the above-described compositions, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is primatized.
[0129] In various embodiments of the above-described compositions, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is chimeric.
[0130] In some embodiments of the above-described compositions, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is fully human.
[0131] In various embodiments of the above-described compositions, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is an Fab fragment, an Fab' fragment, an F(ab)2 fragment, or an Fv fragment. In certain embodiments of the above-described compositions, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is a single chain antibody.
[0132] In some embodiments of the above-described compositions, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid specifically binds to an IGF-Rl polypeptide or fragment thereof, or an IGF-Rl variant polypeptide, with an affinity characterized by a dissociation constant (KD) no greater than 5 x 10'2 M, 10'2 M, 5 x 10° M, 103 M, 5 x 10"4 M, 1(T4 M, 5 x 10'5 M, 10~5 M, 5 x 106 M, 10"6 M, 5 x 10'7 M, 10~7 M, 5 x 10'8 M, 10"8 M, 5 x 10~9 M, 10~9 M, 5 x 10~10 M, 10~10 M, 5 x 10 M, 10 11 M, 5 x 10 12 M, 10 12 M, 5 x 10 13 M, 10 13 M, 5 x 10 14 M, 1(T14 M, 5 x
10'15 M, or l0 15-M. [0133J In some embodiments of the above-described compositions, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid preferentially binds to a human IGF-Rl polypeptide or fragment thereof, relative to a murine IGF-Rl polypeptide or fragment thereof or a non-human primate IGF-Rl polypeptide or fragment thereof.
[0134] In some embodiments of the above-described compositions, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid binds to a human IGF-Rl polypeptide or fragment thereof, and also binds to a non-human primate IGF-Rl polypeptide or fragment thereof.
[0135] In some embodiments of the above-described compositions, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid binds to IGF-Rl expressed on the surface of a cell. In further embodiments, the cell is a malignant cell, a neoplastic cell, a tumor cell, or a metastatic cell.
[0136] In some embodiments of the above-described compositions, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by said nucleic acid blocks insulin growth factor from binding to IGF-Rl . In further embodiments, the insulin growth factor is insulin growth factor- 1 (IGF-I) or insulin growth factor-2 (IGF- 2). In certain other embodiments of the above-described compositions, the antibody or antigen-binding fragment thereof blocks both IGF-I and IGF-2 from binding to IGF-Rl .
[0137] In some embodiments of the above-described compositions, the an antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid inhibits IGF-Rl -mediated cell proliferation, inhibits IGF-I or IGF-2-mediated IGF-Rl phosphorylation, inhibits tumor cell growth or inhibits IGF-Rl internalization.
[0138] In some embodiments, the above-described compositions, the VH encoding polynucleotide, the VL encoding polynucleotide, or both the VH and the VL encoding polynucleotides further comprise a nucleic acid encoding a heterologous polypeptide.
[0139] In some embodiments of the above-described compositions, the antibody or antigen-binding fragment thereof comprising the polypeptide encoded by the nucleic acid is conjugated to an agent selected from the group consisting of cytotoxic agent, a therapeutic agent, cytostatic agent, a biological toxin, a prodrug, a peptide, a protein, an enzyme, a virus, a lipid, a biological response modifier, pharmaceutical agent, a lymphokine, a heterologous antibody or fragment thereof, a detectable label, polyethylene glycol (PEG), and a combination of two or more of any said agents. In further embodiments, the cytotoxic agent is selected from the group consisting of a radionuclide, a biotoxin, an enzymatically active toxin, a cytostatic or cytotoxic therapeutic agent, a prodrugs, an immunologically active ligand, a biological response modifier, or a combination of two or more of any said cytotoxic agents. In certain other embodiments, the detectable label is selected from the group consisting of an enzyme, a fluorescent label, a chemiluminescent label, a bioluminescent label, a radioactive label, or a combination of two or more of any said detectable labels.
[0140] In some embodiments of the above-described compositions, the VH encoding polynucleotide is contained on a first vector and the VL encoding polynucleotide is contained on a second vector. In further embodiments, the VH encoding polynucleotide is operably associated with a first promoter and the VL encoding polynucleotide is operably associated with a second promoter. In certain other embodiments, the first and second promoters are copies of the same promoter, hi further embodiments, the first and second promoters non-identical.
[0141] In various embodiments of the above-described compositions, the first vector and the second vector are contained in a single host cell.
[0142] In certain other embodiments of the above-described compositions, the first vector and the second vector are contained in a separate host cells.
[0143] In some embodiments, the invention provides a method of producing an antibody or fragment thereof which specifically binds IGF-IR, comprising culturing the above- described host cells, and recovering the antibody, or fragment thereof.
[0144] In other embodiments, the invention provides a method of producing an antibody or fragment thereof which specifically binds IGF-IR, comprising co-culturing separate host cells, and recovering the antibody, or fragment thereof. Li further embodiments of the above-described method, the invention provides combining the VH and VL encoding polypeptides, and recovering the antibody, or fragment thereof.
[0145] hi some embodiments, the invention provides an antibody or fragment thereof which specifically binds IGF-IR, produced by the above-described methods.
[0146] In some embodiments, the invention provides compositions, where the VH encoding polynucleotide and the VL encoding polynucleotide are on the same vector, as well as the vectors therein.
[0147] hi various embodiments of the above described vectors, the VH encoding polynucleotide and the VL encoding polynucleotide are each operably associated with a promoter. [0148] In various embodiments of the above described vectors, the VH encoding polynucleotide and the VL encoding polynucleotide are fused in frame, are co-transcribed from a single promoter operably associated therewith, and are cotranslated into a single chain antibody or antigen-binding fragment thereof.
[0149] hi various embodiments of the above described vectors, the VH encoding polynucleotide and said VL encoding polynucleotide are co-transcribed from a single promoter operably associated therewith, but are separately translated. In further embodiments, the vectors further comprise an IRES sequence disposed between the VH encoding polynucleotide and the VL encoding polynucleotide. Li certain other embodiments, the polynucleotide encoding a VH and the polynucleotide encoding a VL are separately transcribed, each being operably associated with a separate promoter. In further embodiments, the separate promoters are copies of the same promoter or the separate promoters are non-identical.
[0150] hi some embodiments, the invention provides host cells comprising the above- described vectors.
[0151] In other embodiments, the invention provides a method of producing an antibody or fragment thereof which specifically binds IGF-IR, comprising culturing the above- described host cells, and recovering the antibody, or fragment thereof.
[0152] In some embodiments, the invention provides an antibody or fragment thereof which specifically binds IGF-IR, produced by the above-described methods.
[0153] In some embodiments, the invention provides a method for treating a hyperproliferative disorder in an animal, comprising administering to an animal in need of treatment a composition comprising: a) an isolated antibody or fragment as described above; and b) a pharmaceutically acceptable carrier. In further embodiments, the hyperproliferative disease or disorder is selected from the group consisting of cancer, a neoplasm, a tumor, a malignancy, or a metastasis thereof.
[0154] In various embodiments of the above-described methods, the antibody or fragment thereof specifically binds to IGF-IR expressed on the surface of a malignant cell, hi further embodiments, the binding of the antibody or fragment thereof to the malignant cell results in growth inhibition of the malignant cell.
[0155] In various embodiments of the above-described methods, the antibody or fragment thereof inhibits IGF binding to the malignant cell. In further embodiments, the IGF is IGF-I or IGF-2. [0156] In various embodiments of the above-described methods, the antibody or fragment thereof inhibits IGF-I from binding to said malignant cell but does not inhibit IGF-2. In certain other embodiments, the antibody or fragment thereof inhibits IGF-2 from binding to said malignant cell but does not inhibit IGF-I.
[0157] In various embodiments of the above-described methods, the antibody or fragment thereof promotes internalization of IGF-IR into the malignant cell.
[0158] In various embodiments of the above-described methods, the antibody or fragment thereof inhibits IGF-IR phosphorylation or inhibits tumor cell proliferation. In further embodiments, the tumor cell proliferation is inhibited through the prevention or retardation of metastatic growth.
[0159] In various embodiments of the above-described methods, the antibody or fragment thereof inhibits tumor cell migration. In further embodiments, the tumor cell proliferation is inhibited through the prevention or retardation of tumor spread to adjacent tissues.
[0160] In various embodiments of the above-described methods, the hyperproliferative disease or disorder is a neoplasm located in the: prostate, colon, abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, adrenal gland, parathyroid gland, pituitary gland, testicles, ovary, thymus, thyroid, eye, head, neck, central nervous system, peripheral nervous system, lymphatic system, pelvis, skin, soft tissue, spleen, thoracic region, or urogenital tract.
[0161] In various embodiments of the above-described methods, the hyperproliferative disease is cancer, said cancer selected from the group consisting of: epithelial squamous cell cancer, melanoma, leukemia, myeloma, stomach cancer, brain cancer, lung cancer, pancreatic cancer, cervical cancer, ovarian cancer, liver cancer, bladder cancer, breast cancer, colon cancer, renal cancer, prostate cancer, testicular cancer, thyroid cancer, and head and neck cancer. In further embodiments, the cancer is selected from the group consisting of stomach cancer, renal cancer, brain cancer, bladder cancer, colon cancer, lung cancer, breast cancer, pancreatic cancer, ovarian cancer, and prostate cancer.
[0162] In various embodiments of the above-described methods, the animal is a mammal.
In further embodiments, the mammal is a human.
BRIEF DESCRIPTION OF THE DRAWINGS
[0163] Figure 1 : Binding activity of IGF-IR specific Fabs. (a) Binding of purified anti-
IGFlR Fab antibodies to recombinant IGFlR-his and IGFlR-Fc protein by ELISA. (b) Binding of purifed anti-IGFIR Fab antibodies to human IGFlR expressed on 3T3 by flowcytometry.
[0164] Figure 2: Binding activity of Fabs to IGF-IR expressed on MCF-7 cells.
[01651 Figure 3: Anti-IGF-1R Fabs inhibited the (a) IGF-I and (b) IGF-2 induced phosphorylation in MCF7 cells
[0166] Figure 4: Binding of IGF-IR Fab fragment antibodies to soluble IGF-IR (a) and
INSR (b) by ELISA.
[01671 Figure 5: The nucleotide and the amino acid sequence of the original and the modified versions of VH and VL chains of M13-C06, M14-G11, M14-C03 and M14- BOl. (a) (SEQ ID NO: 13) shows the single-stranded DNA sequence of heavy chain M13-C06. (b) (SEQ ID NO:77) shows the single-stranded DNA sequence of light chain M13-C06. (c) (SEQ ID NO: 14) shows the amino acid sequence of heavy chain Ml 3- C06. (d) (SEQ ID NO:78) shows the amino acid sequence of light chain M13-C06. (e) (SEQ ID NO:25) shows the single-stranded DNA sequence of heavy chain M14-C03. (f) (SEQ ID NO:87) shows the single-stranded DNA sequence of light chain M14-C03. (g) (SEQ ID NO:26) shows the amino acid sequence of heavy chain M14-C03. (h) (SEQ ID NO:88) shows the amino acid sequence of light chain M14-C03. (i) (SEQ BD NO:31) shows the single-stranded DNA sequence of heavy chain M 14-Gl 1. (j) (SEQ ID NO:92) shows the single-stranded DNA sequence of light chain M14-G11. (k) (SEQ ID NO:32) shows the amino acid sequence of heavy chain M 14-Gl 1. (1) (SEQ DD NO:93) shows the amino acid sequence of light chain M14-G11. (m) (SEQ DD NO: 19) shows the single- stranded DNA sequence of heavy chain M14-B01. (n) (SEQ DD NO:82) shows the single-stranded DNA sequence of light chain M14-B01. (o) (SEQ DD NO:20) shows the amino acid sequence of heavy chain M14-B01. (p) (SEQ DD NO:83) shows the amino acid sequence of light chain M14-B01. (q) (SEQ DD NO:18) shows the single-stranded DNA sequence of sequence optimized heavy chain M13-C06. (r) (SEQ DD NO:14) shows the amino acid sequence of sequence optimized heavy chain M13-C06. (s) (SEQ DD NO:30) shows the single-stranded DNA sequence of sequence optimized heavy chain M14-C03. (t) (SEQ DD NO:26) shows the amino acid sequence of sequence optimized heavy chain M14-C03. (u) (SEQ DD NO:36) shows the single-stranded DNA sequence of sequence optimized heavy chain M14-G11. (v) (SEQ DD NO:32) shows the amino acid sequence of sequence optimized heavy chain M14-G11. (w) (SEQ DD NO:24) shows the single-stranded DNA sequence of sequence optimized heavy chain M14-B01. (x) (SEQ
DD NO:20) shows the amino acid seonence of sequence optimized heavy chain M14-B01. (y) (SEQ ID NO: 153) shows the single-stranded DNA sequence of light chain constant domain, (z) (SEQ ID NO: 154) shows the amino acid sequence of light chain constant domain, (aa) (SEQ ID NO: 155) shows the single-stranded DNA sequence of heavy chain agly.IgG4.P constant domains, (bb) (SEQ ID NO: 156) shows the amino acid sequence of heavy chain aglyIgG4.P constant domains.
[0168] Figure 6: Non-reduced and reduced SDA PAGE analysis of G4.P.agly versions of fully human M13-C06 and M14-C03 antibodies.
[0169] Figure 7: The binding activity of fully human G4.P (a) and G4.P.agly (b) versions of anti-IGF-lR antibodies as determined by ELISA.
[0170] Figure 8: The binding of fully human antibodies to IGF-IR expressed on MCF-7
(8.a), IGF-1R/3T3 (8.b) cell was determined by flowcytometry. The binding EC50 on MCF-7 ranged between 2.7-12 x 10-10 nM.
[0171] Figure 9: The ability of G4 versions of fully human antibodies to block IGF-I (a) and IGF-2 (b) binding to IGF-IR was determined by an RIA.
[0172] Figure 10: (a) Inhibition of H-23 tumor cell proliferation in response to IGF-I by
G4 versions of fully human antibodies; (b) Inhibition of H-23 tumor cell proliferation in response to IGF-2 by G4 versions of fully human antibodies; (c) Inhibition of Calu-6 tumor cell proliferation in response to IGF-I by G4 versions of fully human antibodies.
[0173] Figure 11: Inhibition of IGF-I (a) and IGF-2 (b) driven receptor phosphorylation by M13.C06.G4.P.agly, M14.C03.G4.P.agly and M14.G11.P antibodies.
[0174] Figure 12: Inhibition of downstream signaling by M13.C06.G4.P.agly. (a).
Phospho Akt (Thr308) and total Akt have been shown in top and bottom rows respectively, (b) Top Phospho p44/42 MAPK and total p44/42 MAPK shown in top and bottom rows respectively.
[0175] • Figure 13: Internalization of IGF-IR by human anti-IGF-lR antibodies. The internalization of IGF-IR by M13-C06.G4.P.agly antibody (a) was observed at time 0, 15 and 60 min by confocal microscopy. Anti-mouse IGF-IR antibody clone 24-31 was the positive control (b) and mouse 7F2 antibody and a human G4.P antibody IDEC-151.G4.P were the isotype matched negative controls (c) for the experiment.
[0176] Figure 14: Inhibition of IGF-I mediated tumor cell growth by selected IGF-IR mAbs. (a) H23; (b) Calu-6; (c) Panc-1; (d) BxPC3; (e) MaPaCa; and (f) Colo205. Bars show means and SD.
[0177] Figure 15: Inhibition of IGF-I and IGF-2 driven proliferation of H-23 cells by anti-IGF-lR antibodies. [0178] Figure 16: Inhibition of BxPC3 cell proliferation (driven with recombinant human IGF-I and IGF-2) by M13-C06.G4.P.agly antibody. [0179] Figure 17: Inhibition of NCI-H23 cell proliferation (driven with recombinant human IGF-I and IGF-2) by M13-C06.G4.P.agly antibody. [0180] Figure 18: Inhibition of A549 cell proliferation (driven with recombinant human
IGF-I and IGF-2) by M13-C06.G4.P.agly antibody. [0181] Figure 19: Inhibition of IGF-I and IGF-2 induced phosphorylation of Akt at amino acid residue Ser473 by a fully human IGF-IR antibody. [0182] Figure 20: Fully human M13.C06.G4.P.agly antibody exhibits in vivo dose dependent inhibition of tumor growth in a pancreatic cancer model. [0183] Figure 21: Fully human M13.C06.G4.P.agly antibody exhibits in vivo dose dependent inhibition of tumor growth in a lung cancer model. [0184] Figure 22: Fully human M13.C06.G4.P.agly antibody administered in combination with gemcitabine exhibits increased efficacy in inhibiting tumor growth. [0185] Figure 23: Fully human M13.C06.G4.P.agly antibody binds to IGF-IR expressed on an established cynomolgus fibroblast cell line. [0186] Figure 24: Cross-competition binding analysis of IGF-IR antibody binding epitopes. [0187] Figure 25: Co-immunoprecipitation of IRS-I and p85 (regulatory subunit of
PBK) demonstrates M13-C06.G4.P.agly mediated inhibition of IGF- IR signal transduction. [0188] Figure 26: Immunoprecipitation of IGF-IR and INSR in mammalian cells demonstrates M13.C06.G4.P.agly antibody binding to IGF-IR but not insulin receptor.
IGF-I R and INSR proteins were detected by immunoblot (Western blot) analysis with mouse anti-human IR (A) or mouse anti-human IGF-IR (B). [0189] Figure 27. Relative binding affinity measurements of M 13-C06 Fab for (A) hlGF-
IR-Fc and (B) mIGF- IR-Fc. The x- and y-axis scales are identical for (A) and (B).
Residuals for the binding fits are shown at the bottom of each panel to indicate the applicability of the 1:1 binding model in determining relative affinities of M13-C06 for each receptor. [0190] Figure 28: Examples of M13.C06 antibody binding to hIGF-lR-Fc and mlGF-
IR-Fc controls in the SPR assay compared to antibody binding to IGF-IR mutant proteins
SD006 (binding positive) and SDOl 5 (binding negative). [0191] Figure 29: Structural representations of IGF-IR and INSR: A) Schematic diagram of the structure of IGF-IR. A) FnIII-2 contains loop structure that is proteolytically processed in vivo as shown on the diagram. The transmembrane region is shown as a helical loop that traverses a schematic of a phospholipid bilayer. The location of the IGF-l/IGF-2 binding site within IGF-IR is shown by a star. It has been demonstrated that only one IGF-l/IGF-2 molecule binds to each IGF-IR heterodimeric molecule. B & C) M13-C06 IGF-IR binding epitope mapped to the surface of the structure of the homologous INSR. The M13-C06 IGF-IR binding epitope was modeled based on the highly homologous INSR crystal structure. B) Surface representation of the INSR structure with amino acid residue positions corresponding to the homologous positions of V462-H464 in IGF-IR (i.e., L472-K474 in ESfSR) are shaded black. The first three domains corresponding to IGF-IR (i.e., L1-CR-L2) (such as are included in the truncated IGF-lR(l-462)-Fc construct described herein) are shaded grey. C) Surface representation of the INSR structure with those residues that expose surface area to solvent and that are within a 14 A (angstrom) radius (or 28 A diameter) of residues corresponding to 462-464 of IGF-IR (i.e., 472-474 of DvTSR) are shaded black. Residues corresponding to IGF-IR amino acids 462-464 are shaded grey to indicate the experimentally confirmed surface area of the proposed epitope.
[0192] Figure 30: Immunoblot (Western blot) analysis of in vivo IGF-IR expression in mouse tumors treated with M13.C06.G4.P.agly antibody.
[0193] Figure 31: In vivo anti-tumor activity of M13-C06.G4.P.agly in tumors generated from a primary human colon tumor.
[0194] Figure 32: In vivo anti-tumor activity of M13-C06.G4.P.agly in tumors generated from breast carcinoma (MCF-7) cells.
[0195] Figure 33: M13-C06 antibody does not exhibit in vitro ADCC activity.
DETAILED DESCRIPTION OF THE INVENTION
I. DEFINITIONS
[0196] It is to be noted that the term "a" or "an" entity refers to one or more of that entity; for example, "an IGF-IR antibody," is understood to represent one or more IGF-IR antibodies. As such, the terms "a" (or "an"), "one or more," and "at least one" can be used interchangeably herein.
[0197] As used herein, the term "polypeptide" is intended to encompass a singular
"polypeptide" as well as plural "polypeptides," and refers to a molecule composed of monomers (amino acids) linearly linked by amide bonds (also known as peptide bonds). The term "polypeptide" refers to any chain or chains of two or more amino acids, and does not refer to a specific length of the product. Thus, peptides, dipeptides, tripeptides, oligopeptides, "protein," "amino acid chain," or any other term used to refer to a chain or chains of two or more amino acids, are included within the definition of "polypeptide," and the term "polypeptide" may be used instead of, or interchangeably with any of these terms. The term "polypeptide" is also intended to refer to the products of post-expression modifications of the polypeptide, including without limitation glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturally occurring amino acids. A polypeptide may be derived from a natural biological source or produced by recombinant technology, but is not necessarily translated from a designated nucleic acid sequence. It may be generated in any manner, including by chemical synthesis.
[0198] A polypeptide of the invention may be of a size of about 3 or more, 5 or more, 10 or more, 20 or more, 25 or more, 50 or more, 75 or more, 100 or more, 200 or more, 500 or more, 1,000 or more, or 2,000 or more amino acids. Polypeptides may have a defined three-dimensional structure, although they do not necessarily have such structure. Polypeptides with a defined three-dimensional structure are referred to as folded, and polypeptides which do not possess a defined three-dimensional structure, but rather can adopt a large number of different conformations, and are referred to as unfolded. As used herein, the term glycoprotein refers to a protein coupled to at least one carbohydrate moiety that is attached to the protein via an oxygen-containing or a nitrogen-containing side chain of an amino acid residue, e.g., a serine residue or an asparagine residue.
10199] By an "isolated" polypeptide or a fragment, variant, or derivative thereof is intended a polypeptide that is not in its natural milieu. No particular level of purification is required. For example, an isolated polypeptide can be removed from its native or natural environment. Recombinantly produced polypeptides and proteins expressed in host cells are considered isolated for purposed of the invention, as are native or recombinant polypeptides which have been separated, fractionated, or partially or substantially purified by any suitable technique. [0200] Also included as polypeptides of the present invention are fragments, derivatives, analogs, or variants of the foregoing polypeptides, and any combination thereof. The terms "fragment," "variant," "derivative" and "analog" when referring to IGF-IR antibodies or antibody polypeptides of the present invention include any polypeptides which retain at least some of the antigen-binding properties of the corresponding native antibody or polypeptide. Fragments of polypeptides of the present invention include proteolytic fragments, as well as deletion fragments, in addition to specific antibody fragments discussed elsewhere herein. Variants of IGF-IR antibodies and antibody polypeptides of the present invention include fragments as described above, and also polypeptides with altered amino acid sequences due to amino acid substitutions, deletions, or insertions. Variants may occur naturally or be non-naturally occurring Non- naturally occurring variants may be produced using art-known mutagenesis techniques. Variant polypeptides may comprise conservative or non-conservative amino acid substitutions, deletions or additions. Derivatives of IGF-IR antibodies and antibody polypeptides of the present invention, are polypeptides which have been altered so as to exhibit additional features not found on the native polypeptide. Examples include fusion proteins. Variant polypeptides may also be referred to herein as "polypeptide analogs." As used herein a "derivative" of an IGF-IR antibody or antibody polypeptide refers to a subject polypeptide having one or more residues chemically derivatized by reaction of a functional side group. Also included as "derivatives" are those peptides which contain one or more naturally occurring amino acid derivatives of the twenty standard amino acids. For example, 4-hydroxyproline may be substituted for proline; 5-hydroxylysine may be substituted for lysine; 3-methylhistidine may be substituted for histidine; homoserine may be substituted for serine; and ornithine may be substituted for lysine.
[0201] The term "polynucleotide" is intended to encompass a singular nucleic acid as well as plural nucleic acids, and refers to an isolated nucleic acid molecule or construct, e.g., messenger RNA (mRNA) or plasmid DNA (pDNA). A polynucleotide may comprise a conventional phosphodiester bond or a non-conventional bond (e.g., an amide bond, such as found in peptide nucleic acids (PNA)). The term "nucleic acid" refer to any one or more nucleic acid segments, e.g., DNA or RNA fragments, present in a polynucleotide. By "isolated" nucleic acid or polynucleotide is intended a nucleic acid molecule, DNA or RNA, which has been removed from its native environment. For example, a recombinant polynucleotide encoding an IGF-IR antibody contained in a vector is considered isolated for the Durposes of the present invention. Further examples of an isolated polynucleotide include recombinant polynucleotides maintained in heterologous host cells or purified (partially or substantially) polynucleotides in solution. Isolated RNA molecules include in vivo or in vitro RNA transcripts of polynucleotides of the present invention. Isolated polynucleotides or nucleic acids according to the present invention further include such molecules produced synthetically. In addition, polynucleotide or a nucleic acid may be or may include a regulatory element such as a promoter, ribosome binding site, or a transcription terminator.
[0202] As used herein, a "coding region" is a portion of nucleic acid which consists of codons translated into amino acids. Although a "stop codon" (TAG, TGA, or TAA) is not translated into an amino acid, it may be considered to be part of a coding region, but any flanking sequences, for example promoters, ribosome binding sites, transcriptional terminators, introns, and the like, are not part of a coding region. Two or more coding regions of the present invention can be present in a single polynucleotide construct, e.g., on a single vector, or in separate polynucleotide constructs, e.g., on separate (different) vectors. Furthermore, any vector may contain a single coding region, or may comprise two or more coding regions, e.g., a single vector may separately encode an immunoglobulin heavy chain variable region and an immunoglobulin light chain variable region. In addition, a vector, polynucleotide, or nucleic acid of the invention may encode heterologous coding regions, either fused or unfused to a nucleic acid encoding an IGF- IR antibody or fragment, variant, or derivative thereof. Heterologous coding regions include without limitation specialized elements or motifs, such as a secretory signal peptide or a heterologous functional domain.
[0203] In certain embodiments, the polynucleotide or nucleic acid is DNA. In the case of
DNA, a polynucleotide comprising a nucleic acid which encodes a polypeptide normally may include a promoter and/or other transcription or translation control elements operably associated with one or more coding regions. An operable association is when a coding region for a gene product, e.g., a polypeptide, is associated with one or more regulatory sequences in such a way as to place expression of the gene product under the influence or control of the regulatory sequence(s). Two DNA fragments (such as a polypeptide coding region and a promoter associated therewith) are "operably associated" if induction of promoter function results in the transcription of mRNA encoding the desired gene product and if the nature of the linkage between the two DNA fragments does not interfere with the ability of the expression regulatory sequences to direct the expression of the gene product or interfere with the ability of the DNA template to be transcribed. Thus, a promoter region would be operably associated with a nucleic acid encoding a polypeptide if the promoter was capable of effecting transcription of that nucleic acid. The promoter may be a cell-specific promoter that directs substantial transcription of the DNA only in predetermined cells. Other transcription control elements, besides a promoter, for example enhancers, operators, repressors, and transcription termination signals, can be operably associated with the polynucleotide to direct cell-specific transcription. Suitable promoters and other transcription control regions are disclosed herein.
[0204] A variety of transcription control regions are known to those skilled in the art.
These include, without limitation, transcription control regions which function in vertebrate cells, such as, but not limited to, promoter and enhancer segments from cytomegaloviruses (the immediate early promoter, in conjunction with intron-A), simian virus 40 (the early promoter), and retroviruses (such as Rous sarcoma virus). Other transcription control regions include those derived from vertebrate genes such as actin, heat shock protein, bovine growth hormone and rabbit β-globin, as well as other sequences capable of controlling gene expression in eukaryotic cells. Additional suitable transcription control regions include tissue-specific promoters and enhancers as well as lymphokine-inducible promoters (e.g., promoters inducible by interferons or interleukins).
[0205] Similarly, a variety of translation control elements are known to those of ordinary skill in the art. These include, but are not limited to ribosome binding sites, translation initiation and termination codons, and elements derived from picornaviruses (particularly an internal ribosome entry site, or IRES, also referred to as a CITE sequence).
[0206] In other embodiments, a polynucleotide of the present invention is RNA, for example, in the form of messenger RNA (mRNA).
[0207] Polynucleotide and nucleic acid coding regions of the present invention may be associated with additional coding regions which encode secretory or signal peptides, which direct the secretion of a polypeptide encoded by a polynucleotide of the present invention. According to the signal hypothesis, proteins secreted by mammalian cells have a signal peptide or secretory leader sequence which is cleaved from the mature protein once export of the growing protein chain across the rough endoplasmic reticulum has been initiated. Those of ordinary skill in the art are aware that polypeptides secreted by vertebrate cells generally have a signal peptide fused to the N-terminus of the polypeptide, which is cleaved from the complete or "full length" polypeptide to produce a secreted or "mature" form of the polypeptide. In certain embodiments, the native signal peptide, e.g., an immunoglobulin heavy chain or light chain signal peptide is used, or a functional derivative of that sequence that retains the ability to direct the secretion of the polypeptide that is operably associated with it. Alternatively, a heterologous mammalian signal peptide, or a functional derivative thereof, may be used. For example, the wild- type leader sequence may be substituted with the leader sequence of human tissue plasminogen activator (TPA) or mouse β-glucuronidase.
[0208] The present invention is directed to certain IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof. Unless specifically referring to full-sized antibodies such as naturally-occurring antibodies, the term "IGF-IR antibodies" encompasses full-sized antibodies as well as antigen-binding fragments, variants, analogs, or derivatives of such antibodies, e.g., naturally occurring antibody or immunoglobulin molecules or engineered antibody molecules or fragments that bind antigen in a manner similar to antibody molecules.
[0209] The terms "antibody" and "immunoglobulin" are used interchangeably herein. An antibody or immunoglobulin comprises at least the variable domain of a heavy chain, and normally comprises at least the variable domains of a heavy chain and a light chain. Basic immunoglobulin structures in vertebrate systems are relatively well understood. See, e.g., Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988).
[0210] As will be discussed in more detail below, the term "immunoglobulin" comprises various broad classes of polypeptides that can be distinguished biochemically. Those skilled in the art will appreciate that heavy chains are classified as gamma, mu, alpha, delta, or epsilon, (γ, μ, α, δ, ε) with some subclasses among them (e.g., γl-γ4). It is the nature of this chain that determines the "class" of the antibody as IgG, IgM, IgA IgG, or IgE, respectively. The immunoglobulin subclasses (isotypes) e.g., IgGl, IgG2, IgG3, IgG4, IgAl, etc. are well characterized and are known to confer functional specialization. Modified versions of each of these classes and isotypes are readily discernable to the skilled artisan in view of the instant disclosure and, accordingly, are within the scope of the instant invention. All immunoglobulin classes are clearly within the scope of the present invention, the following discussion will generally be directed to the IgG class of immunoglobulin molecules. With regard to IgG, a standard immunoglobulin molecule comprises two identical light chain polypeptides of molecular weight approximately 23,000 Daltons, and two identical heavy chain polypeptides of molecular weight 53,000- 70,000. The four chains are typically joined by disulfide bonds in a "Y" configuration wherein the light chains bracket the heavy chains starting at the mouth of the "Y" and continuing through the variable region.
[0211] Light chains are classified as either kappa or lambda (K, λ). Each heavy chain class may be bound with either a kappa or lambda light chain. In general, the light and heavy chains are covalently bonded to each other, and the "tail" portions of the two heavy chains are bonded to each other by covalent disulfide linkages or non-covalent linkages when the immunoglobulins are generated either by hybridomas, B cells or genetically engineered host cells. In the heavy chain, the amino acid sequences run from an N- terminus at the forked ends of the Y configuration to the C-terminus at the bottom of each chain.
[0212] Both the light and heavy chains are divided into regions of structural and functional homology. The terms "constant" and "variable" are used functionally. In this regard, it will be appreciated that the variable domains of both the light (VL) and heavy (VH) chain portions determine antigen recognition and specificity. Conversely, the constant domains of the light chain (CL) and the heavy chain (CHl, CH2 or CH3) confer important biological properties such as secretion, transplacental mobility, Fc receptor binding, complement binding, and the like. By convention the numbering of the constant region domains increases as they become more distal from the antigen binding site or amino-terminus of the antibody. The N-terminal portion is a variable region and at the C- terminal portion is a constant region; the CH3 and CL domains actually comprise the carboxy-terminus of the heavy and light chain, respectively.
[0213] As indicated above, the variable region allows the antibody to selectively recognize and specifically bind epitopes on antigens. That is, the VL domain and VH domain, or subset of the complementarity determining regions (CDRs), of an antibody combine to form the variable region that defines a three dimensional antigen binding site. This quaternary antibody structure forms the antigen binding site present at the end of each arm of the Y. More specifically, the antigen binding site is defined by three CDRs on each of the VH and VL chains, hi some instances, e.g., certain immunoglobulin molecules derived from camelid species or engineered based on camelid immunoglobulins, a complete immunoglobulin molecule may consist of heavy chains only, with no light chains. See, e.g., Hamers-Casterman et al., Nature 363:446-448 (1993).
[0214] In naturally occurring antibodies, the six "complementarity determining regions" or "CDRs" present in each antigen binding domain are short, non-contiguous sequences of amino acids that are specifically positioned to form the antigen binding domain as the antibody assumes its three dimensional configuration in an aqueous environment. The remainder of the amino acids in the antigen binding domains, referred to as "framework" regions, show less inter-molecular variability. The framework regions largely adopt a β- sheet conformation and the CDRs form loops which connect, and in some cases form part of, the β-sheet structure. Thus, framework regions act to form a scaffold that provides for positioning the CDRs in correct orientation by inter-chain, non-covalent interactions. The antigen binding domain formed by the positioned CDRs defines a surface complementary to the epitope on the immunoreactive antigen. This complementary surface promotes the non-covalent binding of the antibody to its cognate epitope. The amino acids comprising the CDRs and the framework regions, respectively, can be readily identified for any given heavy or light chain variable region by one of ordinary skill in the art, since they have been precisely defined (see, "Sequences of Proteins of Immunological Interest," Kabat, E., et al., U.S. Department of Health and Human Services, (1983); and Chothia and Lesk, J. MoI. Biol., 196:901-917 (1987), which are incorporated herein by reference in their entireties).
[0215] In the case where there are two or more definitions of a term which is used and/or accepted within the art, the definition of the term as used herein is intended to include all such meanings unless explicitly stated to the contrary. A specific example is the use of the term "complementarity determining region" ("CDR") to describe the non-contiguous antigen combining sites found within the variable region of both heavy and light chain polypeptides. This particular region has been described by Kabat et al., U.S. Dept. of Health and Human Services, "Sequences of Proteins of Immunological Interest" (1983) and by Chothia et al., J. MoI. Biol. 196:901-917 (1987), which are incorporated herein by reference, where the definitions include overlapping or subsets of amino acid residues when compared against each other. Nevertheless, application of either definition to refer to a CDR of an antibody or variants thereof is intended to be within the scope of the term as defined and used herein. The appropriate amino acid residues which encompass the CDRs as defined by each of the above cited references are set forth below in Table I as a comparison. The exact residue numbers which encompass a particular CDR will vary depending on the sequence and size of the CDR. Those skilled in the art can routinely determine which residues comprise a particular CDR given the variable region amino acid sequence of the antibody.
TABLE l. CDR Definitions'
'Numbering of all CDR definitions in Table 1 is according to the numbering conventions set forth by Kabat et al. (see below).
[0216] Kabat et al. also defined a numbering system for variable domain sequences that is applicable to any antibody. One of ordinary skill in the art can unambigously assign this system of "Kabat numbering" to any variable domain sequence, without reliance on any experimental data beyond the sequence itself. As used herein, "Kabat numbering" . refers to the numbering system set forth by Kabat et al., U.S. Dept. of Health and Human Services, "Sequence of Proteins of Immunological Interest" (1983). Unless otherwise specified, references to the numbering of specific amino acid residue positions in an IGF- IR antibody or antigen-binding fragment, variant, or derivative thereof of the present invention are according to the Kabat numbering system.
[0217] In camelid species, the heavy chain variable region, referred to as VHH, forms the entire antigen-binding domain. The main differences between camelid VHH variable regions and those derived from conventional antibodies (VH) include (a) more hydrophobic amino acids in the light chain contact surface of VH as compared to the corresponding region in VHH, (b) a longer CDR3 in VHH, and (c) the frequent occurrence of a disulfide bond between CDRl and CDR3 in VHH.
[0218] Antibodies or antigen-binding fragments, variants, or derivatives thereof of the invention include, but are not limited to, polyclonal, monoclonal, multispecific, human, humanized, primatized, or chimeric antibodies, single chain antibodies, epitope-binding fragments, e.g., Fab, Fab' and F(ab')2, Fd, Fvs, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (sdFv), fragments comprising either a VL or VH domain, fragments produced by a Fab expression library, and anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to IGF-IR antibodies disclosed herein). ScFv molecules are known in the art and are described, e.g., in US patent 5,892,019. Immunoglobulin or antibody molecules of the invention can be of any type {e.g., IgG, IgE, IgM, IgD, IgA, and IgY), class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) or subclass of immunoglobulin molecule.
[0219] Antibody fragments, including single-chain antibodies, may comprise the variable region(s) alone or in combination with the entirety or a portion of the following: hinge region, CHl, CH2, and CH3 domains. Also included in the invention are antigen-binding fragments also comprising any combination of variable region(s) with a hinge region, CHl, CH2, and CH3 domains. Antibodies or immunospecific fragments thereof of the present invention may be from any animal origin including birds and mammals. Preferably, the antibodies are human, murine, donkey, rabbit, goat, guinea pig, camel, llama, horse, or chicken antibodies. In another embodiment, the variable region may be condricthoid in origin {e.g., from sharks). As used herein, "human" antibodies include antibodies having the amino acid sequence of a human immunoglobulin and include antibodies isolated from human immunoglobulin libraries or from animals transgenic for one or more human immunoglobulins and that do not express endogenous immunoglobulins, as described infra and, for example in, U.S. Pat. No. 5,939,598 by Kucherlapati et al.
[0220] As used herein, the term "heavy chain portion" includes amino acid sequences derived from an immunoglobulin heavy chain. A polypeptide comprising a heavy chain portion comprises at least one of: a CHl domain, a hinge {e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, or a variant or fragment thereof. For example, a binding polypeptide for use in the invention may comprise a polypeptide chain comprising a CHl domain; a polypeptide chain comprising a CHl domain, at least a portion of a hinge domain, and a CH2 domain; a polypeptide chain comprising a CHl domain and a CH3 domain; a polypeptide chain comprising a CHl domain, at least a portion of a hinge domain, and a CH3 domain, or a polypeptide chain comprising a CHl domain, at least a portion of a hinge domain, a CH2 domain, and a CH3 domain. In another embodiment, a polypeptide of the invention comprises a polypeptide chain comprising a CH3 domain. Further, a binding polypeptide for use in the invention may lack at least a portion of a CH2 domain {e.g., all or part of a CH2 domain). As set forth above, it will be understood by one of ordinary skill in the art that these domains (e.g., the heavy chain portions) may be modified such that they vary in amino acid sequence from the naturally occurring immunoglobulin molecule.
[0221] In certain IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof disclosed herein, the heavy chain portions of one polypeptide chain of a multimer are identical to those on a second polypeptide chain of the multimer. Alternatively, heavy chain portion-containing monomers of the invention are not identical. For example, each monomer may comprise a different target binding site, forming, for example, a bispecific antibody.
[0222] The heavy chain portions of a binding polypeptide for use in the diagnostic and treatment methods disclosed herein may be derived from different immunoglobulin molecules. For example, a heavy chain portion of a polypeptide may comprise a CHl domain derived from an IgGl molecule and a hinge region derived from an IgG3 molecule. In another example, a heavy chain portion can comprise a hinge region derived, in part, from an IgGl molecule and, in part, from an IgG3 molecule. In another example, a heavy chain portion can comprise a chimeric hinge derived, in part, from an IgGl molecule and, in part, from an IgG4 molecule.
[0223] As used herein, the term "light chain portion" includes amino acid sequences derived from an immunoglobulin light chain. Preferably, the light chain portion comprises at least one of a VL or CL domain.
[0224] IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof disclosed herein may be described or specified in terms of the epitope(s) or portion(s) of an antigen, e.g., a target polypeptide (IGF-IR) that they recognize or specifically bind. The portion of a target polypeptide which specifically interacts with the antigen binding domain of an antibody is an "epitope," or an "antigenic determinant." A target polypeptide may comprise a single epitope, but typically comprises at least two epitopes, and can include any number of epitopes, depending on the size, conformation, and type of antigen. Furthermore, it should be noted that an "epitope" on a target polypeptide may be or include non-polypeptide elements, e.g., an "epitope may include a carbohydrate side chain.
[0225] The minimum size of a peptide or polypeptide epitope for an antibody is thought to be about four to five amino acids. Peptide or polypeptide epitopes preferably contain at least seven, more preferably at least nine and most preferably between at least about 15 to about 30 amino acids. Since a CDR can recognize an antigenic peptide or polypeptide in its tertiary form, the amino acids comprising an epitope need not be contiguous, and in some cases, may not even be on the same peptide chain. In the present invention, peptide or polypeptide epitope recognized by IGF-IR antibodies of the present invention contains a sequence of at least 4, at least 5, at least 6, at least 7, more preferably at least 8, at least 9, at least 10, at least 15, at least 20, at least 25, or between about 15 to about 30 contiguous or non-contiguous amino acids of IGF-IR.
[0226] By "specifically binds," it is generally meant that an antibody binds to an epitope via its antigen binding domain, and that the binding entails some complementarity between the antigen binding domain and the epitope. According to this definition, an antibody is said to "specifically bind" to an epitope when it binds to that epitope, via its antigen binding domain more readily than it would bind to a random, unrelated epitope. The term "specificity" is used herein to qualify the relative affinity by which a certain antibody binds to a certain epitope. For example, antibody "A" may be deemed to have a higher specificity for a given epitope than antibody "B," or antibody "A" may be said to bind to epitope "C" with a higher specificity than it has for related epitope "D."
[0227] By "preferentially binds," it is meant that the antibody specifically binds to an epitope more readily than it would bind to a related, similar, homologous, or analogous epitope. Thus, an antibody which "preferentially binds" to a given epitope would more likely bind to that epitope than to a related epitope, even though such an antibody may cross-react with the related epitope.
[0228] By way of non-limiting example, an antibody may be considered to bind a first epitope preferentially if it binds said first epitope with a dissociation constant (KD) that is less than the antibody's KD for the second epitope. In another non-limiting example, an antibody may be considered to bind a first antigen preferentially if it binds the first epitope with an affinity that is at least one order of magnitude less than the antibody's KD for the second epitope. In another non-limiting example, an antibody may be considered to bind a first epitope preferentially if it binds the first epitope with an affinity that is at least two orders of magnitude less than the antibody's KD for the second epitope.
[0229] In another non-limiting example, an antibody may be considered to bind a first epitope preferentially if it binds the first epitope with an off rate (k(off)) that is less than the antibody's k(ofϊ) for the second epitope. In another non-limiting example, an antibody may be considered to bind a first epitope preferentially if it binds the first epitope with an affinity that is at least one order of magnitude less than the antibody's k(off) for the second epitope. In another non-limiting example, an antibody may be considered to bind a first epitope preferentially if it binds the first epitope with an affinity that is at least two orders of magnitude less than the antibody's k(off) for the second epitope.
[0230] An antibody or antigen-binding fragment, variant, or derivative disclosed herein may be said to bind a target polypeptide disclosed herein or a fragment or variant thereof with an off rate (k(off)) of less than or equal to 5 X 102 sec 1, 10"2 sec"1, 5 X 10"3 sec 1 or 10'3 sec"1. More preferably, an antibody of the invention may be said to bind a target polypeptide disclosed herein or a fragment or variant thereof with an off rate (k(off)) less than or equal to 5 X 10^ sec"1, 10"4 sec"1, 5 X 10"5 sec"1, or 10"5 sec'1 5 X 10"6 sec"1, 10"6 sec"1, 5 X 10"7 sec"1 or 10"7 sec"1.
[0231] An antibody or antigen-binding fragment, variant, or derivative disclosed herein may be said to bind a target polypeptide disclosed herein or a fragment or variant thereof with an on rate (k(on)) of greater than or equal to 103 M"1 sec"1, 5 X 103 M"1 sec"1, 104 M"1 sec"1 or 5 X 104 M"1 sec"1. More preferably, an antibody of the invention may be said to bind a target polypeptide disclosed herein or a fragment or variant thereof with an on rate (k(on)) greater than or equal to 10s M"1 sec 1, 5 X 105 M"1 sec"1, 106 M"1 sec"1, or 5 X 106 M 1 SeC 1 Or IO7 M-1 SeC"1.
[0232] An antibody is said to competitively inhibit binding of a reference antibody to a given epitope if it preferentially binds to that epitope to the extent that it blocks, to some degree, binding of the reference antibody to the epitope. Competitive inhibition may be determined by any method known in the art, for example, competition ELISA assays. An antibody may be said to competitively inhibit binding of the reference antibody to a given epitope by at least 90%, at least 80%, at least 70%, at least 60%, or at least 50%.
[0233] As used herein, the term "affinity" refers to a measure of the strength of the binding of an individual epitope with the CDR of an immunoglobulin molecule. See, e.g., Harlow et ah. Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988) at pages 27-28. As used herein, the term "avidity" refers to the overall stability of the complex between a population of immunoglobulins and an antigen, that is, the functional combining strength of an immunoglobulin mixture with the antigen. See, e.g. , Harlow at pages 29-34. Avidity is related to both the affinity of individual immunoglobulin molecules in the population with specific epitopes, and also the valencies of the immunoglobulins and the antigen. For example, the interaction between a bivalent monoclonal antibody and an antigen with a highly repeating epitope structure, such as a polymer, would be one of hi eh avidity. [0234] IGF-IR antibodies or antigen-binding fragments, variants or derivatives thereof of the invention may also be described or specified in terms of their cross-reactivity. As used herein, the term "cross-reactivity" refers to the ability of an antibody, specific for one antigen, to react with a second antigen; a measure of relatedness between two different antigenic substances. Thus, an antibody is cross reactive if it binds to an epitope other than the one that induced its formation. The cross reactive epitope generally contains many of the same complementary structural features as the inducing epitope, and in some cases, may actually fit better than the original.
[0235] For example, certain antibodies have some degree of cross-reactivity, in that they bind related, but non-identical epitopes, e.g., epitopes with at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 65%, at least 60%, at least 55%, and at least 50% identity (as calculated using methods known in the art and described herein) to a reference epitope. An antibody may be said to have little or no cross-reactivity if it does not bind epitopes with less than 95%, less than 90%, less than 85%, less than 80%, less than 75%, less than 70%, less than 65%, less than 60%, less than 55%, and less than 50% identity (as calculated using methods known in the art and described herein) to a reference epitope. An antibody may be deemed "highly specific" for a certain epitope, if it does not bind any other analog, ortholog, or homolog of that epitope.
[0236] IGF-IR antibodies or antigen-binding fragments, variants or derivatives thereof of the invention may also be described or specified in terms of their binding affinity to a polypeptide of the invention. Preferred binding affinities include those with a dissociation constant or Kd less than 5 x 10"2 M, 102 M, 5 x 103 M, 10"3 M, 5 x 10^ M, 1O-4 M, 5 x 10"5 M, 10"5M, 5 x 10"6 M, 10"6 M, 5 x 10"7M, 107M, 5 x 10-8M, W8 M, 5 x 109M, 10"9M, 5 x 10"10M, 10"10M, 5 x 10"n M, 10 11 M, 5 x 10"12M, 10"12 M, 5 x 10"13 M, 10"13M, 5 x 10" 14M, 10"14M, 5 x 10 15 M, or 10"15M.
[0237] IGF-IR antibodies or antigen-binding fragments, variants or derivatives thereof of the invention may be "multispecific," e.g., bispecific, trispecific or of greater multispecificity, meaning that it recognizes and binds to two or more different epitopes present on one or more different antigens {e.g., proteins) at the same time. Thus, whether an IGF-IR antibody is "monospecific" or "multispecific," e.g., "bispecific," refers to the number of different epitopes with which a binding polypeptide reacts. Multispecific antibodies may be specific for different epitopes of a target polypeptide described herein or may be specific for a target polypeptide as well as for a heterologous epitope, such as a heterologous polypeptide or solid support material.
[02381 As used herein the term "valency" refers to the number of potential binding domains, e.g., antigen binding domains, present in an IGF-IR antibody, binding polypeptide or antibody. Each binding domain specifically binds one epitope. When an IGF-IR antibody, binding polypeptide or antibody comprises more than one binding domain, each binding domain may specifically bind the same epitope, for an antibody with two binding domains, termed "bivalent monospecific," or to different epitopes, for an antibody with two binding domains, termed "bivalent bispecific." An antibody may also be bispecific and bivalent for each specificity (termed "bispecific tetravalent antibodies"). In another embodiment, tetravalent minibodies or domain deleted antibodies can be made.
[0239] Bispecific bivalent antibodies, and methods of making them, are described, for instance in U.S. Patent Nos. 5,731,168; 5,807,706; 5,821,333; and U.S. Appl. Publ. Nos. 2003/020734 and 2002/0155537, the disclosures of all of which are incorporated by reference herein. Bispecific tetravalent antibodies, and methods of making them are described, for instance, in WO 02/096948 and WO 00/44788, the disclosures of both of which are incorporated by reference herein. See generally, PCT publications WO 93/17715; WO 92/08802; WO 91/00360; WO 92/05793; Tutt et al., J. Immunol. 147:60- 69 (1991); U.S. Pat. Nos. 4,474,893; 4,714,681; 4,925,648; 5,573,920; 5,601,819; Kostelny et al., J. Immunol. 7^:1547-1553 (1992).
[0240] As previously indicated, the subunit structures and three dimensional configuration of the constant regions of the various immunoglobulin classes are well known. As used herein, the term "VH domain" includes the amino terminal variable domain of an immunoglobulin heavy chain and the term "CHl domain" includes the first (most amino terminal) constant region domain of an immunoglobulin heavy chain. The CHl domain is adjacent to the VH domain and is amino terminal to the hinge region of an immunoglobulin heavy chain molecule.
[0241] As used herein the term "CH2 domain" includes the portion of a heavy chain molecule that extends, e.g., from about residue 244 to residue 360 of an antibody using conventional numbering schemes (residues 244 to 360, Kabat numbering system; and residues 231-340, EU numbering system; see Kabat EA et al. op. cit. The CH2 domain is unique in that it is not closely paired with another domain. Rather, two N-linked branched carbohydrate chains are interposed between the two CH2 domains of an intact native IgG molecule. It is also well documented that the CH3 domain extends from the CH2 domain to the C-terminal of the IgG molecule and comprises approximately 108 residues.
[0242] As used herein, the term "hinge region" includes the portion of a heavy chain molecule that joins the CHl domain to the CH2 domain. This hinge region comprises approximately 25 residues and is flexible, thus allowing the two N-terminal antigen binding regions to move independently. Hinge regions can be subdivided into three distinct domains: upper, middle, and lower hinge domains (Roux et al., J. Immunol. 757:4083 (1998)).
[0243] As used herein the term "disulfide bond" includes the covalent bond formed between two sulfur atoms. The amino acid cysteine comprises a thiol group that can form a disulfide bond or bridge with a second thiol group. In most naturally occurring IgG molecules, the CHl and CL regions are linked by a disulfide bond and the two heavy chains are linked by two disulfide bonds at positions corresponding to 239 and 242 using the Kabat numbering system (position 226 or 229, EU numbering system).
[0244] As used herein, the term "chimeric antibody" will be held to mean any antibody wherein the immunoreactive region or site is obtained or derived from a first species and the constant region (which may be intact, partial or modified in accordance with the instant invention) is obtained from a second species, hi preferred embodiments the target binding region or site will be from a non-human source {e.g. mouse or primate) and the constant region is human.
[0245] As used herein, the term "engineered antibody" refers to an antibody in which the variable domain in either the heavy and light chain or both is altered by at least partial replacement of one or more CDRs from an antibody of known specificity and, if necessary, by partial framework region replacement and sequence changing. Although the CDRs may be derived from an antibody of the same class or even subclass as the antibody from which the framework regions are derived, it is envisaged that the CDRs will be derived from an antibody of different class and preferably from an antibody from a different species. An engineered antibody in which one or more "donor" CDRs from a non-human antibody of known specificity is grafted into a human heavy or light chain framework region is referred to herein as a "humanized antibody." It may not be necessary to replace all of the CDRs with the complete CDRs from the donor variable region to transfer the antigen binding capacity of one variable domain to another. Rather, it may only be necessary to transfer those residues that are necessary to maintain the activity of the target binding site. Given the explanations set forth in, e.g., U. S. Pat. Nos. 5,585,089, 5,693,761, 5,693,762, and 6,180,370, it will be well within the competence of those skilled in the art, either by carrying out routine experimentation or by trial and error testing to obtain a functional engineered or humanized antibody.
[0246] As used herein the term "properly folded polypeptide" includes polypeptides (e.g.,
IGF-IR antibodies) in which all of the functional domains comprising the polypeptide are distinctly active. As used herein, the term "improperly folded polypeptide" includes polypeptides in which at least one of the functional domains of the polypeptide is not active. In one embodiment, a properly folded polypeptide comprises polypeptide chains linked by at least one disulfide bond and, conversely, an improperly folded polypeptide comprises polypeptide chains not linked by at least one disulfide bond.
[0247} As used herein the term "engineered" includes manipulation of nucleic acid or polypeptide molecules by synthetic means (e.g. by recombinant techniques, in vitro peptide synthesis, by enzymatic or chemical coupling of peptides or some combination of these techniques).
[0248] As used herein, the terms "linked," "fused" or "fusion" are used interchangeably.
These terms refer to the joining together of two more elements or components, by whatever means including chemical conjugation or recombinant means. An "in-frame fusion" refers to the joining of two or more polynucleotide open reading frames (ORFs) to form a continuous longer ORF, in a manner that maintains the correct translational reading frame of the original ORFs. Thus, a recombinant fusion protein is a single protein containing two ore more segments that correspond to polypeptides encoded by the original ORFs (which segments are not normally so joined in nature.) Although the reading frame is thus made continuous throughout the fused segments, the segments may be physically or spatially separated by, for example, in-frame linker sequence. For example, polynucleotides encoding the CDRs of an immunoglobulin variable region may be fused, in-frame, but be separated by a polynucleotide encoding at least one immunoglobulin framework region or additional CDR regions, as long as the "fused" CDRs are co-translated as part of a continuous polypeptide.
[0249] In the context of polypeptides, a "linear sequence" or a "sequence" is an order of amino acids in a polypeptide in an amino to carboxyl terminal direction in which residues that neighbor each other in the sequence are contiguous in the primary structure of the polypeptide. [0250] The term "expression" as used herein refers to a process by which a gene produces a biochemical, for example, an RNA or polypeptide. The process includes any manifestation of the functional presence of the gene within the cell including, without limitation, gene knockdown as well as both transient expression and stable expression. It includes without limitation transcription of the gene into messenger RNA (mRNA), transfer RNA (tRNA), small hairpin RNA (shRNA), small interfering RNA (siRNA) or any other RNA product, and the translation of such mRNA into polypeptide(s). If the final desired product is a biochemical, expression includes the creation of that biochemical and any precursors. Expression of a gene produces a "gene product." As used herein, a gene product can be either a nucleic acid, e.g., a messenger RNA produced by transcription of a gene, or a polypeptide which is translated from a transcript. Gene products described herein further include nucleic acids with post transcriptional modifications, e.g., polyadenylation, or polypeptides with post translational modifications, e.g., methylation, glycosylation, the addition of lipids, association with other protein subunits, proteolytic cleavage, and the like.
[0251] As used herein, the terms "treat" or "treatment" refer to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change or disorder, such as the development or spread of cancer. Beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable. "Treatment" can also mean prolonging survival as compared to expected survival if not receiving treatment. Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
[0252] By "subject" or "individual" or "animal" or "patient" or "mammal," is meant any subject, particularly a mammalian subject, for whom diagnosis, prognosis, or therapy is desired. Mammalian subjects include humans, domestic animals, farm animals, and zoo, sports, or pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, cows, and so on.
[0253] As used herein, phrases such as "a subject that would benefit from administration of a binding molecule" and "an animal in need of treatment" includes subjects, such as mammalian subjects, that would benefit from administration of a binding molecule used, e.g., for detection of an antigen recognized by a binding molecule (e.g., for a diagnostic procedure) and/or from treatment, i.e., palliation or prevention of a disease such as cancer, with a binding molecule which specifically binds a given target protein. As described in more detail herein, the binding molecule can be used in unconjugated form or can be conjugated, e.g., to a drug, prodrug, or an isotope.
[0254] By "hyperproliferative disease or disorder" is meant all neoplastic cell growth and proliferation, whether malignant or benign, including all transformed cells and tissues and all cancerous cells and tissues. Hyperproliferative diseases or disorders include, but are not limited to, precancerous lesions, abnormal cell growths, benign tumors, malignant tumors, and "cancer." In certain embodiments of the present invention, the hyperproliferative disease or disorder, e.g., the precancerous lesion, abnormal cell growth, benign tumor, malignant tumor, or "cancer" comprises cells which express, over-express, or abnormally express IGF-IR.
[0255] Additional examples of hyperproliferative diseases, disorders, and/or conditions include, but are not limited to neoplasms, whether benign or malignant, located in the: prostate, colon, abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, endocrine glands (adrenal, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye- head and neck, nervous (central and peripheral), lymphatic system, pelvic, skin, soft tissue, spleen, thoracic, and urogenital tract. Such neoplasms, in certain embodiments, express, over-express, or abnormally express IGF-IR.
[0256] Other hyperproliferative disorders include, but are not limited to: hypergammaglobulinemia, lymphoproliferative disorders, paraproteinemias, purpura, sarcoidosis, Sezary Syndrome, Waldenstron's macroglobulinemia, Gaucher's Disease, histiocytosis, and any other hyperproliferative disease, besides neoplasia, located in an organ system listed above. In certain embodiments of the present invention the diseases involve cells which express, over-express, or abnormally express IGF-IR.
[0257] As used herein, the terms "tumor" or "tumor tissue" refer to an abnormal mass of tissue that results from excessive cell division, in certain cases tissue comprising cells which express, over-express, or abnormally express IGF-IR. A tumor or tumor tissue comprises "tumor cells" which are neoplastic cells with abnormal growth properties and no useful bodily function. Tumors, tumor tissue and tumor cells may be benign or malignant. A tumor or tumor tissue may also comprise "tumor-associated non-tumor cells", e.g., vascular cells which form blood vessels to supply the tumor or tumor tissue. Non-tumor cells may be induced to replicate and develop by tumor cells, for example, the induction of angiogenesis in a tumor or tumor tissue.
[0258] As used herein, the term "malignancy" refers to a non-benign tumor or a cancer.
As used herein, the term "cancer" connotes a type of hyperproliferative disease which includes a malignancy characterized by deregulated or uncontrolled cell growth. Examples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers are noted below and include: squamous cell cancer (e.g. epithelial squamous cell cancer), lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial cancer or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, as well as head and neck cancer. The term "cancer" includes primary malignant cells or tumors {e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original malignancy or tumor) and secondary malignant cells or tumors (e.g., those arising from metastasis, the migration of malignant cells or tumor cells to secondary sites that are different from the site of the original tumor). Cancers conducive to treatment methods of the present invention involves cells which express, over-express, or abnormally express IGF-IR.
[02591 Other examples of cancers or malignancies include, but are not limited to: Acute
Childhood Lymphoblastic Leukemia, Acute Lymphoblastic Leukemia, Acute Lymphocytic Leukemia, Acute Myeloid Leukemia, Adrenocortical Carcinoma, Adult (Primary) Hepatocellular Cancer, Adult (Primary) Liver Cancer, Adult Acute Lymphocytic Leukemia, Adult Acute Myeloid Leukemia, Adult Hodgkin's Disease, Adult Hodgkin's Lymphoma, Adult Lymphocytic Leukemia, Adult Non-Hodgkin's Lymphoma, Adult Primary Liver Cancer, Adult Soft Tissue Sarcoma, AIDS-Related Lymphoma, AIDS-Related Malignancies, Anal Cancer, Astrocytoma, Bile Duct Cancer, Bladder Cancer, Bone Cancer, Brain Stem Glioma, Brain Tumors, Breast Cancer, Cancer of the Renal Pelvis and Ureter, Central Nervous System (Primary) Lymphoma, Central Nervous System Lymphoma, Cerebellar Astrocytoma, Cerebral Astrocytoma, Cervical Cancer,
Childhood (Primary) Hepatocellular Cancer, Childhood (Primary) Liver Cancer, Childhood Acute Lymphoblastic Leukemia, Childhood Acute Myeloid Leukemia, Childhood Brain Stem Glioma, Childhood Cerebellar Astrocytoma, Childhood Cerebral Astrocytoma, Childhood Extracranial Germ Cell Tumors, Childhood Hodgkin's Disease, Childhood Hodgkin's Lymphoma, Childhood Hypothalamic and Visual Pathway Glioma, Childhood Lymphoblastic Leukemia, Childhood Medulloblastoma, Childhood Non- Hodgkin's Lymphoma, Childhood Pineal and Supratentorial Primitive Neuroectodermal Tumors, Childhood Primary Liver Cancer, Childhood Rhabdomyosarcoma, Childhood Soft Tissue Sarcoma, Childhood Visual Pathway and Hypothalamic Glioma, Chronic Lymphocytic Leukemia, Chronic Myelogenous Leukemia, Colon Cancer, Cutaneous T- CeIl Lymphoma, Endocrine Pancreas Islet Cell Carcinoma, Endometrial Cancer, Ependymoma, Epithelial Cancer, Esophageal Cancer, Ewing's Sarcoma and Related Tumors, Exocrine Pancreatic Cancer, Extracranial Germ Cell Tumor, Extragonadal Germ Cell Tumor, Extrahepatic Bile Duct Cancer, Eye Cancer, Female Breast Cancer, Gaucher's Disease, Gallbladder Cancer, Gastric Cancer, Gastrointestinal Carcinoid Tumor, Gastrointestinal Tumors, Germ Cell Tumors, Gestational Trophoblastic Tumor, Hairy Cell Leukemia, Head and Neck Cancer, Hepatocellular Cancer, Hodgkin's Disease, Hodgkin's Lymphoma, Hypergammaglobulinemia, Hypopharyngeal Cancer, Intestinal Cancers, Intraocular Melanoma, Islet Cell Carcinoma, Islet Cell Pancreatic Cancer, Kaposi's Sarcoma, Kidney Cancer, Laryngeal Cancer, Lip and Oral Cavity Cancer, Liver Cancer, Lung Cancer, Lymphoproliferative Disorders, Macroglobulinemia, Male Breast Cancer, Malignant Mesothelioma, Malignant Thymoma, Medulloblastoma, Melanoma, Mesothelioma, Metastatic Occult Primary Squamous Neck Cancer, Metastatic Primary Squamous Neck Cancer, Metastatic Squamous Neck Cancer, Multiple Myeloma, Multiple Myeloma/Plasma Cell Neoplasm, Myelodysplastic Syndrome, Myelogenous Leukemia, Myeloid Leukemia, Myeloproliferative Disorders, Nasal Cavity and Paranasal Sinus Cancer, Nasopharyngeal Cancer, Neuroblastoma, Non-Hodgkin's Lymphoma During Pregnancy, Nonmelanoma Skin Cancer, Non-Small Cell Lung Cancer, Occult Primary Metastatic Squamous Neck Cancer, Oropharyngeal Cancer, Osteo-ZMalignant Fibrous Sarcoma, Osteosarcoma/Malignant Fibrous Histiocytoma, Osteosarcoma/Malignant Fibrous Histiocytoma of Bone, Ovarian Epithelial Cancer, Ovarian Germ Cell Tumor, Ovarian Low Malignant Potential Tumor, Pancreatic Cancer, Paraproteinemias, Purpura, Parathyroid Cancer, Penile Cancer, Pheochromocytoma, Pituitary Tumor, Plasma Cell Neoplasm/Multiple Myeloma, Primary Central Nervous System Lymphoma, Primary
Liver Cancer, Prostate Cancer, Rectal Cancer, Renal Cell Cancer, Renal Pelvis and Ureter Cancer, Retinoblastoma, Rhabdomyosarcoma, Salivary Gland Cancer, Sarcoidosis Sarcomas, Sezary Syndrome, Skin Cancer, Small Cell Lung Cancer, Small Intestine Cancer, Soft Tissue Sarcoma, Squamous Neck Cancer, Stomach Cancer, Supratentorial Primitive Neuroectodermal and Pineal Tumors, T-CeIl Lymphoma, Testicular Cancer, Thymoma, Thyroid Cancer, Transitional Cell Cancer of the Renal Pelvis and Ureter, Transitional Renal Pelvis and Ureter Cancer, Trophoblastic Tumors, Ureter and Renal Pelvis Cell Cancer, Urethral Cancer, Uterine Cancer, Uterine Sarcoma, Vaginal Cancer, Visual Pathway and Hypothalamic Glioma, Vulvar Cancer, Waldenstrom's Macroglobulinemia, Wilms' Tumor, and any other hyperproliferative disease, besides neoplasia, located in an organ system listed above.
[0260] The method of the present invention may be used to treat premalignant conditions and to prevent progression to a neoplastic or malignant state, including but not limited to those disorders described above. Such uses are indicated in conditions known or suspected of preceding progression to neoplasia or cancer, in particular, where nonneoplastic cell growth consisting of hyperplasia, metaplasia, or most particularly, dysplasia has occurred (for review of such abnormal growth conditions, see Robbins and Angell, Basic Pathology, 2d Ed., W. B. Saunders Co., Philadelphia, pp. 68-79 (1976). Such conditions in which cells begin to express, over-express, or abnormally express IGF-IR, are particularly treatable by the methods of the present invention.
[0261] Hyperplasia is a form of controlled cell proliferation, involving an increase in cell number in a tissue or organ, without significant alteration in structure or function. Hyperplastic disorders which can be treated by the method of the invention include, but are not limited to, angiofollicular mediastinal lymph node hyperplasia, angiolymphoid hyperplasia with eosinophilic atypical melanocytic hyperplasia, basal cell hyperplasia, benign giant lymph node hyperplasia, cementum hyperplasia, congenital adrenal hyperplasia, congenital sebaceous hyperplasia, cystic hyperplasia, cystic hyperplasia of the breast, denture hyperplasia, ductal hyperplasia, endometrial hyperplasia, fibromuscular hyperplasia, focal epithelial hyperplasia, gingival hyperplasia, inflammatory fibrous hyperplasia, inflammatory papillary hyperplasia, intravascular papillary endothelial hyperplasia, nodular hyperplasia of prostate, nodular regenerative hyperplasia, pseudoepitheliomatous hyperplasia, senile sebaceous hyperplasia, and verrucous hyperplasia.
[0262] Metaplasia is a form of controlled cell growth in which one type of adult or fully differentiated cell substitutes for another type of adult cell. Metaplastic disorders which can be treated by the method of the invention include, but are not limited to, agnogenic myeloid metaplasia, apocrine metaplasia, atypical metaplasia, autoparenchymatous metaplasia, connective tissue metaplasia, epithelial metaplasia, intestinal metaplasia, metaplastic anemia, metaplastic ossification, metaplastic polyps, myeloid metaplasia, primary myeloid metaplasia, secondary myeloid metaplasia, squamous metaplasia, squamous metaplasia of amnion, and symptomatic myeloid metaplasia.
[0263] Dysplasia is frequently a forerunner of cancer, and is found mainly in the epithelia; it is the most disorderly form of non-neoplastic cell growth, involving a loss in individual cell uniformity and in the architectural orientation of cells. Dysplastic cells often have abnormally large, deeply stained nuclei, and exhibit pleomorphism. Dysplasia characteristically occurs where there exists chronic irritation or inflammation. Dysplastic disorders which can be treated by the method of the invention include, but are not limited to, anhidrotic ectodermal dysplasia, anterofacial dysplasia, asphyxiating thoracic dysplasia, atriodigital dysplasia, bronchopulmonary dysplasia, cerebral dysplasia, cervical dysplasia, chondroectodermal dysplasia, cleidocranial dysplasia, congenital ectodermal dysplasia, craniodiaphysial dysplasia, craniocarpotarsal dysplasia, craniometaphysial dysplasia, dentin dysplasia, diaphysial dysplasia, ectodermal dysplasia, enamel dysplasia, encephalo-ophthalmic dysplasia, dysplasia epiphysialis hemimelia, dysplasia epiphysialis multiplex, dysplasia epiphysialis punctata, epithelial dysplasia, faciodigitogenital dysplasia, familial fibrous dysplasia of jaws, familial white folded dysplasia, fibromuscular dysplasia, fibrous dysplasia of bone, florid osseous dysplasia, hereditary renal-retinal dysplasia, hidrotic ectodermal dysplasia, hypohidrotic ectodermal dysplasia, lymphopenic thymic dysplasia, mammary dysplasia, mandibulofacial dysplasia, metaphysial dysplasia, Mondini dysplasia, monostotic fibrous dysplasia, mucoepithelial dysplasia, multiple epiphysial dysplasia, oculoauriculovertebral dysplasia, oculodentodigital dysplasia, oculovertebral dysplasia, odontogenic dysplasia, ophthalmomandibulomelic dysplasia, periapical cemental dysplasia, polyostotic fibrous dysplasia, pseudoachondroplastic spondyloepiphysial dysplasia, retinal dysplasia, septo- optic dysplasia, spondyloepiphysial dysplasia, and ventriculoradial dysplasia.
[0264] Additional pre-neoplastic disorders which can be treated by the method of the invention include, but are not limited to, benign dysproliferative disorders (e.g., benign tumors, fibrocystic conditions, tissue hypertrophy, intestinal polyps, colon polyps, and esophageal dysplasia), leukoplakia, keratoses, Bowen's disease, Farmer's Skin, solar cheilitis, and solar keratosis. [0265] In preferred embodiments, the method of the invention is used to inhibit growth, progression, arid/or metastasis of cancers, in particular those listed above.
[0266] Additional hyperproliferative diseases, disorders, and/or conditions include, but are not limited to, progression, and/or metastases of malignancies and related disorders such as leukemia (including acute leukemias {e.g., acute lymphocytic leukemia, acute myelocytic leukemia (including myeloblastic, promyelocytic, myelomonocytic, monocytic, and erythroleukemia)) and chronic leukemias (e.g., chronic myelocytic (granulocytic) leukemia and chronic lymphocytic leukemia)), polycythemia vera, lymphomas (e.g., Hodgkin's disease and non-Hodgkin's disease), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, and solid tumors including, but not limited to, sarcomas and carcinomas such as fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, pancreatic cancer, breast cancer, ovarian cancer, prostate cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilm's tumor, cervical cancer, testicular tumor, lung carcinoma, small cell lung carcinoma, bladder carcinoma, epithelial carcinoma, glioma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, emangioblastoma, acoustic neuroma, oligodendroglioma, menangioma, melanoma, neuroblastoma, and retinoblastoma.
π. IGF-IR
[0267] Naturally occurring insulin-like growth factor receptor-1 (IGF-IR) IGF-IR is a heterotetrameric plasma membrane glycoprotein composed of two α-subunits (130 kDa each) and two β-subunits (90 kDa each) linked by disulfide bonds. Massague ,J. and Czech,M.P. J. Biol. Chem. 257:5038-5045 (1992). IGF-IR is also known in the art by the names CD221 and JTKl 3. The nucleic acid sequence of the human IGF-IR mRNA is available under GenBank Accession Number NM_OOO875, and is presented herein as SEQ ID NO:!. SEQ IDNO:1
>gi| 11068002 |ref |NM_000875.2 I Homo sapiens insulin-like growth factor 1 receptor (IGFlR) , mRNA
TTTTTTTTTTTTTTGAGAAAGGGAATTTCATCCCAAATAAAAGGAATGAAGTCTGGCTCCGGAGGAGGGT CCCCGACCTCGCTGTGGGGGCTCCTGTTTCTCTCCGCCGCGCTCTCGCTCTGGCCGACGAGTGGAGAAAT
GAGGGCTACCTCCACATCCTGCTCATCTCCAAGGCCGAGGACTACCGCAGCTACCGCTTCCCCAAGCTCA CGGTCATTACCGAGTACTTGCTGCTGTTCCGAGTGGCTGGCCTCGAGAGCCTCGGAGACCTCTTCCCCAA CCTCACGGTCATCCGCGGCTGGAAACTCTTCTACAACTACGCCCTGGTCATCTTCGAGATGACCAATCTC
TCTGTTACCTCTCCACTGTGGACTGGTCCCTGATCCTGGATGCGGTGTCCAATAACTACATTGTGGGGAA TAAGCCCCCAAAGGAATGTGGGGACCTGTGTCCAGGGACCATGGAGGAGAAGCCGATGTGTGAGAAGACC ACCATCAACAATGAGTACAACTACCGCTGCTGGACCACAAACCGCTGCCAGAAAATGTGCCCAAGCACGT
CCCAACACCTACAGGTTTGAGGGCTGGCGCTGTGTGGACCGTGACTTCTGCGCCAACATCCTCAGCGCCG AGAGCAGCGACTCCGAGGGGTTTGTGATCCACGACGGCGAGTGCATGCAGGAGTGCCCCTCGGGCTTCAT CCGCAACGGCAGCCAGAGCATGTACTGCATCCCTTGTGAAGGTCCTTGCCCGAAGGTCTGTGAGGAAGAA
GGTGGTGACGGGCTACGTGAAGATCCGCCATTCTCATGCCTTGGTCTCCTTGTCCTTCCTAAAAAACCTT CGCCTCATCCTAGGAGAGGAGCAGCTAGAAGGGAATTACTCCTTCTACGTCCTCGACAACCAGAACTTGC AGCAACTGTGGGACTGGGACCACCGCAACCTGACCATCAAAGCAGGGAAAATGTACTTTGCTTTCAATCC CAAATTATGTGTTTCCGAAATTTACCGCATGGAGGAAGTGACGGGGACTAAAGGGCGCCAAAGCAAAGGG GACATAAACACCAGGAACAACGGGGAGAGAGCCTCCTGTGAAAGTGACGTCCTGCATTTCACCTCCACCA CCACGTCGAAGAATCGCATCATCATAACCTGGCACCGGTACCGGCCCCCTGACTACAGGGATCTCATCAG CTTCACCGTTTACTACAAGGAAGCACCCTTTAAGAATGTCACAGAGTATGATGGGCAGGATGCCTGCGGC TCCAACAGCTGGAACATGGTGGACGTGGACCTCCCGCCCAACAAGGACGTGGAGCCCGGCATCTTACTAC
CCATATCCGTGGGGCCAAGAGTGAGATCTTGTACATTCGCACCAATGCTTCAGTTCCTTCCATTCCCTTG
CTGCTCCAAAGACAAAATCCCCATCAGGAAGTATGCCGACGGCACCATCGACATTGAGGAGGTCACAGAG
GCCCAGACCTGAAAGGAAGCGGAGAGATGTCATGCAAGTGGCCAACACCACCATGTCCAGCCGAAGCAGG AACACCACGGCCGCAGACACCTACAACATCACCGACCCGGAAGAGCTGGAGACAGAGTACCCTTTCTTTG AGAGCAGAGTGGATAACAAGGAGAGAACTGTCATTTCTAACCTTCGGCCTTTCACATTGTACCGCATCGA TATCCACAGCTGCAACCACGAGGCTGAGAAGCTGGGCTGCAGCGCCTCCAACTTCGTCTTTGCAAGGACT
AGTTGAGGATCAGCGAGAATGTGTGTCCAGACAGGAATACAGGAAGTATGGAGGGGCCAAGCTAAACCGG
CGCTGTCCTGTTGATCGTGGGAGGGTTGGTGATTATGCTGTACGTCTTCCATAGAAAGAGAAATAACAGC AGGCTGGGGAATGGAGTGCTGTATGCCTCTGTGAACCCGGAGTACTTCAGCGCTGCTGATGTGTACGTTC
GTCACCATGTGGTGCGATTGCTGGGTGTGGTGTCCCAAGGCCAGCCAACACTGGTCATCATGGAACTGAT
ATAAGTTCGTCCACAGAGACCTTGCTGCCCGGAATTGCATGGTAGCCGAAGATTTCACAGTCAAAATCGG GTGCGCTGGATGTCTCCTGAGTCCCTCAAGGATGGAGTCTTCACCACTTACTCGGACGTCTGGTCCTTCG
CGCATGTGCTGGCAGTATAACCCCAAGATGAGGCCTTCCTTCCTGGAGATCATCAGCAGCATCAAAGAGG AGATGGAGCCTGGCTTCCGGGAGGTCTCCTTCTACTACAGCGAGGAGAACAAGCTGCCCGAGCCGGAGGA GCTGGACCTGGAGCCAGAGAACATGGAGAGCGTCCCCCTGGACCCCTCGGCCTCCTCGTCCTCCCTGCCA CTGCCCGACAGACACTCAGGACACAAGGCCGAGAACGGCCCCGGCCCTGGGGTGCTGGTCCTCCGCGCCA GCTTCGACGAGAGACAGCCTTACGCCCACATGAACGGGGGCCGCAAGAACGAGCGGGCCTTGCCGCTGCC CCAGTCTTCGACCTGCTGATCCTTGGATCCTGAATCTGTGCAAACAGTAACGTGTGCGCACGCGCAGCGG GGTGGGGGGGGAGAGAGAGTTTTAACAATCCATTCACAAGCCTCCTGTACCTCAGTGGATCTTCAGTTCT GCCCTTGCTGCCCGCGGGAGACAGCTTCTCTGCAGTAAAACACATTTGGGATGTTCCTTTTTTCAATATG
TCTCCTCTCTGCTTCATAACGGAAAAATAATTGCCACAAGTCCAGCTGGGAAGCCCTTTTTATCAGTTTG
AAAAACACGTGGAGATGGAAATTTTTACCTTTATCTTTCACCTTTCTAGGGACATGAAATTTACAAAGGG CCATCGTTCATCO^GGCTGTTACCΛTTTTAACGCTGCCTAATTTTGCCAAAATCCTGAACTTTCTCCCT CATCGGCCCGGCGCTGATTCCTCGTGTCCGGAGGCATGGGTGAGCATGGCAGCTGGTTGCTCCATTTGAG AGACACGCTGGCGACACACTCCGTCCATCCGACTGCCCCTGCTGTGCTGCTCAAGGCCACAGGCACACAG
GGGGAGAAGCTGAACCGGC
[0268] The precursor polypeptide sequence is available under GenBank Accession
Number NP_000866, and is presented herein as SEQ ID NO:2.
SEQ ID NO:2
>gi I 4S57665 |ref |NP_000866.11 insulin-like growth factor 1 receptor precursor [Homo sapiens] MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHIIiI1ISKAEDY
IRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNR CQKMCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRD FCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQML QGCTIFKGNLLINIRRGNNIASELENFMGLIEWTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCES DVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNK DVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVK WNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCC ACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEE LETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSL SGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEY FSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGWKDEPETRVAIKTVNEAASMRERIEFLNE ASVMKEFNCHHWRLLGWSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIA DGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFT TYSDVWSFGWLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
PGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
[0269] Amino acids 1 to 30 of SEQ ID NO:2 are reported to encode the IGF-IR signal peptide, amino acids 31 to 740 of SEQ ID NO:2 are reported to encode the IGF-IR α- subunit, and amino acids 741 to 1367 of SEQ ED NO:2 are reported to encode the IGF-IR β-subunit. These and other features of human IGF-IR reported in the NP_000866 GenBank entry are presented in Table 2. Table 2
[0270] The present invention is also directed to IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof which bind specifically, preferentially, or competitively to non-human IGF-IR proteins, e.g., IGF-IR from rodents or non-human primates.
[0271] IGF-IR is expressed in a large number of tumor cells, including, but not limited to certain of the following: bladder tumors (Hum. Pathol. 34:803 (2003)); brain tumors (Clinical Cancer Res. 8:1822 (2002)); breast tumors (Eur. J. Cancer 30:307 (1994) and Hum Pathol. 36:448-449 (2005)); colon tumors, e.g., adenocarcinomas, metastases, and adenomas (Human Pathol. 30:1128 (1999), Virchows. Arc. 443:139 (2003), and Clinical Cancer Res. 10:843 (2004)); gastric tumors (Clin. Exp. Metastasis 21:755 (2004)); kidney tumors, e.g., clear cell, chromophobe and papillary RCC (Am. J. Clin. Pathol. 122:931- 937 (2004)); lung tumors (Hum. Pathol. 34:803-808 (2003) and J. Cancer Res. Clinical Oncol. 119:665-668 (1993)); ovarian tumors (Hum. Pathol. 34:803-808 (2003)); pancreatic tumors, e.g., ductal adenocarcinoma (Digestive Diseases. Sci. 48:1972-1978 (2003) and Clinical Cancer Res. 11:3233-3242 (2005)); and prostate tumors (Cancer Res. 62:2942-2950 (2002)). m. IGF-IR ANTIBODIES
[0272] In one embodiment, the present invention is directed to IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof. For example, the present invention includes at least the antigen-binding domains of certain monoclonal antibodies, and fragments, variants, and derivatives thereof shown in Tables 3 and 4. Table 3 lists human anti-human IGF-IR Fab regions identified from a phage display library and various binding properties of the antibodies, described in more detail in the Examples. Table 4 lists murine anti-human IGF-IR monoclonal antibodies identified by hybridoma technology, and various binding properties of the antibodies, described in more detail in the Examples.
Table 3: Functional properties of IGF-IR specific Fabs. lnhibitlor I Of IGF-IR
Fabs ELISA Binding FACS Binding IGF Blocking Phosphorylation
IGF-1 R- IGF-1R MCF-7
His IGF-IR-Fc InsR 3T3 EC50nM IGF-1 IGF-2 IGF-1 IGF-2
1 M13-C06 ¥ «++ *■++ 8.8 «-+ f+
2 M14-G11 ¥+ «++ *++ 39.8 ++ t- f++
3 M14-C03 «++ ¥++ 25.4 . f *+ f+
4 M14-B01 *■++ «■++ *++ 29.4 H- 4-+ 4-+
5 M12-E01 *■++ ¥++ 7.4 . 4-+ *■+ f
6 M12-G04 ¥ <•+ 25.0 f + ¥ 4- pTy-IGF-1R >30%@0.1ug/ml +++ Ligand Blocking >30%@0.1ug/ml +++
>30%@1ug/ml ++ >30%@1ug/ml ++
>30%@10ug/ml + >30%@10ug/ml +
> OD 2x bkg
ELISA @0.1ug/ml +++
> OD 2x bkg @1ug/ml++
> OD 2x bkg
@10ug/ml +
Table 4: Functional properties of murine monoclonal antibodies
MCF-1 = breast cancer cell; H-23 and Calu-6=lung cancer cells; Panc-1 =pancrβatic cancer cell; Colo205=colon cancer cell
pTy-IGF-1R Llgand Blocking * Ki67 Inhibit (MCF-7) Prolif. Inhibition
>30%@0.1 μg/ml +++ >40%@0.1 μg/ml +++ >50%@0.01 μg/ml ++++ >30%@0.01 μg/ml ++++
>30%@1μg/ml ++ >40%@1 μg/ml ++ >50%@0.1 μg/ml +++ >30%@0.1 μg/ml +++
>30%@10μg/ml + >40%@10μg/ml + >50%@1 μg/ml ++ >30%@1 μg/ml ++
>50%@10μg/ml + >30%@10μg/ml +
[0273 J Chinese Hamster Ovary cell lines which express full-length antibody of M13-C06 and M14-C03 were deposited with the American Type Culture Collection ("ATCC") on March 28, 2006, and were given ATCC Deposit Numbers PTA-7444 and PTA-7445, respectively. Chinese Hamster Ovary cell lines which express Fab antibody fragment M14-G11 were deposited with the American Type Culture Collection ("ATCC") on August 29, 2006, and were given ATCC Deposit Number PTA-7855.
[0274] Hybridoma cell line which express full-length human antibodies P2A7.3E11,
20C8.3B8, and P1A2.2B11 were deposited with the ATCC on March 28, 2006, June 13, 2006, and March 28, 2006, respectively, and were given the ATCC Deposit Numbers PTA-7458, PTA-7732, and, PTA-7457, respectively. Hybridoma cell lines which express full-length human antibodies 20D8.24B11, P1E2.3B12, and P1G10.2B8 were deposited with the ATCC on March 28, 2006, July 11, 2006, and July 11, 2006, respectively, and were given the ATCC Deposit Numbers PTA-7456, PTA-7730, and PTA-7731, respectively. See, ATCC Deposit Table (below) for correlation of antibodies and deposited cell lines.
[0275] The ATCC is located at 10801 University Boulevard, Manassas, VA 20110-2209,
USA. The ATCC deposits were made pursuant to the terms of the Budapest Treaty on the international recognition of the deposit of microorganisms for purposes of patent procedure. [0276] Certain embodiments of the invention were deposited with the American Type
Culture Collection as shown in the following table ("ATCC Deposit Table").
ATCC DEPOSIT TABLE
[0277] As used herein, the term "antigen binding domain" includes a site that specifically binds an epitope on an antigen {e.g., an epitope of IGF-IR). The antigen binding domain of an antibody typically includes at least a portion of an immunoglobulin heavy chain variable region and at least a portion of an immunoglobulin light chain variable region. The binding site formed by these variable regions determines the specificity of the antibody.
[0278J The present invention is more specifically directed to an IGF-IR antibody, or antigen-binding fragment, variant or derivatives thereof, where the IGF-IR antibody specifically binds to the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14- BOl, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 2OD8.24B11, P1E2.3B12, and PlG10.2B8.
[0279] The invention is further drawn to an IGF-IR antibody, or antigen-binding fragment, variant or derivatives thereof, where the IGF-IR antibody competitively inhibits a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8 from binding to IGF-IR.
[0280] The invention is also drawn to an IGF-IR antibody, or antigen-binding fragment, variant or derivatives thereof, where the IGF-IR antibody comprises an antigen binding domain identical to that of a monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8.
[0281] Methods of making antibodies are well known in the art and described herein.
Once antibodies to various fragments of, or to the full-length IGF-IR without the signal sequence, have been produced, determining which amino acids, or epitope, of IGF- IR to which the antibody or antigen binding fragment binds can be determined by epitope mapping protocols as described herein as well as methods known in the art (e.g. double antibody-sandwich ELISA as described in "Chapter 11 - Immunology," Current Protocols in Molecular Biology, Ed. Ausubel et al., v.2, John Wiley & Sons, Inc. (1996)). Additional epitope mapping protocols may be found in Morris, G. Epitope Mapping Protocols, New Jersey: Humana Press (1996), which are both incorporated herein by reference in their entireties. Epitope mapping can also be performed by commercially available means (i.e. ProtoPROBE, Inc. (Milwaukee, Wisconsin)).
[0282] Additionally, antibodies produced which bind to any portion of IGF-IR can then be screened for their ability to act as an antagonist of IGF-IR for example, to inhibit binding of insulin growth factor, e.g., IGF-I, IGF-2, or both IGF-I and IGF-2 to IGF-IR, to promote internalization of IGF-IR, to inhibit phosphorylation of IGF-IR, to inhibit downstream phosphorylation, e.g., of Akt or p42/44 MAPK, or to inhibit tumor cell proliferation, motility or metastasis. Antibodies can be screened for these and other properties according to methods described in detail in the Examples. Other functions of antibodies of the present invention can be tested using other assays as described in the Examples herein.
[0283] In other embodiments, the present invention includes an antibody, or antigen- binding fragment, variant, or derivative thereof which specifically or preferentially binds to at least one epitope of IGF-IR, where the epitope comprises, consists essentially of, or consists of at least about four to five amino acids of SEQ ID NO:2, at least seven, at least nine, or between at least about 15 to about 30 amino acids of SEQ ID NO:2. The amino acids of a given epitope of SEQ ID NO:2 as described may be, but need not be contiguous or linear. In certain embodiments, at least one epitope of IGF-IR comprises, consists essentially of, or consists of a non-linear epitope formed by the extracellular domain of IGF-IR as expressed on the surface of a cell or as a soluble fragment, e.g., fused to an IgG Fc region. Thus, in certain embodiments at least one epitope of IGF-IR comprises, consists essentially of, or consists of at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20, at least 25, between about 15 to about 30, or at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 contiguous or non-contiguous amino acids of SEQ ID NO:2, where non-contiguous amino acids form an epitope through protein folding.
[0284] In other embodiments, the present invention includes an antibody, or antigen- binding fragment, variant, or derivative thereof which specifically or preferentially binds to at least one epitope of IGF-IR, where the epitope comprises, consists essentially of, or consists of, in addition to one, two, three, four, five, six or more contiguous or noncontiguous amino acids of SEQ ID NO:2 as described above, and an additional moiety which modifies the protein, e.g., a carbohydrate moiety may be included such that the IGF-IR antibody binds with higher affinity to modified target protein than it does to an unmodified version of the protein. Alternatively, the IGF-IR antibody does not bind the unmodified version of the target protein at all.
[0285] In certain aspects, the present invention is directed to an antibody, or antigen- binding fragment, variant, or derivative thereof which specifically binds to a IGF-IR polypeptide or fragment thereof, or an IGF-IR variant polypeptide, with an affinity characterized by a dissociation constant (KD) which is less than the KD for a given reference monoclonal antibody.
[0286] In certain embodiments, an antibody, or antigen-binding fragment, variant, or derivative thereof of the invention binds specifically to at least one epitope of IGF-IR or fragment or variant described above, i.e., binds to such an epitope more readily than it would bind to an unrelated, or random epitope; binds preferentially to at least one epitope of IGF-IR or fragment or variant described above, i.e., binds to such an epitope more readily than it would bind to a related, similar, homologous, or analogous epitope; competitively inhibits binding of a reference antibody which itself binds specifically or preferentially to a certain epitope of IGF-IR or fragment or variant described above; or binds to at least one epitope of IGF-IR or fragment or variant described above with an affinity characterized by a dissociation constant KD of less than about 5 x 10"2 M, about 10"2 M, about 5 x 103 M, about 10"3 M, about 5 X lO-4 M, about 10 M, about 5 x 10'5 M, about 10"5M, about 5 x 10"6M, about 10"6M, about 5 x 10"7M, about 10"7 M, about 5 x 10" 8 M, about 10"8 M, about 5 x 10"9M, about 10"9M, about 5 x 10"10M, about 10 10 M, about 5 x 10"11 M, about 10"11 M, about 5 x 10 12 M, about 10'12M, about 5 x 10"13 M, about 10 13 M, about 5 x 10 14 M, about 10 14 M, about 5 x 10'15 M, or about 10"15 M. In a particular aspect, the antibody or fragment thereof preferentially binds to a human IGF-IR polypeptide or fragment thereof, relative to a murine IGF-IR polypeptide or fragment thereof. In another particular aspect, the antibody or fragment thereof preferentially binds to one or more IGF-IR polypeptides or fragments thereof, e.g., one or more mammalian IGF-IR polypeptides, but does not bind to insulin receptor (InsR) polypeptides. While not being bound by theory, insulin receptor polypeptides are known to have some sequence similarity with IGF-IR polypeptides, and antibodies which cross react with InsR may produce unwanted side effects in vivo, e.g., interfering with glucose metabolism.
[0287] As used in the context of antibody binding dissociation constants, the term
"about" allows for the degree of variation inherent in the methods utilized for measuring antibody affinity. For example, depending on the level of precision of the instrumentation used, standard error based on the number of samples measured, and rounding error, the term "about 10"2 M" might include, for example, from 0.05 M to 0.005 M.
[0288] In specific embodiments, an antibody, or antigen-binding fragment, variant, or derivative thereof of the invention binds IGF-IR polypeptides or fragments or variants thereof with an off rate (k(off)) of less than or equal to 5 X 10"2 sec 1, 10"2 sec'1, 5 X 10'3 sec"1 or 10"3 sec"1. Alternatively, an antibody, or antigen-binding fragment, variant, or derivative thereof of the invention binds IGF-IR polypeptides or fragments or variants thereof with an off rate (k(off)) of less than or equal to 5 X 10"* sec'1, W4 sec 1, 5 X 10'5 sec'1, or 10"5 sec"1 5 X lO"6 sec 1, 10'6 sec"1, 5 X 10'7 sec'1 or 10'7 sec'1. [0289] In other embodiments, an antibody, or antigen-binding fragment, variant, or derivative thereof of the invention binds IGF-IR polypeptides or fragments or variants thereof with an on rate (k(on)) of greater than or equal to 103 M"1 sec"1, 5 X 103 M"1 sec"1, 104 M"1 sec"1 or 5 X 104 M"1 sec"1. Alternatively, an antibody, or antigen-binding fragment, variant, or derivative thereof of the invention binds IGF-IR polypeptides or fragments or variants thereof with an on rate (k(on)) greater than or equal to 105 M"1 sec"1, 5 X 105 M"1 sec"1, 106 M"1 sec"1, or 5 X 106 M"1 sec"1 or 107 M"1 sec"1.
[0290] In various embodiments, an IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof as described herein is an antagonist of IGF-IR activity. In certain embodiments, for example, binding of an antagonist IGF-IR antibody to IGF-IR as expressed on a tumor cell inhibits binding of insulin growth factor, e.g., IGF-I, IGF-2, or both IGF-I and IGF-2 to IGF-IR, promotes internalization of IGF-IR thereby inhibiting its signal transduction capability, inhibits phosphorylation of IGF-IR, inhibits phosphorylation of molecules downstream in the signal transduction pathway, e.g., Akt or p42/44 MAPK, or inhibits tumor cell proliferation, motility or metastasis.
[0291] Unless it is specifically noted, as used herein a "fragment thereof in reference to an antibody refers to an antigen-binding fragment, i.e., a portion of the antibody which specifically binds to the antigen. In one embodiment, an IGF-IR antibody, e.g., an antibody of the invention is a bispecifϊc IGF-IR antibody, e.g., a bispecific antibody, minibody, domain deleted antibody, or fusion protein having binding specificity for more than one epitope, e.g., more than one antigen or more than one epitope on the same antigen. In one embodiment, a bispecific IGF-IR antibody has at least one binding domain specific for at least one epitope on a target polypeptide disclosed herein, e.g., IGF-IR. In another embodiment, a bispecific IGF-IR antibody has at least one binding domain specific for an epitope on a target polypeptide and at least one target binding domain specific for a drug or toxin. In yet another embodiment, a bispecific IGF-IR antibody has at least one binding domain specific for an epitope on a target polypeptide disclosed herein, and at least one binding domain specific for a prodrug. A bispecific IGF-IR antibody may be a tetravalent antibody that has two target binding domains specific for an epitope of a target polypeptide disclosed herein and two target binding domains specific for a second target. Thus, a tetravalent bispecific IGF-IR antibody may be bivalent for each specificity.
[0292] IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention, as known by those of ordinary skill in the art, can comprise a constant region which mediates one or more effector functions. For example, binding of the Cl component of complement to an antibody constant region may activate the complement system. Activation of complement is important in the opsonisation and lysis of cell pathogens. The activation of complement also stimulates the inflammatory response and may also be involved in autoimmune hypersensitivity. Further, antibodies bind to receptors on various cells via the Fc region, with a Fc receptor binding site on the antibody Fc region binding to a Fc receptor (FcR) on a cell. There are a number of Fc receptors which are specific for different classes of antibody, including IgG (gamma receptors), IgE (epsilon receptors), IgA (alpha receptors) and IgM (mu receptors). Binding of antibody to Fc receptors on cell surfaces triggers a number of important and diverse biological responses including engulfment and destruction of antibody-coated particles, clearance of immune complexes, lysis of antibody-coated target cells by killer cells (called antibody-dependent cell-mediated cytotoxicity, or ADCC), release of inflammatory mediators, placental transfer and control of immunoglobulin production.
[0293] Accordingly, certain embodiments of the invention include an IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof, in which at least a fraction of one or more of the constant region domains has been deleted or otherwise altered so as to provide desired biochemical characteristics such as reduced effector functions, the ability to non-covalently dimerize, increased ability to localize at the site of a tumor, reduced serum half-life, or increased serum half-life when compared with a whole, unaltered antibody of approximately the same immunogenicity. For example, certain antibodies for use in the diagnostic and treatment methods described herein are domain deleted antibodies which comprise a polypeptide chain similar to an immunoglobulin heavy chain, but which lack at least a portion of one or more heavy chain domains. For instance, in certain antibodies, one entire domain of the constant region of the modified antibody will be deleted, for example, all or part of the CH2 domain will be deleted. In other embodiments, certain antibodies for use in the diagnostic and treatment methods described herein have s constant region, e.g., an IgG4 heavy chain constant region, which is altered to eliminate glycosylation, referred to elsewhere herein as "agly" antibodies. While not being bound by theory, it is believed that "agly" antibodies may have an improved safety and stability profile in vivo.
[0294] In certain IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof described herein, the Fc portion may be mutated to decrease effector function using techniques known in the art. For example, the deletion or inactivation (through point mutations or other means) of a constant region domain may reduce Fc receptor binding of the circulating modified antibody thereby increasing tumor localization. In other cases it may be that constant region modifications consistent with the instant invention moderate complement binding and thus reduce the serum half life and nonspecific association of a conjugated cytotoxin. Yet other modifications of the constant region may be used to modify disulfide linkages or oligosaccharide moieties that allow for enhanced localization due to increased antigen specificity or antibody flexibility. The resulting physiological profile, bioavailability and other biochemical effects of the modifications, such as tumor localization, biodistribution and serum half- life, may easily be measured and quantified using well know immunological techniques without undue experimentation.
[0295] Modified forms of IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention can be made from whole precursor or parent antibodies using techniques known in the art. Exemplary techniques are discussed in more detail herein.
[0296] In certain embodiments both the variable and constant regions of IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof are fully human. Fully human antibodies can be made using techniques that are known in the art and as described herein. For example, fully human antibodies against a specific antigen can be prepared by administering the antigen to a transgenic animal which has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled. Exemplary techniques that can be used to make such antibodies are described in US patents: 6,150,584; 6,458,592; 6,420,140. Other techniques are known in the art. Fully human antibodies can likewise be produced by various display technologies, e.g., phage display or other viral display systems, as described in more detail elsewhere herein.
[0297] IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention can be made or manufactured using techniques that are known in the art. In certain embodiments, antibody molecules or fragments thereof are "recombinantly produced," i.e., are produced using recombinant DNA technology. Exemplary techniques for making antibody molecules or fragments thereof are discussed in more detail elsewhere herein.
[0298] IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention also include derivatives that are modified, e.g., by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from specifically binding to its cognate epitope. For example, but not by way of limitation, the antibody derivatives include antibodies that have been modified, e.g., by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc. Additionally, the derivative may contain one or more non-classical amino acids.
[0299] In certain embodiments, IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention will not elicit a deleterious immune response in the animal to be treated, e.g., in a human. In one embodiment, IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention are modified to reduce their immunogenicity using art-recognized techniques. For example, antibodies can be humanized, primatized, deimmunized, or chimeric antibodies can be made. These types of antibodies are derived from a non-human antibody, typically a murine or primate antibody, that retains or substantially retains the antigen-binding properties of the parent antibody, but which is less immunogenic in humans. This may be achieved by various methods, including (a) grafting the entire non-human variable domains onto human constant regions to generate chimeric antibodies; (b) grafting at least a part of one or more of the non-human complementarity determining regions (CDRs) into a human framework and constant regions with or without retention of critical framework residues; or (c) transplanting the entire non-human variable domains, but "cloaking" them with a human-like section by replacement of surface residues. Such methods are disclosed in Morrison et al., Proc. Natl. Acad. Sd. 57:6851-6855 (1984); Morrison et ai, Adv. Immunol. 44:65-92 (1988); Verhoeyen et al, Science 239:1534- 1536 (1988); Padlan, Molec. Immun. 25:489-498 (1991); Padlan, Molec. Immun. 37:169- 217 (1994), and U.S. Pat. Nos. 5,585,089, 5,693,761, 5,693,762, and 6,190,370, all of which are hereby incorporated by reference in their entirety.
[0300] De-immunization can also be used to decrease the immunogenicity of an antibody.
As used herein, the term "de-immunization" includes alteration of an antibody to modify T cell epitopes (see, e.g., WO9852976A1, WO0034317A2). For example, VH and VL sequences from the starting antibody are analyzed and a human T cell epitope "map" from each V region showing the location of epitopes in relation to complementarity- determining regions (CDRs) and other key residues within the sequence. Individual T cell epitopes from the T cell epitope map are analyzed in order to identify alternative amino acid substitutions with a low risk of altering activity of the final antibody. A range of alternative VH and VL sequences are designed comprising combinations of amino acid substitutions and these sequences are subsequently incorporated into a range of binding polypeptides, e.g., IGF-lR-specific antibodies or immunospecific fragments thereof for use in the diagnostic and treatment methods disclosed herein, which are then tested for function. Typically, between 12 and 24 variant antibodies are generated and tested. Complete heavy and light chain genes comprising modified V and human C regions are then cloned into expression vectors and the subsequent plasmids introduced into cell lines for the production of whole antibody. The antibodies are then compared in appropriate biochemical and biological assays, and the optimal variant is identified.
[0301] IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention may be generated by any suitable method known in the art. Polyclonal antibodies to an antigen of interest can be produced by various procedures well known in the art. For example, an IGF-IR antibody, e.g., a binding polypeptide, e.g., an IGF-IR- specific antibody or immunospecific fragment thereof can be administered to various host animals including, but not limited to, rabbits, mice, rats, chickens, hamsters, goats, donkeys, etc., to induce the production of sera containing polyclonal antibodies specific for the antigen. Various adjuvants may be used to increase the immunological response, depending on the host species, and include but are not limited to, Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanins, dinitrophenol, and potentially useful human adjuvants such as BCG (bacille Calmette-Guerin) and Corynebacterium parvum. Such adjuvants are also well known in the art.
[0302] Monoclonal antibodies can be prepared using a wide variety of techniques known in the art including the use of hybridoma, recombinant, and phage display technologies, or a combination thereof. For example, monoclonal antibodies can be produced using hybridoma techniques including those known in the art and taught, for example, in Harlow et al, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, 2nd ed. (1988); Hammerling et al., in: Monoclonal Antibodies and T-CeIl Hybridomas Elsevier, N.Y., 563-681 (1981) (said references incorporated by reference in their entireties). The term "monoclonal antibody" as used herein is not limited to antibodies produced through hybridoma technology. The term "monoclonal antibody" refers to an antibody that is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, and not the method by which it is produced. Thus, the term "monoclonal antibody" is not limited to antibodies produced through hybridoma technology. Monoclonal antibodies can be prepared using IGF-IR knockout mice to increase the regions of epitope recognition. Monoclonal antibodies can be prepared using a wide variety of techniques known in the art including the use of hybridoma and recombinant and phage display technology as described elsewhere herein.
[0303] Using art recognized protocols, in one example, antibodies are raised in mammals by multiple subcutaneous or intraperitoneal injections of the relevant antigen (e.g., purified IGF-IR or cells or cellular extracts comprising IGF-IR) and an adjuvant. This immunization typically elicits an immune response that comprises production of antigen- reactive antibodies from activated splenocytes or lymphocytes. While the resulting antibodies may be harvested from the serum of the animal to provide polyclonal preparations, it is often desirable to isolate individual lymphocytes from the spleen, lymph nodes or peripheral blood to provide homogenous preparations of monoclonal antibodies (MAbs). Preferably, the lymphocytes are obtained from the spleen.
[0304] In this well known process (Kohler et al. Nature 256:495 (1975)) the relatively short-lived, or mortal, lymphocytes from a mammal which has been injected with antigen are fused with an immortal tumor cell line (e.g. a myeloma cell line), thus, producing hybrid cells or "hybridomas" which are both immortal and capable of producing the genetically coded antibody of the B cell. The resulting hybrids are segregated into single genetic strains by selection, dilution, and regrowth with each individual strain comprising specific genes for the formation of a single antibody. They produce antibodies which are homogeneous against a desired antigen and, in reference to their pure genetic parentage, are termed "monoclonal."
[0305] Hybridoma cells thus prepared are seeded and grown in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells. Those skilled in the art will appreciate that reagents, cell lines and media for the formation, selection and growth of hybridomas are commercially available from a number of sources and standardized protocols are well established. Generally, culture medium in which the hybridoma cells are growing is assayed for production of monoclonal antibodies against the desired antigen. Preferably, the binding specificity of the monoclonal antibodies produced by hybridoma cells is determined by in vitro assays such as immunoprecipitation, radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA). After hybridoma cells are identified that produce antibodies of the desired specificity, affinity and/or activity, the clones may be subcloned by limiting dilution procedures and grown by standard methods (Goding, Monoclonal Antibodies: Principles and Practice, Academic Press, pp 59-103 (1986)). It will further be appreciated that the monoclonal antibodies secreted by the subclones may be separated from culture medium, ascites fluid or serum by conventional purification procedures such as, for example, protein-A, hydroxylapatite chromatography, gel electrophoresis, dialysis or affinity chromatography.
[0306] Antibody fragments that recognize specific epitopes may be generated by known techniques. For example, Fab and F(ab')2 fragments may be produced recombinantly or by proteolytic cleavage of immunoglobulin molecules, using enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab')2 fragments). F(ab')2 fragments contain the variable region, the light chain constant region and the CHl domain of the heavy chain.
[0307] Those skilled in the art will also appreciate that DNA encoding antibodies or antibody fragments {e.g., antigen binding sites) may also be derived from antibody libraries, such as phage display libraries. In a particular, such phage can be utilized to display antigen-binding domains expressed from a repertoire or combinatorial antibody library (e.g., human or murine). Phage expressing an antigen binding domain that binds the antigen of interest can be selected or identified with antigen, e.g., using labeled antigen or antigen bound or captured to a solid surface or bead. Phage used in these methods are typically filamentous phage including fd and Ml 3 binding domains expressed from phage with Fab, Fv OE DAB (individual Fv region from light or heavy chains)or disulfide stabilized Fv antibody domains recombinantly fused to either the phage gene III or gene VIII protein. Exemplary methods are set forth, for example, in EP 368 684 Bl; U.S. patent. 5,969,108, Hoogenboom, H.R. and Chames, Immunol. Today 27:371 (2000); Nagy et al. Nat. Med. 5:801 (2002); Huie et ah, Proc. Natl. Acad. Sci. USA 98:2682 (2001); Lui et al., J. MoI. Biol. 375:1063 (2002), each of which is incorporated herein by reference. Several publications {e.g., Marks et al., Bio/Technology 70:779-783 (1992)) have described the production of high affinity human antibodies by chain shuffling, as well as combinatorial infection and in vivo recombination as a strategy for constructing large phage libraries. In another embodiment, Ribosomal display can be used to replace bacteriophage as the display platform (see, e.g., Hanes et al., Nat. Biotechnol. /5:1287 (2000); Wilson et al, Proc. Natl. Acad. Sci. USA 98:3750 (2001); or Irving et al., J. Immunol. Methods 248:31 (2001)). In yet another embodiment, cell surface libraries can be screened for antibodies (Boder et al., Proc. Natl. Acad. Sci. USA 97:10701 (2000); Daugherty et al., J. Immunol. Methods 243:211 (2000)). Such procedures provide alternatives to traditional hybridoma techniques for the isolation and subsequent cloning of monoclonal antibodies.
[0308] In phage display methods, functional antibody domains are displayed on the surface of phage particles which carry the polynucleotide sequences encoding them. For example, DNA sequences encoding VH and VL regions are amplified or otherwise isolated from animal cDNA libraries (e.g., human or murine cDNA libraries of lymphoid tissues) or synthetic cDNA libraries. In certain embodiments, the DNA encoding the VH and VL regions are joined together by an scFv linker by PCR and cloned into a phagemid vector (e.g., p CANTAB 6 or pComb 3 HSS). The vector is electroporated in E. coli and the E. coli is infected with helper phage. Phage used in these methods are typically filamentous phage including fd and Ml 3 and the VH or VL regions are usually recombinantly fused to either the phage gene in or gene VIH. Phage expressing an antigen binding domain that binds to an antigen of interest (i.e., an IGF-IR polypeptide or a fragment thereof) can be selected or identified with antigen, e.g., using labeled antigen or antigen bound or captured to a solid surface or bead.
[0309] Additional examples of phage display methods that can be used to make the antibodies include those disclosed in Brinkman et al., J. Immunol. Methods 752:41-50 (1995); Ames et al., J. Immunol. Methods 754:177-186 (1995); Kettleborough et al., Eur. J. Immunol. 24:952-958 (1994); Persic et al, Gene 757:9-18 (1997); Burton et al, Advances in Immunology 57:191-280 (1994); PCT Application No. PCT/GB91/01134; PCT publications WO 90/02809; WO 91/10737; WO 92/01047; WO 92/18619; WO 93/11236; WO 95/15982; WO 95/20401; and U.S. Pat. Nos. 5,698,426; 5,223,409; 5,403,484; 5,580,717; 5,427,908; 5,750,753; 5,821,047; 5,571,698; 5,427,908; 5,516,637; 5,780,225; 5,658,727; 5,733,743 and 5,969,108; each of which is incorporated herein by reference in its entirety.
[0310] As described in the above references, after phage selection, the antibody coding regions from the phage can be isolated and used to generate whole antibodies, including human antibodies, or any other desired antigen binding fragment, and expressed in any desired host, including mammalian cells, insect cells, plant cells, yeast, and bacteria. For example, techniques to recombinantiv produce Fab, Fab' and F(ab')2 fragments can also be employed using methods known in the art such as those disclosed in PCT publication WO 92/22324; Mullinax et al, BioTechniques 12(6):S64-$69 (1992); and Sawai et al, AJRI 34:26-34 (1995); and Better et al, Science 240:1041-1043 (1988) (said references incorporated by reference in their entireties).
10311] Examples of techniques which can be used to produce single-chain Fvs and antibodies include those described in U.S. Pat. Nos. 4,946,778 and 5,258,498; Huston et al, Methods in Enzymology 203:46-88 (1991); Shu et al., PNAS 901995-1999 (1993); and Skerra et al., Science 240:1038-1040 (1988). For some uses, including in vivo use of antibodies in humans and in vitro detection assays, it may be preferable to use chimeric, humanized, or human antibodies. A chimeric antibody is a molecule in which different portions of the antibody are derived from different animal species, such as antibodies having a variable region derived from a murine monoclonal antibody and a human immunoglobulin constant region. Methods for producing chimeric antibodies are known in the art. See, e.g., Morrison, Science 229:1202 (1985); Oi et al., BioTechniques 4:214 (1986); Gillies et al., J. Immunol. Methods 725:191-202 (1989); U.S. Pat. Nos. 5,807,715; 4,816,567; and 4,816397, which are incorporated herein by reference in their entireties. Humanized antibodies are antibody molecules from non-human species antibody that binds the desired antigen having one or more complementarity determining regions (CDRs) from the non-human species and framework regions from a human immunoglobulin molecule. Often, framework residues in the human framework regions will be substituted with the corresponding residue from the CDR donor antibody to alter, preferably improve, antigen binding. These framework substitutions are identified by methods well known in the art, eg-., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions. {See, e.g., Queen et al., U.S. Pat. No. 5,585,089; Riechmann et al., Nature 332:323 (1988), which are incorporated herein by reference in their entireties.) Antibodies can be humanized using a variety of techniques known in the art including, for example, CDR- grafting (EP 239,400; PCT publication WO 91/09967; U.S. Pat. Nos. 5,225,539; 5,530,101; and 5,585,089), veneering or resurfacing (EP 592,106; EP 519,596; Padlan, Molecular Immunology 28(4/5):489-49S (1991); Studnicka et al., Protein Engineering 7^:805-814 (1994); Roguska. et al., PNAS 91:969-913 (1994)), and chain shuffling (U.S. Pat. No. 5,565,332). [0312] Completely human antibodies are particularly desirable for therapeutic treatment of human patients. Human antibodies can be made by a variety of methods known in the art including phage display methods described above using antibody libraries derived from human immunoglobulin sequences. See also, U.S. Pat. Nos. 4,444,887 and 4,716,111; and PCT publications WO 98/46645, WO 98/50433, WO 98/24893, WO 98/16654, WO 96/34096, WO 96/33735, and WO 91/10741; each of which is incorporated herein by reference in its entirety.
[0313] Human antibodies can also be produced using transgenic mice which are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes. For example, the human heavy and light chain immunoglobulin gene complexes may be introduced randomly or by homologous recombination into mouse embryonic stem cells. Alternatively, the human variable region, constant region, and diversity region may be introduced into mouse embryonic stem cells in addition to the human heavy and light chain genes. The mouse heavy and light chain immunoglobulin genes may be rendered non-functional separately or simultaneously with the introduction of human immunoglobulin loci by homologous recombination. In particular, homozygous deletion of the JH region prevents endogenous antibody production. The modified embryonic stem cells are expanded and microinjected into blastocysts to produce chimeric mice. The chimeric mice are then bred to produce homozygous offspring that express human antibodies. The transgenic mice are immunized in the normal fashion with a selected antigen, e.g., all or a portion of a desired target polypeptide. Monoclonal antibodies directed against the antigen can be obtained from the immunized, transgenic mice using conventional hybridoma technology. The human immunoglobulin transgenes harbored by the transgenic mice rearrange during B- cell differentiation, and subsequently undergo class switching and somatic mutation. Thus, using such a technique, it is possible to produce therapeutically useful IgG, IgA, IgM and IgE antibodies. For an overview of this technology for producing human antibodies, see Lonberg and Huszar Int. Rev. Immunol. 73:65-93 (1995). For a detailed discussion of this technology for producing human antibodies and human monoclonal antibodies and protocols for producing such antibodies, see, e.g., PCT publications WO 98/24893; WO 96/34096; WO 96/33735; U.S. Pat. Nos. 5,413,923; 5,625,126; 5,633,425; 5,569,825; 5,661,016; 5,545,806; 5,814,318; and 5,939,598, which are incorporated by reference herein in their entirety. In addition, companies such as Abgenix, Inc. (Freemont, Calif.) and GenPharm (San Jose, Calif.) can be engaged to provide human antibodies directed against a selected antigen using technology similar to that described above.
[0314] Completely human antibodies which recognize a selected epitope can be generated using a technique referred to as "guided selection." In this approach a selected non-human monoclonal antibody, e.g., a mouse antibody, is used to guide the selection of a completely human antibody recognizing the same epitope. (Jespers et al., Bio/Technology 72:899-903 (1988). See also, U.S. Patent No. 5,565,332.)
[0315] Further, antibodies to target polypeptides of the invention can, in turn, be utilized to generate anti-idiotype antibodies that "mimic" target polypeptides using techniques well known to those skilled in the art. (See, e.g., Greenspan & Bona, FASEB J. 7(5):437- 444 (1989) and Nissinoff, J. Immunol. J47(8):2429-243S (1991)). For example, antibodies which bind to and competitively inhibit polypeptide multimerization and/or binding of a polypeptide of the invention to a ligand can be used to generate antiidiotypes that "mimic" the polypeptide multimerization and/or binding domain and, as a consequence, bind to and neutralize polypeptide and/or its ligand. Such neutralizing antiidiotypes or Fab fragments of such anti-idiotypes can be used in therapeutic regimens to neutralize polypeptide ligand. For example, such anti-idiotypic antibodies can be used to bind a desired target polypeptide and/or to bind its ligands/receptors, and thereby block its biological activity.
[0316] In another embodiment, DNA encoding desired monoclonal antibodies may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies). The isolated and subcloned hybridoma cells serve as a preferred source of such DNA. Once isolated, the DNA may be placed into expression vectors, which are then transfected into prokaryotic or eukaryotic host cells such as, but not limited to, E. coli cells, simian COS cells, Chinese Hamster Ovary (CHO) cells or myeloma cells that do not otherwise produce immunoglobulins. More particularly, the isolated DNA (which may be synthetic as described herein) may be used to clone constant and variable region sequences for the manufacture antibodies as described in Newman et al, U.S. Pat. No. 5,658,570, filed January 25, 1995, which is incorporated by reference herein. Essentially, this entails extraction of RNA from the selected cells, conversion to cDNA, and amplification by PCR using Ig specific primers. Suitable primers for this purpose are also described in U.S. Pat. No. 5,658,570. As will be discussed in more detail below, transformed cells expressing the desired antibody may be grown up in relatively large quantities to provide clinical and commercial supplies of the immunoglobulin.
[0317] In one embodiment, an IGF-IR antibody of the invention comprises at least one heavy or light chain CDR of an antibody molecule. In another embodiment, an IGF-IR antibody of the invention comprises at least two CDRs from one or more antibody molecules. In another embodiment, an IGF-IR antibody of the invention comprises at least three CDRs from one or more antibody molecules. In another embodiment, an IGF- IR antibody of the invention comprises at least four CDRs from one or more antibody molecules. In another embodiment, an IGF-IR antibody of the invention comprises at least five CDRs from one or more antibody molecules. In another embodiment, an IGF- IR antibody of the invention comprises at least six CDRs from one or more antibody molecules. Exemplary antibody molecules comprising at least one CDR that can be included in the subject IGF-IR antibodies are described herein.
[0318] In a specific embodiment, the amino acid sequence of the heavy and/or light chain variable domains may be inspected to identify the sequences of the complementarity determining regions (CDRs) by methods that are well know in the art, e.g., by comparison to known amino acid sequences of other heavy and light chain variable regions to determine the regions of sequence hypervariability. Using routine recombinant DNA techniques, one or more of the CDRs may be inserted within framework regions, e.g., into human framework regions to humanize a non-human antibody. The framework regions may be naturally occurring or consensus framework regions, and preferably human framework regions {see, e.g., Chothia et al., J. MoI. Biol. 278:457-479 (1998) for a listing of human framework regions). Preferably, the polynucleotide generated by the combination of the framework regions and CDRs encodes an antibody that specifically binds to at least one epitope of a desired polypeptide, e.g., IGF-IR. Preferably, one or more amino acid substitutions may be made within the framework regions, and, preferably, the amino acid substitutions improve binding of the antibody to its antigen. Additionally, such methods may be used to make amino acid substitutions or deletions of one or more variable region cysteine residues participating in an intrachain disulfide bond to generate antibody molecules lacking one or more intrachain disulfide bonds. Other alterations to the polynucleotide are encompassed by the present invention and within the skill of the art.
[0319] In addition, techniques developed for the production of "chimeric antibodies"
(Morrison et al., Proc. Natl. Acad. Sd. 57:851-855 (1984); Neuberger et al, Nature
11 372:604-608 (1984); Takeda et al, Nature 314:452-454 (1985)) by splicing genes from a mouse antibody molecule of appropriate antigen specificity together with genes from a human antibody molecule of appropriate biological activity can be used. As used herein, a chimeric antibody is a molecule in which different portions are derived from different animal species, such as those having a variable region derived from a murine monoclonal antibody and a human immunoglobulin constant region, e.g., humanized antibodies.
[0320] Alternatively, techniques described for the production of single chain antibodies
(U.S. Pat. No. 4,694,778; Bird, Science 242:423-442 (1988); Huston et al, Proc. Natl. Acad. Sd. USA 55:5879-5883 (1988); and Ward et al, Nature 354:544-554 (1989)) can be adapted to produce single chain antibodies. Single chain antibodies are formed by linking the heavy and light chain fragments of the Fv region via an amino acid bridge, resulting in a single chain antibody. Techniques for the assembly of functional Fv fragments in E coli may also be used (Skerra et al, Science 242:1038-1041 (1988)).
[0321] Yet other embodiments of the present invention comprise the generation of human or substantially human antibodies in transgenic animals (e.g., mice) that are incapable of endogenous immunoglobulin production (see e.g., U.S. Pat. Nos. 6,075,181, 5,939,598, 5,591,669 and 5,589,369 each of which is incorporated herein by reference). For example, it has been described that the homozygous deletion of the antibody heavy-chain joining region in chimeric and germ-line mutant mice results in complete inhibition of endogenous antibody production. Transfer of a human immunoglobulin gene array to such germ line mutant mice will result in the production of human antibodies upon antigen challenge. Another preferred means of generating human antibodies using SCDD mice is disclosed in U.S. Pat. No. 5,811,524 which is incorporated herein by reference. It will be appreciated that the genetic material associated with these human antibodies may also be isolated and manipulated as described herein.
[0322] Yet another highly efficient means for generating recombinant antibodies is disclosed by Newman, Biotechnology 10: 1455-1460 (1992). Specifically, this technique results in the generation of primatized antibodies that contain monkey variable domains and human constant sequences. This reference is incorporated by reference in its entirety herein. Moreover, this technique is also described in commonly assigned U.S. Pat. Nos. 5,658,570, 5,693,780 and 5,756,096 each of which is incorporated herein by reference.
[0323] In another embodiment, lymphocytes can be selected by micromanipulation and the variable genes isolated. For example, peripheral blood mononuclear cells can be isolated from an immunized mamma1 *nd cultured for about 7 days in vitro. The cultures can be screened for specific IgGs that meet the screening criteria. Cells from positive wells can be isolated. Individual Ig-producing B cells can be isolated by FACS or by identifying them in a complement-mediated hemolytic plaque assay. Ig-producing B cells can be micromanipulated into a tube and the VH and VL genes can be amplified using, e.g., RT-PCR. The VH and VL genes can be cloned into an antibody expression vector and transfected into cells (e.g., eukaryotic or prokaryotic cells) for expression.
[03241 Alternatively, antibody-producing cell lines may be selected and cultured using techniques well known to the skilled artisan. Such techniques are described in a variety of laboratory manuals and primary publications. In this respect, techniques suitable for use in the invention as described below are described in Current Protocols in Immunology, Coligan et al., Eds., Green Publishing Associates and Wiley-Interscience, John Wiley and Sons, New York (1991) which is herein incorporated by reference in its entirety, including supplements.
[0325] Antibodies of the present invention can be produced by any method known in the art for the synthesis of antibodies, in particular, by chemical synthesis or preferably, by recombinant expression techniques as described herein.
[0326] In one embodiment, an IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof of the invention comprises a synthetic constant region wherein one or more domains are partially or entirely deleted ("domain-deleted antibodies")- In certain embodiments compatible modified antibodies will comprise domain deleted constructs or variants wherein the entire CH2 domain has been removed (ΔCH2 constructs). For other embodiments a short connecting peptide may be substituted for the deleted domain to provide flexibility and freedom of movement for the variable region. Those skilled in the art will appreciate that such constructs are particularly preferred due to the regulatory properties of the CH2 domain on the catabolic rate of the antibody. Domain deleted constructs can be derived using a vector encoding an IgGi human constant domain (see, e.g., WO 02/060955 A2 and WO02/096948A2). This vector is engineered to delete the CH2 domain and provide a synthetic vector expressing a domain deleted IgG] constant region.
[0327] In certain embodiments, IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention are minibodies. Minibodies can be made using methods described in the art (see e.g., US patent 5,837,821 or WO 94/09817A1). [0328] In one embodiment, an IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof of the invention comprises an immunoglobulin heavy chain having deletion or substitution of a few or even a single amino acid as long as it permits association between the monomelic subunits. For example, the mutation of a single amino acid in selected areas of the CH2 domain may be enough to substantially reduce Fc binding and thereby increase tumor localization. Similarly, it may be desirable to simply delete that part of one or more constant region domains that control the effector function (e.g. complement binding) to be modulated. Such partial deletions of the constant regions may improve selected characteristics of the antibody (serum half-life) while leaving other desirable functions associated with the subject constant region domain intact. Moreover, as alluded to above, the constant regions of the disclosed antibodies may be synthetic through the mutation or substitution of one or more amino acids that enhances the profile of the resulting construct. In this respect it may be possible to disrupt the activity provided by a conserved binding site {e.g. Fc binding) while substantially maintaining the configuration and immunogenic profile of the modified antibody. Yet other embodiments comprise the addition of one or more amino acids to the constant region to enhance desirable characteristics such as effector function or provide for more cytotoxin or carbohydrate attachment. In such embodiments it may be desirable to insert or replicate specific sequences derived from selected constant region domains.
[0329] The present invention also provides antibodies that comprise, consist essentially of, or consist of, variants (including derivatives) of antibody molecules (e.g., the VH regions and/or VL regions) described herein, which antibodies or fragments thereof immunospecifically bind to an IGF-IR polypeptide or fragment or variant thereof. Standard techniques known to those of skill in the art can be used to introduce mutations in the nucleotide sequence encoding an IGF-IR antibody, including, but not limited to, site-directed mutagenesis and PCR-mediated mutagenesis which result in amino acid substitutions. Preferably, the variants (including derivatives) encode less than 50 amino acid substitutions, less than 40 amino acid substitutions, less than 30 amino acid substitutions, less than 25 amino acid substitutions, less than 20 amino acid substitutions, less than 15 amino acid substitutions, less than 10 amino acid substitutions, less than 5 amino acid substitutions, less than 4 amino acid substitutions, less than 3 amino acid substitutions, or less than 2 amino acid substitutions relative to the reference VH region, VH-CDRl, VH-CDR2, VH-CDR3, VL region, VL-CDRl, VL-CDR2, or VL-CDR3. A
"conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a side chain with a similar charge. Families of amino acid residues having side chains with similar charges have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagjne, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains ( e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Alternatively, mutations can be introduced randomly along all or part of the coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for biological activity to identify mutants that retain activity (e.g., the ability to bind an IGF-IR polypeptide). [03301 F°r example, it is possible to introduce mutations only in framework regions or only in CDR regions of an antibody molecule. Introduced mutations may be silent or neutral missense mutations, i.e., have no, or little, effect on an antibody's ability to bind antigen, indeed some such mutations do not alter the amino acid sequence whatsoever. These types of mutations may be useful to optimize codon usage, or improve a. hybridoma's antibody production. Codon-optimized coding regions encoding IGF-IR antibodies of the present invention are disclosed elsewhere herein. Alternatively, non- neutral missense mutations may alter an antibody's ability to bind antigen. The location of most silent and neutral missense mutations is likely to be in the framework regions, while the location of most non-neutral missense mutations is likely to be in CDR, though this is not an absolute requirement. One of skill in the art would be able to design and test mutant molecules with desired properties such as no alteration in antigen binding activity or alteration in binding activity (e.g., improvements in antigen binding activity or change in antibody specificity). Following mutagenesis, the encoded protein may routinely be expressed and the functional and/or biological activity of the encoded protein, (e.g., ability to immunospecifically bind at least one epitope of an IGF-IR polypeptide) can be determined using techniques described herein or by routinely modifying techniques known in the art.
IV. POLYNUCLEOTIDES ENCODING IGF-IR ANTIBODIES
[0331] The present invention also provides for nucleic acid molecules encoding IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention. 2] In one embodiment, the present invention provides an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid encoding an immunoglobulin heavy chain variable region (VH), where at least one of the CDRs of the heavy chain variable region or at least two of the VH-CDRs of the heavy chain variable region are at least 80%, 85%, 90% or 95% identical to reference heavy chain VH-CDRl, VH-CDR2, or VH-CDR3 amino acid sequences from monoclonal IGF-IR antibodies disclosed herein. Alternatively, the VH-CDRl, VH-CDR2, and VH-CDR3 regions of the VH are at least 80%, 85%, 90% or 95% identical to reference heavy chain VH-CDRl, VH-CDR2, and VH-CDR3 amino acid sequences from monoclonal IGF-IR antibodies disclosed herein. Thus, according to this embodiment a heavy chain variable region of the invention has VH-CDRl, VH-CDR2, or VH-CDR3 polypeptide sequences related to the polypeptide sequences shown in Table 5:
TABLE 5: Reference VH-CDRl, VH-CDR2, and VH-CDR3 amino acid sequences"
Determined by the Kabat system (see supra). N=nucleotide sequence, P= polypeptide sequence.
[0333] As known in the art, "sequence identity" between two polypeptides or two polynucleotides is determined by comparing the amino acid or nucleic acid sequence of one polypeptide or polynucleotide to the sequence of a second polypeptide or polynucleotide. When discussed herein, whether any particular polypeptide is at least about 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or 95% identical to another polypeptide can be determined using methods and computer programs/software known in the art such as, but not limited to, the BESTFIT program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, WI 53711). BESTFIT uses the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2:482-489 (1981), to find the best segment of homology between two sequences. When using BESTFIT or any other sequence alignment program to determine whether a particular sequence is, for example, 95% identical to a reference sequence according to the present invention, the parameters are set, of course, such that the percentage of identity is calculated over the full length of the reference polypeptide sequence and that gaps in homology of up to 5% of the total number of amino acids in the reference sequence are allowed.
[0334] In certain embodiments, an antibody or antigen-binding fragment comprising the
VH encoded by the polynucleotide specifically or preferentially binds to IGF-IR. In certain embodiments the nucleotide sequence encoding the VH polypeptide is altered without altering the amino acid sequence encoded thereby. For instance, the sequence may be altered for improved codon usage in a given species, to remove splice sites, or the remove restriction enzyme sites. Sequence optimizations such as these are described in the examples and are well known and routinely carried out by those of ordinary skill in the art.
[0335] In another embodiment, the present invention provides an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid encoding an immunoglobulin heavy chain variable region (VH) in which the VH-CDRl, VH-CDR2, and VH-CDR3 regions have polypeptide sequences which are identical to the VH-CDRl, VH-CDR2, and VH-CDR3 groups shown in Table 5. In certain embodiments, an antibody or antigen-binding fragment comprising the VH encoded by the polynucleotide specifically or preferentially binds to IGF-IR.
[0336] In certain embodiments, an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VH encoded by one or more of the polynucleotides described above specifically or preferentially binds to the same IGF- Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8, or will competitively inhibit such a monoclonal antibody or fragment from binding to IGF-IR.
[0337] In certain embodiments, an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VH encoded by one or more of the polynucleotides described above specifically or preferentially binds to an IGF-IR polypeptide or fragment thereof, or a IGF-IR variant polypeptide, with an affinity characterized by a dissociation constant (KD) no greater than 5 x 10"2 M, 10"2 M, 5 x 10'3 M, IO 3 M, 5 x 10^ M, 10^ M, 5 x 10"5 M, 10"5 M, 5 x 1(T6 M, 1(T6 M, 5 x 107 M, 1(T7 M, 5 x 108 M, 108 M, 5 x 10'9 M, 109 M, 5 x lO"10 M, lO"10 M, 5 x lO'11 M, lθ " M, 5 x 10 12 M, 10"12 M, 5 x 10 13 M, 10 13 M, 5 x 10 14 M, 10"14 M, 5 x 10'15 M, or 1(T15 M. 8] In another embodiment, the present invention provides an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid encoding an immunoglobulin light chain variable region (VL), where at least one of the VL-CDRs of the light chain variable region or at least two of the VL-CDRs of the light chain variable region are at least 80%, 85%, 90% or 95% identical to reference light chain VL-CDRl, VL-CDR2, or VL-CDR3 amino acid sequences from monoclonal IGF-IR antibodies disclosed herein. Alternatively, the VL-CDRl, VL-CDR2, and VL-CDR3 regions of the VL are at least 80%, 85%, 90% or 95% identical to reference light chain VL-CDRl, VL- CDR2, and VL-CDR3 amino acid sequences from monoclonal IGF-IR antibodies disclosed herein. Thus, according to this embodiment a light chain variable region of the invention has VL-CDRl, VL-CDR2, or VL-CDR3 polypeptide sequences related to the polypeptide sequences shown in Table 6: TABLE 6: Reference VL-CDRl, VL-CDR2, and VL-CDR3 amino acid sequences*
QQGSSIPL
QHSRELPY
QQGKTLPW
Determined by the Kabat system (see supra). PN=nucleotide sequence, PP=polypeptide sequence.
[0339J In certain embodiments, an antibody or antigen-binding fragment comprising the
VL encoded by the polynucleotide specifically or preferentially binds to IGF-IR. [0340] In another embodiment, the present invention provides an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid encoding an immunoglobulin light chain variable region (VL) in which the VL-CDRl , VL-CDR2, and VL-CDR3 regions have polypeptide sequences which are identical to the VL-CDRl, VL- CDR2, and VL-CDR3 groups shown in Table 6. In certain embodiments, an antibody or antigen-binding fragment comprising the VL encoded by the polynucleotide specifically or preferentially binds to IGF-IR.
[0341] In a further aspect, the present invention provides an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid encoding an immunoglobulin light chain variable region (VL) in which the VL-CDRl, VL-CDR2, and VL-CDR3 regions are encoded by nucleotide sequences which are identical to the nucleotide sequences which encode the VL-CDRl, VL-CDR2, and VL-CDR3 groups shown in Table 6. In certain embodiments, an antibody or antigen-binding fragment comprising the VL encoded by the polynucleotide specifically or preferentially binds to IGF-IR.
[0342] In certain embodiments, an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VL encoded by one or more of the polynucleotides described above specifically or preferentially binds to the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8, or will competitively inhibit such a monoclonal antibody or fragment from binding to IGF-IR.
[0343] In certain embodiments, an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VL encoded by one or more of the polynucleotides described above specifically or preferentially binds to an IGF-IR polypeptide or fragment thereof, or a IGF-IR variant polypeptide, with an affinity characterized by a dissociation constant (KD) no greater than 5 x 10"2 M, 10"2 M, 5 x 10"3 M, 10"3 M, 5 x 10"4 M, KT4 M, 5 x 10 s M, 1(T5 M, 5 x 10"6 M, 1O-6 M, 5 x 1(T7 M, 10'7 M, 5 x 10"8 M, 108 M, 5 x 10"9 M, 10"9 M, 5 x 10'10 M, 10"10 M, 5 x 10"u M, 10 n M, 5 x 10" 12 M, Kr12 M, 5 x Kr13 M, 10 13 M, 5 x 1(T14 M, 10'14 M, 5 x 10'15 M, or 10 15 M.
[0344] In a further embodiment, the present invention includes an isolated polynucleotide comprising, consisting essentially of. or consisting of a nucleic acid encoding a VH at least 80%, 85%, 90% 95% or 100% identical to a reference VH polypeptide sequence selected from the group consisting of SEQ ID NOs: 4, 9, 14, 20, 26, 32, 38, 43, 48, 53, 58, and 63. In certain embodiments, an antibody or antigen-binding fragment comprising the VH encoded by the polynucleotide specifically or preferentially binds to IGF-IR.
[0345] In another aspect, the present invention includes an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid sequence encoding a VH having a polypeptide sequence selected from the group consisting of SEQ ID NOs: 4, 9, 14, 20, 26, 32, 38, 43, 48, 53, 58, and 63. In certain embodiments, an antibody or antigen-binding fragment comprising the VH encoded by the polynucleotide specifically or preferentially binds to IGF-IR.
[0346] In a further embodiment, the present invention includes an isolated polynucleotide comprising, consisting essentially of, or consisting of a VH-encoding nucleic acid at least 80%, 85%, 90% 95% or 100% identical to a reference nucleic acid sequence selected from the group consisting of SEQ ID NOs: 3, 8, 13, 18, 19, 24, 25, 30, 31, 36, 37, 42, 47, 52, 57, and 62. In certain embodiments, an antibody or antigen-binding fragment comprising the VH encoded by such polynucleotides specifically or preferentially binds to IGF-IR.
[0347] In another aspect, the present invention includes an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid sequence encoding a VH of the invention, where the amino acid sequence of the VH is selected from the group consisting of SEQ ID NOs: 4, 9, 14, 20, 26, 32, 38, 43, 48, 53, 58, and 63. The present invention further includes an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid sequence encoding a VH of the invention, where the sequence of the nucleic acid is selected from the group consisting of SEQ ID NOs: 3, 8, 13, 18, 19, 24, 25, 30, 31, 36, 37, 42, 47, 52, 57, and 62. In certain embodiments, an antibody or antigen-binding fragment comprising the VH encoded by such polynucleotides specifically or preferentially binds to IGF-IR.
[0348] In certain embodiments, an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VH encoded by one or more of the polynucleotides described above specifically or preferentially binds to the same IGF- Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8, or will competitively inhibit such a monoclonal antibody or fragment from binding to IGF-IR, or will competitively inhibit such a monoclonal antibody from binding to IGF-IR.
[0349] In certain embodiments, an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VH encoded by one or more of the polynucleotides described above specifically or preferentially binds to an IGF-IR polypeptide or fragment thereof, or a IGF-IR variant polypeptide, with an affinity characterized by a dissociation constant (KD) no greater than 5 x 10"2 M, 10'2 M, 5 x 10"3 M, 10'3 M, 5 x 10^ M, IO-4 M, 5 x 1(T5 M, 10 5 M, 5 x 1(T6 M, 1(T6 M, 5 x 10'7 M, 107 M, 5 x 10"8 M, 10"8 M, 5 x 10"9 M, 10~9 M, 5 x 10'10 M, 10"10 M, 5 x 10"n M, lθ " M, 5 x 10" 12 M, 10-12 M, 5 x 1(T13 M, 10 13 M, 5 x 10"14 M, 10"14 M, 5 x 1(T15 M, or 1(T15 M.
[0350] In a further embodiment, the present invention includes an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid encoding a VL at least 80%, 85%, 90% 95% or 100% identical to a reference VL polypeptide sequence having an amino acid sequence selected from the group consisting of SEQ ID NOs: 68, 73, 78, 83, 88, 93, 98, 103, 108, 113, and 118. In a further embodiment, the present invention includes an isolated polynucleotide comprising, consisting essentially of, or consisting of a VL-encoding nucleic acid at least 80%, 85%, 90% 95% or 100% identical to a reference nucleic acid sequence selected from the group consisting of SEQ ID NOs:
67, 72, 77, 82, 87, 92, 97, 102, 107, 112, and 117. In certain embodiments, an antibody or antigen-binding fragment comprising the VL encoded by such polynucleotides specifically or preferentially binds to IGF-IR.
[0351] In another aspect, the present invention includes an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid sequence encoding a VL having a polypeptide sequence selected from the group consisting of SEQ ID NOs:
68, 73, 78, 83, 88, 93, 98, 103, 108, 113, and 118. The present invention further includes an isolated polynucleotide comprising, consisting essentially of, or consisting of a nucleic acid sequence encoding a VL of the invention, where the sequence of the nucleic acid is selected from the group consisting of SEQ ID NOs: 67, 72, 77, 82, 87, 92, 97, 102, 107, 112, and 117. In certain embodiments, an antibody or antigen-binding fragment comprising the VL encoded by such polynucleotides specifically or preferentially binds to IGF-IR.
[0352] In certain embodiments, an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VL encoded by one or more of the polynucleotides described above specifically or preferentially binds to the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8, or will competitively inhibit such a monoclonal antibody or fragment from binding to IGF-IR.
[0353] In certain embodiments, an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a VL encoded by one or more of the polynucleotides described above specifically or preferentially binds to an IGF-IR polypeptide or fragment thereof, or a IGF-IR variant polypeptide, with an affinity characterized by a dissociation constant (KD) no greater than 5 x 10"2 M, 10~2 M, 5 x 10"3 M, 10~3 M, 5 x 10"4 M, 10"4 M, 5 x 10'5 M, 10~5 M, 5 x 10"6 M, 10"6 M, 5 x 10"7 M, 10~7 M, 5 x 10"8 M, 1(T8 M, 5 x 10~9 M, 10"9 M, 5 x 1(T10 M, 10 10 M, 5 x 10"u M, 10 M, 5 x 10" 12 M, 10~12 M, 5 x 10 ° M, 10 13 M, 5 x 10"14 M, 10 14 M, 5 x 10"15 M, or 10 15 M.
[0354] Any of the polynucleotides described above may further include additional nucleic acids, encoding, e.g., a signal peptide to direct secretion of the encoded polypeptide, antibody constant regions as described herein, or other heterologous polypeptides as described herein.
[0355] Also, as described in more detail elsewhere herein, the present invention includes compositions comprising the polynucleotides comprising one or more of the polynucleotides described above. In one embodiment, the invention includes compositions comprising a first polynucleotide and second polynucleotide wherein said first polynucleotide encodes a VH polypeptide as described herein and wherein said second polynucleotide encodes a VL polypeptide as described herein. Specifically a composition which comprises, consists essentially of, or consists of a VH polynucleotide, and a VL polynucleotide, wherein the VH polynucleotide and the VL polynucleotide encode polypeptides, respectively at least 80%, 85%, 90% 95% or 100% identical to reference VL and VL polypeptide amino acid sequences selected from the group consisting of SEQ ID NOs: 4 and 68, 8 and 73, 14 and 78, 20 and 83, 26 and 88, 32 and 93, 38 and 98, 43 and 103, 48 and 108, 53 and 103, 58 and 113, and 63 and 118. Or alternatively, a composition which comprises, consists essentially of, or consists of a VH polynucleotide, and a VL polynucleotide at least 80%, 85%, 90% 95% or 100% identical, respectively, to reference VL and VL nucleic acid sequences selected from the group consisting of SEQ ID NOs: 3 and 67, 8 and 72, 13 and 77, 18 and 77, 19 and 82, 24 and 82, 25 and 87, 30 and 87, 31 and 92, 36 and 92, 37 and 97, 42 and 102, 47 and 107, 58 and 102, 57 and 112, and 62 and 117. In certain embodiments, an antibody or antigen- binding fragment comprising the VH and VL encoded by the polynucleotides in such compositions specifically or preferentially binds to IGF-IR.
[0356] The present invention also includes fragments of the polynucleotides of the invention, as described elsewhere. Additionally polynucleotides which encode fusion polynucleotides, Fab fragments, and other derivatives, as described herein, are also contemplated by the invention.
[0357] The polynucleotides may be produced or manufactured by any method known in the art. For example, if the nucleotide sequence of the antibody is known, a polynucleotide encoding the antibody may be assembled from chemically synthesized oligonucleotides (e.g., as described in Kutmeier et al., BioTechniques 17:242 (1994)), which, briefly, involves the synthesis of overlapping oligonucleotides containing portions of the sequence encoding the antibody, annealing and ligating of those oligonucleotides, and then amplification of the ligated oligonucleotides by PCR.
[0358] Alternatively, a polynucleotide encoding an IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof may be generated from nucleic acid from a suitable source. If a clone containing a nucleic acid encoding a particular antibody is not available, but the sequence of the antibody molecule is known, a nucleic acid encoding the antibody may be chemically synthesized or obtained from a suitable source (e.g., an antibody cDNA library, or a cDNA library generated from, or nucleic acid, preferably poly A+RNA, isolated from, any tissue or cells expressing the antibody or other IGF-IR antibody, such as hybridoma cells selected to express an antibody) by PCR amplification using synthetic primers hybridizable to the 3' and 5' ends of the sequence or by cloning using an oligonucleotide probe specific for the particular gene sequence to identify, e.g., a cDNA clone from a cDNA library that encodes the antibody or other IGF-IR antibody. Amplified nucleic acids generated by PCR may then be cloned into replicable cloning vectors using any method well known in the art.
[0359] Once the nucleotide sequence and corresponding amino acid sequence of the IGF-
IR antibody, or antigen-binding fragment, variant, or derivative thereof is determined, its nucleotide sequence may be manipulated using methods well known in the art for the manipulation of nucleotide sequences, e.g., recombinant DNA techniques, site directed mutagenesis, PCR, etc. (see, for example, the techniques described in Sambrook et al., Molecular Cloning, A Laboratory Manual, 2d Ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. (1990) and Ausubel et al., eds., Current Protocols in Molecular Biology, John Wiley & Sons, NY (1998), which are both incorporated by reference herein in their entireties ), to generate antibodies having a different amino acid sequence, for example to create amino acid substitutions, deletions, and/or insertions.
[0360] A polynucleotide encoding an IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof can be composed of any polyribonucleotide or polydeoxribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA. For example, a polynucleotide encoding IGF-IR antibody, or antigen-binding fragment," variant, or derivative thereof can be composed of single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and double- stranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that may be single-stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions. In addition, a polynucleotide encoding an IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof can be composed of triple-stranded regions comprising RNA or DNA or both RNA and DNA. A polynucleotide encoding an IGF-IR antibody, or antigen- binding fragment, variant, or derivative thereof may also contain one or more modified bases or DNA or RNA backbones modified for stability or for other reasons. "Modified" bases include, for example, tritylated bases and unusual bases such as inosine. A variety of modifications can be made to DNA and RNA; thus, "polynucleotide" embraces chemically, enzymatically, or metabolically modified forms.
[0361] An isolated polynucleotide encoding a non-natural variant of a polypeptide derived from an immunoglobulin (e.g., an immunoglobulin heavy chain portion or light chain portion) can be created by introducing one or more nucleotide substitutions, additions or deletions into the nucleotide sequence of the immunoglobulin such that one or more amino acid substitutions, additions or deletions are introduced into the encoded protein. Mutations may be introduced by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis. Preferably, conservative amino acid substitutions are made at one or more non-essential amino acid residues.
V. IGF- 1 R ANTIBODY POLYPEPTIDES
[0362] The present invention is further directed to isolated polypeptides which make up
IGF-IR antibodies, and polynucleotides encoding such polypeptides. IGF-IR antibodies of the present invention comprise polypeptides, e.g., amino acid sequences encoding IGF- lR-specific antigen binding regions derived from immunoglobulin molecules. A polypeptide or amino acid sequence "derived from" a designated protein refers to the origin of the polypeptide having a certain amino acid sequence. In certain cases, the polypeptide or amino acid sequence which is derived from a particular starting polypeptide or amino acid sequence has an amino acid sequence that is essentially identical to that of the starting sequence, or a portion thereof, wherein the portion consists of at least 10-20 amino acids, at least 20-30 amino acids, at least 30-50 amino acids, or which is otherwise identifiable to one of ordinary skill in the art as having its origin in the starting sequence.
[0363] In one embodiment, the present invention provides an isolated polypeptide comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable region (VH), where at least one of VH-CDRs of the heavy chain variable region or at least two of the VH-CDRs of the heavy chain variable region are at least 80%, 85%, 90% or 95% identical to reference heavy chain VH-CDRl, VH-CDR2 or VH-CDR3 amino acid sequences from monoclonal IGF-IR antibodies disclosed herein. Alternatively, the VH-CDRl, VH-CDR2 and VH-CDR3 regions of the VH are at least 80%, 85%, 90% or 95% identical to reference heavy chain VH-CDRl, VH-CDR2 and VH-CDR3 amino acid sequences from monoclonal IGF-IR antibodies disclosed herein. Thus, according to this embodiment a heavy chain variable region of the invention has VH-CDRl, VH-CDR2 and VH-CDR3 polypeptide sequences related to the groups shown in Table 5, supra. While Table 5 shows VH-CDRs defined by the Kabat system, other CDR definitions, e.g., VH-CDRs defined by the Chothia system, are also included in the present invention. In certain embodiments, an antibody or antigen-binding fragment comprising the VH specifically or preferentially binds to IGF-IR.
[0364] In another embodiment, the present invention provides an isolated polypeptide comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable region (VH) in which the VH-CDRl, VH-CDR2 and VH-CDR3 regions have polypeptide sequences which are identical to the VH-CDRl, VH-CDR2 and VH-CDR3 groups shown in Table 5. In certain embodiments, an antibody or antigen-binding fragment comprising the VH specifically or preferentially binds to IGF-IR.
[0365] In another embodiment, the present invention provides an isolated polypeptide comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable region (VH) in which the VH-CDRl, VH-CDR2 and VH-CDR3 regions have polypeptide sequences which are identical to the VH-CDRl, VH-CDR2 and VH-CDR3 groups shown in Table 5, except for one, two, three, four, five, or six amino acid substitutions in any one VH-CDR. In larger CDRs, e.g., VH-CDR-3, additional substitutions may be made in the CDR, as long as the a VH comprising the VH-CDR specifically or preferentially binds to IGF-IR. In certain embodiments the amino acid substitutions are conservative. In certain embodiments, an antibody or antigen-binding fragment comprising the VH specifically or preferentially binds to IGF-IR.
[0366] In a further embodiment, the present invention includes an isolated polypeptide comprising, consisting essentially of, or consisting of a VH polypeptide at least 80%, 85%, 90% 95% or 100% identical to a reference VH polypeptide amino acid sequence selected from the group consisting of SEQ ID NOs: SEQ ED NOs: 4, 9, 14, 20, 26, 32, 38, 43, 48, 53, 58, and 63. In certain embodiments, an antibody or antigen-binding fragment comprising the VH polypeptide specifically or preferentially binds to IGF-IR.
[0367J In another aspect, the present invention includes an isolated polypeptide comprising, consisting essentially of, or consisting of a VH polypeptide selected from the group consisting of SEQ ED NOs: SEQ DD NOs: 4, 9, 14, 20, 26, 32, 38, 43, 48, 53, 58, and 63. In certain embodiments, an antibody or antigen-binding fragment comprising the VH polypeptide specifically or preferentially binds to IGF-IR.
[0368] In certain embodiments, an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a one or more of the VH polypeptides described above specifically or preferentially binds to the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8, or will competitively inhibit such a monoclonal antibody or fragment from binding to IGF-IR
[0369] In certain embodiments, an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of one or more of the VH polypeptides described above specifically or preferentially binds to an IGF-IR polypeptide or fragment thereof, or a IGF-IR variant polypeptide, with an affinity characterized by a dissociation constant (KD) no greater than 5 x 10'2 M, 102 M, 5 x 10"3 M, 10"3 M, 5 x 10"4 M, 10"4 M, 5 x 105 M, 10"5 M, 5 x 10"6 M, 10"6 M, 5 x 107 M, 10"7 M, 5 x 10"8 M, 10'8 M, 5 x lO'9 M, 1(F M, 5 x 10 10 M, 10"10 M, 5 x 10"" M, 10 π M, 5 x 10 12 M, 10 12 M, 5 x 10"13 M, 10 13 M, 5 x 10~14 M, 10"14 M, 5 x 1(T15 M, or 10"15 M.
[0370] In another embodiment, the present invention provides an isolated polypeptide comprising, consisting essentially of, or consisting of an immunoglobulin light chain variable region (VL), where at least one of the VL-CDRs of the light chain variable region or at least two of the VL-CDRs of the light chain variable region are at least 80%, 85%, 90% or 95% identical to reference light chain VL-CDRl, VL-CDR2 or VL-CDR3 amino acid sequences from monoclonal IGF-IR antibodies disclosed herein. Alternatively, the VL-CDRl, VL-CDR2 and VL-CDR3 regions of the VL are at least 80%, 85%, 90% or 95% identical to reference light chain VL-CDRl, VL-CDR2 and VL- CDR3 amino acid sequences from monoclonal IGF-IR antibodies disclosed herein. Thus, according to this embodiment a light chain variable region of the invention has VL- CDRl, VL-CDR2 and VL-CDR3 polypeptide sequences related to the polypeptides shown in Table 6, supra. While Table 6 shows VL-CDRs defined by the Kabat system, other CDR definitions, e.g., VL-CDRs defined by the Chothia system, are also included in the present invention. In certain embodiments, an antibody or antigen-binding fragment comprising the VL polypeptide specifically or preferentially binds to IGF-IR.
[0371] In another embodiment, the present invention provides an isolated polypeptide comprising, consisting essentially of, or consisting of an immunoglobulin light chain variable region (VL) in which the VL-CDRl, VL-CDR2 and VL-CDR3 regions have polypeptide sequences which are identical to the VL-CDRl, VL-CDR2 and VL-CDR3 groups shown in Table 6. In certain embodiments, an antibody or antigen-binding fragment comprising the VL polypeptide specifically or preferentially binds to IGF-IR.
[0372] In another embodiment, the present invention provides an isolated polypeptide comprising, consisting essentially of, or consisting of an immunoglobulin heavy chain variable region (VL) in which the VL-CDRl, VL-CDR2 and VL-CDR3 regions have polypeptide sequences which are identical to the VL-CDRl, VL-CDR2 and VL-CDR3 groups shown in Table 6, except for one, two, three, four, five, or six amino acid substitutions in any one VL-CDR. In larger CDRs, additional substitutions may be made in the VL-CDR, as long as the a VL comprising the VL-CDR specifically or preferentially binds to IGF-IR. In certain embodiments the amino acid substitutions are conservative. In certain embodiments, an antibody or antigen-binding fragment comprising the VL specifically or preferentially binds to IGF-IR. [0373] In a further embodiment, the present invention includes an isolated polypeptide comprising, consisting essentially of, or consisting of a VL polypeptide at least 80%, 85%, 90% 95% or 100% identical to a reference VL polypeptide sequence selected from the group consisting of SEQ ID NOs: 68, 73, 78, 83, 88, 93, 98, 103, 108, 113, and 118. In certain embodiments, an antibody or antigen-binding fragment comprising the VL polypeptide specifically or preferentially binds to IGF-IR.
[0374] In another aspect, the present invention includes an isolated polypeptide comprising, consisting essentially of, or consisting of a VL polypeptide selected from the group consisting of S SEQ ID NOs: 68, 73, 78, 83, 88, 93, 98, 103, 108, 113, and 118. In certain embodiments, an antibody or antigen-binding fragment comprising the VL polypeptide specifically or preferentially binds to IGF-IR.
[0375] In certain embodiments, an antibody or antigen-binding fragment thereof comprising, consisting essentially of, one or more of the VL polypeptides described above specifically or preferentially binds to the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M 14- GI l, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8, or will competitively inhibit such a monoclonal antibody or fragment from binding to IGF-IR
[0376] In certain embodiments, an antibody or antigen-binding fragment thereof comprising, consisting essentially of, or consisting of a one or more of the VL polypeptides described above specifically or preferentially binds to an IGF-IR polypeptide or fragment thereof, or a IGF-IR variant polypeptide, with an affinity characterized by a dissociation constant (KD) no greater than 5 x 10'2 M, 10"2 M, 5 x 10° M, 10° M, 5 x W4 M, W4 M, 5 x 10"5 M, 105 M, 5 x 1O-6 M, 10"6 M, 5 x 10"7 M, 107 M, 5 x 10"8 M, 10"8 M, 5 x 10'9 M, 10"9 M, 5 x 10"10 M, 10"10 M, 5 x 10"n M, 10"u M, 5 x 10" 12 M, 10 12 M, 5 x 10"13 M, 10 13 M, 5 x 10 14 M, IO 14 M, 5 x 10"15 M, or 10"15 M.
[0377] In other embodiments, an antibody or antigen-binding fragment thereof comprises, consists essentially of or consists of a VH polypeptide, and a VL polypeptide, where the VH polypeptide and the VL polypeptide, respectively are at least 80%, 85%, 90% 95% or 100% identical to reference VL and VL polypeptide amino acid sequences selected from the group consisting of SEQ ID NOs: 4 and 68, 8 and 73, 14 and 78, 20 and 83, 26 and 88, 32 and 93, 38 and 98, 43 and 103, 48 and 108, 53 and 103, 58 and 113, and 63 and 118. In certain embodiments, an antibody or antigen-binding fragment comprising these VH and VL polypeptides specifically or preferentially binds to IGF-IR.
[0378] Any of the polypeptides described above may further include additional polypeptides, e.g., a signal peptide to direct secretion of the encoded polypeptide, antibody constant regions as described herein, or other heterologous polypeptides as described herein. Additionally, polypeptides of the invention include polypeptide fragments as described elsewhere. Additionally polypeptides of the invention include fusion polypeptide, Fab fragments, and other derivatives, as described herein.
[03791 Also, as described in more detail elsewhere herein, the present invention includes compositions comprising the polypeptides described above.
[0380] It will also be understood by one of ordinary skill in the art that IGF-IR antibody polypeptides as disclosed herein may be modified such that they vary in amino acid sequence from the naturally occurring binding polypeptide from which they were derived. For example, a polypeptide or amino acid sequence derived from a designated protein may be similar, e.g., have a certain percent identity to the starting sequence, e.g., it may be 60%, 70%, 75%, 80%, 85%, 90%, or 95% identical to the starting sequence.
[0381] Furthermore, nucleotide or amino acid substitutions, deletions, or insertions leading to conservative substitutions or changes at "non-essential" amino acid regions may be made. For example, a polypeptide or amino acid sequence derived from a designated protein may be identical to the starting sequence except for one or more individual amino acid substitutions, insertions, or deletions, e.g., one, two, three, four, five, six, seven, eight, nine, ten, fifteen, twenty or more individual amino acid substitutions, insertions, or deletions, a polypeptide or amino acid sequence derived from a designated protein may be identical to the starting sequence except for one or more individual amino acid substitutions, insertions, or deletions, e.g., one, two, three, four, five, six, seven, eight, nine, ten, fifteen, twenty or more individual amino acid substitutions, insertions, or deletions. In other embodiments, a polypeptide or amino acid sequence derived from a designated protein may be identical to the starting sequence except for two or fewer, three or fewer, four or fewer, five or fewer, six or fewer, seven or fewer, eight or fewer, nine or fewer, ten or fewer, fifteen or fewer, or twenty or fewer individual amino acid substitutions, insertions, or deletions. In certain embodiments, a polypeptide or amino acid sequence derived from a designated protein has one to five, one to ten, one to fifteen, or one to twenty individual amino acid substitutions, insertions, or deletions relative to the starting sequence. [0382] Certain IGF-IR antibody polypeptides of the present invention comprise, consist essentially of, or consist of an amino acid sequence derived from a human amino acid sequence. However, certain IGF-IR antibody polypeptides comprise one or more contiguous amino acids derived from another mammalian species. For example, an IGF- IR antibody of the present invention may include a primate heavy chain portion, hinge portion, or antigen binding region. In another example, one or more murine-derived amino acids may be present in a non-murine antibody polypeptide, e.g., in an antigen binding site of an IGF-IR antibody. In another example, the antigen binding site of an IGF-IR antibody is fully murine, hi certain therapeutic applications, IGF-lR-specific antibodies, or antigen-binding fragments, variants, or analogs thereof are designed so as to not be immunogenic in the animal to which the antibody is administered.
[0383] In certain embodiments, an IGF-IR antibody polypeptide comprises an amino acid sequence or one or more moieties not normally associated with an antibody. Exemplary modifications are described in more detail below. For example, a single-chain fv antibody fragment of the invention may comprise a flexible linker sequence, or may be modified to add a functional moiety (e.g., PEG, a drug, a toxin, or a label).
[0384] An IGF-IR antibody polypeptide of the invention may comprise, consist essentially of, or consist of a fusion protein. Fusion proteins are chimeric molecules which comprise, for example, an immunoglobulin antigen-binding domain with at least one target binding site, and at least one heterologous portion, i.e., a portion with which it is not naturally linked in nature. The amino acid sequences may normally exist in separate proteins that are brought together in the fusion polypeptide or they may normally exist in the same protein but are placed in a new arrangement in the fusion polypeptide. Fusion proteins may be created, for example, by chemical synthesis, or by creating and translating a polynucleotide in which the peptide regions are encoded in the desired relationship.
[0385] The term "heterologous" as applied to a polynucleotide or a polypeptide, means that the polynucleotide or polypeptide is derived from a distinct entity from that of the rest of the entity to which it is being compared. For instance, as used herein, a "heterologous polypeptide" to be fused to an IGF-IR antibody, or an antigen-binding fragment, variant, or analog thereof is derived from a non-immunoglobulin polypeptide of the same species, or an immunoglobulin or non-immunoglobulin polypeptide of a different species. [0386] A "conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, a nonessential amino acid residue in an immunoglobulin polypeptide is preferably replaced with another amino acid residue from the same side chain family. In another embodiment, a string of amino acids can be replaced with a structurally similar string that differs in order and/or composition of side chain family members.
[0387] Alternatively, in another embodiment, mutations may be introduced randomly along all or part of the immunoglobulin coding sequence, such as by saturation mutagenesis, and the resultant mutants can be incorporated into IGF-IR antibodies for use in the diagnostic and treatment methods disclosed herein and screened for their ability to bind to the desired antigen, e.g., IGF-IR.
VI. FUSION PROTEINS AND ANTIBODY CONJUGATES
[0388] As discussed in more detail elsewhere herein, IGF-IR antibodies, or antigen- binding fragments, variants, or derivatives thereof of the invention may further be recombinantly fused to a heterologous polypeptide at the N- or C-terminus or chemically conjugated (including covalent and non-covalent conjugations) to polypeptides or other compositions. For example, IGF-lR-specific IGF-IR antibodies may be recombinantly fused or conjugated to molecules useful as labels in detection assays and effector molecules such as heterologous polypeptides, drugs, radionuclides, or toxins. See, e.g., PCT publications WO 92/08495; WO 91/14438; WO 89/12624; U.S. Patent No. 5,314,995; and EP 396,387.
[0389] IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention include derivatives that are modified, i.e., by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody binding IGF-IR. For example, but not by way of limitation, the antibody derivatives include antibodies that have been modified, e.g., by glycosylation, acetylation, pegylation, phosphylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc. Additionally, the derivative may contain one or more non-classical amino acids. IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention can be composed of amino acids joined to each other by peptide bonds or modified peptide bonds, i.e., peptide isosteres, and may contain amino acids other than the 20 gene-encoded amino acids. IGF-lR-specfic antibodies may be modified by natural processes, such as posttranslational processing, or by chemical modification techniques which are well known in the art. Such modifications are well described in basic texts and in more detailed monographs, as well as in a voluminous research literature. Modifications can occur anywhere in the IGF-lR-specific antibody, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini, or on moieties such as carbohydrates. It will be appreciated that the same type of modification may be present in the same or varying degrees at several sites in a given IGF-lR-specific antibody. Also, a given IGF-lR-specific antibody may contain many types of modifications. IGF-lR-specific antibodies may be branched, for example, as a result of ubiquitination, and they may be cyclic, with or without branching. Cyclic, branched, and branched cyclic IGF-lR-specific antibodies may result from posttranslation natural processes or may be made by synthetic methods. Modifications include acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphotidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent cross-links, formation of cysteine, formation of pyroglutamate, formylation, gamma-carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, pegylation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination. (See, for instance, Proteins - Structure And Molecular Properties, T. E. Creighton, W. H. Freeman and Company, New York 2nd Ed., (1993); Posttranslational Covalent Modification Of Proteins, B. C. Johnson, Ed., Academic Press, New York, pgs. 1-12 (1983); Seifter et al., Meth Enzymol 182:626-646 (1990); Rattan et al., Ann NY Acad Sd 663AZ-62 (1992)). The present invention also provides for fusion proteins comprising an IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof, and a heterologous polypeptide. The heterologous polypeptide to which the antibody is fused may be useful for function or is useful to target the IGF-IR polypeptide expressing cells. In one embodiment, a fusion protein of the invention comprises, consists essentially of, or consists of, a polypeptide having the amino acid sequence of any one or more of the VH regions of an antibody of the invention or the amino acid sequence of any one or more of the VL regions of an antibody of the invention or fragments or variants thereof, and a heterologous polypeptide sequence. In another embodiment, a fusion protein for use in the diagnostic and treatment methods disclosed herein comprises, consists essentially of, or consists of a polypeptide having the amino acid sequence of any one, two, three of the VH-CDRs of an IGF-lR-specific antibody, or fragments, variants, or derivatives thereof, or the amino acid sequence of any one, two, three of the VL-CDRs of an IGF-lR-specific antibody, or fragments, variants, or derivatives thereof, and a heterologous polypeptide sequence. In one embodiment, the fusion protein comprises a polypeptide having the amino acid sequence of a VH-CDR3 of an IGF-lR-specific antibody of the present invention, or fragment, derivative, or variant thereof, and a heterologous polypeptide sequence, which fusion protein specifically binds to at least one epitope of IGF-IR. In another embodiment, a fusion protein comprises a polypeptide having the amino acid sequence of at least one VH region of an IGF-lR-specific antibody of the invention and the amino acid sequence of at least one VL region of an IGF-lR-specific antibody of the invention or fragments, derivatives or variants thereof, and a heterologous polypeptide sequence. Preferably, the VH and VL regions of the fusion protein correspond to a single source antibody (or scFv or Fab fragment) which specifically binds at least one epitope of IGF-IR. In yet another embodiment, a fusion protein for use in the diagnostic and treatment methods disclosed herein comprises a polypeptide having the amino acid sequence of any one, two, three or more of the VH CDRs of an IGF-lR-specific antibody and the amino acid sequence of any one, two, three or more of the VL CDRs of an IGF- lR-specific antibody, or fragments or variants thereof, and a heterologous polypeptide sequence. Preferably, two, three, four, five, six, or more of the VH-CDR(s) or VL- CDR(s) correspond to single source antibody (or scFv or Fab fragment) of the invention. Nucleic acid molecules encoding these fusion proteins are also encompassed by the invention.
[0392] Exemplary fusion proteins reported in the literature include fusions of the T cell receptor (Gascoigne et al, Proc. Natl. Acad. ScL USA 54:2936-2940 (1987)); CD4 (Capon et al., Nature 537:525-531 (1989); Traunecker et al., Nature 339:68-70 (1989); Zettmeissl et al., DNA Cell Biol. USA 9:347-353 (1990); and Bym et al., Nature 344:667- 670 (1990)); L-selectin (homing receptor) (Watson et al., J. Cell. Biol. 110:2221-2229 (1990); and Watson et al., Nature 349:164-167 (1991)); CD44 (ArufTo et al., Cell 67:1303-1313 (1990)); CD28 and B7 (Linsley et al, J. Exp. Med. 773:721-730 (1991)); CTLA-4 (Lisley et al., J. Exp. Med. 774:561-569 (1991)); CD22 (Stamenkovic et al., Cell 66:1133-1144 (1991)); TNF receptor (Ashkenazi et al., Proc. Natl. Acad. ScL USA 88: 10535-10539 (1991); Lesslauer et al., Eur. J. Immunol. 27:2883-2886 (1991); and Peppel et al., J. Exp. Med. 774:1483-1489 (1991)); and IgE receptor a (Ridgway and Gorman, J. Cell. Biol. Vol. 115, Abstract No. 1448 (1991)).
[0393] As discussed elsewhere herein, IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention may be fused to heterologous polypeptides to increase the in vivo half life of the polypeptides or for use in immunoassays using methods known in the art. For example, in one embodiment, PEG can be conjugated to the IGF-IR antibodies of the invention to increase their half-life in vivo. Leong, S.R., et al., Cytokine 16:106 (2001); Adv. in Drug Deliv. Rev. 54:531 (2002); or Weir et al., Biochem. Soc. Transactions 30:512 (2002).
[0394] Moreover, IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention can be fused to marker sequences, such as a peptide to facilitate their purification or detection, hi preferred embodiments, the marker amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector (QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, Calif, 91311), among others, many of which are commercially available. As described in Gentz et al., Proc. Natl. Acad. ScL USA 56:821- 824 (1989), for instance, hexa-histidine provides for convenient purification of the fusion protein. Other peptide tags useful for purification include, but are not limited to, the "HA" tag, which corresponds to an epitope derived from the influenza hemagglutinin protein (Wilson et al., Cell 37:767 (1984)) and the "flag" tag.
[0395] Fusion proteins can be prepared using methods that are well known in the art (see for example US Patent Nos. 5,116,964 and 5,225,538). The precise site at which the fusion is made may be selected empirically to optimize the secretion or binding characteristics of the fusion protein. DNA encoding the fusion protein is then transfected into a host cell for expression.
[0396] IGF-IR antibodies of the present invention may be used in non-conjugated form or may be conjugated to at least one of a variety of molecules, e.g., to improve the therapeutic properties of the molecule, to facilitate target detection, or for imaging or therapy of the patient. IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention can be labeled or conjugated either before or after purification, when purification is performed.
[0397] In particular, IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention may be conjugated to therapeutic agents, prodrugs, peptides, proteins, enzymes, viruses, lipids, biological response modifiers, pharmaceutical agents, or PEG.
[0398] Those skilled in the art will appreciate that conjugates may also be assembled using a variety of techniques depending on the selected agent to be conjugated. For example, conjugates with biotin are prepared e.g. by reacting a binding polypeptide with an activated ester of biotin such as the biotin N-hydroxysuccinimide ester. Similarly, conjugates with a fluorescent marker may be prepared in the presence of a coupling agent, e.g. those listed herein, or by reaction with an isothiocyanate, preferably fluorescein-isothiocyanate. Conjugates of the IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention are prepared in an analogous manner.
[0399] The present invention further encompasses IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention conjugated to a diagnostic or therapeutic agent. The IGF-IR antibodies can be used diagnostically to, for example, monitor the development or progression of a neurological disease as part of a clinical testing procedure to, e.g., determine the efficacy of a given treatment and/or prevention regimen. Detection can be facilitated by coupling the IGF-IR antibody, or antigen- binding fragment, variant, or derivative thereof to a detectable substance. Examples of detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, radioactive materials, positron emitting metals using various positron emission tomographies, and nonradioactive paramagnetic metal ions. See, for example, U.S. Pat. No. 4,741,900 for metal ions which can be conjugated to antibodies for use as diagnostics according to the present invention.
Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, β- galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin; and examples of suitable radioactive material include 1251, 1311, 111In or 99Tc.
[0400] An IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof also can be detectably labeled by coupling it to a chemiluminescent compound. The presence of the chemiluminescent-tagged IGF-IR antibody is then determined by detecting the presence of luminescence that arises during the course of a chemical reaction. Examples of particularly useful chemiluminescent labeling compounds are luminol, isoluminol, theromatic acridinium ester, imidazole, acridinium salt and oxalate ester.
[0401] One of the ways in which an IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof can be detectably labeled is by linking the same to an enzyme and using the linked product in an enzyme immunoassay (EIA) (Voller, A., "The Enzyme Linked Immunosorbent Assay (ELISA)" Microbiological Associates Quarterly Publication, Walkersville, Md., Diagnostic Horizons 2:1-7 (1978)); Voller et al., J. Clin. Pathol. 37:507-520 (1978); Butler, J. E., Meth. Enzymol. 73:482-523 (1981); Maggio, E. (ed.), Enzyme Immunoassay, CRC Press, Boca Raton, FIa., (1980); Ishikawa, E. et al., (eds.), Enzyme Immunoassay, Kgaku Shoin, Tokyo (1981). The enzyme, which is bound to the IGF-IR antibody will react with an appropriate substrate, preferably a chromogenic substrate, in such a manner as to produce a chemical moiety which can be detected, for example, by spectrophotometric, fluorimetric or by visual means. Enzymes which can be used to detectably label the antibody include, but are not limited to, malate dehydrogenase, staphylococcal nuclease, delta-5-steroid isomerase, yeast alcohol dehydrogenase, alpha-glycerophosphate, dehydrogenase, triose phosphate isomerase, horseradish peroxidase, alkaline phosphatase, asparaginase, glucose oxidase, beta- galactosidase, ribonuclease, urease, catalase, glucose-6-phosphate dehydrogenase, glucoamylase and acetylcholinesterase. Additionally, the detection can be accomplished by colorimetric methods which employ a chromogenic substrate for the enzyme. Detection may also be accomplished by visual comparison of the extent of enzymatic reaction of a substrate in comparison with similarly prepared standards. [0402] Detection may also be accomplished using any of a variety of other immunoassays. For example, by radioactively labeling the IGF-IR antibody, or antigen- binding fragment, variant, or derivative thereof, it is possible to detect the antibody through the use of a radioimmunoassay (RIA) (see, for example, Weintraub, B., Principles of Radioimmunoassays, Seventh Training Course on Radioligand Assay Techniques, The Endocrine Society, (March, 1986)), which is incorporated by reference herein). The radioactive isotope can be detected by means including, but not limited to, a gamma counter, a scintillation counter, or autoradiography.
[0403] An IGF-IR antibody, or antigen-binding fragment, variant, or derivative thereof can also be detectably labeled using fluorescence emitting metals such as 152Eu, or others of the lanthanide series. These metals can be attached to the antibody using such metal chelating groups as diethylenetriaminepentacetic acid (DTPA) or ethylenediaminetetraacetic acid (EDTA).
[0404] Techniques for conjugating various moieties to an IGF-IR antibody, or antigen- binding fragment, variant, or derivative thereof are well known, see, e.g., Arnon et al., "Monoclonal Antibodies For hnmunotargeting Of Drugs In Cancer Therapy", in Monoclonal Antibodies And Cancer Therapy, Reisfeld et al. (eds.), pp. 243-56 (Alan R. Liss, Inc. (1985); Hellstrom et al., "Antibodies For Drug Delivery", in Controlled Drug Delivery (2nd Ed.), Robinson et al. (eds.), Marcel Dekker, Inc., pp. 623-53 (1987); Thorpe, "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", in Monoclonal Antibodies '84: Biological And Clinical Applications, Pinchera et al. (eds.), pp. 475-506 (1985); "Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy", in Monoclonal Antibodies For Cancer Detection And Therapy, Baldwin et al. (eds.), Academic Press pp. 303-16 (1985), and Thorpe et al., "The Preparation And Cytotoxic Properties Of Antibody-Toxin Conjugates", Immunol. Rev. 62:119-58 (1982).
[0405] In particular, binding molecules, e.g., binding polypeptides, e.g., IGF-lR-specific antibodies or immunospeciflc fragments thereof for use in the diagnostic and treatment methods disclosed herein may be conjugated to cytotoxins (such as radioisotopes, cytotoxic drugs, or toxins) therapeutic agents, cytostatic agents, biological toxins, prodrugs, peptides, proteins, enzymes, viruses, lipids, biological response modifiers, pharmaceutical agents, immunologically active ligands (e.g., lymphokines or other antibodies wherein the resulting molecule binds to both the neoplastic cell and an effector cell such as a T cell), or PEG. In another embodiment, a binding molecule, e.g., a binding polypeptide, e.g., a IGF-lR-specific antibody or immunospecific fragment thereof for use in the diagnostic and treatment methods disclosed herein can be conjugated to a molecule that decreases vascularization of tumors. In other embodiments, the disclosed compositions may comprise binding molecules, e.g., binding polypeptides, e.g., IGF-IR- specific antibodies or immunospecific fragments thereof coupled to drugs or prodrugs. Still other embodiments of the present invention comprise the use of binding molecules, e.g., binding polypeptides, e.g., IGF-lR-specific antibodies or immunospecific fragments thereof conjugated to specific biotoxins or their cytotoxic fragments such as ricin, gelonin, ps eudomonas exotoxin or diphtheria toxin. The selection of which conjugated or unconjugated binding molecule to use will depend on the type and stage of cancer, use of adjunct treatment (e.g., chemotherapy or external radiation) and patient condition. It will be appreciated that one skilled in the art could readily make such a selection in view of the teachings herein.
[0406] It will be appreciated that, in previous studies, anti-tumor antibodies labeled with isotopes have been used successfully to destroy cells in solid tumors as well as lymphomas/leukernias in animal models, and in some cases in humans. Exemplary radioisotopes include: 90Y, 125I, 131I, 123I, 111In, 105Rh, 153Sm, 67Cu, 67Ga, 166Ho, 177Lu, 186Re and 188Re. The radionuclides act by producing ionizing radiation which causes multiple strand breaks in nuclear DNA, leading to cell death. The isotopes used to produce therapeutic conjugates typically produce high energy α- or β-particles which have a short path length. Such radionuclides kill cells to which they are in close proximity, for example neoplastic cells to which the conjugate has attached or has entered. They have little or no effect on non-localized cells. Radionuclides are essentially non-immunogenic.
[0407] With respect to the use of radiolabeled conjugates in conjunction with the present invention, binding molecules, e.g., binding polypeptides, e.g., IGF-lR-specific antibodies or immunospecific fragments thereof may be directly labeled (such as through iodination) or may be labeled indirectly through the use of a chelating agent. As used herein, the phrases "indirect labeling" and "indirect labeling approach" both mean that a chelating agent is covalently attached to a binding molecule and at least one radionuclide is associated with the chelating agent. Such chelating agents are typically referred to as bifunctional chelating agents as they bind both the polypeptide and the radioisotope. Particularly preferred chelating agents comprise l-isothiocycmatobenzyl-3- methyldiothelene triaminepentaacetic acid ("MX-DTPA") and cyclohexyl diethylenetriamine pentaacetic acid ("CHX-DTPA") derivatives. Other chelating agents comprise P-DOTA and EDTA derivatives. Particularly preferred radionuclides for indirect labeling include ' 11In and 90Y.
[0408] As used herein, the phrases "direct labeling" and "direct labeling approach" both mean that a radionuclide is covalently attached directly to a polypeptide (typically via an amino acid residue). More specifically, these linking technologies include random labeling and site-directed labeling. In the latter case, the labeling is directed at specific sites on the polypeptide, such as the N-linked sugar residues present only on the Fc portion of the conjugates. Further, various direct labeling techniques and protocols are compatible with the instant invention. For example, Technetium-99 labeled polypeptides may be prepared by ligand exchange processes, by reducing pertechnate (TcO4 ") with stannous ion solution, chelating the reduced technetium onto a Sephadex column and applying the binding polypeptides to this column, or by batch labeling techniques, e.g. by incubating pertechnate, a reducing agent such as SnCl2, a buffer solution such as a sodium-potassium phthalate-solution, and the antibodies. In any event, preferred radionuclides for directly labeling antibodies are well known in the art and a particularly preferred radionuclide for direct labeling is 131I covalently attached via tyrosine residues. Binding molecules, e.g., binding polypeptides, e.g., IGF-lR-specific antibodies or immunospecific fragments thereof for use in the diagnostic and treatment methods disclosed herein may be derived, for example, with radioactive sodium or potassium iodide and a chemical oxidizing agent, such as sodium hypochlorite, chloramine T or the like, or an enzymatic oxidizing agent, such as lactoperoxidase, glucose oxidase and glucose.
[0409] Patents relating to chelators and chelator conjugates are known in the art. For instance, U.S. Patent No. 4,831,175 of Gansow is directed to polysubstituted diethylenetriaminepentaacetic acid chelates and protein conjugates containing the same, and methods for their preparation. U.S. Patent Nos. 5,099,069, 5,246,692, 5,286,850, 5,434,287 and 5,124,471 of Gansow also relate to polysubstituted DTPA chelates. These patents are incorporated herein by reference in their entireties. Other examples of compatible metal chelators are ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid (DPTA), 1,4,8,11-tetraazatetradecane, 1,4,8,11- tetraazatetradecane- 1 ,4,8, 11 -tetraacetic acid, 1 -oxa-4,7, 12, 15-tetraazaheptadecane-
4,7,12,15 -tetraacetic acid, or the like Cyclohexyl-DTPA or CHX-DTPA is particularly preferred and is exemplified extensively below. Still other compatible chelators, including those yet to be discovered, may easily be discerned by a skilled artisan and are clearly within the scope of the present invention.
[0410] Compatible chelators, including the specific bifunctional chelator used to facilitate chelation U.S. Patent Nos. 6,682,134, 6,399,061, and 5,843,439, incorporated herein by reference in their entireties, are preferably selected to provide high affinity for trivalent metals, exhibit increased tumor-to-non-tumor ratios and decreased bone uptake as well as greater in vivo retention of radionuclide at target sites, i.e., B-cell lymphoma tumor sites. However, other bifunctional chelators that may or may not possess all of these characteristics are known in the art and may also be beneficial in rumor therapy.
[0411] It will also be appreciated that, in accordance with the teachings herein, binding molecules may be conjugated to different radiolabels for diagnostic and therapeutic purposes. To this end the aforementioned U.S. Patent Nos. 6,682,134, 6,399,061, and 5,843,439 disclose radiolabeled therapeutic conjugates for diagnostic "imaging" of tumors before administration of therapeutic antibody. "In2B8" conjugate comprises a murine monoclonal antibody, 2B8, specific to human CD20 antigen, that is attached to 111In via a bifunctional chelator, i.e., MX-DTPA (diethylenetriaminepentaacetic acid), which comprises a 1:1 mixture of l-isothiocyanatobenzyl-3-methyl-DTPA and 1-methyl- 3-isothiocyanatobenzyl-DTPA. 111In is particularly preferred as a diagnostic radionuclide because between about 1 to about 10 mCi can be safely administered without detectable toxicity; and the imaging data is generally predictive of subsequent 90Y-labeled antibody distribution. Most imaging studies utilize 5 mCi π 'in-labeled antibody, because this dose is both safe and has increased imaging efficiency compared with lower doses, with optimal imaging occurring at three to six days after antibody administration. See, for example, Murray, J. Nuc. Med. 26: 3328 (1985) and Carraguillo et al, J. Nuc. Med. 26: 67 (1985).
[0412] As indicated above, a variety of radionuclides are applicable to the present invention and those skilled in the can readily determine which radionuclide is most appropriate under various circumstances. For example, 131I is a well known radionuclide used for targeted immunotherapy. However, the clinical usefulness of 131I can be limited by several factors including: eight-day physical half-life; dehalogenation of iodinated antibody both in the blood and at tumor sites; and emission characteristics (e.g., large gamma component) which can be suboptimal for localized dose deposition in tumor.
With the advent of superior chelating agents, the opportunity for attaching metal chelating groups to proteins has increased the opportunities to utilize other radionuclides such as 111In and 90Y. 90Y provides several benefits for utilization in radioimmunotherapeutic applications: the 64 hour half-life of 90Y is long enough to allow antibody accumulation by tumor and, unlike e.g., 131I, 90Y is a pure beta emitter of high energy with no accompanying gamma irradiation in its decay, with a range in tissue of 100 to 1,000 cell diameters. Furthermore, the minimal amount of penetrating radiation allows for outpatient administration of ^'V-labeled antibodies. Additionally, internalization of labeled antibody is not required for cell killing, and the local emission of ionizing radiation should be lethal for adjacent tumor cells lacking the target molecule.
[0413] Additional preferred agents for conjugation to binding molecules, e.g., binding polypeptides, e.g., IGF-lR-specific antibodies or immunospecific fragments thereof are cytotoxic drugs, particularly those which are used for cancer therapy. As used herein, "a cytotoxin or cytotoxic agent" means any agent that is detrimental to the growth and proliferation of cells and may act to reduce, inhibit or destroy a cell or malignancy. Exemplary cytotoxins include, but are not limited to, radionuclides, biotoxins, enzymatically active toxins, cytostatic or cytotoxic therapeutic agents, prodrugs, immunologically active ligands and biological response modifiers such as cytokines. Any cytotoxin that acts to retard or slow the growth of immunoreactive cells or malignant cells is within the scope of the present invention.
[0414] Exemplary cytotoxins include, in general, cytostatic agents, alkylating agents, anti-metabolites, antiproliferative agents, tubulin binding agents, hormones and hormone antagonists, and the like. Exemplary cytostatics that are compatible with the present invention include alkylating substances, such as mechlorethamine, triethylenephosphoramide, cyclophosphamide, ifosfamide, chlorambucil, busulfan, melphalan or triaziquone, also nitrosourea compounds, such as carmustine, lomustine, or semustine. Other preferred classes of cytotoxic agents include, for example, the maytansinoid family of drugs. Other preferred classes of cytotoxic agents include, for example, the anthracycline family of drugs, the vinca drugs, the mitomycins, the bleomycins, the cytotoxic nucleosides, the pteridine family of drugs, diynenes, and the podophyllotoxins. Particularly useful members of those classes include, for example, adriamycin, carminomycin, daunorubicin (daunomycin), doxorubicin, aminopterin, methotrexate, methopterin, mithramycin, streptonigrin, dichloromethotrexate, mitomycin C, actinomycin-D, porfiromycin, 5-fluorouracil, floxuridine, ftorafur, 6-mercaptopurine, cytarabine, cytosine arabinoside, podonhyllotoxin, or podophyllotoxin derivatives such as etoposide or etoposide phosphate, melphalan, vinblastine, vincristine, leurosidine, vindesine, leurosine and the like. Still other cytotoxins that are compatible with the teachings herein include taxol, taxane, cytochalasin B, gramicidin D, ethidium bromide, emetine, tenoposide, colchicin, dihydroxy anthracin dione, mitoxantrone, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof. Hormones and hormone antagonists, such as corticosteroids, e.g. prednisone, progestins, e.g. hydroxyprogesterone or medroprogesterone, estrogens, e.g. diethylstilbestrol, antiestrogens, e.g. tamoxifen, androgens, e.g. testosterone, and aromatase inhibitors, e.g. aminogluthetimide are also compatible with the teachings herein. One skilled in the art may make chemical modifications to the desired compound in order to make reactions of that compound more convenient for purposes of preparing conjugates of the invention.
[0415] One example of particularly preferred cytotoxins comprise members or derivatives of the enediyne family of anti-tumor antibiotics, including calicheamicin, esperamicins or dynemicins. These toxins are extremely potent and act by cleaving nuclear DNA, leading to cell death. Unlike protein toxins which can be cleaved in vivo to give many inactive but immunogenic polypeptide fragments, toxins such as calicheamicin, esperamicins and other enediynes are small molecules which are essentially non-immunogenic. These non-peptide toxins are chemically-linked to the dimers or tetramers by techniques which have been previously used to label monoclonal antibodies and other molecules. These linking technologies include site-specific linkage via the N-linked sugar residues present only on the Fc portion of the constructs. Such site- directed linking methods have the advantage of reducing the possible effects of linkage on the binding properties of the constructs.
[0416] As previously alluded to, compatible cytotoxins for preparation of conjugates may comprise a prodrug. As used herein, the term "prodrug" refers to a precursor or derivative form of a pharmaceutically active substance that is less cytotoxic to tumor cells compared to the parent drug and is capable of being enzymatically activated or converted into the more active parent form. Prodrugs compatible with the invention include, but are not limited to, phosphate-containing prodrugs, thiophosphate-containing prodrugs, sulfate containing prodrugs, peptide containing prodrugs, β-lactam-containing prodrugs, optionally substituted phenoxyacetamide-containing prodrugs or optionally substituted phenylacetamide-containing prodrugs, 5-fluorocytosine and other 5-fluorouridine prodrugs that can be converted to the more active cytotoxic free drug. Further examples of cytotoxic drugs that can be derivatized into a prodrug form for use in the present invention comprise those chemotherapeutic agents described above.
[0417] Among other cytotoxins, it will be appreciated that binding molecules, e.g., binding polypeptides, e.g., IGF-lR-specific antibodies or immunospecific fragments thereof disclosed herein can also be associated with or conjugated to a biotoxin such as ricin subunit A, abrin, diptheria toxin, botulinum, cyanginosins, saxitoxin, shigatoxin, tetanus, tetrodotoxin, trichothecene, verrucologen or a toxic enzyme. Preferably, such constructs will be made using genetic engineering techniques that allow for direct expression of the antibody-toxin construct. Other biological response modifiers that may be associated with the binding molecules, e.g., binding polypeptides, e.g., IGF-IR- specific antibodies or immunospecific fragments thereof disclosed herein comprise cytokines such as Iymphokines and interferons. In view of the instant disclosure it is submitted that one skilled in the art could readily form such constructs using conventional techniques.
[0418] Another class of compatible cytotoxins that may be used in association with or conjugated to the disclosed binding molecules, e.g., binding polypeptides, e.g., IGF-IR- specific antibodies or immunospecific fragments thereof, are radiosensitizing drugs that may be effectively directed to tumor or immunoreactive cells. Such drugs enhance the sensitivity to ionizing radiation, thereby increasing the efficacy of radiotherapy. An antibody conjugate internalized by the tumor cell would deliver the radiosensitizer nearer the nucleus where radiosensitization would be maximal. The unbound radiosensitizer linked binding molecules of the invention would be cleared quickly from the blood, localizing the remaining radiosensitization agent in the target tumor and providing minimal uptake in normal tissues. After rapid clearance from the blood, adjunct radiotherapy would be administered in one of three ways: 1.) external beam radiation directed specifically to the tumor, 2.) radioactivity directly implanted in the tumor or 3.) systemic radioimmunotherapy with the same targeting antibody. A potentially attractive variation of this approach would be the attachment of a therapeutic radioisotope to the radiosensitized immunoconjugate, thereby providing the convenience of administering to the patient a single drug.
[0419] In certain embodiments, a moiety that enhances the stability or efficacy of a binding molecule, e.g., a binding polypeptide, e.g., a IGF- lR-speci fie antibody or immunospecific fragment thereof can be conjugated. For example, in one embodiment,
PEG can be conjugated to the binding molecules of the invention to increase their half- life in vivo. Leong, S.R., et al, Cytokine i<5:106 (2001); Adv. in Drug Deliv. Rev. 54:531 (2002); or Weir et al., Biochem. Soc. Transactions 30:512 (2002).
[0420] The present invention further encompasses the use of binding molecules, e.g., binding polypeptides, e.g., IGF-lR-specific antibodies or immunospecific fragments conjugated to a diagnostic or therapeutic agent. The binding molecules can be used diagnostically to, for example, monitor the development or progression of a tumor as part of a clinical testing procedure to, e.g., determine the efficacy of a given treatment and/or prevention regimen. Detection can be facilitated by coupling the binding molecule, e.g., binding polypeptide, e.g., IGF-lR-specific antibody or immunospecific fragment thereof to a detectable substance. Examples of detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, radioactive materials, positron emitting metals using various positron emission tomographies, and nonradioactive paramagnetic metal ions. See, for example, U.S. Pat. No. 4,741,900 for metal ions which can be conjugated to antibodies for use as diagnostics according to the present invention. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, β-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin; and examples of suitable radioactive material include 125I, 131I, 111In or 99Tc.
[0421] A binding molecule, e.g., a binding polypeptide, e.g., a IGF-lR-specific antibody or immunospecific fragment thereof also can be detectably labeled by coupling it to a chemiluminescent compound. The presence of the chemiluminescent-tagged binding molecule is then determined by detecting the presence of luminescence that arises during the course of a chemical reaction. Examples of particularly useful chemiluminescent labeling compounds are luminol, isoluminol, theromatic acridinium ester, imidazole, acridinium salt and oxalate ester.
[0422] One of the ways in which a binding molecule, e.g., a binding polypeptide, e.g., a
IGF-lR-specific antibody or immunospecific fragment thereof can be detectably labeled is by linking the same to an enzyme and using the linked product in an enzyme immunoassay (EIA) (Voller, A., "The Enzyme Linked Immunosorbent Assay (ELISA)"
Microbiological Associates Quarterly Publication, Walkersville, Md., Diagnostic Horizons 2:1-7 (1978)); Voller et al, J. Clin. Pathol. 37:507-520 (1978); Butler, J. E., Meth. Enrymol. 75:482-523 (1981); Maggio, E. (ed.), Enzyme Immunoassay, CRC Press, Boca Raton, FIa., (1980); Ishikawa, E. et al., (eds.), Enzyme Immunoassay, Kgaku Shoin, Tokyo (1981). The enzyme, which is bound to the binding molecule will react with an appropriate substrate, preferably a chromogenic substrate, in such a manner as to produce a chemical moiety which can be detected, for example, by spectrophotometric, fluorimetric or by visual means. Enzymes which can be used to detectably label the antibody include, but are not limited to, malate dehydrogenase, staphylococcal nuclease, delta-5-steroid isomerase, yeast alcohol dehydrogenase, alpha-glycerophosphate, dehydrogenase, triose phosphate isomerase, horseradish peroxidase, alkaline phosphatase, asparaginase, glucose oxidase, beta-galactosidase, ribonuclease, urease, catalase, glucose- 6-phosphate dehydrogenase, glucoamylase and acetylcholinesterase. Additionally, the detection can be accomplished by colorimetric methods which employ a chromogenic substrate for the enzyme. Detection may also be accomplished by visual comparison of the extent of enzymatic reaction of a substrate in comparison with similarly prepared standards.
[0423] Detection may also be accomplished using any of a variety of other immunoassays. For example, by radioactively labeling the binding molecule, e.g., binding polypeptide, e.g., IGF-lR-specific antibody or immunospecific fragment thereof, it is possible to detect cancer antigens through the use of a radioimmunoassay (RIA) (see, for example, Weintraub, B., Principles of Radioimmunoassays, Seventh Training Course on Radioligand Assay Techniques, The Endocrine Society, (March, 1986)), which is incorporated by reference herein). The radioactive isotope can be detected by means including, but not limited to, a gamma counter, a scintillation counter, or autoradiography.
[0424] A binding molecule, e.g., a binding polypeptide, e.g., a IGF-lR-specific antibody or immunospecific fragment thereof can also be detectably labeled using fluorescence emitting metals such as 152Eu, or others of the lanthanide series. These metals can be attached to the antibody using such metal chelating groups as diethylenetriaminepentacetic acid (DTPA) or ethylenediaminetetraacetic acid (EDTA).
[0425] Techniques for conjugating various moieties to a binding molecule, e.g., a binding polypeptide, e.g., a IGF-lR-specific antibody or immunospecific fragment thereof are well known, see, e.g., Arnon et al., "Monoclonal Antibodies For Immunotargeting Of
Drugs In Cancer Therapy", in Monoclonal Antibodies And Cancer Therapy, Reisfeld et al. (eds.), PP- 243-56 (Alan R. Liss, Inc. (1985); Hellstrom et al., "Antibodies For Drug Delivery", in Controlled Drug Delivery (2nd Ed.), Robinson et al. (eds.), Marcel Dekker, Inc., pp. 623-53 (1987); Thorpe, "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", in Monoclonal Antibodies '84: Biological And Clinical Applications, Pinchera et al. (eds.), pp. 475-506 (1985); "Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy", in Monoclonal Antibodies For Cancer Detection And Therapy, Baldwin et al. (eds.), Academic Press pp. 303-16 (1985), and Thorpe et al., "The Preparation And Cytotoxic Properties Of Antibody-Toxin Conjugates", Immunol. Rev. 62:119-58 (1982).
Vπ. EXPRESSION OF ANTIBODY POLYPEPTIDES
[0426] As is well known, RNA may be isolated from the original hybridoma cells or from other transformed cells by standard techniques, such as guanidinium isothiocyanate extraction and precipitation followed by centrifugation or chromatography. Where desirable, mRNA may be isolated from total RNA by standard techniques such as chromatography on oligo dT cellulose. Suitable techniques are familiar in the art.
[0427] In one embodiment, cDNAs that encode the light and the heavy chains of the antibody may be made, either simultaneously or separately, using reverse transcriptase and DNA polymerase in accordance with well known methods. PCR may be initiated by consensus constant region primers or by more specific primers based on the published heavy and light chain DNA and amino acid sequences. As discussed above, PCR also may be used to isolate DNA clones encoding the antibody light and heavy chains. In this case the libraries may be screened by consensus primers or larger homologous probes, such as mouse constant region probes.
[0428] DNA, typically plasmid DNA, may be isolated from the cells using techniques known in the art, restriction mapped and sequenced in accordance with standard, well known techniques set forth in detail, e.g., in the foregoing references relating to recombinant DNA techniques. Of course, the DNA may be synthetic according to the present invention at any point during the isolation process or subsequent analysis.
[0429] Following manipulation of the isolated genetic material to provide IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention, the polynucleotides encoding the IGF-IR antibodies are typically inserted in an expression vector for introduction into host cells that may be used to produce the desired quantity of IGF-IR antibody. [0430] Recombinant expression of an antibody, or fragment, derivative or analog thereof, e.g., a heavy or light chain of an antibody which binds to a target molecule described herein, e.g., IGF-IR, requires construction of an expression vector containing a polynucleotide that encodes the antibody. Once a polynucleotide encoding an antibody molecule or a heavy or light chain of an antibody, or portion thereof (preferably containing the heavy or light chain variable domain), of the invention has been obtained, the vector for the production of the antibody molecule may be produced by recombinant DNA technology using techniques well known in the art. Thus, methods for preparing a protein by expressing a polynucleotide containing an antibody encoding nucleotide sequence are described herein. Methods which are well known to those skilled in the art can be used to construct expression vectors containing antibody coding sequences and appropriate transcriptional and translational control signals. These methods include, for example, in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination. The invention, thus, provides replicable vectors comprising a nucleotide sequence encoding an antibody molecule of the invention, or a heavy or light chain thereof, or a heavy or light chain variable domain, operably linked to a promoter. Such vectors may include the nucleotide sequence encoding the constant region of the antibody molecule (see, e.g., PCT Publication WO 86/05807; PCT Publication WO 89/01036; and U.S. Pat. No. 5,122,464) and the variable domain of the antibody may be cloned into such a vector for expression of the entire heavy or light chain.
[0431] The host cell may be co-transfected with two expression vectors of the invention, the first vector encoding a heavy chain derived polypeptide and the second vector encoding a light chain derived polypeptide. The two vectors may contain identical selectable markers which enable equal expression of heavy and light chain polypeptides. Alternatively, a single vector may be used which encodes both heavy and light chain polypeptides. In such situations, the light chain is advantageously placed before the heavy chain to avoid an excess of toxic free heavy chain (Proudfoot, Nature 322:52 (1986); Kohler, Proc. Natl. Acad. ScL USA 77:2197 (1980)). The coding sequences for the heavy and light chains may comprise cDNA or genomic DNA.
[0432] The term "vector" or "expression vector" is used herein to mean vectors used in accordance with the present invention as a vehicle for introducing into and expressing a desired gene in a host cell. As known to those skilled in the art, such vectors may easily be selected from the group consisting of plasmids, phages, viruses and retroviruses. In general, vectors compatible with the instant invention will comprise a selection marker, appropriate restriction sites to facilitate cloning of the desired gene and the ability to enter and/or replicate in eukaryotic or prokaryotic cells.
[0433] For the purposes of this invention, numerous expression vector systems may be employed. For example, one class of vector utilizes DNA elements which are derived from animal viruses such as bovine papilloma virus, polyoma virus, adenovirus, vaccinia virus, baculovirus, retroviruses (RSV, MMTV or MOMLV) or SV40 virus. Others involve the use of polycistronic systems with internal ribosome binding sites. Additionally, cells which have integrated the DNA into their chromosomes may be selected by introducing one or more markers which allow selection of transfected host cells. The marker may provide for prototrophy to an auxotrophic host, biocide resistance (e.g., antibiotics) or resistance to heavy metals such as copper. The selectable marker gene can either be directly linked to the DNA sequences to be expressed, or introduced into the same cell by cotransformation. Additional elements may also be needed for optimal synthesis of mRNA. These elements may include signal sequences, splice signals, as well as transcriptional promoters, enhancers, and termination signals.
[0434] In particularly preferred embodiments the cloned variable region genes are inserted into an expression vector along with the heavy and light chain constant region genes (preferably human) synthetic as discussed above. In one embodiment, this is effected using a proprietary expression vector of Biogen IDEC, Inc., referred to as NEOSPLA (disclosed in U.S. patent 6,159,730). This vector contains the cytomegalovirus promoter/enhancer, the mouse beta globin major promoter, the SV40 origin of replication, the bovine growth hormone polyadenylation sequence, neomycin phosphotransferase exon 1 and exon 2, the dihydrofolate reductase gene and leader sequence. This vector has been found to result in very high level expression of antibodies upon incorporation of variable and constant region genes, transfection in CHO cells, followed by selection in G418 containing medium and methotrexate amplification. Of course, any expression vector which is capable of eliciting expression in eukaryotic cells may be used in the present invention. Examples of suitable vectors include, but are not limited to plasmids pcDNA3, pHCMV/Zeo, pCR3.1, pEFl/His, pIND/GS, pRc/HCMV2, pSV40/Zeo2, pTRACER-HCMV, pUB6/V5-His, pVAXl, and pZeoSV2 (available from Invitrogen, San Diego, CA), and plasmid pCI (available from Promega, Madison, WI). In general, screening large numbers of transformed cells for those which express suitably high levels if immunoglobulin heavy and light chains is routine experimentation which can be carried out, for example, by robotic systems. Vector systems are also taught in U.S. Pat. Nos. 5,736,137 and 5,658,570, each of which is incorporated by reference in its entirety herein. This system provides for high expression levels, e.g., > 30 pg/cell/day. Other exemplary vector systems are disclosed e.g., in U.S. Patent 6,413,777.
[0435] In other preferred embodiments the IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention may be expressed using polycistronic constructs such as those disclosed in United States Patent Application Publication No. 2003-0157641 Al, filed November 18, 2002 and incorporated herein in its entirety. In these novel expression systems, multiple gene products of interest such as heavy and light chains of antibodies may be produced from a single polycistronic construct. These systems advantageously use an internal ribosome entry site (IRES) to provide relatively high levels of IGF-IR antibodies, e.g., binding polypeptides, e.g., IGF- lR-specific antibodies or immunospecific fragments thereof in eukaryotic host cells. Compatible IRES sequences are disclosed in U.S. Pat. No. 6,193,980 which is also incorporated herein. Those skilled in the art will appreciate that such expression systems may be used to effectively produce the full range of IGF-IR antibodies disclosed in the instant application.
[0436] More generally, once the vector or DNA sequence encoding a monomelic subunit of the IGF-IR antibody has been prepared, the expression vector may be introduced into an appropriate host cell. Introduction of the plasmid into the host cell can be accomplished by various techniques well known to those of skill in the art. These include, but are not limited to, transfection (including electrophoresis and electroporation), protoplast fusion, calcium phosphate precipitation, cell fusion with enveloped DNA, microinjection, and infection with intact virus. See, Ridgway, A. A. G. "Mammalian Expression Vectors" Vectors, Rodriguez and Denhardt, Eds., Butterworths, Boston, Mass., Chapter 24.2, pp. 470-472 (1988). Typically, plasmid introduction into the host is via electroporation. The host cells harboring the expression construct are grown under conditions appropriate to the production of the light chains and heavy chains, and assayed for heavy and/or light chain protein synthesis. Exemplary assay techniques include enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), or fluorescence-activated cell sorter analysis (FACS), immunohistochemistry and the like.
[0437] The expression vector is transferred to a host cell by conventional techniques and the transfected cells are then cultured by conventional techniques to produce an antibody for use in the methods described herein. Thus, the invention includes host cells containing a polynucleotide encoding an antibody of the invention, or a heavy or light chain thereof, operably linked to a heterologous promoter. In preferred embodiments for the expression of double-chained antibodies, vectors encoding both the heavy and light chains may be co-expressed in the host cell for expression of the entire immunoglobulin molecule, as detailed below.
[0438] As used herein, "host cells" refers to cells which harbor vectors constructed using recombinant DNA techniques and encoding at least one heterologous gene. In descriptions of processes for isolation of antibodies from recombinant hosts, the terms "cell" and "cell culture" are used interchangeably to denote the source of antibody unless it is clearly specified otherwise. In other words, recovery of polypeptide from the "cells" may mean either from spun down whole cells, or from the cell culture containing both the medium and the suspended cells.
[0439] A variety of host-expression vector systems may be utilized to express antibody molecules for use in the methods described herein. Such host-expression systems represent vehicles by which the coding sequences of interest may be produced and subsequently purified, but also represent cells which may, when transformed or transfected with the appropriate nucleotide coding sequences, express an antibody molecule of the invention in situ. These include but are not limited to microorganisms such as bacteria {e.g., E. coli, B. subtilis) transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing antibody coding sequences; yeast (e.g., Saccharomyces, Pichiά) transformed with recombinant yeast expression vectors containing antibody coding sequences; insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus) containing antibody coding sequences; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing antibody coding sequences; or mammalian cell systems (e.g., COS, CHO, BLK, 293, 3T3 cells) harboring recombinant expression constructs containing promoters derived from the genome of mammalian cells (e.g., metallothionein promoter) or from mammalian viruses (e.g., the adenovirus late promoter; the vaccinia virus 7.5K promoter). Preferably, bacterial cells such as Escherichia coli, and more preferably, eukaryotic cells, especially for the expression of whole recombinant antibody molecule, are used for the expression of a recombinant antibody molecule. For example, mammalian cells such as Chinese hamster ovary cells (CHO), in conjunction with a vector such as the major intermediate early gene promoter element from human cytomegalovirus is an effective expression system for antibodies (Foecking et al., Gene 4.5:101 (1986); Cockett et ah, Bio/Technology 8:2 (1990)).
[04401 The host cell line used for protein expression is often of mammalian origin; those skilled in the art are credited with ability to preferentially determine particular host cell lines which are best suited for the desired gene product to be expressed therein. Exemplary host cell lines include, but are not limited to, CHO (Chinese Hamster Ovary), DG44 and DUXBI l (Chinese Hamster Ovary lines, DHFR minus), HELA (human cervical carcinoma), CVI (monkey kidney line), COS (a derivative of CVI with SV40 T antigen), VERY, BHK (baby hamster kidney), MDCK, 293, WD8, R1610 (Chinese hamster fibroblast) BALBC/3T3 (mouse fibroblast), HAK (hamster kidney line), SP2/O (mouse myeloma), P3x63-Ag3.653 (mouse myeloma), BFA- IcI BPT (bovine endothelial cells), RAJI (human lymphocyte) and 293 (human kidney). CHO cells are particularly preferred. Host cell lines are typically available from commercial services, the American Tissue Culture Collection or from published literature.
[0441] In addition, a host cell strain may be chosen which modulates the expression of the inserted sequences, or modifies and processes the gene product in the specific fashion desired. Such modifications (e.g., glycosylation) and processing (e.g., cleavage) of protein products may be important for the function of the protein. Different host cells have characteristic and specific mechanisms for the post-translational processing and modification of proteins and gene products. Appropriate cell lines or host systems can be chosen to ensure the correct modification and processing of the foreign protein expressed. To this end, eukaryotic host cells which possess the cellular machinery for proper processing of the primary transcript, glycosylation, and phosphorylation of the gene product may be used.
[0442] For long-term, high-yield production of recombinant proteins, stable expression is preferred. For example, cell lines which stably express the antibody molecule may be engineered. Rather than using expression vectors which contain viral origins of replication, host cells can be transformed with DNA controlled by appropriate expression control elements (e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.), and a selectable marker. Following the introduction of the foreign DNA, engineered cells may be allowed to grow for 1-2 days in an enriched media, and then are switched to a selective media. The selectable marker in the recombinant plasmid confers resistance to the selection and allows cells to stably integrate the plasmid into their chromosomes and grow to form foci which in turn can be cloned and expanded into cell lines. This method may advantageously be used to engineer cell lines which stably express the antibody molecule.
[04431 A number of selection systems may be used, including but not limited to the herpes simplex virus thymidine kinase (Wigler et al., Cell 11:223 (1977)), hypoxanthine- guanine phosphoribosyltransferase (Szybalska & Szybalski, Proc. Natl. Acad. ScL USA 48:202 (1992)), and adenine phosphoribosyltransferase (Lowy et al., Cell 22:817 1980) genes can be employed in tk-, hgprt- or aprt-cells, respectively. Also, anti-metabolite resistance can be used as the basis of selection for the following genes: dhfr, which confers resistance to methotrexate (Wigler et al., Natl. Acad. ScL USA 77:357 (1980); OΗare et al, Proc. Natl. Acad. ScL USA 78:1527 (1981)); gpt, which confers resistance to mycophenolic acid (Mulligan & Berg, Proc. Natl. Acad. ScL USA 78:2072 (1981)); neo, which confers resistance to the aminoglycoside G-418 Clinical Pharmacy /2:488- 505; Wu and Wu, Biotherapy 5:87-95 (1991); Tolstoshev, Ann. Rev. Pharmacol. Toxicol. 32:573-596 (1993); Mulligan, Science 260:926-932 (1993); and Morgan and Anderson, Ann. Rev. Biochem. 62:191-217 (1993);, TIB TECH 11(5):155-215 (May, 1993); and hygro, which confers resistance to hygromycin (Santerre et al., Gene 30:147 (1984). Methods commonly known in the art of recombinant DNA technology which can be used are described in Ausubel et al. (eds.), Current Protocols in Molecular Biology, John Wiley & Sons, NY (1993); Kriegler, Gene Transfer and Expression, A Laboratory Manual, Stockton Press, NY (1990); and in Chapters 12 and 13, Dracopoli et al. (eds), Current Protocols in Human Genetics, John Wiley & Sons, NY (1994); Colberre-Garapin et al., J. MoI. Biol. 150:1 (1981), which are incorporated by reference herein in their entireties.
[0444] The expression levels of an antibody molecule can be increased by vector amplification (for a review, see Bebbington and Hentschel, The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning, Academic Press, New York, Vol. 3. (1987)). When a marker in the vector system expressing antibody is amplifiable, increase in the level of inhibitor present in culture of host cell will increase the number of copies of the marker gene. Since the amplified region is associated with the antibody gene, production of the antibody will also increase (Crouse et al., MoI. Cell. Biol. 3:257 (1983)).
[0445] In vitro production allows scale-up to give large amounts of the desired polypeptides. Techniques for mammalian cell cultivation under tissue culture conditions are known in the art and include homogeneous suspension culture, e.g. in an airlift reactor or in a continuous stirrer reactor, or immobilized or entrapped cell culture, e.g. in hollow fibers, microcapsules, on agarose microbeads or ceramic cartridges. If necessary and/or desired, the solutions of polypeptides can be purified by the customary chromatography methods, for example gel filtration, ion-exchange chromatography, chromatography over DEAE-cellulose or (immuno-)affinity chromatography, e.g., after preferential biosynthesis of a synthetic hinge region polypeptide or prior to or subsequent to the HIC chromatography step described herein.
[0446] Genes encoding IGF-IR antibodies, or antigen-binding fragments, variants, or derivatives thereof of the invention can also be expressed non-mammalian cells such as bacteria or insect or yeast or plant cells. Bacteria which readily take up nucleic acids include members of the enterobacteriaceae, such as strains of Escherichia coli or Salmonella; Bacillaceae, such as Bacillus subtilis; Pneumococcus; Streptococcus, and Haemophilus influenzae. It will further be appreciated that, when expressed in bacteria, the heterologous polypeptides typically become part of inclusion bodies. The heterologous polypeptides must be isolated, purified and then assembled into functional molecules. Where terravalent forms of antibodies are desired, the subunits will then self- assemble into terravalent antibodies (WO02/096948A2).
[0447] In bacterial systems, a number of expression vectors may be advantageously selected depending upon the use intended for the antibody molecule being expressed. For example, when a large quantity of such a protein is to be produced, for the generation of pharmaceutical compositions of an antibody molecule, vectors which direct the expression of high levels of fusion protein products that are readily purified may be desirable. Such vectors include, but are not limited, to the E. coli expression vector pUR278 (Ruther et all, EMBO J. 2:1791 (1983)), in which the antibody coding sequence may be ligated individually into the vector in frame with the lacZ coding region so that a fusion protein is produced; pIN vectors (Inouye & Inouye, Nucleic Acids Res. 73:3101- 3109 (1985); Van Heeke & Schuster, J. Biol. Chem. 24:5503-5509 (1989)); and the like. pGEX vectors may also be used to express foreign polypeptides as fusion proteins with glutathione S-transferase (GST). In general, such fusion proteins are soluble and can easily be purified from lysed cells by adsorption and binding to a matrix glutathione- agarose beads followed by elution in the presence of free glutathione. The pGEX vectors are designed to include thrombin or factor Xa protease cleavage sites so that the cloned target gene product can be released from the GST moiety. [0448] In addition to prokaryotes, eukaryotic microbes may also be used. Saccharomyces cerevisiae, or common baker's yeast, is the most commonly used among eukaryotic microorganisms although a number of other strains are commonly available, e.g., Pichia pastoris.
[0449] For expression in Saccharomyces, the plasmid YRp7, for example, (Stinchcomb et al., Nature 282:39 (1979); Kingsman et al., Gene 7:141 (1979); Tschemper et ah, Gene 70:157 (1980)) is commonly used. This plasmid already contains the TRPl gene which provides a selection marker for a mutant strain of yeast lacking the ability to grow in tryptophan, for example ATCC No. 44076 or PEP4-1 (Jones, Genetics 85:12 (1977)). The presence of the trpl lesion as a characteristic of the yeast host cell genome then provides an effective environment for detecting transformation by growth in the absence of tryptophan.
[0450] In an insect system, Autographa californica nuclear polyhedrosis virus (AcNPV) is typically used as a vector to express foreign genes. The virus grows in Spodoptera frugiperda cells. The antibody coding sequence may be cloned individually into nonessential regions (for example the polyhedrin gene) of the virus and placed under control of an AcNPV promoter (for example the polyhedrin promoter).
[0451] Once an antibody molecule of the invention has been recombinantly expressed, it may be purified by any method known in the art for purification of an immunoglobulin molecule, for example, by chromatography (e.g., ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins. Alternatively, a preferred method for increasing the affinity of antibodies of the invention is disclosed in US 2002 0123057 Al.
Vm. TREATMENT METHODS USING THERAPEUTIC IGF- 1 R-SPECIFIC ANTIBODIES, OR IMMUNOSPECIFIC FRAGMENTS THEREOF
[0452] One embodiment of the present invention provides methods for treating a hyperproliferative disease or disorder, e.g., cancer, a malignancy, a tumor, or a metastasis thereof, in an animal suffering from such disease or predisposed to contract such disease, the method comprising, consisting essentially of, or consisting of administering to the animal an effective amount of an antibody or immunospecific fragment thereof, that binds to IGF-IR or a variant of IGF-IR. Suitable antibodies include all antibodies and antigen- specific fragments thereof described herein. Examples include, but are not limited to, an isolated antibody or antigen-binding fragment thereof which specifically binds to the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8, an isolated antibody or antigen-binding fragment thereof which specifically binds to IGF-Rl, where the antibody or fragment thereof competitively inhibits a reference monoclonal Fab antibody fragment selected from the group consisting of Ml 3- C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8 from binding to IGF-Rl, or an isolated antibody or antigen-binding fragment thereof which specifically binds to IGF-Rl, where the antibody or fragment thereof comprises an antigen binding domain identical to that of a monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8. In certain embodiments an antibody of the present invention which specifically binds to IGF-IR or a variant thereof inhibits one or more insulin growth factors, e.g., IGF-I, IGF-2 or both IGF-I and IGF-I from binding to IGF-IR. In other embodiments, an antibody of the present invention which specifically binds to IGF-IR or a variant thereof inhibits phosphorylation of IGF-IR upon binding of one or more insulin growth factors. In a further embodiment, an antibody of the present invention which specifically binds to IGF-IR or a variant thereof expressed on a cell, in particular, a tumor cell, inhibits phosphorylation of downstream signal transduction molecules involved in cell proliferation, motility and/or metastasis. Such molecules include, but are not limited to Akt and p42/44 MAPK. In a further embodiment, an antibody of the present invention which specifically binds to IGF-IR or a variant thereof expressed on a cell promotes internalization of surface-expressed IGF-IR, limiting its availability to interact with IGF. In yet a further embodiment, an antibody of the present invention which specifically binds to IGF-IR or a variant thereof expressed on a cell, in particular, a tumor cell, inhibits cell proliferation, motility, and/or metastasis. [0454] An antibody of the present invention which specifically binds to IGF-IR or a variant thereof, to be used in treatment methods disclosed herein can be prepared and used as a therapeutic agent that stops, reduces, prevents, or inhibits cellular activities involved in cellular hyperproliferation, e.g., cellular activities that induce the altered or abnormal pattern of vascularization that is often associated with hyperproliferative diseases or disorders.
[0455] Antibodies or immunospecifϊc fragments thereof of the present invention include, but are not limited to monoclonal, chimeric or humanized antibodies, and fragments of antibodies that bind specifically to tumor-associated proteins such as IGF-IR. The antibodies may be monovalent, bivalent, polyvalent, or bifunctional antibodies, and the antibody fragments include Fab F(ab')2, and Fv.
[0456] Therapeutic antibodies according to the invention can be used in unlabeled or unconjugated form, or can be coupled or linked to cytotoxic moieties such as radiolabels and biochemical cytotoxins to produce agents that exert therapeutic effects.
[0457] In certain embodiments, an antibody, or immunospecific fragment thereof of the invention includes an antigen binding domain. An antigen binding domain is formed by antibody variable regions that vary from one antibody to another. Naturally occurring antibodies comprise at least two antigen binding domains, i.e., they are at least bivalent. As used herein, the term "antigen binding domain" includes a site that specifically binds an epitope on an antigen (e.g., a cell surface or soluble antigen). The antigen binding domain of an antibody typically includes at least a portion of an immunoglobulin heavy chain variable region and at least a portion of an immunoglobulin light chain variable region. The binding site formed by these variable regions determines the specificity of the antibody.
[0458] The present invention provides methods for treating various hyperproliferative disorders, e.g., by inhibiting tumor growth, in a mammal, comprising, consisting essentially of, or consisting of administering to the mammal an effective amount of a antibody or antigen-binding fragment thereof which specifically or preferentially binds to IGF-Rl, e.g., human IGF-Rl.
[0459] The present invention is more specifically directed to a method of treating a hyperproliferative disease, e.g., inhibiting or preventing tumor formation, tumor growth, tumor invasiveness, and/or metastasis formation, in an animal, e.g., a mammal, e.g., a human, comprising, consisting essentially of, or consisting of administering to an animal in need thereof an effective amount of a an antibody or immunospecific fragment thereof, which specifically or preferentially binds to one or more epitopes of IGF-IR.
[0460] In other embodiments, the present invention includes a method for treating a hyperproliferative disease, e.g., inhibiting tumor formation, tumor growth, tumor invasiveness, and/or metastasis formation in an animal, e.g., a human patient, where the method comprises administering to an animal in need of such treatment an effective amount of a composition comprising, consisting essentially of, or consisting of, in addition to a pharmaceutically acceptable carrier, an antibody, or immunospecific fragment thereof, which specifically binds to at least one epitope of IGF-IR, where the epitope comprises, consists essentially of, or consists of at least about four to five amino acids amino acids of SEQ ID NO:2, at least seven, at least nine, or between at least about 15 to about 30 amino acids of SEQ ID NO:2. The amino acids of a given epitope of SEQ ID NO:2 as described may be, but need not be contiguous. In certain embodiments, the at least one epitope of IGF-IR comprises, consists essentially of, or consists of a non-linear epitope formed by the extracellular domain of IGF-IR as expressed on the surface of a cell. Thus, in certain embodiments the at least one epitope of IGF-IR comprises, consists essentially of, or consists of at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20, at least 25, between about 15 to about 30, or at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 contiguous or noncontiguous amino acids of SEQ ID NO:2, where non-contiguous amino acids form an epitope through protein folding.
[0461] In other embodiments, the present invention includes a method for treating a hyperproliferative disease, e.g., inhibiting tumor formation, tumor growth, tumor invasiveness, and/or metastasis formation in an animal, e.g., a human patient, where the method comprises administering to an animal in need of such treatment an effective amount of a composition comprising, consisting essentially of, or consisting of, in addition to a pharmaceutically acceptable carrier, an antibody, or immunospecific fragment thereof, which specifically binds to at least one epitope of IGF-IR, where the epitope comprises, consists essentially of, or consists of, in addition to one, two, three, four, five, six or more contiguous or non-contiguous amino acids of SEQ ED NO:2 as described above, and an additional moiety which modifies the protein, e.g., a carbohydrate moiety may be included such that the binding molecule binds with higher affinity to modified target protein than it does to an unmodified version of the protein. Alternatively, the binding molecule does not bind the unmodified version of the target protein at all.
[0462] More specifically, the present invention provides a method of treating cancer in a human, comprising administering to a human in need of treatment a composition comprising an effective amount of an IGF-lR-specific antibody or immunospecific fragment thereof, and a pharmaceutically acceptable carrier. Types of cancer to be treated include, but are not limited to, stomach cancer, renal cancer, brain cancer, bladder cancer, colon cancer, lung cancer, breast cancer, pancreatic cancer, ovarian cancer, and prostate cancer.
[0463] In certain embodiments, an antibody or fragment thereof binds specifically to at least one epitope of IGF-IR or fragment or variant described above, i.e., binds to such an epitope more readily than it would bind to an unrelated, or random epitope; binds preferentially to at least one epitope of IGF-IR or fragment or variant described above, i.e., binds to such an epitope more readily than it would bind to a related, similar, homologous, or analogous epitope; competitively inhibits binding of a reference antibody which itself binds specifically or preferentially to a certain epitope of IGF-IR or fragment or variant described above; or binds to at least one epitope of IGF-IR or fragment or variant described above with an affinity characterized by a dissociation constant KD of less than about 5 x 10'2 M, about 10"2 M, about 5 x 10'3 M, about 10"3 M, about 5 X lO-4M, about 10"4M, about 5 x 10"sM, about 10"5M, about 5 x 10'6M, about 10"6M, about 5 x 10" 7M, about 10'7M, about 5 x 10"8M, about 10"8 M, about 5 x 10"9M, about 10"9M, about 5 x 10"10 M, about 10'10M, about 5 x 10"11 M, about 10"n M, about 5 x 10"12 M, about 10"12 M, about 5 x 10"13 M, about 10"13 M, about 5 x 10"14M, about 10"14 M, about 5 x 10"l s M, or about 10"15 M. As used in the context of antibody binding dissociation constants, the term "about" allows for the degree of variation inherent in the methods utilized for measuring antibody affinity. For example, depending on the level of precision of the instrumentation used, standard error based on the number of samples measured, and rounding error, the term "about 10"2 M" might include, for example, from 0.05 M to 0.005 M. In certain embodiments, antibodies and fragments thereof of the present invention cross-react with IGF-IR proteins of other species from which they were raised, e.g., an antibody or fragment thereof which specifically binds to human IGF-IR also binds to primate IGF-IR and/or murine IGF-IR. Other suitable antibodies or fragments thereof of the present invention include those that are highly species specific. [0464] In specific embodiments, antibodies or immunospecific fragments thereof disclosed herein bind IGF-IR polypeptides or fragments or variants thereof with an off rate (k(off)) of less than or equal to 5 X 10'2 sec'1, 10"2 sec"1, 5 X 10~3 sec"1 or 10'3 sec"1. Other antibodies or immunospecific fragments thereof disclosed herein bind IGF-IR polypeptides or fragments or variants thereof with an off rate (k(off)) of less than or equal to 5 X 10^ sec 1, 10"4 sec 1, 5 X 10"5 sec 1, or 10'5 sec"1 5 X 1(T6 sec"1, 10"6 sec"1, 5 X 10"7 sec"1 or 10"7 sec"1.
[0465] In other embodiments, antibodies or immunospecific fragments thereof disclosed herein bind IGF-IR polypeptides or fragments or variants thereof with an on rate (k(on)) of greater than or equal to 103 M"1 sec"1, 5 X 103 M"1 sec"1, 104 M"1 sec"1 or 5 X 104 M"1 sec'1. Other antibodies or immunospecific fragments thereof for use in the diagnostic and treatment methods disclosed herein bind IGF-IR polypeptides or fragments or variants thereof with an on rate (k(on)) greater than or equal to 105 M"1 sec*1, 5 X 105 M"1 sec"1, 106 M"1 sec"1, or 5 X 106 M"1 sec'1 or 107 M 1 sec"1.
[0466] In various embodiments, one or more binding molecules as described above is an antagonist of IGF-IR activity, for example, binding of an antagonist IGF-IR antibody to IGF-IR as expressed on a tumor cell inhibits binding of insulin growth factor, e.g., IGF-I, IGF-2, or both IGF-I and IGF-2 to IGF-IR, promotes internalization of IGF-IR thereby inhibiting its signal transduction capability, inhibits phosphorylation of IGF-IR, inhibits phosphorylation of molecules downstream in the signal transduction pathway, e.g., Akt or p42/44 MAPK, or inhibits tumor cell proliferation, motility or metastasis.
DC. DIAGNOSTIC OR PROGNOSTIC METHODS USING IGF-I R-SPECIFIC BINDING MOLECULES AND NUCLEIC ACID AMPLIFICATION ASSAYS
[0467] . IGF-lR-specific antibodies, or fragments, derivatives, or analogs thereof, can be used for diagnostic purposes to detect, diagnose, or monitor diseases, disorders, and/or conditions associated with the aberrant expression and/or activity of IGF-IR. IGF-IR expression is increased in tumor tissue and other neoplastic conditions.
[0468] IGF-lR-specific antibodies or fragments thereof, are useful for diagnosis, treatment, prevention and/or prognosis of hyperproliferative disorders in mammals, preferably humans. Such disorders include, but are not limited to, cancer, neoplasms, tumors and/or as described under elsewhere herein, especially IGF-lR-associated cancers such as stomach cancer, renal cancer, brain cancer, bladder cancer, colon cancer, lung cancer, breast cancer, pancreatic cancer, ovarian cancer, and prostate cancer. [0469] F°r example, as disclosed herein, IGF-IR expression is associated with at least stomach, renal, brain, bladder, colon, lung, breast, pancreatic, ovarian, and prostate tumor tissues. Accordingly, antibodies (and antibody fragments) directed against IGF-IR may be used to detect particular tissues expressing increased levels of IGF-IR. These diagnostic assays may be performed in vivo or in vitro, such as, for example, on blood samples, biopsy tissue or autopsy tissue.
[0470] Thus, the invention provides a diagnostic method useful during diagnosis of a cancers and other hyperproliferative disorders, which involves measuring the expression level of IGF-IR protein or transcript in tissue or other cells or body fluid from an individual and comparing the measured expression level with a standard IGF-IR expression levels in normal tissue or body fluid, whereby an increase in the expression level compared to the standard is indicative of a disorder.
[0471] One embodiment provides a method of detecting the presence of abnormal hyperproliferative cells, e.g., precancerous or cancerous cells, in a fluid or tissue sample, comprising assaying for the expression of IGF-IR in tissue or body fluid samples of an individual and comparing the presence or level of IGF-IR expression in the sample with the presence or level of IGF-IR expression in a panel of standard tissue or body fluid samples, where detection of IGF-IR expression or an increase in IGF-IR expression over the standards is indicative of aberrant hyperproliferative cell growth.
[0472] More specifically, the present invention provides a method of detecting the presence of abnormal hyperproliferative cells in a body fluid or tissue sample, comprising (a) assaying for the expression of IGF-IR in tissue or body fluid samples of an individual using IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention, and (b) comparing the presence or level of IGF-IR expression in the sample with a the presence or level of IGF-IR expression in a panel of standard tissue or body fluid samples, whereby detection of IGF-IR expression or an increase in IGF-IR expression over the standards is indicative of aberrant hyperproliferative cell growth.
[0473] With respect to cancer, the presence of a relatively high amount of IGF-IR protein in biopsied tissue from an individual may indicate the presence of a tumor or other malignant growth, may indicate a predisposition for the development of such malignancies or tumors, or may provide a means for detecting the disease prior to the appearance of actual clinical symptoms. A more definitive diagnosis of this type may allow health professionals to employ preventative measures or aggressive treatment earlier thereby preventing the develomnent or further progression of the cancer. [0474] IGF-lR-specific antibodies of the present invention can be used to assay protein levels in a biological sample using classical immunohistological methods known to those of skill in the art (e.g., see Jalkanen, et al., J. Cell. Biol. 707:976-985 (1985); Jalkanen, et al., J. Cell Biol. 705:3087-3096 (1987)). Other antibody-based methods useful for detecting protein expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA). Suitable antibody assay labels are known in the art and include enzyme labels, such as, glucose oxidase; radioisotopes, such as iodine (125I, 121I), carbon (14C), sulfur (35S), tritium (3H), indium (112In), and technetium (99Tc); luminescent labels, such as luminol; and fluorescent labels, such as fluorescein and rhodamine, and biotin. Suitable assays are described in more detail elsewhere herein.
[04751 One aspect of the invention is a method for the in vivo detection or diagnosis of a hyperproliferative disease or disorder associated with aberrant expression of IGF-IR in ah animal, preferably a mammal and most preferably a human. In one embodiment, diagnosis comprises: a) administering (for example, parenterally, subcutaneously, or intraperitoneally) to a subject an effective amount of a labeled antibody or fragment thereof of the present invention, which specifically binds to IGF-IR; b) waiting for a time interval following the administering for permitting the labeled binding molecule to preferentially concentrate at sites in the subject where IGF-IR is expressed (and for unbound labeled molecule to be cleared to background level); c) determining background level; and d) detecting the labeled molecule in the subject, such that detection of labeled molecule above the background level indicates that the subject has a particular disease or disorder associated with aberrant expression of IGF-IR. Background level can be determined by various methods including comparing the amount of labeled molecule detected to a standard value previously determined for a particular system.
[0476] It will be understood in the art that the size of the subject and the imaging system used will determine the quantity of imaging moiety needed to produce diagnostic images. In the case of a radioisotope moiety, for a human subject, the quantity of radioactivity injected will normally range from about 5 to 20 millicuries of, e.g., 99Tc. The labeled binding molecule, e.g., antibody or antibody fragment, will then preferentially accumulate at the location of cells which contain the specific protein. In vivo tumor imaging is described in S.W. Burchiel et al., "Immunopharmacokinetics of Radiolabeled Antibodies and Their Fragments." (Chapter 13 in Tumor Imaging: The Radiochemical Detection of
Cancer, S. W. Burchiel and B. A. Rhodes, eds., Masson Publishing Inc. (1982). [0477] Depending on several variables, including the type of label used and the mode of administration, the time interval following the administration for permitting the labeled molecule to preferentially concentrate at sites in the subject and for unbound labeled molecule to be cleared to background level is 6 to 48 hours or 6 to 24 hours or 6 to 12 hours. In another embodiment the time interval following administration is 5 to 20 days or 7 to 10 days.
[0478] Presence of the labeled molecule can be detected in the patient using methods known in the art for in vivo scanning. These methods depend upon the type of label used. Skilled artisans will be able to determine the appropriate method for detecting a particular label. Methods and devices that may be used in the diagnostic methods of the invention include, but are not limited to, computed tomography (CT), whole body scan such as position emission tomography (PET), magnetic resonance imaging (MRI), and sonography.
[0479] In a specific embodiment, the binding molecule is labeled with a radioisotope and is detected in the patient using a radiation responsive surgical instrument (Thurston et al., U.S. Pat. No. 5,441,050). In another embodiment, the binding molecule is labeled with a fluorescent compound and is detected in the patient using a fluorescence responsive scanning instrument. In another embodiment, the binding molecule is labeled with a positron emitting metal and is detected in the patent using positron emission-tomography. In yet another embodiment, the binding molecule is labeled with a paramagnetic label and is detected in a patient using magnetic resonance imaging (MRI).
[0480] Antibody labels or markers for in vivo imaging of IGF-IR expression include those detectable by X-radiography, nuclear magnetic resonance imaging (NMR), MRI, CAT-scans or electron spin resonance imaging (ESR). For X-radiography, suitable labels include radioisotopes such as barium or cesium, which emit detectable radiation but are not overtly harmful to the subject. Suitable markers for NMR and ESR. include those with a detectable characteristic spin, such as deuterium, which may be incorporated into the antibody by labeling of nutrients for the relevant hybridoma. Where in vivo imaging is used to detect enhanced levels of IGF-IR expression for diagnosis in humans, it may be preferable to use human antibodies or "humanized" chimeric monoclonal antibodies as described elsewhere herein.
[0481] In a related embodiment to those described above, monitoring of an already diagnosed disease or disorder is carried out by repeating any one of the methods for diagnosing the disease or disorder, for example, one month after initial diagnosis, six months after initial diagnosis, one year after initial diagnosis, etc.
[0482] Where a diagnosis of a disorder, including diagnosis of a tumor, has already been made according to conventional methods, detection methods as disclosed herein are useful as a prognostic indicator, whereby patients continuing to exhibiting enhanced IGF- IR expression will experience a worse clinical outcome relative to patients whose expression level decreases nearer the standard level.
[0483] By "assaying the expression level of the tumor associated IGF-IR polypeptide" is intended qualitatively or quantitatively measuring or estimating the level of IGF-IR polypeptide in a first biological sample either directly (e.g., by determining or estimating absolute protein level) or relatively (e.g., by comparing to the cancer associated polypeptide level in a second biological sample). Preferably, IGF-IR polypeptide expression level in the first biological sample is measured or estimated and compared to a standard IGF-IR polypeptide level, the standard being taken from a second biological sample obtained from an individual not having the disorder or being determined by averaging levels from a population of individuals not having the disorder. As will be appreciated in the art, once the "standard" IGF-IR polypeptide level is known, it can be used repeatedly as a standard for comparison.
[0484] By "biological sample" is intended any biological sample obtained from an individual, cell line, tissue culture, or other source of cells potentially expressing IGF-IR. As indicated, biological samples include body fluids (such as sera, plasma, urine, synovial fluid and spinal fluid), and other tissue sources which contain cells potentially expressing IGF-IR. Methods for obtaining tissue biopsies and body fluids from mammals are well known in the art.
[0485] In an additional embodiment, antibodies, or immunospecific fragments of antibodies directed to a conformational epitope of IGF-IR may be used to quantitatively or qualitatively detect the presence of IGF-IR gene products or conserved variants or peptide fragments thereof. This can be accomplished, for example, by immunofluoresence techniques employing a fluorescently labeled antibody coupled with light microscopic, flow cytometric, or fluorimetric detection.
[0486] Cancers that may be diagnosed, and/or prognosed using the methods described above include but are not limited to, stomach cancer, renal cancer, brain cancer, bladder cancer, colon cancer, lung cancer, breast cancer, pancreatic cancer, ovarian cancer, and prostate cancer. X. IMMUNOASSAYS
[0487] IGF-lR-specific antibodies or immunospecific fragments thereof disclosed herein may be assayed for immunospecific binding by any method known in the art. The immunoassays which can be used include but are not limited to competitive and noncompetitive assay systems using techniques such as western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay), "sandwich" immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays. complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, protein A immunoassays, to name but a few. Such assays are routine and well known in the art (see, e.g., Ausubel et al., eds, Current Protocols in Molecular Biology, John Wiley & Sons, Inc., New York, Vol. 1 (1994), which is incorporated by reference herein in its entirety). Exemplary immunoassays are described briefly below (but are not intended by way of limitation).
[0488] Immunoprecipitation protocols generally comprise lysing a population of cells in a lysis buffer such as RIPA buffer (1% NP-40 or Triton X-100, 1% sodium deoxycholate, 0.1% SDS, 0.15 M NaCl, 0.01 M sodium phosphate at pH 7.2, 1% Trasylol) supplemented with protein phosphatase and/or protease inhibitors (e.g., EDTA, PMSF, aprotinin, sodium vanadate), adding the antibody of interest to the cell lysate, incubating for a period of time (e.g., 1-4 hours) at 4.degree. C, adding protein A and/or protein G sepharose beads to the cell lysate, incubating for about an hour or more at 4.degree. C, washing the beads in lysis buffer and resuspending the beads in SDS/sample buffer. The ability of the antibody of interest to immunoprecipitate a particular antigen can be assessed by, e.g., western blot analysis. One of skill in the art would be knowledgeable as to the parameters that can be modified to increase the binding of the antibody to an antigen and decrease the background (e.g., pre-clearing the cell lysate with sepharose beads). For further discussion regarding immunoprecipitation protocols see, e.g., Ausubel et al., eds, Current Protocols in Molecular Biology, John Wiley & Sons, Inc., New York, Vol. 1 (1994) at 10.16.1.
[0489] Western blot analysis generally comprises preparing protein samples, electrophoresis of the protein samples in a polyacrylamide gel (e.g., 8%-20% SDS-PAGE depending on the molecular weight of the antigen), transferring the protein sample from the polyacrylamide gel to a membrane such as nitrocellulose, PVDF or nylon, blocking the membrane in blocking solution (e.g., PBS with 3% BSA or non-fat milk), washing the membrane in washing buffer (e.g., PBS-Tween 20), blocking the membrane with primary antibody (the antibody of interest) diluted in blocking buffer, washing the membrane in washing buffer, blocking the membrane with a secondary antibody (which recognizes the primary antibody, e.g., an anti-human antibody) conjugated to an enzymatic substrate (e.g., horseradish peroxidase or alkaline phosphatase) or radioactive molecule (e.g., 32p or 1251) diluted in blocking buffer, washing the membrane in wash buffer, and detecting the presence of the antigen. One of skill in the art would be knowledgeable as to the parameters that can be modified to increase the signal detected and to reduce the background noise. For further discussion regarding western blot protocols see, e.g., Ausubel et al., eds, Current Protocols in Molecular Biology, John Wiley & Sons, Inc., New York Vol. 1 (1994) at 10.8.1.
[0490] ELISAs comprise preparing antigen, coating the well of a 96 well microtiter plate with the antigen, adding the antibody of interest conjugated to a detectable compound such as an enzymatic substrate (e.g., horseradish peroxidase or alkaline phosphatase) to the well and incubating for a period of time, and detecting the presence of the antigen. In ELISAs the antibody of interest does not have to be conjugated to a detectable compound; instead, a second antibody (which recognizes the antibody of interest) conjugated to a detectable compound may be added to the well. Further, instead of coating the well with the antigen, the antibody may be coated to the well. In this case, a second antibody conjugated to a detectable compound may be added following the addition of the antigen of interest to the coated well. One of skill in the art would be knowledgeable as to the parameters that can be modified to increase the signal detected as well as other variations of ELISAs known in the art. For further discussion regarding ELISAs see, e.g., Ausubel et al., eds, Current Protocols in Molecular Biology, John Wiley & Sons, Inc., New York, Vol. 1 (1994) at 11.2.1.
[0491] The binding affinity of an antibody to an antigen and the off-rate of an antibody- antigen interaction can be determined by competitive binding assays. One example of a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen (e.g., 3H or 125I) with the antibody of interest in the presence of increasing amounts of unlabeled antigen, and the detection of the antibody bound to the labeled antigen. The affinity of the antibody of interest for a particular antigen and the binding off-rates can be determined from the data by Scatchard plot analysis. Competition with a second antibody can also be determined using radioimmunoassays. In this case, the antigen is incubated with antibody of interest is conjugated to a labeled compound (e.g., 3H or 125I) in the presence of increasing amounts of an unlabeled second antibody.
[0492] IGF-lR-specific antibodies may, additionally, be employed histologically, as in immunofluorescence, immunoelectron microscopy or non-immunological assays, for in situ detection of cancer antigen gene products or conserved variants or peptide fragments thereof. In situ detection may be accomplished by removing a histological specimen from a patient, and applying thereto a labeled IGF-lR-specifϊc antibody or fragment thereof, preferably applied by overlaying the labeled antibody (or fragment) onto a biological sample. Through the use of such a procedure, it is possible to determine not only the presence of IGF-IR protein, or conserved variants or peptide fragments, but also its distribution in the examined tissue. Using the present invention, those of ordinary skill will readily perceive that any of a wide variety of histological methods (such as staining procedures) can be modified in order to achieve such in situ detection.
[0493] Immunoassays and non-immunoassays for IGF-IR gene products or conserved variants or peptide fragments thereof will typically comprise incubating a sample, such as a biological fluid, a tissue extract, freshly harvested cells, or lysates of cells which have been incubated in cell culture, in the presence of a detectably labeled antibody capable of binding to IGF-IR or conserved variants or peptide fragments thereof, and detecting the bound antibody by any of a number of techniques well-known in the art.
[0494] The biological sample may be brought in contact with and immobilized onto a solid phase support or carrier such as nitrocellulose, or other solid support which is capable of immobilizing cells, cell particles or soluble proteins. The support may then be washed with suitable buffers followed by treatment with the detectably labeled IGF-IR- specific antibody. The solid phase support may then be washed with the buffer a second time to remove unbound antibody. Optionally the antibody is subsequently labeled. The amount of bound label on solid support may then be detected by conventional means.
[0495] By "solid phase support or carrier" is intended any support capable of binding an antigen or an antibody. Well-known supports or carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, gabbros, and magnetite. The nature of the carrier can be either soluble to some extent or insoluble for the purposes of the present invention. The support material may have virtually any possible structural configuration so long as the coupled molecule is capable of binding to an antigen or antibody. Thus, the support configuration may be spherical, as in a bead, or cylindrical, as in the inside surface of a test tube, or the external surface of a rod. Alternatively, the surface may be flat such as a sheet, test strip, etc. Preferred supports include polystyrene beads. Those skilled in the art will know many other suitable carriers for binding antibody or antigen, or will be able to ascertain the same by use of routine experimentation.
[0496] The binding activity of a given lot of IGF-lR-specific antibody may be determined according to well known methods. Those skilled in the art will be able to determine operative and optimal assay conditions for each determination by employing routine experimentation.
[0497] There are a variety of methods available for measuring the affinity of an antibody- antigen interaction, but relatively few for determining rate constants. Most of the methods rely on either labeling antibody or antigen, which inevitably complicates routine measurements and introduces uncertainties in the measured quantities.
[0498] Surface plasmon resonance (SPR) as performed on BIAcore offers a number of advantages over conventional methods of measuring the affinity of antibody-antigen interactions: (i) no requirement to label either antibody or antigen; (ii) antibodies do not need to be purified in advance, cell culture supernatant can be used directly; (iii) real-time measurements, allowing rapid semi-quantitative comparison of different monoclonal antibody interactions, are enabled and are sufficient for many evaluation purposes; (iv) biospecific surface can be regenerated so that a series of different monoclonal antibodies can easily be compared under identical conditions; (v) analytical procedures are fully automated, and extensive series of measurements can be performed without user intervention. BIAapplications Handbook, version AB (reprinted 1998), BIACORE code No. BR-1001-86; BIAtechnology Handbook, version AB (reprinted 1998), BIACORE code No. BR-1001-84.
[0499] SPR based binding studies require that one member of a binding pair be immobilized on a sensor surface. The binding partner immobilized is referred to as the ligand. The binding partner in solution is referred to as the analyte. In some cases, the ligand is attached indirectly to the surface through binding to another immobilized molecule, which is referred as the capturing molecule. SPR response reflects a change in mass concentration at the detector surface as analytes bind or dissociate.
[0500] Based on SPR, real-time BIAcore measurements monitor interactions directly as they happen. The technique is well suited to determination of kinetic parameters. Comparative affinity ranking is extremely simple to perform, and both kinetic and affinity constants can be derived from the sensorgram data. [0501] When analyte is injected in a discrete pulse across a ligand surface, the resulting sensorgram can be divided into three essential phases: (i) Association of analyte with ligand during sample injection; (ii) Equilibrium or steady state during sample injection, where the rate of analyte binding is balanced by dissociation from the complex; (iii) Dissociation of analyte from the surface during buffer flow.
[0S02] The association and dissociation phases provide information on the kinetics of analyte-ligand interaction (ka and k<j, the rates of complex formation and dissociation, k<j/ka = KD)- The equilibrium phase provides information on the affinity of the analyte- ligand interaction (KD)-
[0503] BIAevaluation software provides comprehensive facilities for curve fitting using both numerical integration and global fitting algorithms. With suitable analysis of the data, separate rate and affinity constants for interaction can be obtained from simple BIAcore investigations. The range of affinities measurable by this technique is very broad ranging from mM to pM.
[0504] Epitope specificity is an important characteristic of a monoclonal antibody.
Epitope mapping with BIAcore, in contrast to conventional techniques using radioimmunoassay, ELISA or other surface adsorption methods, does not require labeling or purified antibodies, and allows multi-site specificity tests using a sequence of several monoclonal antibodies. Additionally, large numbers of analyses can be processed automatically.
[0505] Pair- wise binding experiments test the ability of two MAbs to bind simultaneously to the same antigen. MAbs directed against separate epitopes will bind independently, whereas MAbs directed against identical or closely related epitopes will interfere with each other's binding. These binding experiments with BIAcore are straightforward to carry out.
[0506] For example, one can use a capture molecule to bind the first Mab, followed by addition of antigen and second MAb sequentially. The sensorgrams will reveal: 1. how much of the antigen binds to first Mab, 2. to what extent the second MAb binds to the surface-attached antigen, 3. if the second MAb does not bind, whether reversing the order of the pair-wise test alters the results.
[0507] Peptide inhibition is another technique used for epitope mapping. This method can complement pair-wise antibody binding studies, and can relate functional epitopes to structural features when the primary sequence of the antigen is known. Peptides or antigen fragments are tested for inhibition of binding of different MAbs to immobilized antigen. Peptides which interfere with binding of a given MAb are assumed to be structurally related to the epitope defined by that MAb.
XI. PHARMACEUTICAL COMPOSITIONS AND ADMINISTRATION METHODS
[0508] Methods of preparing and administering IGF-lR-specific antibodies or imrnunospecifϊc fragments thereof to a subject in need thereof are well known to or are readily determined by those skilled in the art. The route of administration of the binding molecule, e.g., binding polypeptide, e.g., IGF-lR-specific antibody or immunospecific fragment thereof may be, for example, oral, parenteral, by inhalation or topical. The term parenteral as used herein includes, e.g., intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, rectal or vaginal administration. While all these forms of administration are clearly contemplated as being within the scope of the invention, a form for administration would be a solution for injection, in particular for intravenous or intraarterial injection or drip. Usually, a suitable pharmaceutical composition for injection may comprise a buffer {e.g. acetate, phosphate or citrate buffer), a surfactant {e.g. polysorbate), optionally a stabilizer agent {e.g. human albumin), etc. However, in other methods compatible with the teachings herein, binding molecules, e.g., binding polypeptides, e.g., IGF-lR-specific antibodies or immunospecific fragments thereof can be delivered directly to the site of the adverse cellular population thereby increasing the exposure of the diseased tissue to the therapeutic agent.
[0509] Preparations for parenteral administration includes sterile aqueous or non-aqueous solutions, suspensions, and emulsions. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. In the subject invention, pharmaceutically acceptable carriers include, but are not limited to, 0.01-0. IM and preferably 0.05M phosphate buffer or 0.8% saline. Other common parenteral vehicles include sodium phosphate solutions, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils. Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers, such as those based on Ringer's dextrose, and the like. Preservatives and other additives may also be present such as for example, antimicrobials, antioxidants, chelating agents, and inert gases and the like.
[0510] More particularly, pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. In such cases, the composition must be sterile and should be fluid to the extent that easy syringability exists. It should be stable under the conditions of manufacture and storage and will preferably be preserved against the contaminating action of microorganisms, such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Suitable formulations for use in the therapeutic methods disclosed herein are described in Remington's Pharmaceutical Sciences, Mack Publishing Co., 16th ed. (1980).
[0511] Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal and the like, hi many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols, such as mannitol, sorbitol, or sodium chloride in the composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
[0512] In any case, sterile injectable solutions can be prepared by incorporating an active compound (e.g., a binding molecule, e.g., a binding polypeptide, e.g., a IGF-lR-specific antibody or immunospecific fragment thereof, by itself or in combination with other active agents) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated herein, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle, which contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze- drying, which yields a powder of an active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof. The preparations for injections are processed, filled into containers such as ampoules, bags, bottles, syringes or vials, and sealed under aseptic conditions according to methods known in the art. Further, the preparations may be packaged and sold in the form of a kit such as those described in co-pending U.S.S.N. 09/259,337 (US-2002-0102208 Al), which is incorporated herein by reference in its entirety. Such articles of manufacture will preferably have labels or package inserts indicating that the associated compositions are useful for treating a subject suffering from, or predisposed to autoimmune or neoplastic disorders.
[0513] Effective doses of the compositions of the present invention, for treatment of hyperproliferative disorders as described herein vary depending upon many different factors, including means of administration, target site, physiological state of the patient, whether the patient is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic. Usually, the patient is a human but non-human mammals including transgenic mammals can also be treated. Treatment dosages may be titrated using routine methods known to those of skill in the art to optimize safety and efficacy.
[0514] For treatment of hyperproliferative disorders with an antibody or fragment thereof, the dosage can range, e.g., from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 mg/kg (e.g., 0.02 mg/kg, 0.25 mg/kg, 0.5 mg/kg, 0.75 mg/kg, 1 mg/kg, 2 mg/kg, etc.), of the host body weight. For example dosages can be 1 mg/kg body weight or 10 mg/kg body weight or within the range of 1-10 mg/kg, preferably at least 1 mg/kg. Doses intermediate in the above ranges are also intended to be within the scope of the invention. Subjects can be administered such doses daily, on alternative days, weekly or according to any other schedule determined by empirical analysis. An exemplary treatment entails administration in multiple dosages over a prolonged period, for example, of at least six months. Additional exemplary treatment regimes entail administration once per every two weeks or once a month or once every 3 to 6 months. Exemplary dosage schedules include 1-10 mg/kg or 15 mg/kg on consecutive days, 30 mg/kg on alternate days or 60 mg/kg weekly. In some methods, two or more monoclonal antibodies with different binding specificities are administered simultaneously, in which case the dosage of each antibody administered falls within the ranges indicated.
[0515] IGF-lR-specific antibodies or immunospecific fragments thereof disclosed herein can be administered on multiple occasions. Intervals between single dosages can be weekly, monthly or yearly. Intervals can also be irregular as indicated by measuring blood levels of target polypeptide or target molecule in the patient. In some methods, dosage is adjusted to achieve a plasma polypeptide concentration of 1-1000 μg/ml and in some methods 25-300 μg/ml. Alternatively, binding molecules can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the antibody in the patient. The half-life of a binding molecule can also be prolonged via fusion to a stable polypeptide or moiety, e.g., albumin or PEG. hi general, humanized antibodies show the longest half- life, followed by chimeric antibodies and nonhuman antibodies. In one embodiment, the binding molecules of the invention can be administered in unconjugated form, In another embodiment, the binding molecules, e.g., binding polypeptides, e.g., IGF-lR-speciflc antibodies or immunospecific fragments thereof for use in the methods disclosed herein can be administered multiple times in conjugated form. In still another embodiment, the binding molecules of the invention can be administered in unconjugated form, then in conjugated form, or vise versa.
[0516] The dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, compositions comprising antibodies or a cocktail thereof are administered to a patient not already in the disease state or in a pre-disease state to enhance the patient's resistance. Such an amount is defined to be a "prophylactic effective dose." In this use, the precise amounts again depend upon the patient's state of health and general immunity, but generally range from 0.1 to 25 mg per dose, especially 0.5 to 2.5 mg per dose. A relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives.
[0517] In therapeutic applications, a relatively high dosage (e.g., from about 1 to 400 mg/kg of binding molecule, e.g., antibody per dose, with dosages of from 5 to 25 mg being more commonly used for radioimmunoconjugates and higher doses for cytotoxin- drug conjugated molecules) at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patent can be administered a prophylactic regime.
[0518] In one embodiment, a subject can be treated with a nucleic acid molecule encoding an IGF-lR-specific antibody or immunospecific fragment thereof (e.g., in a vector). Doses for nucleic acids encoding polypeptides range from about 10 ng to 1 g, 100 ng to 100 mg, 1 μg to 10 mg, or 30-300 μg DNA per patient. Doses for infectious viral vectors vary from 10-100, or more, virions per dose.
[0519] Therapeutic agents can be administered by parenteral, topical, intravenous, oral, subcutaneous, intraarterial, intracranial, intraperitoneal, intranasal or intramuscular means for prophylactic and/or therapeutic treatment. In some methods, agents are injected directly into a particular tissue where IGF-lR-expressing cells have accumulated, for example intracranial injection. Intramuscular injection or intravenous infusion are preferred for administration of antibody. In some methods, particular therapeutic antibodies are injected directly into the cranium. In some methods, antibodies are administered as a sustained release composition or device, such as a Medipad™ device.
[0520] IGF-IR antibodies or fragments thereof of the invention can optionally be administered in combination with other agents that are effective in treating the disorder or condition in need of treatment (e.g., prophylactic or therapeutic).
[0521] Effective single treatment dosages (i.e., therapeutically effective amounts) Of 90Y- labeled binding polypeptides range from between about 5 and about 75 mCi, more preferably between about 10 and about 40 mCi. Effective single treatment non-marrow ablative dosages of 13lI-labeled antibodies range from between about 5 and about 70 mCi, more preferably between about 5 and about 40 mCi. Effective single treatment ablative dosages (i.e., may require autologous bone marrow transplantation) of 131I-labeled antibodies range from between about 30 and about 600 mCi, more preferably between about 50 and less than about 500 mCi. In conjunction with a chimeric antibody, owing to the longer circulating half life vis-a-vis murine antibodies, an effective single treatment non-marrow ablative dosages of iodine-131 labeled chimeric antibodies range from between about 5 and about 40 mCi, more preferably less than about 30 mCi. Imaging criteria for, e.g., the U 1m label, are typically less than about 5 mCi.
[0522] While a great deal of clinical experience has been gained with 131I and 90Y, other radiolabels are known in the art and have been used for similar purposes. Still other radioisotopes are used for imaging. For example, additional radioisotopes which are compatible with the scope of the instant invention include, but are not limited to, 123I, 125I, 32P, 57Co, 64Cu, 67Cu, 77Br, 81Rb, 81Kr, 87Sr, 113In, 127Cs, 129Cs, 1321, 197Hg, 203Pb, 206Bi, 177Lu, 186Re, 212Pb, 212Bi, 47Sc, 105Rh, 109Pd, 153Sm, 188Re, 199Au, 225Ac, 211At, and 213Bi. In this respect alpha, gamma and beta emitters are all compatible with in the instant invention. Further, in view of the instant disclosure it is submitted that one skilled in the art could readily determine which radionuclides are compatible with a selected course of treatment without undue experimentation. To this end, additional radionuclides which have already been used in clinical diagnosis include 125I, 123I, 99Tc, 43K, 52Fe, 67Ga, 68Ga, as well as 111In. Antibodies have also been labeled with a variety of radionuclides for potential use in targeted immunotherapy (Peirersz et al. Immunol. Cell Biol. 65: 111-125 (1987)). These radionuclides include 188Re and 186Re as well as 199Au and 67Cu to a lesser extent. U.S. Patent No. 5,460,785 provides additional data regarding such radioisotopes and is incorporated herein by reference.
[0523] Whether or not IGF-lR-specific antibodies or immunospecific fragments thereof disclosed herein are used in a conjugated or unconjugated form, it will be appreciated that a major advantage of the present invention is the ability to use these molecules in myelosuppressed patients, especially those who are undergoing, or have undergone, adjunct therapies such as radiotherapy or chemotherapy. That is, the beneficial delivery profile (i.e. relatively short serum dwell time, high binding affinity and enhanced localization) of the molecules makes them particularly useful for treating patients that have reduced red marrow reserves and are sensitive to myelotoxicity. In this regard, the unique delivery profile of the molecules make them very effective for the administration of radiolabeled conjugates to myelosuppressed cancer patients. As such, the IGF-IR- specific antibodies or immunospecific fragments thereof disclosed herein are useful in a conjugated or unconjugated form in patients that have previously undergone adjunct therapies such as external beam radiation or chemotherapy. In other preferred embodiments, binding molecules, e.g., binding polypeptides, e.g., IGF-lR-specific antibodies or immunospecific fragments thereof (again in a conjugated or unconjugated form) may be used in a combined therapeutic regimen with chemotherapeutic agents. Those skilled in the art will appreciate that such therapeutic regimens may comprise the sequential, simultaneous, concurrent or coextensive administration of the disclosed antibodies or other binding molecules and one or more chemotherapeutic agents. Particularly preferred embodiments of this aspect of the invention will comprise the administration of a radiolabeled binding polypeptide.
[0524] While IGF-lR-specific antibodies or immunospecific fragments thereof may be administered as described immediately above, it must be emphasized that in other embodiments conjugated and unconjugated binding molecules may be administered to otherwise healthy patients as a first line therapeutic agent. In such embodiments binding molecules may be administered to patients having normal or average red marrow reserves and/or to patients that have not, and are not, undergoing adjunct therapies such as external beam radiation or chemotherapy.
[0525] However, as discussed above, selected embodiments of the invention comprise the administration of IGF-lR-specific antibodies or immunospecific fragments thereof to myelosuppressed patients or in combination or conjunction with one or more adjunct therapies such as radiotherapy or chemotherapy (i.e. a combined therapeutic regimen). As used herein, the administration of IGF-lR-specific antibodies or immunospecific fragments thereof in conjunction or combination with an adjunct therapy means the sequential, simultaneous, coextensive, concurrent, concomitant or contemporaneous administration or application of the therapy and the disclosed binding molecules. Those skilled in the art will appreciate that the administration or application of the various components of the combined therapeutic regimen may be timed to enhance the overall effectiveness of the treatment. For example, chemotherapeutic agents could be administered in standard, well known courses of treatment followed within a few weeks by radioimmunoconjugates described herein. Conversely, cytotoxin-conjugated binding molecules could be administered intravenously followed by tumor localized external beam radiation. In yet other embodiments, binding molecules may be administered concurrently with one or more selected chemotherapeutic agents in a single office visit. A skilled artisan (e.g. an experienced oncologist) would be readily be able to discern effective combined therapeutic regimens without undue experimentation based on the selected adjunct therapy and the teachings of the instant specification. In this regard it will be appreciated that the combination of a binding molecule
(with or without cytotoxin) and the chemotherapeutic agent may be administered in any order and within any time frame that provides a therapeutic benefit to the patient. That is, the chemotherapeutic agent and IGF-lR-specific antibody or immunospecific fragment thereof, may be administered in any order or concurrently. In selected embodiments IGF- lR-specific antibodies or immunospecific fragments thereof of the present invention will be administered to patients that have previously undergone chemotherapy. In yet other embodiments, IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention will be administered substantially simultaneously or concurrently with the chemotherapeutic treatment. For example, the patient may be given the binding molecule while undergoing a course of chemotherapy. In preferred embodiments the binding molecule will be administered within 1 year of any chemotherapeutic agent or treatment. In other preferred embodiments the polypeptide will be administered within 10, 8, 6, 4, or 2 months of any chemotherapeutic agent or treatment. In still other preferred embodiments the binding molecule will be administered within 4, 3, 2 or 1 week of any chemotherapeutic agent or treatment. In yet other embodiments the binding molecule will be administered within 5, 4, 3, 2 or 1 days of the selected chemotherapeutic agent or treatment. It will further be aopreciated that the two agents or treatments may be administered to the patient within a matter of hours or minutes {i.e. substantially simultaneously).
[0527J Moreover, in accordance with the present invention a myelosuppressed patient shall be held to mean any patient exhibiting lowered blood counts. Those skilled in the art will appreciate that there are several blood count parameters conventionally used as clinical indicators of myelosuppression and one can easily measure the extent to which myelosuppression is occurring in a patient. Examples of art accepted myelosuppression measurements are the Absolute Neutrophil Count (ANC) or platelet count. Such myelosuppression or partial myeloablation may be a result of various biochemical disorders or diseases or, more likely, as the result of prior chemotherapy or radiotherapy. In this respect, those skilled in the art will appreciate that patients who have undergone traditional chemotherapy typically exhibit reduced red marrow reserves. As discussed above, such subjects often cannot be treated using optimal levels of cytotoxin (i.e. radionuclides) due to unacceptable side effects such as anemia or immunosuppression that result in increased mortality or morbidity.
[0528] More specifically conjugated or unconjugated IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention may be used to effectively treat patients having ANCs lower than about 2000/mm3 or platelet counts lower than about 150,000/ mm3. More preferably IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention may be used to treat patients having ANCs of less than about 1500/ mm3, less than about 1000/mm3 or even more preferably less than about 500/ mm3. Similarly, IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention may be used to treat patients having a platelet count of less than about 75,000/mm3, less than about 50,000/mm3 or even less than about 10,000/mm3. In a more general sense, those skilled in the art will easily be able to determine when a patient is myelosuppressed using government implemented guidelines and procedures.
[0529] As indicated above, many myelosuppressed patients have undergone courses of treatment including chemotherapy, implant radiotherapy or external beam radiotherapy. In the case of the latter, an external radiation source is for local irradiation of a malignancy. For radiotherapy implantation methods, radioactive reagents are surgically located within the malignancy, thereby selectively irradiating the site of the disease. In any event, IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention may be used to treat disorders in patients exhibiting myelosuppression regardless of the cause.
[0530] In this regard it will further be appreciated that IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention may be used in conjunction or combination with any chemotherapeutic agent or agents {e.g. to provide a combined therapeutic regimen) that eliminates, reduces, inhibits or controls the growth of neoplastic cells in vivo. As discussed, such agents often result in the reduction of red marrow reserves. This reduction may be offset, in whole or in part, by the diminished myelotoxicity of the compounds of the present invention that advantageously allow for the aggressive treatment of neoplasias in such patients. In other embodiments, radiolabeled immunoconjugates disclosed herein may be effectively used with radiosensitizers that increase the susceptibility of the neoplastic cells to radionuclides. For example, radiosensitizing compounds may be administered after the radiolabeled binding molecule has been largely cleared from the bloodstream but still remains at therapeutically effective levels at the site of the tumor or tumors.
[0531] With respect to these aspects of the invention, exemplary chemotherapeutic agents that are compatible with the instant invention include alkylating agents, vinca alkaloids (e.g., vincristine and vinblastine), procarbazine, methotrexate and prednisone. The four- drug combination MOPP (mechlethamine (nitrogen mustard), vincristine (Oncovin), procarbazine and prednisone) is very effective in treating various types of lymphoma and comprises a preferred embodiment of the present invention. In MOPP-resistant patients, ABVD (e.g., adriamycin, bleomycin, vinblastine and dacarbazine), ChIVPP (chlorambucil, vinblastine, procarbazine and prednisone), CABS (lomustine, doxorubicin, bleomycin and streptozotocin), MOPP plus ABVD, MOPP plus ABV (doxorubicin, bleomycin and vinblastine) or BCVPP (carmustine, cyclophosphamide, vinblastine, procarbazine and prednisone) combinations can be used. Arnold S. Freedman and Lee M. Nadler, Malignant Lymphomas, in Harrison's Principles of Internal Medicine 1774-1788 (Kurt J. Isselbacher et al, eds., 13th ed. 1994) and V. T. DeVita et al. (1997) and the references cited therein for standard dosing and scheduling. These therapies can be used unchanged, or altered as needed for a particular patient, in combination with one or more IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention.
[0532] Additional regimens that are useful in the context of the present invention include use of single alkylating agents such as cyclophosphamide or chlorambucil, or combinations such as CVP (cyclophosphamide, vincristine and prednisone), CHOP (CVP and doxorubicin), C-MOPP (cyclophosphamide, vincristine, prednisone and procarbazine), CAP-BOP (CHOP plus procarbazine and bleomycin), m-BACOD (CHOP plus methotrexate, bleomycin and leucovorin), ProMACE-MOPP (prednisone, methotrexate, doxorubicin, cyclophosphamide, etoposide and leucovorin plus standard MOPP), ProMACE-CytaBOM (prednisone, doxorubicin, cyclophosphamide, etoposide, cytarabine, bleomycin, vincristine, methotrexate and leucovorin) and MACOP-B (methotrexate, doxorubicin, cyclophosphamide, vincristine, fixed dose prednisone, bleomycin and leucovorin). Those skilled in the art will readily be able to determine standard dosages and scheduling for each of these regimens. CHOP has also been combined with bleomycin, methotrexate, procarbazine, nitrogen mustard, cytosine arabinoside and etoposide. Other compatible chemotherapeutic agents include, but are not limited to, 2-chlorodeoxyadenosine (2-CDA), 2*-deoxycoformycin and fludarabine.
[0533] For patients with intermediate- and high-grade malignancies, who fail to achieve remission or relapse, salvage therapy is used. Salvage therapies employ drugs such as cytosine arabinoside, cisplatin, carboplatin, etoposide and ifosfamide given alone or in combination. In relapsed or aggressive forms of certain neoplastic disorders the following protocols are often used: IMVP-16 (ifosfamide, methotrexate and etoposide), MIME (methyl-gag, ifosfamide, methotrexate and etoposide), DHAP (dexamethasone, high dose cytarabine and cisplatin), ESHAP (etoposide, methylpredisolone, HD cytarabine, cisplatin), CEPP(B) (cyclophosphamide, etoposide, procarbazine, prednisone and bleomycin) and CAMP (lomustine, mitoxantrone, cytarabine and prednisone) each with well known dosing rates and schedules.
[0534] The amount of chemotherapeutic agent to be used in combination with the IGF- lR-specific antibodies or immunospecific fragments thereof of the present invention may vary by subject or may be administered according to what is known in the art. See for example, Bruce A Chabner et al., Antineoplastic Agents, in Goodman & Gilman's The Pharmacological Basis of Therapeutics 1233-1287 (Joel G. Hardman et al, eds., 9th ed. (1996)).
[0535] In another embodiment, an IGF-lR-specific antibody or immunospecific fragment thereof of the present invention is administered in conjunction with a biologic. Biologies useful in the treatment of cancers are known in the art and a binding molecule of the invention may be administered, for example, in conjunction with such known biologies.
[0536] For example, the FDA has approved the following biologies for the treatment of breast cancer: Herceptin® (trastuzumab, Genentech Inc., South San Francisco, CA; a humanized monoclonal antibody that has anti-tumor activity in HER2-positive breast cancer); Faslodex® (fulvestrant, AstraZeneca Pharmaceuticals, LP, Wilmington, DE; an estrogen-receptor antagonist used to treat breast cancer); Arimidex® (anastrozole, AstraZeneca Pharmaceuticals, LP; a nonsteroidal aromatase inhibitor which blocks aromatase, an enzyme needed to make estrogen); Aromasin® (exemestane, Pfizer Inc., New York, NY; an irreversible, steroidal aromatase inactivator used in the treatment of breast cancer); Femara® (letrozole, Novartis Pharmaceuticals, East Hanover, NJ; a nonsteroidal aromatase inhibitor approved by the FDA to treat breast cancer); and Nolvadex® (tamoxifen, AstraZeneca Pharmaceuticals, LP; a nonsteroidal antiestrogen approved by the FDA to treat breast cancer). Other biologies with which the binding molecules of the invention may be combined include: Avastin™ (bevacizumab, Genentech Inc.; the first FDA-approved therapy designed to inhibit angiogenesis); and Zevalin® (ibritumomab tiuxetan, Biogen Idee, Cambridge, MA; a radiolabeled monoclonal antibody currently approved for the treatment of B-cell lymphomas).
[0537] In addition, the FDA has approved the following biologies for the treatment of colorectal cancer: Avastin™ ;Erbitux™ (cetuximab, ImClone Systems Inc., New York, NY, and Bristol-Myers Squibb, New York, NY; is a monoclonal antibody directed against the epidermal growth factor receptor (EGFR)); Gleevec® (imatinib mesylate; a protein kinase inhibitor); and Ergamisol® (levamisole hydrochloride, Janssen Pharmaceutica Products, LP, Titusville, NJ; an immunomodulator approved by the FDA in 1990 as an adjuvant treatment in combination with 5-fluorouracil after surgical resection in patients with Dukes' Stage C colon cancer).
[0538] For use in treatment of Non-Hodgkin's Lymphomas currently approved therapies include: Bexxar® (tositumomab and iodine 1-131 tositumomab, GlaxoSmithKline, Research Triangle Park, NC; a multi-step treatment involving a mouse monoclonal antibody (tositumomab) linked to a radioactive molecule (iodine 1-131)); Intron® A (interferon alfa-2b, Schering Corporation, Kenilworth, NJ; a type of interferon approved for the treatment of follicular non-Hodgkin's lymphoma in conjunction with anthracycline-containing combination chemotherapy (e.g., cyclophosphamide, doxorubicin, vincristine, and prednisone [CHOP])); Rituxan® (rituximab, Genentech Inc., South San Francisco, CA, and Biogen Idee, Cambridge, MA; a monoclonal antibody approved for the treatment of non-Hodgkin's lymphoma; Ontak® (denileukin diftitox, Ligand Pharmaceuticals Inc., San Diego, CA; a fusion protein consisting of a fragment of diphtheria toxin genetically fused to interleukin-2); and Zevalin® (ibritumomab tiuxetan, Biogen Idee; a radiolabeled monoclonal antibody approved by the FDA for the treatment of B-cell non-Hodgkin's lymphomas).
[0539] For treatment of Leukemia, exemplary biologies which may be used in combination with the binding molecules of the invention include Gleevec®; Campath®- IH (alemtuzumab, Berlex Laboratories, Richmond, CA; a type of monoclonal antibody used in the treatment of chronic Lymphocytic leukemia). In addition, Genasense (oblimersen, Genta Corporation, Berkley Heights, NJ; a BCL-2 antisense therapy under development to treat leukemia may be used (e.g., alone or in combination with one or more chemotherapy drugs, such as fludarabine and cyclophosphamide) may be administered with the claimed binding molecules.
[0540] For the treatment of lung cancer, exemplary biologies include Tarceva™ (erlotinib
HCL, OSI Pharmaceuticals Inc., Melville, NY; a small molecule designed to target the human epidermal growth factor receptor 1 (HERl) pathway).
[0541] For the treatment of multiple myeloma, exemplary biologies include Velcade®
Velcade (bortezomib, Millennium Pharmaceuticals, Cambridge MA; a proteasome inhibitor). Additional biologies include Thalidomid® (thalidomide, Clegene Corporation, Warren, NJ; an immunomodulatory agent and appears to have multiple actions, including the ability to inhibit the growth and survival of myeloma cells and anti-angiogenesis).
[0542] Other exemplary biologies include the MOAB EMC-C225, developed by ImClone
Systems, Inc., New York, NY.
[0543] As previously discussed, IGF-lR-specific antibodies or immunospeciflc fragments thereof of the present invention, or recombinants thereof may be administered in a pharmaceutically effective amount for the in vivo treatment of mammalian . hyperproliferative disorders, hi this regard, it will be appreciated that the disclosed antibodies will be formulated so as to facilitate administration and promote stability of the active agent. Preferably, pharmaceutical compositions in accordance with the present invention comprise a pharmaceutically acceptable, non-toxic, sterile carrier such as physiological saline, non-toxic buffers, preservatives and the like. For the purposes of the instant application, a pharmaceutically effective amount of IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention, or recombinant thereof, conjugated or unconjugated to a therapeutic agent, shall be held to mean an amount sufficient to achieve effective binding to a target and to achieve a benefit, e.g., to ameliorate symptoms of a disease or disorder or to detect a substance or a cell. In the case of tumor cells, the binding molecule will be preferably be capable of interacting with selected immunoreactive antigens on neoplastic or immunoreactive cells, or on non neoplastic cells, e.g., vascular cells associated with neoplastic cells, and provide for an increase in the death of those cells. Of course, the pharmaceutical compositions of the present invention may be administered in single or multiple doses to provide for a pharmaceutically effective amount of the binding molecule.
[0544] In keeping with the scope of the present disclosure, IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention may be administered to a human or other animal in accordance with the aforementioned methods of treatment in an amount sufficient to produce a therapeutic or prophylactic effect. The IGF-lR-specific antibodies or immunospecific fragments thereof of the present invention can be administered to such human or other animal in a conventional dosage form prepared by combining the antibody of the invention with a conventional pharmaceutically acceptable carrier or diluent according to known techniques. It will be recognized by one of skill in the art that the form and character of the pharmaceutically acceptable carrier or diluent is dictated by the amount of active ingredient with which it is to be combined, the route of administration and other well-known variables. Those skilled in the art will further appreciate that a cocktail comprising one or more species of binding molecules according to the present invention may prove to be particularly effective.
[0545] The practice of the present invention will employ, unless otherwise indicated, conventional techniques of cell biology, cell culture, molecular biology, transgenic biology, microbiology, recombinant DNA, and immunology, which are within the skill of the art. Such techniques are explained fully in the literature. See, for example, Molecular Cloning A Laboratory Manual, 2nd Ed., Sambrook et al., ed., Cold Spring Harbor Laboratory Press: (1989); Molecular Cloning: A Laboratory Manual, Sambrook et al., ed., Cold Springs Harbor Laboratory, New York (1992), DNA Cloning, D. N. Glover ed., Volumes I and II (1985); Oligonucleotide Synthesis, M. J. Gait ed., (1984); Mullis et al. U.S. Pat. No: 4,683,195; Nucleic Acid Hybridization, B. D. Hames & S. J. Higgins eds. (1984); Transcription And Translation, B. D. Hames & S. J. Higgins eds. (1984); Culture Of Animal Cells, R. I. Freshney, Alan R. Liss, Inc., (1987); Immobilized Cells And Enzymes, IRL Press, (1986); B. Perbal, A Practical Guide To Molecular Cloning (1984); the treatise, Methods In Enzymology, Academic Press, Inc., N. Y.; Gene Transfer Vectors For Mammalian Cells, J. H. Miller and M. P. Calos eds., Cold Spring Harbor Laboratory (1987); Methods In Enzymology, VoIs. 154 and 155 (Wu et al. eds.); Immunochemical
Methods In Cell And Molecular Biology, Mayer and Walker, eds., Academic Press, London (1987); Handbook Of Experimental Immunology, Volumes I- IV, D. M. Weir and C. C. Blackwell, eds., (1986); Manipulating the Mouse Embryo, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N. Y., (1986); and in Ausubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Maryland (1989).
[0546] General principles of antibody engineering are set forth in Antibody Engineering,
2nd edition, C.A.K. Borrebaeck, Ed., Oxford Univ. Press (1995). General principles of protein engineering are set forth in Protein Engineering, A Practical Approach, Rickwood, D., et al, Eds., IRL Press at Oxford Univ. Press, Oxford, Eng. (1995). General principles of antibodies and antibody-hapten binding are set forth in: Nisonoff, A., Molecular Immunology, 2nd ed., Sinauer Associates, Sunderland, MA (1984); and Steward, M.W., Antibodies, Their Structure and Function, Chapman and Hall, New York, NY (1984). Additionally, standard methods in immunology known in the art and not specifically described are generally followed as in Current Protocols in Immunology, John Wiley & Sons, New York; Stites et al. (eds) , Basic and Clinical -Immunology (8th ed.), Appleton & Lange, Norwalk, CT (1994) and Mishell and Shiigi (eds), Selected Methods in Cellular Immunology, W.H. Freeman and Co., New York (1980).
[0547] Standard reference works setting forth general principles of immunology include
Current Protocols in Immunology, John Wiley & Sons, New York; Klein, J., Immunology/ The Science of Self-Nonself Discrimination, John Wiley & Sons, New York (1982); Kennett, R., et al., eds., Monoclonal Antibodies, Hybridoma: A New Dimension in Biological Analyses, Plenum Press, New York (1980); Campbell, A., "Monoclonal Antibody Technology" in Burden, R., et al. , eds., Laboratory Techniques in Biochemistry and Molecular Biology, Vol. 13, Elsevere, Amsterdam (1984), Kuby Immunology 4th ed. Ed. Richard A. Goldsby, Thomas J. Kindt and Barbara A. Osborne, H. Freemand & Co. (2000); Roitt, L, Brostoff, J. and Male D., Immunology 6th ed. London: Mosby (2001); Abbas A., Abul, A. and Lichtman, A., Cellular and Molecular Immunology Ed. 5, Elsevier Health Sciences Division (2005); Kontermann and Dubel, Antibody Engineering, Springer Verlan (2001); Sambrook and Russell, Molecular Cloning: A Laboratory Manual. Cold Spring Harbor Press (2001); Lewin, Genes VIII, Prentice Hall (2003); Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Press (1988); Dieffenbach and Dveksler, PCR Primer Cold Spring Harbor Press (2003).
[0548] All of the references cited above, as well as all references cited herein, are incorporated herein by reference in their entireties. Examples
Example 1
Selection of IGF-IR specific Fabs from Phage libraries
[05491 Recombinant human IGF-IR ectodomain was used to screen a human naϊve phagemid Fab library containing 3.5 x 10 unique clones (Hoet, R.M., et al. Nat Biotechnol. 23(3):3Λ4-S (2005), ("Hoet et al.") which is incorporated herein by reference in its entirety). Two distinct panning arms were followed using biotinylated IGFlR-his and IGFlR-Fc protein. Proteins were captured on steptavidin-coated magnetic beads prior to incubation with the phage library. In the case of IGFlR-Fc, a biotinylated anti-Fc antibody was captured on the magnetic beads, followed by captured of the Fc fusion protein. Selections were performed as described in Hoet et al. After 3 rounds of panning, the 479 bp gene III stump was removed by MIuI digestion, and the vector was religated for soluble Fab expression in TGl cells. ELISA analysis of 920 clones from the biotinylated IGFlR-his arm yielded 593 positive clones, containing 33 unique sequences. ELISA analysis of 920 clones from the IGFlR-Fc arm yielded 163 positive clones, containing 12 unique sequences. Sequence analysis of all clones determined 12 clones were isolated in both arms of the panning strategy. Unique clones were purified and binding was reconfirmed to recombinant human IGF-IR ectodomain by ELISA as well as 3T3 cells stably transfected with full-length human IGF-IR (Figure IA & IB). Based on binding data, 6 of the 12 unique clones isolated in both arms were selected for further analysis.
Example 2
Binding activity of Fabs to IGF-IR expressed on tumor cells.
[05501 The ability of Fabs to bind to the wild type IGF-IR was determined by flowcytometry using MCF-7 tumor cell line.
[0551] MCF-7 cells (Human Breast Adenocarcinoma from NCI) were split 24 hours prior to the setup of the assay to obtain 70% confluent monolayer. Routinely, MCF-7 cell line was maintained within 20 passages. Cells were lifted with cell dissociation buffer (Gibco catalog #13151-014), counted, washed and adjusted to IxIO6 cells/ml and one ml of cells were then added to each tube (12x75mm tube Falcon catalog# 352054). Cells were pelleted and supernatant removed by centrifugation at 1200rpm for 5min and lOOμl of diluted antibodies were then added to the cell pellet. Purified Fabs were tested at a starting concentration of either 210 or 60μg/ml with 1 :3 dilutions in FACS buffer, down to 0.001 μg/ml. FACS buffer used throughout the assay was PBS (without Ca-H-ZMg++) containing 1% BSA (Sigma catalog# A-7906) and 0.1% Sodium Azide (Sigma catalog #S2002). As a positive control IR3 a murine antibody (Ab-I; Calbiochem #GR1 IL) was used. Samples were allowed to incubate on ice for lhour and 15 minutes then were washed with 2ml FACS buffer and centrifuged at 1200rpm for 5 minutes at 4°C. The supernatant was aspirated and lOOμl of the secondary detection antibody was added to each corresponding tube in FACS buffer. Samples were then incubated for 30minutes on ice, in the dark. Cells were washed as described above, then, re-suspended in 250μl FACS buffer per tube/sample.
[0552] Cell bound Fabs were detected using FITC-conjugated affinity-purified F(ab')2
Fragment specific goat anti-human-IgG (Jackson ImmunoResearch Lab catalog #109- 096-006; use at 5μg/ml), while positive murine control antibody was detected using the F(ab')2 FITC conjugated goat anti-mouse IgG (H + L) (Jackson ImmunoResearch, catalog# 115-096-062; used at 5 μg/ml). Cells were stained for live cell determination with Propidium Iodide staining solution (PI for dead cell exclusion; BD Pharmingen catalog# 51-6621 IE or 556463; use at 1:500 final in FACS buffer). Samples were run on the FACSCalibur instrument (Becton Dickinson) with 10,000 live events collected per sample. Data analysis was done using GraphPad Prism version 4.0 software (yvww.graphpad.com) (GraphPad Software, Inc., 11452 El Camino Real,, #215, San Diego, CA 92130 USA).
[0553] Once samples have been run and geometric means determined, antibody concentration (X axis) vs. geometric mean (Y axis) was graphed to the loglO, using Graphpad Prism (Prism Graph) graphing program. Data sets were then transformed (X value data set = antibody concentration) to X= Log(X) and graphed using a nonlinear regression curve fit, Sigmoidal dose-response. EC50 values and R2 values were generated using the Prism Graph software.
[0554] All 6 Fabs showed good binding activity to wild type IGF-IR expressed on MCF-
7 tumor cells (Figure 2). The EC50 of binding ranged between 9 to 42 nM (Table 3). Example 3
Inhibition of ligand binding to IGF-IR by Fabs.
[0555] The ability of Fabs to block the binding of IGF-I and IGF-2 ligands to IGF-IR was determined using a radioimmunoassay (RIA).
[0556] Ligand blocking assay (RIA). Recombinant human IGF-I (Cat #291 -Gl), IGF-2
(Cat #292-G2), insulin (Cat # Custom02) human Insulin Receptor (Cat #1544-1R) were purchased from R&D Systems, Inc., Minneapolis, MN. Insulin (Arg-Insulin, Cat #01- 207) was purchased from Upstate Cell Signaling Solutions (Lake Placid, NY (now part of Millipore, Concord, MA (USA)). 125I-rhIGF-l (Cat # IM172), 125I-rhIGF-2 (Cat# IM238) and l25I-rhInsulin (Cat# IMl 66) were purchased from Amersham Biosciences (Piscataway, NJ). AffiPure goat anti-human IgG, Fcγ fragment specific antibodies (Cat #109-005-098, Jackson IrnmunoResearch, West Grove, PA) was used for IGF-IR-Fc capture. As detection antibody, goat anti-mouse IgG HRP (Cat #1030-05, Southern Biotech Birmingham, AL) was used.
[0557] As positive controls for IGF-I and IGF-2 blocking, ffi.3 (Ab-I, Cat. #GR11LSP5,
Calbiochem, La Jolla, CA) and 1H7 (Mouse Monoclonal specific to IGF-IR α-chain, sc- 461, IgGi Santa Cruz Biotechnology, Santa Cruz, CA) were used respectively. Human insulin receptor α-subunit specific antibodies, Clone 83-14, (Cat #AHR0221, Biosource International, Inc., Camarillo, CA) and the 47-9 (Cat #E55502M, Biodesign International, Saco, ME) were used as positive controls blocking of insulin-insulin receptor binding experiments. Recombinant IGF-IR-Fc fusion protein was produced at Biogen Idee (Cambridge, MA).
[0558] As isotype matched mouse negative control antibodies, 2B8 (murine α-
CD20.IgGi) and 2B8 mkm.G2a (murine α-CD20 MAb, IgG23, Biogen Idee, Lot #NB3304-87, San Diego, CA) were used. The negative control for Fabs was ROOl-IB provided by Christilyn Graff (Biogen Idee, Cambridge, MA). PBS used in buffers was from BioWhittaker (Cat. # 17-513F, Walkersville, MD).
[0559] Recombinant human IGF-IR (Histidine tagged version) or IGF-IR-Fc was coated onto IMMULON2 HB (high binding) Removawell strips (Dynex Technologies, Inc., cat. #6302) diluted with carbonate coating buffer pH 9.5 to a concentration of 250 ng/well. After overnight incubation at 4°C, the wells were washed three times with washing buffer (0.05% Tween 20/ PBS) then blocked with blocking buffer (3% BSA/ PBS) for one hour at room temperature. The blocking buffer was removed and the wells washed three more times. Antibody, Fab, or ligand preparations were diluted to desired concentration with dilution buffer (1% BSA/0.05% Tween 20/ PBS) and plated at 50μl per well in duplicate. After 45 minutes at room temperature, 100,000 cpm of either [1251] rhIGF-1 or [1251] rhIGF-2 in 50 μl dilution buffer was added per well. This was incubated at room temperature for one more hour. The wells were washed again three more times and left liquid free after the last wash. The air-dried wells were counted with the Isodata Gamma Counter.
[0560] Alternatively, Fabs were evaluated by a modified capture assay, where the IGF-
IR-Fc was captured using anti-human IgG immobilized to a plate. Immobilization was carried out by overnight incubation of goat anti-human IgG, Fcγ fragment specific antibody (200 ng/well) in carbonate coating buffer. The wells were washed, blocked and 250 ng of IGF-IR-Fc was added per well.
[0561] The ability of 6 different Fabs to block the binding of IGF-I or IGF-2, or both ligands is shown in Table 3. The top 6 Fabs with different blocking activity were selected for further analysis.
Example 4
Fabs inhibited IGF-I and IGF-2 mediated IGF-IR phosphorylation.
[0562] Cell lines: IGFlR expressing human breast carcinoma cell line MCF-7 (NCI) were maintained at 37°C and 5% CO2 in MEM eagle (ATCC) containing 10% FBS, IX non-essential amino acids, 2mM L-glutamine, ImM sodium pyruvate and 1000U/ml penicillin and streptomycin. Cells were sub-cultured twice weekly for maintenance and assay, and used with a maximum of 12 passages.
[0563] MCF-7 cells were plated in 2ml growth media at 2 X 105 to 4.0 X lO5 cells/well in
Ploy-D-Lysine coated 12 well plates (BD Biosciences, #35-6470) and cultured at 37°C, 5% CO2. At 48 hours, media removed and cells serum starved overnight at 37°C, 5% CO2. Serum free media was removed and control or test antibodies at indicated concentration were added in 350ul of fresh serum free media and incubated for 1 hour at room temperature, or alternately at 37°C. Fabs were tested at 20OnM, 2OnM and 2nM concentration and the mAbs were tested at 67, 6.7 and 0.67 nM. The commercial anti- IGF-IR control antibody used was αIR3 (EMD biosciences, Oncogene Research products, #D27249). Human recombinant IGF-I at 13nM or IGF-2 at 27nM (R & D Systems, #291-G1, #292-G2) added to wells in 35ul serum free media and incubated at 37°C for 15 minutes. Ligand was incubated at room temperature for 37°C antibody experiments. Cells were Iysed in IX cell lysis buffer (Cell Signal technologies, #9803) with ImM PMSF for 1 hour at room temperature.
[0564] Cell lysates were added to ELISA plates pre-coated with IGF-I Rp antibody
(Clone 1-2, Biosource International, #AHR0361) and incubated for 2 hours. Following which plates were washed and the plate bound phosphorylated receptor was detected with the biotin labeled anti-phosphotyrosine antibody 4G10 (Catalog #16-103, Upstate Cell Signaling Solutions (Lake Placid, NY (now part of Millipore, Concord, MA (USA)) and streptavidin-HRP (BD Pharmingen, #554066). Assay is developed by addition of TMB substrate (Kierkegaard & Perry, #50-76-00) and color stopped by addition of 4N H2SCV-4 (LabChem,Cat#LC25830-l). Optical density is measured at 450nm using a Molecular Devices plate reader and percent inhibition over the ligand control is calculated for each antibody-ligand sample.
[0565] Table 3 summarizes the inhibition of IGF-I and IGF-2 mediated phosphorylation of IGF-IR in MCF-7 cells by Fabs. A total of 16 IGF-IR Fabs were screened for inhibition of receptor phosphorylation by ELISA. Nine antibodies showed positive response of "+" or better at a concentration of 200 nM against IGF-I, IGF-2 or both. These antibodies were selected for scale up quantities and tested again for dose dependent inhibitory response. Based on the ability to inhibit ligand binding and receptor phosphorylation, four Fabs were selected as lead candidates for full-length antibody conversion (see, Example 6).
[0566] Figure 3 (A & B), shows the Inhibition of IGF-IR phosphorylation of the scaled up material of the top 6 IGF-IR Fabs.
Example 5
Antibody Binding Specificities and Affinities for IGF-IR versus INSR
[0567] Part I: Analysis of antibody binding to soluble IGF-IR versus soluble INSR using Enzyme-Linked Immunosorbent Assays (ELISA) [0568] ELISA assays were performed to determine specific binding of the Fab fragment antibodies to soluble IGF-IR over the insulin receptor. Plates were coated with lOug/ml of rh-IGF-lR (R & D Systems, #305-GR) or rh-INSR (R & D Systems, #1544-IR) overnight and blocked with 5% milk. The antibodies were added at a range of 2μM — 0.2nM for Fabs or 667 — 0.067nM for murine MAbs in a 1:10 serial dilution and incubated 1 hour at room temperature. Bound antibody was detected with HRPO labeled goat α-human kappa (Southern Biotechnology Associates, #2060-05) for Fabs and goat α-mouse IgG Fcγ (Jackson Immunoresearch, # 115-035-164) for murine MAbs. Color development was stopped by addition of 4N H2SO4 and optical density is measured at 450nm using a Molecular Devices plate reader and binding curves are generated.
[0569J IGF-IR Fabs showed no specific binding to soluble insulin receptor at any concentration (Table 3) while, as expected they showed good binding to IGF-IR-Fc.
[0570] Figure 4 (A & B) illustrates the representative binding curves obtained with Fabs
M14-B01, M14-C03 and M12-G04. Similar binding patterns were observed for M13- C06, M14-G11 and M12-E01 (data not shown).
[0571] Part II: Analysis of antibody binding to soluble IGF-IR versus soluble INSR using Surface Plasmon Resonance (SPR) and time-resolved Fuorescence Resonance Energy Transfer (tr-FRET)
[0572] Binding affinities of M13-C06, M14-C03, and M14-G11 antibodies to soluble human IGF-IR and insulin receptor ectodomains were compared using surface plasmon resonance (Biacore) and time-resolved fluorescence resonance energy transfer (tr-FRET); further demonstrating that M13-C06 antibody does not exhibit significant cross-reactivity with insulin receptor, murine IGF-IR, or a truncated version of human IGF-IR (i.e., hIGF-lR amino acid residues 1-462 containing only the first and second leucine rich repeat domains as well as the cysteine rich repeat domain, but lacking IGF-lR's three fibronectin type in domains).
[0573] Surface Plasmon Resonance (SPR) Analyses
[0574] SPR analyses were performed using a Biacore3000. The instrument was set to
25°C and assays performed with running buffer HBS-EP pH 7.2 purchased from Biacore (Biacore, Cat. No. BR-1001-88). The fully human antibodies, M13-C06, M14-C03, and M 14-Gl 1 were immobilized to ~10,000 RU on Biacore CM5 Research Grade SensorChip surfaces using the standard NHS/EDC-amine reactive chemistry according to protocols supplied by Biacore. For immobilization, the antibodies were diluted to 40 μg/mL in a 10 mM Acetate pH 4.0 buffer. To investigate the relative kinetics of association and dissociation of the full-length ectodomains of human IGF-lR(l-902)-Hisi0 (hlGF-lR- Hisio (R&D systems)) and human INSR(28-956)-Hisi0 (INSR (R&D systems)) to each of the human antibodies, increasing concentrations of hIGF-lR-Hisio or INSR were injected over the sensorchip surfaces. The hIGF-lR-Hisio concentration series ranged from 1.0 nM to 250 nM while the INSR concentrations ranged from 1.0 nM to 2 μM. All antibody surfaces were reliably regenerated with 100 mM Glycine, pH 2.0. Repeated regenerations did not lead to activity losses for any of the antibody surfaces. Flow rates were 20 μl/min. ("Hisio" denotes a 10-residue histidine tag on the C-terminus of the constructs.) [0575] Time-resolved fluorescence resonance energy transfer (tr-FRET) assay
[0576] MGF-IR-Hisio and M13-C06 were covalently conjugated to Cy5 and a Europium chelate, respectively, using standard NHS chemistry according to the dye manufacturer's protocols. Serial dilutions of several unlabeled soluble ectodomain receptor competitors, (1) hIGF-lR-Hisio, (2) human IGF-lR(l-903)-FlagHis10 (hIGF-lR-FlagHis10, Biogen Idee), (3) human IGF-IR(I -903)-Fc (hIGF-lR-Fc, Biogen Idee), (4) human IGF-IR(I- 462)-Fc (hIGF-lR(l-462)-Fc, Biogen Idee), (5) murine IGF-1R(1-9O3)-Fc (mIGF-lR-Fc, Biogen Idee) or (6) INSR, starting at 6.25 μg (50 μl of 125 μg/ml stock solution) were mixed with 0.1 μg hIGFlR-Hislo-Cy5 (25 μl of 4 μg/ml stock solution) and 0.075 μg Eu- C06 (25 μl of 3 μg/ml stock solution) in 96-well microliter plates (black from Costar). The conjugation levels for hIGF-lR-HiS]0-Cy5 were 6.8:1 (Cy5:IGF-lR-Hisi0), and for Eu-C06 were 10.3:1 (Eu:C06) as determined by the absorbance of each dye with respect to the protein concentration. The total volume was 100 μl for each sample. Plates were incubated for 1 hr at room temperature on a plate agitator. Fluorescence measurements were carried out on a Wallac Victor2 fluorescent plate reader (Perkin Elmer) using the LANCE protocol with the excitation wavelength at 340 run and emission wavelength at 665 nm. All constructs were sampled with at least two replicates.
[0577] All Biogen Idee derived soluble IGF-IR receptor ectodomain constructs were subcloned into Biogen Idee PV-90 vectors for CHO expression using described methodology (Brezinsky et ah, 2003). Each receptor containing a C-terminal IgG-Fc tag was affinity purified using a single protein A SEPHAROSE FF™ (GE Heathcare) step as described previously. hIGF-lR-FlagHisio was purified using Ni2+-agarose (Qiagen) as described previously (Demarest et al., 2006). Results:
[0578] The fully human anti-IGF-lR antibodies, M13-C06, M14-C03, and M14-G11, were evaluated for their comparative binding activities towards soluble IGF-IR and INSR ectodomain constructs using surface plasmon resonance (SPR). hIGF-lR-Hisio and INSR were injected over immobilized antibody surfaces using identical protocols. hlGF-lR- Hisio demonstrated binding to all three anti-IGF-lR antibodies even at the lowest concentration, 0.5 nM (data not shown: concentrations ranged from 1 to 250 nM and the receptor injection phase was 400-2200 seconds followed by a buffer dissociation phase and subsequent regeneration with glycine, pH 2.0). hIGF-lR-Hisio binding was strongest for the M13-C06 surface. In contrast, INSR demonstrated little activity towards the M13- C06 surface even at a concentration as high as 2 μM receptor (>1000 higher than what was observed for IGF-IR binding (data not shown: concentrations ranged from 1.0 nM to 2 μM and the receptor injection phase was 500-1000 seconds followed by a buffer dissociation phase). The M14-C03 and M14-G11 surfaces also demonstrated little binding activity towards INSR.
[0579] Next, the affinities of various recombinant IGF-IR and INSR constructs for Ml 3-
C06 were determined using a competition-based tr-FRET assay. Best fit binding curves for all recombinant receptor constructs (described below) were determined (data not shown). All data were fitted to a one-site binding model from which the corresponding IC50 values were determined. The three full-length human IGF-IR ectodomain constructs (hIGF-lR-Fc, hIGF-lR-Hisio, and hlGF-lR-FlagHisio) all competed in a concentration dependent manner with IC50 values of 2.9, 2.0, 5.2 μg/ml, respectively. The truncated human IGF- IR(I -462)-Fc construct, the full-length mouse IGF-IR-Fc construct, and the full-length human INSR-Hisio construct did not inhibit Cy5-labeled hIGF-lR-Hisio at concentrations 100-fold above the IC50 of the recombinant full-length human IGF-IR constructs, suggesting these former constructs do not exhibit significant binding reactivity for M13-C06 compared to the latter full-length human IGF-IR.
[0580] Part III: Relative binding affinity of M13-C06 antibody for soluble human versus murine IGF-IR.
[0581] The relative binding affinity of M13-C06 for murine versus human IGF-IR were compared. Surface plasmon resonance (SPR) was used to determine the affinity of Ml 3- C06 for murine IGF-IR Fc and human IGF-IR Fc. Experiments were performed on a Biacore 3000 set to 25°C using HBS-EP (Biacore, Cat. No. BR-1001-88) as the running buffer. An anti-human IgG-Fc antibody (2Cl 1 from Biogenesis, Cat. No. 5218-9850) was immobilized to saturation on a Biacore CM5 chip (Cat. No. BR-1000-14) surface by injection at 500 nM in HBS-EP buffer. mIGF-lR-Fc or hlGF-lR-Fc was captured on the chip surface by injecting 40μL of 2OnM receptor at 3μL/min. Following capture of receptor, 40μL of M13-C06 Fab was injected at 3μL/min. Dissociation of Fab was measured for ~27 minutes. Fab was serially diluted from 25 to 0.4 nM to obtain concentration dependent kinetic binding curves. Regeneration of the surface chip between each injection series was performed using 3x1 OμL injections of 100 mM glycine pH 2.0 at 60μL/min. Each curve was double referenced using (1) data obtained from a CM5 chip surface devoid of the anti-IgG antibody 2Cl 1 and (2) data from a primary injection of receptor followed by a secondary injection of HBS-EP buffer. The concentration series of M13-C06 Fab for each receptor was fit to the 1:1 binding model provided within the BiaEvaluation software of the manufacturer. To obtain the kj of M13-C06 binding to mIGF-lR-Fc, the experiment was repeated with M13-C06 Fab at 25 nM and mIGF- IR-Fc at 20 nM with the only change in the original protocol being an extension of the dissociation period to three hours.
Results: M13-C06 Fab was applied to Biacore surfaces containing MGF- IR-Fc or mlGF-
IR-Fc to determine the relative affinity of the antibody to the two species of receptor. The presence of the C-terminal IgGl-Fc tag results in additional multimerization of the IGF-IR-Fc receptor constructs (data not shown); therefore, the binding model fits provide a measure of the relative or apparent affinities of M13-C06 for each receptor. The affinity of M13-C06 Fab for human and murine IGF-IR Fc was found to be 0.978 nM and 89.1 nM, respectively. The 100-fold decrease in binding to murine IGF-IR is readily apparent when comparing Figure 27 A & B, which display the association and dissociation curves, kinetic rate constants, and equilibrium dissociation constants. Figure 27A shows the concentration dependent binding characteristics of M13-C06 Fab for human IGF-IR (ka (I/Ms) = 8.52e5 M'1 s"1; kd (1/s) = 8.33e-4 s"1; and, KD = 9.78e-10 M). Figure 27B shows the slow association and dissociation binding characteristics of Ml 3- C06 for mIGF-lR-Fc (ka (I/Ms) = 471 M"1 s"1; ka (1/s) = 4.20e-5 s"1; KD = 8.91e-8 M). Due to the extremely slow dissociation of M13-C06 Fab from mIGF- IR-Fc, the kinetic dissociation rate constant, kj, could not be determined using the initial data set. A second experiment was performed using a 3 hr dissociation period to obtain the dissociation rate constant, k<j of 4.20e-5 s"1, which was used to obtain the equilibrium dissociation constant, KD, (described above) from the original dataset. The presence of the C-terminal IgGl-Fc tag results in additional multimerization of the IGF-IR-Fc receptor constructs (data not shown); therefore, the binding model fits provide a measure of the relative or apparent affinities of M13-C06 for each receptor.
[0583] Part IV: M13-C06 full-length antibody specifically binds IGF-IR but not
INSR expressed in mammalian cells.
[0584] Recombinant IGF-IR and insulin receptor (IR) were independently expressed in mammalian cells (3T3 or CHO). Cells were solubilized with 1% Triton X-100 and the receptor was immunoprecipitated with protein-A/G beads coupled to a negative control antibody (IDEC-151), M13.C06.G4.P.agly antibody (C06), M14-G1 l.G4.P.agly antibody (Gl 1), or an INSR antibody (α-IR). Antibody/antigen complexes were released from the beads by acid treatment, applied to Tris-Glycine SDS-PAGE gels and blotted to nitrocellulose membranes. Detection was performed using mouse anti-human IR (Figure 26A) or mouse anti-human IGF-IR (Figure 26B) and goat α-mouse IgG. Results: M13.C06.G4.P.agly antibody binds to IGF-IR but not to INSR expressed in mammalian cells.
Example 6:
Construction of full-length anti-IGF-lRIgGs
[0585] Four Fabs were converted to IgG4.P.agly version and expressed in CHO cells.
DNA sequences encoding four distinct anti-IGF-lR Fabs- M13-C06 (Figures 5 (A)-(D)), M14-C03 (Figures 5(E)-(H)), M14-G11 (Figures 5(I)-(L)), and M14-B01 (Figures 5(M)-(P)) were selected from a human antibody phage library (Dyax Corp) by biopanning against a recombinant human IGF-IR ectodomain-Fc fusion protein. Each of the four anti-IGF-lR Fabs contained theVH3-23 human heavy chain germline framework and were kappa light chains. The Fab gene sequences were used to construct expression plasmids encoding full-length anti-IGF-Rl antibodies using the pV90AS expression vector system for antibody production in mammalian cells. pV90AS is a modified pV90 expression vector designed to generate two transcripts from a single promoter through alternate splicing of a primary transcript (Reference: USPTO Application WO2005/089285). The natural CMV splice donor is spliced either to a partially impaired splice acceptor to generate an antibody light chain-encoding transcript, or to a natural GMV splice acceptor to generate the antibody heavy chain-coding transcript. The partially impaired splice acceptor has been engineered to result in similar amounts of both heavy and light chain transcripts. Light chain Variable (VL) and Constant (CL) regions (SEQ ID NOs: 153 andl54, Figure 5(Y)-(Z)) of each anti-IGF-lR Fab (M13-C06; M14- C03; M14-G11 and M14-B01) were amplified by PCR. (Table 7). The 5' light chain PCR primer IGFlR-FK included a Sfi I restriction endonuclease site followed by sequence encoding an immunoglobulin light chain signal peptide MDMRVPAQLLGLLLLWLPGARC (SEQ ID NO: 157) in frame to sequences corresponding to the amino-terminus of the VL region according to the methods described in Nakamura T, et ah, Int J Immunopharmacol. 22:131-41 (2000), which is incorporated herein by reference in its entirety. All four of the mature IGFlR light chain sequences had identical amino-termini. The 3f light chain PCR primer IGFlR-RK included sequence corresponding to the carboxyl-terminus of the CL region and an Asc I site. The PCR product was purified by agarose gel electrophoresis and extraction using the QIAquick GelExtration kit protocol (QIAGEN CA), digested with restriction endonucleases Sfi I and Asc I and ligated with the Sfi I/ Asc I digested pHLP025 vector (Holly Prentice). The pHLP025 vector contains Sfi I/ Asc I restriction endonuclease sites for receiving antibody light chain (signal peptide- VL-CL) as a Sfi I/Asc I digested PCR fragment in addition to the natural CMV splice donor site sequence, a partially impaired splice acceptor site sequence, and a poly A signal sequence (Reference: USPTO Application WO2005/089285). The heavy chain Variable (VH) region of each anti-IGF-lR Fab (M13-C06; M14-
C03; M14-G11 and M14-B01) was amplified by PCR. The 5' heavy chain VH PCR primer IGFlR-FH included a Nco I restriction endonuclease site followed by sequence encoding synthetic heavy chain signal peptide MGWSLILLFLVAVATRVLS (SEQ ID NO: 122)) in frame to sequences corresponding to the amino-terminus of the VH region as described above. The 3' heavy chain VH PCR primer IGFlR-RH included sequence corresponding to the carboxyl-terminus of the VH region and an Sfi I site. The PCR product was purified by agarose gel electrophoresis and extraction using the QIAquick GelExtration kit protocol (QIAGEN, CA), digested with restriction endonucleases Nco I and Sfi I and ligated with the Nco I/ Sfi I digested pHLP029 vector (Holly Prentice). The pHLP029 vector contains Nco I/ Sfi I sites for receiving the antibody signal peptide- VH sequence as a Nco I/ Sfi I digested PCR fragment in addition to an upstream poly A signal sequence, a natural CMV splice acceptor site sequence, and a downstream poly A signal sequence (Reference: USPTO Application WO2005/089285).
[0587] The gene sequences coding for (Sfi I site- light chain signal peptide- anti-IGF-lR
VL and CL) in pHLP025 and (heavy chain signal peptide- anti-IGF-lR VH- Sfi I site) in pHLP029 were assembled into a single DNA fragment by PCR amplification through common overlapping sequences present in both vectors using the 5' light chain IGFlR- FK and 3' heavy chain VH IGFlR-RH PCR primers described above. The resulting PCR product was purified by agarose gel electrophoresis and extraction using the QIAquick GelExtration kit protocol (QIAGEN, CA), digested with restriction endonuclease Sfi I and Iigated with the Dra III digested pXWU007 vector. Briefly, pXWU007 was first constructed by subcloning an Age I/ BamHI human IgG4 constant region fragment containing a S228P mutation in the IgG4 hinge region and a T299A mutation in the CH2 domain, EU numbering system (Kabat, E, Wu, TT, Perry, HM, Gottesman, KS, Foeller, C: Sequences of Proteins of Immunological Interest. Bethesda, US Department of Health and Human Services, NIH, 1991) (SEQ ID NOs:155 and 156, Figure 5 (AA)- (BB)) from plasmid pEAG1808 (provided by Ellen Garber) into Age I/ BamHI digested pHLP028 vector. pHLP028 is a pV90 IgG4 vector modified to contain a Dra HI site for receiving the single Sfi I-digested PCR product described above (Reference: USPTO Application WO2005/089285).
[0588] The resulting plasmid produces a bi-cistronic precursor transcript that upon alternative splicing results in translationally active antibody heavy and light chain mRNAs in approximately stoichiometric quantities. Intermediate and expression vectors for producing full— length aglycosylated human anti-IGF-lR IgG4.P antibodies are shown in Table 8. Correct sequences were confirmed by DNA sequence analysis. Expression of full-length antibodies from plasmids pXWU020, pXWU022, pXWU024, and pXWU025 in mammalian cells results in production of stable, aglycosylated human IgG4.P antibodies.
Table 7. Oligonucleotides for PCR amplification of human antibody domains.
Forward 5' light chain PCR primer includes a Sfi I restriction endonuclease site (underlined) and sequence encoding the light chain signal peptide;
Reverse 3' light chain PCR primer includes an Asc I site (underlined).
Forward 5' heavy chain variable PCR primer includes a Nco I restriction endonuclease site (underlined) and sequence encoding the heavy chain signal peptide. Reverse 3' heavy chain variable PCR primer includes an SiI I site (underlined).
Table 8. Intermediate and expression plasmids encoding anti-IGF-lR antibodies.
Example 7
Construction of full-length anti-IGF-lR IgGs for improved expression in mammalian cells.
[0589] To improve antibody expression yields and product quality the original VH gene sequences from anti-IGF-lR Fabs M13-C06, M14-C03, M14-G11, and M14-B01 were modified. First, anti-IGF-lR VH sequences were analyzed for sequences containing putative splice sites with public sequence recognition programs (www.tigr.org/tdb/GeneSplicer/gene spl.html (The Institute for Genomic Research, 9712 Medical Center Drive, Rockville, MD 20850), www.fruitfly.org/seq_tools/splice.html)τ (Martin G. Reese and Frank H. Eeckman, Lawrence Berkeley National Laboratory- Genome Informatics Group, 1 Cyclotron Road, Berkeley, CA, 94720; see also, Reese MG, Eeckman, FH, KuIp, D, Haussler, D, 1997. "Improved Splice Site Detection in Genie". J Comp Biol 4(3), 311-23.). Second, codons in the heavy chain variable region of the anti-IGF-lR Fabs were replaced with codons corresponding to the identical Kabat positions from antibodies that have been successfully expressed in CHO cells without encountering any changes in the original anti-IGF-lR VH polypeptide sequence. This second step mostly removes putative splice sites but an additional splice site analysis followed by synonymous codon exchange was performed to reduce the predicted likelihood of a putative splice site being present.
[0590] DNA fragments encoding synthetic heavy chain leader in frame with sequence- optimized VH sequences of anti-IGF-lR Fabs- M13-C06 (SEQ ID NO: 18, Figure 5(Q)), M14-C03 (SEQ ID NO:30, Figure 5(S)), M14-G11 (SEQ ID NO:36, Figure 5(U)), and M14-B01 (SEQ ID NO:24, Figure 5(W)) were obtained as chemically synthesized double-stranded DNA sequences from a commercial provider (Blue Heron Biotechnology, Inc. Bothell WA). The Nco I and Sfi I restriction endonuclease sites at 51 and 3' were included in the synthesized fragments. The leader and anti-IGFlR sequence- optimized VH region fragments were cloned into the Nco I/Sfi I digested the pHLP029 vector as described in Example 6 above. Recombination with the appropriate corresponding light chains in pHLP025 and subsequent cloning of the single fragment into pXWU007 is as described in Example 6 above. Expression constructs producing the sequence-optimized full— length aglycosylated human anti-IGF-lR IgG4.P antibodies are shown in Table 9. Correct sequences were confirmed by DNA sequence analysis. Expression of full-length antibodies from the plasmid series pXWU029-pXWU032 in mammalian cells results in production of stable, aglycosylated human IgG4.P antibodies.
Table 9. Sequence-optimized expression plasmids encoding anti-IGF-lR antibodies. Optimized heavy chain sequences are preceded with an "m".
Example 8
Transient expression and characterization of IGF-IR antibodies.
[0591] Plasmid DNAs were used to transform CHO DG44 cells for transient production of antibody protein. 20μg of plasmid DNA was combined with 4 x 106 cells in a volume of 0.4 mL of IX PBS. The mixture was added to a 0.4 cm cuvette (BioRad) and placed on, ice for 15 min. The cells were electroporated at 600 uF and 350 volts with a Gene Pulser electroporator (BioRad). The cells were placed into a T-25 flask containing CHO-SSFM II media plus lOOuM Hypoxanthine and 16uM Thymidine and incubated at 37° for 4 days. Supernatants were harvested and biochemically characterized by Western Blot and tested for antigen binding by ELISA.
[0592] Alternatively, selected Fabs also converted to full-length human IgG4.P version and expressed using a different vector system by a method described below. DNA sequences encoding five distinct anti-IGFlR Fab antibodies, M12-E01, M12-G04, M13- C06, M14-C03, and M14-G11 were transferred into vectors for expression of full-length human IgG4.P. All five antibodies use the VH3-23 human heavy chain germline fragment. The variable heavy chain was removed from the soluble Fab expression vector by digestion with restriction enzymes Mfel and BstEII. The resulting fragment was purified by agarose gel electrophoresis using the QIAquick Gel Extraction Kit (Qiagen, CA) and ligated into the Mfel/BstEII digested pRR253 vector (Rachel Rennard). The resulting plasmid contains the heavy chain signal peptide (MGWSCIILFLV AT ATGAHS, SEQ ID NO: 127) followed by the anti-IGFIR VH and constant regions for human IgG4.P.
[0593] Four of the five antibodies, M12-G04, M13-C06, M14-C03, and M14-G11, contain kappa light chains. The variable light chain was amplified by PCR with primers to introduce an EcoRV site 5' and a Bsgl 3' to the variable region. The resulting PCR fragment was purified by agarose gel electrophoresis using the QIAquick Gel Extraction Kit (Qiagen, CA) and ligated into TOPO2.1 TA vector (Invitrogen, CA). The variable kappa light chain was removed from the TOPO vector by digestion with restriction enzymes EcoRV and Bsgl and purified. The fragment was ligated into EcoRV/Bsgl digested pRR237 vector, which contains the immunoglobulin light chain signal peptide (MDMRVPAQLLGLLLLWLRGARC, SEQ ID NO: 128) and the constant kappa domain. The resulting vector was digested with BamHI and Notl and the entire expression cassette (signal sequence, variable and constant kappa domains) was purified and ligated into BamHI/Notl digested pRR223.
[0594] The M12-E01 antibody contains a lambda light chain. The variable light chain was amplified by PCR with primers to introduce an Agel site 5' of the variable region. The resulting PCR fragment was purified by agarose gel electrophoresis using the QIAquick Gel Extraction Kit (Qiagen, CA) and ligated into TOPO2.1 TA vector (Invitrogen, CA). The variable lambda light chain was removed from the TOPO vector by digestion with restriction enzymes Agel and Avrll and purified. The fragment was ligated into Agel/Avrll digested pXW347 vector (Xin Wang), which contains the immunoglobulin light chain signal peptide (METDTLLLWVLLLWVPGSTG, SEQ ID NO: 129) and the constant lambda domain. The resulting vector was digested with Notl and the entire expression cassette (signal sequence, variable and constant lambda domains) was purified and ligated into Notl digested pRR223.
[0595] Plasmid DNA was used to transfect 293E cells for transient expression of antibody protein. 1.2 μg of each (heavy and light) plasmid DNA was transfected into 2 x 106 cells with Qiagen' s Effectene Transfection Protocol (Qiagen, CA). Cells were incubated at 37°C for 3 days. Supernatant was harvested and full-length antibody confirmed by both Western Blot and ELISA methods. The ability of full.IgG4.P to bind to IGF-IR was confirmed by ELISA. Example 9
Development of Anti-IGF-1R Antibody Producing CHO Cell Line
[0596] This example gives a detailed description of expression of the anti-IGF-lR antibody comprising the binding domain of the Fab M13-C06 as full-length hinged- modified agly gamma 4, kappa (referred to herein as "agly.IgG4.P" or "G4.P.agly") antibody. The other Fabs described herein, i.e., those listed Table 3, were expressed in a similar manner. The variable and constant regions of M13-C06 are of human sequence origin. The entire light chain and heavy chain variable regions are derived from a Fab generated against human IGF-IR by the DYAX phage display technology. The variable, as well as the light chain constant regions were subcloned into an alternate splice expression vector. The alternate splice configuration links the light and heavy chain through the usage of a single splice donor with two splice acceptors where each splice acceptor generates a transcript encoding one of the two chains. The expression vector DNA encoding the immunoglobulin genes was electroporated into insulin independent Chinese hamster ovary cells (CHO DG44i). A CHO transfectoma (cell line 40B5) was selected for production purposes.
[0597] pXWU007 - an "empty" expression vector contains a human gamma 4 constant region (heavy chain) as well as separate promoter-enhancers and polyadenylation regions for gene expression in mammalian cells, but does not contain variable domains. When expressed and translated the heavy chain polypeptide contains two amino acid substitutions, S228P and T299A, to reduce "half-antibody" formation and eliminate N- linked glycosylation, respectively.
[0598] Complementary DNA from the corresponding variable (VL) and constant (CL) domains of the light chain gene of M13-C06 and the variable (VH) domain of the heavy chain gene of M13-C06 was cloned into the expression vector pXWU007. The pXWU007 vector contains cloning sites for inserting the entire light chain and variable heavy cDNAs directly upstream of the human heavy chain constant region. In addition to the Ig genes, this expression vector contains a dihydrofolate reductase (DHFR) gene that can be used for selection in mammalian cells.
[0599] The resulting expression vector was then transfected into CHO cells to initiate the generation of the anti-IGF-lR secreting CHO cell lines (40B5). [0600] PXWU022 was electroporated into CHO cells. Immunoglobulin light chain specific PCR primers were used to PCR amplify the Fab light chain cDNA. The 5' specific oligo sequence included the native signal peptide from the light chain of the Biogen Idee anti-CD23 molecule. The 5' and 3' oligos contain Sfi I and Asc I restriction endonuclease recognition sequences, respectively, for subcloning into an intermediate vector (pHLP025). The VH cDNA was PCR amplified using a 5' oligo that included a synthetic heavy chain signal peptide. The 5' and 3' oligos contain Nco I and Sfi I restriction endonuclease recognition sequences, respectively, for subcloning into an intermediate vector (pHLP029).
[0601] Overlapping PCR using the light chain 5' and VH 3' oligos and pHLP025 and pHLP029 as templates was employed to combine the light chain and the VH region as one cDNA segment. The resultant product was subcloned into the Dra HI site of pXWU007 thus creating the final alternate splice expression vector, pXWU022. The alternate splice configuration generates two transcripts from a single promoter through alternate splicing of the primary transcript. The natural CMV splice donor is spliced either to a suboptimal splice acceptor to generate a light chain-encoding transcript, or to a natural CMV splice acceptor to generate the heavy chain-coding transcript. The sub- optimal splice acceptor has been designed to generate similar amounts of both transcripts.
[0602] The DNA vector (pXWU022) was prepared in HEBS buffer at a concentration of
~ 700 ng/μL prior to electroporation in to CHO cells. Five electroporations were performed using various concentrations of DNA (15, 20, 30, 40, and 45 μg). Each electroporation was done in a disposable 0.4 cm cuvette (Invitrogen) containing 4x 10 log phase CHO cells in 0.7 ml sterile HEBS buffer and DNA in 0.1 mL HEBS (0.8 mL total volume). Cells were shocked using a Bio-Rad Gene Pulser XCELL, set at 290 volts, 950 micro Faradays. Shocked cells were then allowed to stand at room temperature for 10 minutes then mixed with 10 mL room temp insulin free CHOM 16 medium, centrifuged (3' @ 1000 rpm), and aspirated. Cells were then resuspended in 12 mL (room temp.) insulin free CHOM 16 medium and transferred to a T-75 tissue culture flask. [0603] Cells and Media: prior to electroporation the CHO cells were grown in serum free media (CHOM24) with the addition of IX nucleosides. CHOM24 is a chemically defined in-house media formulation that does not contain any animal components. Methotrexate selection was performed in nucleoside free CHOMl 6 and CHOM24 chemically defined media. [0604] Following electroporation, 4 x 106 CHO cells were pooled into a T-75 flask.
Selection for DHFR expression began immediately as the cells were inoculated in nucleoside free medium. Cells were eventually expanded to 125 mL shake flasks in CHOM24 (~3 weeks). To isolate clonal cell lines, the transfected stable pools were diluted and plated at 1 cell/well in 200 μL CHOM 16 on four 96-well plates. Plates were maintained at 36°C until they were screened for antibody titer.
[06051 CHO colonies were screened for immunoglobulin production by assaying cell supematants using an ELISA specific for the human kappa chain (day 21 to day 28 after plating). The capture antibody used in the ELISA was a polyclonal goat anti-human IgG (SouthernBiotech) and the detection antibody was a polyclonal goat anti-human kappa conjugated to horseradish peroxidase (SouthernBiotech). Colonies secreting the highest amount of immunoglobulin were expanded.
[0606] A total of 381 nearly confluent wells of the 1920 wells seeded were assayed. Of the 381 wells, 60 were expanded for further study and of these 60, 4 were selected for amplification (15A7, 40B3, 40B5, 40F6).
Example 10
Purification and characterization of fully human anti-IGF-lR IgG4.P.agly antibodies:
[0607] The antibody produced in CHO cells were purified and characterized by methods described below.
[0608] Protein A Capture: Pre-equilibrate the Protein A column with IX PBS
(equilibration buffer) at 100-150 cm/hr with 3 column volumes. Load the supernatant at 150 cm/hr with a maximum of 10 mg of αIGF-lR per milliliter of resin. After loading, wash the column with 5 column volumes of equilibration buffer. Then, step elute in an upflow direction with 100 mM Glycine, pH 3.0. Collect desired fractions and titrate to neutral pH with 2M Tris base. Dialyze collected fractions against IX PBS and concentrate material to prepare for the size exclusion step.
TM
[0609] SUPERDEX 200 (Size Exclusion) aggregate removal step involved equilibration of SUPERDEX™ 200 with IX PBS with 1.5 column volumes at a flow rate of 36 cm/hr followed by loading of protein and collecting desired fractions. Identity testing performed as follows
[0610] 1). Intact mass analysis by mass spectrometry where molecular mass measurements were performed on an electrospray mass spectrometer (ESI-MSD). Prior to analysis, the sample was reduced to remove disulfide bonds. The deconvoluted mass spectrum represents the masses of the heavy and light chains.
[0611] 2). N-terminal sequence analysis was performed by Edman degradation using an
ABI protein sequencer equipped with an on-line PTH analyzer. The sequences for the initial amino acids of the light chain and heavy chain were identified.
[0612] 3). Peptide mapping with mass spectrometric analysis: tryptic or/and EndoLysC peptide maps were performed to obtain complete sequence coverage by analysis of the LC/MS data generated from each peptide. In addition, determination of sites and amounts of oxidation and deamidation were detected.
[0613] Purity testing was performed by; 1) SDS-Page or CE-SDS: Reduced and non- reduced samples, this technique is used to measure antibody fragmentation, aggregation and impurities, 2) SEC-HPLC with LS and RI technique was used to measure aggregation and fragmentation and light scattering determines the molar mass of sample components. 3) SDS gel or capillary EEF method was used to determine the isoelectric focusing pattern and pi distribution of charge isoforms that can result from C- and N- terminal heterogeneity and/or deamidation.
[0614] Finally, endotoxin concentrations were measured by the Limulus amoebocyte lysate (LAL) kinetic turbidometric method.
[0615] Figure 6 shows non-reduced and reduced SDS PAGE analysis of G4.P.agly versions of fully human M13-C06 and M14-C03 antibodies. Both G4.P and G4.P.agly versions of antibodies M13-C06, M14-C03, M14-B01, and M14-G11 were produced. M12-E01 and M12-G04 were produced on as the G4.P version.
Example 11
Binding activity of fully human anti-IGF-lR antibodies
[0616] The binding activity to soluble IGF-IR of the G4.P.agly and G4.P versions of antibodies tested by ELISA. Soluble IGF-I receptor fusion protein (Biogen Idee) at 2.5 μg/ml in 0.025 M carbonate buffer, pH 9.6 was coated at 50 μl/well in a 96-well (IMMUL0N2 HB, Dynex Technologies, Inc., Cat. #3455) plate and incubated overnight at 4°C. The plate was washed with phosphate-buffered saline (PBS, Irvine Scientifϊc,Cat#9240), pH 7.4 plus 0.025% Tween 20 in the Skan Washer 300 (Skatron Instruments), blocked with buffer containing 1% nonfat milk, 0.05% Tween 20 in PBS, pH 7.4, and then incubated at room temperature for 1 hour. After incubation plate was washed with PBS plus 0.025% Tween 20 in the Skan Washer 300. For the assay, the soluble IGF-I receptor-coated plate was next incubated with the control and test antibodies of varied concentrations, diluted in 1% nonfat milk, 0.05% Tween 20 in PBS at 50 μl/well. Following a one hour incubation at room temperature, plate was washed with PBS plus 0.025% Tween 20 in the Skan Washer 300. A 2000-fold dilution in 1% nonfat milk, 0.05% Tween 20 in PBS of goat anti-human Kappa - HRP (Southern Biotech Cat#2060-05) was added 50 μl/well to detect bound antibody. Plate incubated for 1 hour at room temperature was washed with PBS plus 0.025% Tween 20 in the Skan Washer 300. TMB solution (KIRKEGAARD & PERRY LABS, INC. cat: 50-76-00) was added lOOμl/well, and the reaction was stopped with 50ul/well of 4N H2SO4
(LabChem,Cat#LC25830-l) after two minutes. The absorbance was measured at 450 nm, background 540 nm for TMB using the Molecular Devices plate reader. Data was analyzed using the SOFTMAX PRO software package version 4.3 LS (Molecular Devices Corp.).
[0617] Figure 7 (A) shows the concentration dependent binding of G4 version of M13-
C06, M14-C03, M14-G11, M12-E01 and M12-G04, whereas the control antibody, IDEC- 151 (G4.P) again did not show any binding to IGF-lR.Fc.
[0618] Figure 7 (B) shows the concentration dependent binding of G4.P.agly version of
M13-C06, M14-C03 and M14-B01 to soluble IGF-IRJFc by ELISA. A G4.P antibody of irrelevant specificity (IDEC-151) used as a negative control did not show any binding to IGF-IR-Fc.
[0619] The binding activity of human antibodies to wild type IGF-IR expressed on tumor cells was determined by flow cytometry. Tumor cell lines MCF-7 and Calu-6 were cultured in Minimum Essential Medium Eagle (ATCC, Cat#30-2003) supplemented with 10% fetal bovine serum (FBS) (Irvine Scientific, Cat#3000A) and 50 μ/ml gentamicin (Gibco Invitrogen, Cat#15750-060). Panc-1, Colo-205, NCI-H23 and ZR-75 were cultured in RPMI-1640 (ATCC, Cat#30-2001) supplemented with 10% FBS and 50 μg/ml gentamicin. Trypsin-EDTA (Sigma, Cat#T4049) solution was used for removal of adherent cells from culture vessels. [0620] Cells were rinsed twice with phosphate buffered saline (PBS) (Irvine Scientific,
Cat# 9240), pH 7.4, trypsinized and washed once in PBS and 10% FBS. Cells were adjusted to 107 cells/ml in FACS buffer (0.05% sodium azide, 2% FBS,10% normal goat serum and 100 μg/ml normal goat IgG in PBS) and put on ice for at least 15 minutes. Control and test antibodies were aliquoted into a Corning 3790 plate. Cells at 50 μl/well were added to a Coming 3799 plate. Primary antibodies from Coming 3790 plate were added at 50 μl/well to respective wells of Corning 3799 plate. Next, cells (0.5 x 106 cells/sample) were incubated 45 min on ice. Following incubation plates were centrifuged at 1500 rpm for 4 minutes and then supernatants were aspirated. Cells were resuspended in 150 μl of FACS buffer. Plates were centrifuged at 1500 rpm for 4 minutes and supernatants were aspirated. A 750-fold dilution in FACS buffer of goat anti-human IgG-RPE (Southern Biotech Cat#2040-09) was added 100 μlΛvell. Next, cells (0.5 x 106 cells/secondary antibody) were incubated 45 min on ice. A 500-fold dilution in FACS buffer of 7AAD(Molecular Probes,Cat#A1310) was added 50 μl/well and incubated for 5 minutes on ice. Following incubation plates are spun at 1500 rpm for 4 minutes and then supernatants were aspirated. Cells were resuspended in 150 μl of FACS buffer. Plates were centrifuged at 1500 rpm for 4 minutes and supernatants were aspirated. Cells were resuspended in 100 μl/well of FACS buffer. Cells were transferred to 12 x 75 mm FACS tubes with 200 μl of FACS buffer. Finally, cells were examined for fluorescence intensity on a FACSCalibur using CellQuest software (both from Becton Dickinson).
[0621] Figure 8 shows the concentration dependent binding of M13-C06.G4.P.agly,
M14-C03.G4.P.agly and M14-G11.G4.P to IGF-IR expressed on MCF-7 cells (Figure 8(A)). The cell-surface binding specificity of antibodies was confirmed by testing binding to IGF-1R/3T3 transfectants and 3T3 parent cells. All of the lead antibodies showed specific reactivity to IGF-IR expressing 3T3 but not to 3T3 cells (Figure 8(B)).
Example 12
Inhibition of ligand binding to IGF-IR by fully human antibodies
[0622] The ability of the G4.P.agly and G4.P versions of human antibodies to block IGF-
1 and IGF-2 binding to soluble IGF-IR-Fc was determined. The IgG4 versions of M13- C06, M14-G11, M14-B01, M12-E01 and M12-G04 blocked both IGF-I and IGF-2 binding to IGF-IR, whereas M14-C03 only blocked IGF-2 (Figure 9 (A) and (B)). [0623] The ligand blocking ability of the anti-IGF-lR antibody was determined by a solid phase RIA capture method as described in Example 3. Briefly, the antibodies at varying concentrations were (lOOnM-O.OlnM) co-incubated with 100,000 cpm of 125I-labeled IGF-I or 125I-lGF-2 in the wells of a 96-well IMMULON2 plate, wherein human IGF-IR- Fc was previously immobilized (200ng/well). After 1 hour of incubation at room temperature, the wells were washed and counted for bound radioactivity by a Gamma Counter. An isotype matched negative antibody control, IDEC-151 (human G4), was used. Percent (%) inhibition was calculated as = [l-(Ave.CPM with Ab) / (Ave.CPM with buffer) ] x 100%.
[0624] The result demonstrate that fully human antibodies M13-C06.G4.P, M 13-
C06.G4.P.agly, M14-G11.G4.P, M14-Gl l.G4.P.agly, M14-B01.G4.P.agly, M12- E01.G4.P, and M12-G04.G4.P block both IGF-I and IGF-2 binding to IGF-IR, whereas, the antibodies M14-C03.G4.P and M14-C03.G4.P.agly block only IGF-2 binding to IGF- IR. See, Figure 9(A)-(B).
Example 13
Inhibition of tumor cell growth by fully human anti-IGF-lR antibodies
[0625] The ability of antibodies to block IGF-I and IGF-2 driven tumor cell growth was tested using a cell viability assay.
[0626] NCI-H23, Calu-6, Colo-205, Panc-1, BxPC-3 (ATCC) tumor lines were purchased from ATCC. Cell lines were grown in complete growth medium containing RPMI-1640 (ATCC), 10% fetal bovine serum (Irvine Scientific Inc.) and 50μg/ml of Gentamycin (Gibco, Invitrogen). Trypsin-EDTA solution (Sigma) was used for removal of adherent cells from culture vessels. Phosphate buffered saline, pH 7.2, was from MediaTech Inc The 96-well clear bottom plates for luminescent assay was purchased from Wallac Inc.
[0627] Cells grown to 80% monolayers were, trypsinized, washed, resuspended and plated into 96-well plates in 200μl of 2% growth medium at 8x103 cells/well for NCI-H23 and Colo-205 cells; and 5x103 cells/well for Calu-6, Panc-1 and BxPC-3 cells. After 24 hours, the culture medium was replaced with lOOμl of serum free medium (SFM), and 50μl of serially diluted antibodies at 4x concentration was added. Following another hour of incubation at 37°C, 50μl of IGF-I or IGF-2 at 4x concentration was added and incubated at 37°C until 48 hours to measure cell growth. All treatments were done in triplicates. Cell growth was measured using the CELL TITER-GLO™ Luminescent Cell Viability Assay (Promega, Madison, WI). The 1 :1 mixture of reagent and SFM was added at 200μl/well. Luminescence was detected on Wallac (Boston, MA) plate reader. [0628] The various human IgG4 versions of the anti-IGF-lR antibodies exhibited inhibition of IGF-I and IGF-2 driven cell proliferation in H-23 (IGF-I and IGF-2) Calu-6 (IGF-2) cells (Figure 10(A)-(C)). Other cell lines exhibited comparable trends (see e.g., Example 20).
Example 14
Internalization of IGF-IR by fully human anti-IGF-lR antibodies
[0629] MCF-7 cells were seeded at 50,000 cells per well into 8 well chamber slides
(Becton Dickinson Collagen Type 1 coated culture slides, BD BioCoat™ #354630) 48 hours prior to staining procedures. Cells were routinely maintained below 20 passages. On day of staining procedures, culture media was discarded from each well and replaced with 500μl cold incubation buffer (MEM Eagle ATCC #30-2003 + 1% BSA). Cells were washed 2X with this buffer for 3 min each wash. 250μl of each mAb or human G4.P.agly antibody to be tested was then added to the appropriate well at a concentration of lOμg/ml, diluted in incubation media, and incubated on ice for 1 hour. A murine anti- human-IGF-lR antibody (Lab Vision/NeoMarkers, clone 24-31 cat# MS-641) was used as a positive control antibody to compare degree of internalization. After the 1 hour incubation on ice, the time zero (t = 0') slide was washed 3X with 500μl of cold wash buffer (PBS + 1% BSA + 2% Goat serum) for 3 min each wash (slides always kept on ice!). The t = 0 slide was then fixed with 500μl 4% paraformaldehyde (diluted with PBS from 16% stock; EMS #15710) for 15 minutes at room temperature. The t = 0 slide was then washed again 3X with cold wash buffer for 3 minutes each wash, then left on ice. Meanwhile, the remaining slides were put into a 37°C incubator for their designated time points (15 and 60 minutes). At the end of their incubation time each slide followed the same procedures as above - washes and fixation, and put on ice. All slides were then permeabilized with 200μl cold permeabilization buffer (Wash buffer + 0.5% Triton-X) for 10 minutes on ice. All slides were then washed 3X with 500μl cold wash buffer for 3 minutes each wash. The secondary antibody was prepared at a 1:1000 dilution (AlexaFluor 488 Goat-anti-mouse IgG (H + L), Molecular Probes #A11029 for the mAbs and AlexaFluor 488 Goat-anti-human IgG (H + L), Molecular Probes #A11013 for G4 antibodies) in wash buffer, after an initial spin of the stock vial at 10,000rpm for lOmin at 4°C. 250μl of the diluted secondary antibody was added to each well and incubated for 40min at room temperature in the dark (covered). Slides were again washed 3X with 500μl cold wash buffer. On the final wash, the buffer was discarded and all wells were left empty. The chambers were then disassembled from the slide using the provided disassembly tool, and cover slips were mounted with Vectashield mounting medium containing DAPI (Vector #H-1500, Hard Set™). Slides were stored at 4°C in the dark overnight to allow the mounting medium to dry.
[0630] Pictures of the slides were taken with a confocal microscope using the LaserSharp
2000 program (BioRad v5.2) and represented as a merge of blue and green components from Kalman 10 average.
[0631] M13-C06.G4.P.agly showed rapid internalization of IGF-IR in 60 min as shown in Figure 13A. Both M14-C03.G4.P.agly and M14-G11.4.P all showed internalization property similar to M13-C06.G4.P.agly antibody (data not shown). As expected the positive control, clone 24-31, also internalized the receptor whereas isotype matched negative controls (mouse 7F2 and human G4, IDEC- 152.G.P (primatized antibody)) did not bind or internalize (Figure 13(B)-(C)).
[0632] In addition, the rate of receptor internalization was measured by a FACS based method for certain of the murine monoclonal antibodies. MCF-7 cells grown to 70% confluent monolayers were lifted off the flask with cell dissociation buffer (Gibco catalog #13151-014). Cells resuspended in media and 5xlO6 cells were added into 12x75mm tube (Falcon catalog# 352054), where each tube represents a different mAb to be tested. lOμg/ml mAb was added to its corresponding tube in 0.5ml FACS buffer containing no azide (PBS + 1% BSA) as well as a control tube with no antibody for measuring experimental internalization error. Tubes were incubated on ice for lhour 15minutes then washed and reconstituted in ImI FACS buffer. lOOμl of each sample was removed into 1 well of a 96 well u-bottom plate (NUNC #163320) kept on ice to prevent internalization and termed time zero (t = 0). This was used as a 100% Ab bound control. Tubes were then transferred to a 370C water bath and lOOμl samples removed at time (t) = 5, 10, 20, 40, and 60 minutes (later changed to 5, 10, 15, 30 and 60 minutes) and placed into separate wells of a 96 well u-bottom plate on ice. Once all samples were collected, the plates were spun at 1200rpm in a 4°C centrifuge to pellet cells. Antibody added to detect internalization of receptor was either anti-CD221-PE (BD Pharmingen cat# 555999 - anti-IGF-lR; lOμ/lOOμl sample) to detect receptors remaining on cell surface, or Goat- anti-mouse-PE (Jackson ImmunoResearch Lab cat#l 15-116-146; 5μg/ml) to detect antibody remaining on cell surface. Samples were incubated 1 hour in FACS buffer containing 0.1% Sodium Azide, washed xl, and brought to a final volume of 200μl in FACS buffer containing azide. Samples were then run and collected using a FACSArray (BD) and geometric means determined. Also run PE-labeled Quantibrite beads (BD #340495) to quantitate the number of PE molecules bound to the cell surface, where the Quantibrite bead are run on the same FL2 setting as samples. The number of PE molecules bound to the bead is given in their packaging, allowing the quantitation of the number of PE molecules bound to the cell surface using geometric means of the sample and of the beads. The FACS assay showed that the murine monoclonal antibodies tested promoted internalization of IGF-IR (data not shown).
Example 15
Inhibition of IGF-IR mediated signaling by fully human antibodies
[0633] Part I: Inhibition of signal transduction in MCF-7 cells
[0634] The effect of human anti-IGF-lR antibodies on IGF-IR signaling was evaluated using MCF-7 cells (human breast adenocarcinoma cells). The ability of antibodies to block IGF-I and IGF-2 mediated IGF-IR receptor phosphorylation was determined as described in Example 4. All of the IgG4 versions of the fully human antibodies showed good inhibition (EC5O < 1 nM) and inhibited the phosphorylation of IGF-IR (Figure 11 (A & B).
[0635] To detect the effect on downstream signaling, cell lysates were generated as described in Example 4. For signaling experiments control and test antibodies were added after serum starvation at 10OnM, 15nM, 5nM and InM in 35Oμl of fresh serum free media and incubated for 1 hour at 37°C. Human recombinant IGF-I at 13nM or IGF-II at 27nM (R & D Systems, #291-G1 and #292-G2) was added to wells in 35μl serum free media and incubated at room temperature for 15 minutes. Cells were lysed and recovered sample separated using a 4-12% Bis-Tris gel and immobilized to nitrocellulose (Invitrogen Corp.). The IGF-IR signaling pathway was detected with phospho-Akt at site Thτ308 (Cell signaling Technologies, #4056) and phospho-p44/42 MAPK at site Thr202/Tyr204 (Cell signaling Technologies, #9101) and anti-rabbit IgG-HRP (Cell Signaling Technologies, #7071). Bands were visualized using ECL luminol reagent (Amersham Biosciences, #RPN2109) and autoradiography. Each blot was stripped of antibody and re-probed respectively for total Akt (Cell signaling Technologies, #9272) or total p44/42 MAPK (Cell signaling Technologies, #9102) and anti-rabbit IgG-HRP. Bands visualized using ECL luminol reagent and autoradiography.
[0636] The effect of antibody on down stream signaling events such as Akt and MAPK phosphorylation was determined. Cell lysates from autophosphorylation were imrnunoprecipitated with polyclonal IGF- lRβ antibody-agarose conjugate (Santa Cruz Biotechnology, #SC-713). Recovered receptor protein was separated using a 4-12% Tris- Glycine gel and immobilized to nitrocellulose (Invitrogen Corp.). Receptor was detected with anti-phospho-IGF-lR site Tyrll31 (Cell Signaling Technologies, #3021) or anti- IGF- lRβ (Santa Cruz Biotechnology, #SC-9038) and anti-rabbit IgG-HRP (Cell Signaling Technologies, #7071). Bands were visualized using ECL luminol reagent (Amersham Biosciences, #RPN2109) and autoradiography. (Figure 12A and 12B).
[0637] Figures 12 A & B show that M13.C06.G4.P.agly inhibited IGF-I and IGF-2 mediated phosphorylation of Akt and p42/44 MAPK in a dose dependent manner. In particular, the M13-C06.G4.P.agly IGF-IR antibody inhibited ligand induced Akt signaling in MCF7 cells at all concentrations tested (i.e., 1-100 nM), as demonstrated by inhibition of IGF-I and IGF-2 induced phosphorylation of Akt at amino acid residue Ser473 (Figure 19). Control antibodies were tested at 10OnM, whereas M13- C06.G4.p.agly was tested at 100, 15, 5 and InM. Antibody IDEC-152, a human G4 version of an antibody of irrelevant specificity, was used as a negative control. Antibody IR3, a murine monoclonal antibody to IGF-IR, was used as a positive control. In addition, M14-C03.G4.P.agly and M14.G11.G4.P full-length antibodies also inhibited IGF-I and IGF-2 driven signaling of Akt and p42/44 MAPK activation (data not shown).
[0638] Part II: Inhibition of signal transduction in A549, CaIu-6, and Hl 299 cells
[0639] The ability of M13-C06.G4.P.agly to disrupt the association of insulin receptor substrate (IRS-I) with p85 the regulatory subunit of phosphoinositide 3-kinase (PI3K) was determined in tumor cell lines by a co-immunoprecipitation assay. In particular,
IRS-I binds to PI3K subunit p85 in an IGF-lR-dependent manner in NSCLC cell lines sensitive to M13-C06.G4.P.agly antibody. Thus, two non-small cell lung carcinoma cell lines (NSCLC) A549 and H1299 (responsive to M13-C06.G4.P.agly) and one NSCLC cell line, Calu-6 (less responsive to M13-C06.G4.P.agly) were grown in the presence of M13.C06.G4.P.agly or control antibody (IDEC- 151) for 24 hours. Cell lysates were immunoprecipitated with an anti-p85 antibody and subjected to western blot analysis with anti-IRS-1 (top blot) and anti-p85 (bottom blot) antibodies (Figure 25).
[0640] . For this assay, human lung tumor cell lines A549, Calu-6, and NCI- 1299 cells were purchased from ATCC and maintained in RPMI medium 1640 containing 10% fetal bovine serum (FBS). Cells were seeded at 3x106 cells per dish in 100 mm dishes, cultured for 24 hours, and then treated with 10OnM of M13-C06.G4.P.agly or BDEC-151 (human G4.P isotype matched negative control antibody) for 24 hours in the presence of 5% FBS. Cell lysates were prepared in 1% Triton X-100 lysis buffer from Cell Signaling Technology, Inc. (Danvers, MA USA)). For immunoprecipitation, anti-p85 antibody (Cat #06-649, Upstate Cell Signaling Solutions (now part of Millipore, Concord, MA (USA) was added to the lysate (4ug of antibody per 1-2 mg of lysate) and incubated at 40C overnight. The immunocomplex was then captured by mixing with protein-G agarose beads for 2 hours at 4°C. The immunoprecipitates were washed with ice-cold lysis buffer and boiled in 2x LDS (Lithium Dodecyl Sulfate) sample buffer before separation by NuP AGE® Novex 4-12% Bis-Tris Gel electrophoresis (Invitrogen Corp., Carlsbad, CA (USA)), and transfer to nitrocellulose membranes. IRS-I (Cat # 06-248, Upstate) and p85 (Cat # 06-649, Upstate) antibodies were purchased from Millipore and immunoblotting was performed according to the manufacturer's protocols. Result:
[0641J M13-C06.G4.P.agly inhibited the association of IRS-I with the p85 regulatory subunit of PDK in the presence of serum in A549 and H 1299 cell lines but not in Calu-6 (Figure 25).
[0642]
Example 16
Antibody cross-reactivity to non-human primate IGF-IR
[0643] The ability of anti-human IGF-IR antibodies to recognize the IGF-IR from non- human primates was tested. First Rhesus and cynomolgus monkey IGF-IR was cloned and expressed in CHO cells. The binding of all antibodies was determined by flow cytometry and confirmed by confocal microscopy. M13.C06.G4.P.agly,
M14.C03.G4.P.agly and M14.G11.G4.P all showed specific binding activity to both Rhesus and cynomolgus IGF-IR (data not shown). Further species cross-reactivity studies showed binding of M14.G11.G4.P and M14.C03.G4.P.agly to murine IGF-IR expressing CHO cells (data not shown).
[0644] In addition to cynomolgus IGF-IR expressed on CHO cells, the
M13.C06.G4.P.agly antibody also cross-reacts with cynomolgus macaque IGF-IR expressed on granulocytes and monocytes from this species. (Specificity of binding was demonstrated by the ability of soluble recombinant human IGF-IR to block M13.C06.G4.P.agly antibody binding (data not shown)). Similarly, the M13.C06.G4.P.agly antibody also binds to an established cynomolgus fibroblast cell line. (See, Example 26, Figure 23). These results indicate that cynomolgus macaque is an ideal non-rodent species in which toxicity testing has been performed.
[0645] hi contrast to results with the IGF-IR receptor in primates, M13.C06.G4.P.agly did not show cross-reactivity to rat or mouse IGF-IR expressed on immune cells (granulocytes, monocytes, lymphocytes) as assessed by FACS analysis.
Example 17
Generation of IGF-I R specific murine Mabs
[0646] Murine monoclonal antibodies specific to human IGF-IR were generated by standard hybridoma technology. Splenocytes from Balb/c mice were immunized with
. IGF-IR expressing NIH 3T3 fibroblast and IGF-IRJg fusion protein were used for PEG induced somatic cell fusion. Table 4 summarizes the properties of the anti-IGF-lR murine monoclonal antibodies.
[0647] The ability of the selected murine antibodies to inhibit IGF/IGF- IR dependent in vitro growth of several human tumor lines (Lung, H-23, Calu-6; Pancreas, BxPc-3, Panc- 1, MiaPaCa and Colon Colo205) was measured by a proliferation as described in Example 13. Figure 14(A)-(F) shows the antibody concentration dependent inhibitory effects of eight of the murine antibodies on tumor cell growth in the presence of IGF-I at lOO ng/ml. [0648] The ability of antibodies to block IGF-I and IGF-2 driven tumor cell growth was compared using the NCI-H23 lung tumor cell line. Figure 15 gives an example of the growth inhibitory effects seen with three of the murine MAbs' (P2A7-3E11, 20C8-3E8, P1A2-2B11) and one of the fully human antibody, M13-C06.G4.P.agly. AU of the antibodies showed inhibition of IGF-I and IGF-2 driven tumor growth. As positive control IR3, a commercially available anti-IGF-lR antibody was used. The mouse IgG (anti-EDectin, IgGl) and human gamma 4 version of IDEC-152 antibody of irrelevant specificity were used as isotype matched controls for the experiments.
Example 18
Cloning of murine anti-human IGF-IR mAbs
Cloning of anti-IGF-lR murine hybridoma P2A7.3E11 immunoglobulin variable regions
[06491 Total cellular RNA from murine hybridoma cells was prepared using a Qiagen
RNeasy mini kit following the manufacturer's recommended protocol. cDNAs encoding the variable regions of the heavy and light chains were cloned by RT-PCR from total cellular RNA using the Pharmacia Biotech First Strand cDNA Synthesis kit following the manufacturer's recommended protocol using random hexamers for priming.
[0650] The cloning and chimerization of the P2A7.3E11 variable domains will be described in detail as an example (other mAb variable domains were cloned and chimerized by similar methods, but will not be described in detail for the sake of brevity, since standard molecular biology techniques familiar to those skilled in the art of antibody engineering were used). For PCR amplification of the murine immunoglobulin variable domains with intact signal sequences, a cocktail of degenerate forward primers hybridizing to multiple murine immunoglobulin gene family signal sequences and a single back primer specific for 5' end of the murine constant domain as described in Current Protocols in Immunology (Wiley and Sons, 1999) were used. PCR conditions using Clontech's Advantage Taq polymerase were: initial denaturation for 2 min at 94o, followed by 30 cycles of denature 1 min at 94o, anneal 1 min at 45o, and elongate 1 min at 72o. The P2A7 heavy chain variable domain was amplified with the following primers: 51 GGG GAT ATC CAC CAT GGR ATG SAG CTG KGT MAT SCT CTT 3" (M=A/C, K=G/T, R=A/G, and S=C/G) (SEQ ID NO: 130) and 5' AGG TCT AGA AYC TCC ACA CAC AGG RRC CAG TGG ATA GAC 31 (R=AJG, and Y=C/T). (SEQ ID NO:131) The P2A7 light chain variable domain with its signal sequence was amplified with the following primers: 5' GGG GAT ATC CAC CAT GGA TTT TCA GGT GCA GAT TTT CAG 3' (SEQ ID NO: 132) and 5' GCG TCT AGA ACT GGA TGG TGG GAG ATG GA 3'. (SEQ ID NO: 133) The PCR products were gel-purified using a Qiagen Qiaquick gel extraction kit following the manufacturer's recommended protocol. Purified PCR products were subcloned into Invitrogen's pCR2. ITOPO vector using their TOPO cloning kit following the manufacturer's recommended protocol. Inserts from multiple independent subclones were sequenced to guard against PCR errors.
[06511 Blast analyses of the variable domain sequences confirmed their immunoglobulin identity. The P2A7 heavy chain variable domain is a member of murine subgroup H(A). The sequence of the P2A7 mature heavy chain variable domain, with its CDRs underlined (with the CDRs, complementarity determining regions, based upon the Kabat designations) is shown below:
1 QVQLQQSGPE LVKPGASVKM SCKASGNTFT DYVINWVKQR TGQGLEWIGE 51 IYPGNENTYY NEKFKGKATL TADKSSNTAY MQLSSLTSED SAVYFCARGI 101 YYYGSRTRTM DYWGQGTSVT VSS (SEQ ID NO: 38)
[0652] The P2A7 light chain variable region is a member of murine kappa subgroup IV.
The sequence of the P2A7 mature light chain variable domain, with its CDRs underlined, is shown below:
1 EWLTQSPTA MAASPGEKIT ITCSASSTLS SNYLHWYQQK PGFSPKLLIY 51 RTSNLASGVP GRFSGSGSGT SYSLTIGTME AEDVATYYCQ QGSSIPLTFG 101 AGTKIiELK (SEQ ID NO: 98)
Construction and expression of chP2A7
[06531 cDNAs encoding the murine P2A7 variable regions of the heavy and light chains were used to construct vectors for expression of murine-human chimeras (chP2A7) in which the muP2A7 variable regions were linked to human IgG4 and kappa constant regions. For construction of the heavy chain chimera, a 0.47 kb Notl-BsmBI fragment from the P2A7 heavy chain subclone pCN363 and the 1.0 kb BsmBI-Notl fragment from pEAG1995 (a plasmid containing a sequence-confirmed aglycosylated S228P/T299A (Kabat EU nomenclature) variant huIgG4 heavy chain constant domain cDNA with the IgG4 C-terminal lysine residue genetically removed) were subcloned into the phosphatased 6.1 kb Notl-linearized vector backbone of pV90 (a sequence-confirmed pUC-based Biogen Idee proprietary expression vector containing a SV40 early promoter- driven dhfr selectable marker in which heterologous gene expression is controlled by a CMV-DB promoter and a human growth hormone polyadenylation signal). The heavy chain cDNA sequence in the resultant plasmid pEAG2045 was confirmed by DNA sequencing. The sequence of the chimeric P2A7 heavy chain cDNA insert (from the signal sequence's initiator ATG through the terminator TGA) is shown below as SEQ ID NO: 134:
1 ATGGAATGGA GCTGTGTCTVT GCTCTTCATC CTGTCAGGAA CTGCAGGTGT
51 CCACTCCCAG GTTCAGCTGC AGCAGTCTGG ACCTGAGCTA GTGAAGCCTG
101 GGGCTTCAGT GAAGATGTCC TGCAAGGCTT CTGGAAACAC ATTCACTGAC
151 TATGTTATAA ACTGGGTGAA GCAGAGAACT GGACAGGGCC TTGAGTGGAT
201 TGGAGAGATT TATCCTGGAA ATGAAAATAC TTATTACAAT GAGAAGTTCA 251 AGGGCAAGGC CACACTGACT GCAGACAAAT CCTCCAACAC AGCCTACATG
301 CAGCTCAGTA GCCTGACATC TGAGGACTCT GCGGTCTATT TCTGTGCAAG 351 AGGGATTTAT TACTACGGTA GTAGGACGAG GACTATGGAC TACTGGGGTC
401 AAGGAACCTC AGTCACCGTC TCCTCAGCCT CCACCAAGGG CCCATCCGTC 451 TTCCCCCTGG CGCCCTGCTC CAGATCTACC TCCGAGAGCA CAGCCGCCCT 501 GGGCTGCCTG GTCAAGGACT ACTTCCCCGA ACCGGTGACG GTGTCGTGGA 551 ACTCAGGCGC CCTGACCAGC GGCGTGCACA CCTTCCCGGC TGTCCTACAG 601 TCCTCAGGAC TCTACTCCCT CAGCAGCGTG GTGACCGTGC CCTCCAGCAG 651 CTTGGGCACO AAGACCTACA CCTGCAACGT AGATCACAAG CCCAGCAACA 701 CCAAGGTGGA CAAGAGAGTT GAGTCCAAAT ATGGTCCCCC ATGCCCACCG 751 TGCCCAGCAC CTGAGTTCCT GGGGGGACCA TCAGTCTTCC TGTTCCCCCC 801 AAAACCCAAG GACACTCTCA TGATCTCCCG GACCCCTGAG GTCACGTGCG 851 TGGTGGTGGA CGTGAGCCAG GAAGACCCCG AGGTCCAGTT CAACTGGTAC 901 GTGGATGGCG TGGAGGTGCA TAATGCCAAG ACAAAGCCGC GGGAGGAGCA 951 GTTCAACAGC GCGTACCGTG TGGTCAGCGT CCTCACCGTC CTGCACCAGG 1001 ACTGGCTGAA CGGCAAGGAG TACAAGTGCA AGGTCTCCAA CAAAGGCCTC
1051 CCGTCCTCCA TCGAGAAAAC CATCTCCAAA GCCAAAGGGC AGCCCCGAGA
1101 GCCACAAGTG TACACCCTGC CCCCATCCCA GGAGGAGATG ACCAAGAACC
1151 AGGTCAGCCT GACCTGCCTG GTCAAAGGCT TCTACCCCAG CGACATCGCC
1201 GTGGAGTGGG AGAGCAATGG GCAGCCGGAG AACAACTACA AGACCACGCC
1251 TCCCGTCCTC GATTCCGACG GCTCCTTCTT CCTCTACAGC AGGCTAACCG
1301 TGGACAAGAG CAGGTGGCAG GAGGGGAATG TCTTCTCATG CTCCGTGATG
1351 CATGAGGCTC TGCACAACCA CTACACACAG AAGAGCCTCT CCCTGTCTCT
1401 GGGTTGA
[0654] The predicted mature chP2A7 heavy chain protein sequence is shown below as
SEQ ID NO:135:
1 QVQLQQSGPE LVKPGASVKM SCKASGNTFT DYVINWVKQR TGQGLEWIGE
51 IYPGNENTYY NEKFKGKATL TADKSSNTAY MQLSSLTSED SAVYFCARGI
101 YYYGSRTRTM DYWGQGTSVT VSSASTKGPS VFPLAPCSRS TSESTAALGC
151 LVKDYFPEPV TVSWNSGALT SGVHTFPAVL QSSGLYSLSS WTVPSSSLG
201 TKTYTCNVDH KPSNTKVDKR VESKYGPPCP PCPAPEFLGG PSVFLFPPKP
251 KDTLMISRTP EVTCWVDVS QEDPEVQFNW YVDGVEVHNA KTKPREEQFN
301 SAYRWSVLT VLHQDWLNGK EYKCKVSNKG LPSSIEKTIS KAKGQPREPQ
351 VYTLPPSQEE MTKNQVSLTC LVKGFYPSDI AVEWESNGQP ENNYKTTPPV
401 LDSDGSFFLY SRLTVDKSRW QEGNVFSCSV MHEALHNHYT QKSLSLSLG
[0655] The murine variable domain is residues 1-122, the human IgG4 heavy chain constant domain is residues 123-459. The Kabat EU-designated S228P hinge substitution (to correct the propensity of IgG4 to form half-antibodies) is residue 231 above, while the T299A substitution in CH2 to genetically remove N-linked glycosylation is residue 302 in the above sequence.
[0656] For construction of the light chain chimera, the PCR-amplifled P2A7 light chain was subjected to site-directed mutagenesis using a STRAT AGENE® Quick-Change mutagenesis kit following the manufacturer's recommended protocol, with the mutagenic primers 5' CGC CAG TGT GCG GCC GCT GGA ATT CGC CCT TG 3'(SEQ ID NO: 136) and its reverse complement, which introduced a unique Notl site 5' of the heavy chain signal sequence, and 5' GGA CCA AGC TGG AGC TGA AGC GTA CGG ATG CTG CAC CAA CTG TAT CC 3' (SEQ ID NO: 137) and its reverse complement, which introduced a unique BsiWI site immediately downstream of the light chain variable/kappa constant domain junction. Mutated plasmids were identified by screening for the introduced Notl and BsiWI site changes. The light chain sequence was confirmed by DNA sequencing. The 0.42 kb Notl-BsiWI light chain variable domain fragment produced as described above, and the 0.34 kb BsiWI-Notl fragment from the plasmid pEAG1572, containing a sequence-confirmed humanized anti-LTbR kappa light chain constant domain cDNA were subcloned into the Notl site of the expression vector pEAG1256 (a sequence-confirmed pUC-based expression vector containing a phosphoglycerokinase promoter-driven neo selectable marker in which heterologous gene expression is controlled by a CMV-IE promoter and a human growth hormone polyadenylation signal). The light chain cDNA sequence in the resultant plasmid was confirmed by DNA sequencing. The sequence of the chimeric P2A7 light chain cDNA insert (from the signal sequence's initiator ATG through the terminator TAG) is shown below (SEQ ID NO: 138):
1 ATGGATTTTC AGGTGCAGAT TTTCAGCTTG CTGCTAATCA GTGTCACAGT
51 CATAGTGTCT AATGGAGAAG TTGTGCTCAC CCAGTCTCCA ACCGCCATGG
101 CTGCATCTCC CGGGGAGAAG ATCACTATCA CCTGCAGTGC CAGCTCAACT
151 TTAAGTTCCA ATTACTTGCA TTGGTATCAG CAGAAGCCAG GATTCTCCCC
201 TAAACTCTTG ATTTATAGGA CATCCAATCT GGCCTCTGGA GTCCCAGGTC 251 GCTTCAGTGG CAGTGGGTCT GGGACCTCTT ACTCTCTCAC AATTGGCACC
301 ATGGAGGCTG AAGATGTTGC CACTTACTAC TGCCAGCAGG GTAGTAGTAT 351 ACCGCTCACG TTCGGTGCTG GGACCAAGCT GGAGCTGAAG CGTACGGTGG 401 CTGCACCATC TGTCTTCATC TTCCCGCCAT CTGATGAGCA GTTGAAATCT 451 GGAACTGCCT CTGTTGTGTG CCTGCTGAAT AACTTCTATC CCAGAGAGGC 501 CAAAGTACAG TGGAAGGTGG ATAACGCCCT CCAATCGGGT AACTCCCAGG 551 AGAGTGTCAC AGAGCAGGAC AGCAAGGACA GCACCTACAG CCTCAGCAGC 601 ACCCTGACGC TGAGCAAAGC AGACTACGAG AAACACAAAG TCTACGCCTG 651 CGAAGTCACC CATCAGGGCC TGAGCTCGCC CGTCACAAAG AGCTTCAACA 701 GGGGAGAGTG TTAG
[0657] The predicted mature chP2A7 light chain protein sequence is shown below (SEQ
ID NO: 139):
1 EWLTQSPTA MAASPGEKIT ITCSASSTLS SNYLHWYQQK PGFSPKLLIY
51 RTSNIiASGVP GRFSGSGSGT SYSLTIGTME AEDVATYYCQ QGSSIPLTFG
101 AGTKLELKRT VAAPSVFIFP PSDEQLKSGT ASWCLLNNF YPREAKVQWK
151 VDNALQSGNS QESVTEQDSK DSTYSLSSTL TLSKADYEKH KVYACEVTHQ
201 GLSSPVTKSF NRGEC
[0658] The murine variable domain is residues 1-108 above, while the human kappa constant domain is residues 109-215 in the above sequence.
[0659] The chP2A7 heavy chain expression vector and the chP2A7 light chain expression vector were co-transfected into 293-EBNA cells and transfected cells were tested for antibody secretion and specificity. Empty vector- and hu5c8-S228P/T299A IgG4 (a molecularly cloned CD40L-specific mAb)- transfected cells served as controls. Western blot analysis (developed with anti-human heavy and light chain antibodies) of conditioned medium indicated that chP2A7-transfected cells synthesized and efficiently secreted heavy and light chains. FACS analysis of IGF-lR-expressing MCF7 human mammary adenocarcinoma cells stained with conditioned medium from transfected cells indicated that the chP2A7 antibody bound and produced staining patterns similar to those of muP2A7, while conditioned medium from mock- and hu5c8-transfected cells failed to stain MCF7 cells (detected with PE-conjugated anti-human heavy and light chain antibodies). Dilution titration indicated that specific staining with the conditioned medium containing chP2A7 mAb demonstrated a dose response. CHO cells were co- transfected with the chP2A7 heavy chain expression vector and the chP2A7 light chain expression vector to generate stable lines expressing chimeric P2A7-aglycosylated huIgG4, kappa mAb.
Cloning of anti-IGF-lR murine hybridoma 20C8.3B8 immunoglobulin variable regions
[0660] Variable domains of other anti-IGF-lR mAbs were cloned and chimerized by standard recombinant DNA techniques similar to those described for the P2A7 mAb. [0661] The predicted mature sequence of the 20C8.3B8 mAb heavy chain variable domain, belonging to murine subgroun I(A), is shown below with its CDRs underlined: 1 DVQLQESGPD LVKPSQSLSI. TCTVTGYSIT SGYSWHWIRQ FPGNKLEWMG 51 YIHYSGGTNY NPSLKSRISI TRDTSKNQFF LQLNSVTTED TATYYCARSG 101 YGYRSAYYFD YWGQGTTVTV SS (SEQ ID NO: 43)
[0662] The predicted mature sequence of the 20C8 light chain variable domain, belonging to murine kappa subgroup HI, is shown below:
1 DIVLTQSPAS LAVSLGQRAT ISCRASKSVS TSAYSYMHWY QQKPGQPPKL 51 LIYLASNLBS GVPARFSGSG SGTDFTLNIH PVEEEDAATY YCQHSRELPY 101 TFGGGTKLEI K (SEQ ID NO: 103)
[0663] Expression vectors for chimeric 20C8 heavy and light chain cDNAs were constructed as described above. The immunoglobulin cDNA sequence in the plasmids' inserts were confirmed by DNA sequencing. The sequence of the chimeric 20C8 heavy chain cDNA insert (from the signal sequence's initiator ATG through the terminator TGA) is shown below as SEQ ID NO: 140:
1 ATGGACTGGA CCTGGAGGGT CTTCTGCTTG CTGGCTGTAG CACCAGGTGC
51 CCACTCCGAC GTCCAACTGC AGGAGTCTGG ACCTGACCTG GTGAAACCTT
101 CTCAGTCACT TTCACTCACC TGCACTGTCA CTGGCTACTC CATCACCAGT
151 GGTTATAGCT GGCACTGGAT CCGGCAGTTT CCAGGAAACA AACTGGAATG
201 GATGGGCTAC ATACACTACA GTGGTGGCAC TAACTACAAC CCATCTCTCA 251 AAAGTCGAAT CTCTATCACT CGAGACACAT CCAAGAACCA GTTCTTCCTC
301 CAGTTGAATT CTGTGACTAC TGAGGACACA GCCACATATT ACTGTGCAAG 351 ATCGGGGTAC GGCTACAGGA GTGCGTACTA TTTTGACTAC TGGGGCCAAG
401 GGACCACGGT CACCGTCTCC TCAGCTTCCA CCAAGGGCCC ATCCGTCTTC 451 CCCCTGGCGC CCTGCTCCAG ATCTACCTCC GAGAGCACAG CCGCCCTGGG 501 CTGCCTGGTC AAGGACTACT TCCCCGAACC GGTGACGGTG TCGTGGAACT 551 CAGGCGCCCT GACCAGCGGC GTGCACACCT TCCCGGCTGT CCTACAGTCC 601 TCAGGACTCT ACTCCCTCAG CAGCGTGGTG ACCGTGCCCT CCAGCAGCTT 651 GGGCACGAAG ACCTACACCT GCAACGTAGA TCACAAGCCC AGCAACACCA 701 AGGTGGACAA GAGAGTTGAG TCCAAATATG GTCCCCCATG CCCACCGTGC 751 CCAGCACCTG AGTTCCTGGG GGGACCATCA GTCTTCCTGT TCCCCCCAAA
801 ACCCAAGGAC ACTCTCATGA TCTCCCGGAC CCCTGAGGTC ACGTGCGTGG
851 TGGTGGACGT GAGCCAGGAA GACCCCGAGG TCCAGTTCAA CTGGTACGTG
901 GATGGCGTGG AGGTGCATAA TGCCAAGACA AAGCCGCGGG AGGAGCAGTT
951 CAACAGCGCG TACCGTGTGG TCAGCGTCCT CACCGTCCTG CACCAGGACT
1001 GGCTGAACGG CAAGGAGTAC AAGTGCAAGG TCTCCAACAA AGGCCTCCCG
1051 TCCTCCATCG AGAAAACCAT CTCCAAAGCC AAAGGGCAGC CCCGAGAGCC
1101 ACAAGTGTAC ACCCTGCCCC CATCCCAGGA GGAGATGACC AAGAACCAGG
1151 TCAGCCTGAC CTGCCTGGTC AAAGGCTTCT ACCCCAGCGA CATCGCCGTG
1201 GAGTGGGAGA GCAATGGGCA GCCGGAGAAC AACTACAAGA CCACGCCTCC
1251 CGTCCTCGAT TCCGACGGCT CCTTCTTCCT CTACAGCAGG CTAACCGTGG
1301 ACAAGAGCAG GTGGCAGGAG GGGAATGTCT TCTCATGCTC CGTGATGCAT
1351 GAGGCTCTGC ACAACCACTA CACACAGAAG AGCCTCTCCC TGTCTCTGGG
1401 TTGA
[0664] The predicted mature ch20C8 heavy chain protein sequence is shown below as
SEQ ID NO: 141:
1 DVQLQESGPD LVKPSQSLSIi TCTVTGYSIT SGYSWHWIRQ FPGNKLEWMG
51 YIHYΞGGTNY NPSLKSRISI TPX)TSKNQFF LQLNSVTTED TATYYCARSG
101 YGYRSAYYFD YWGQGTTVTV SSASTKGPSV FPLAPCSRST SESTAALGCL
151 VKDYFPEPVT VSWNSGALTS GVHTFPAVLQ SSGLYSLSSV VTVPSSSLGT
201 KTYTCNVDHK PSNTKVDKRV ESKYGPPCPP CPAPEFLGGP SVFLFPPKPK
251 DTLMISRTPE VTCWVDVSQ EDPEVQFNWY VDGVEVHNAK TKPREEQFNS
301 AYRWSVLTV LHQDWLNGKE YKCKVSNKGL PSSIEKTISK AKGQPREPQV
351 YTLPPSQEEM TKNQVSLTCL VKGFYPSDIA VEWESNGQPE NNYKTTPPVL
401 DSDGSFFLYS RLTVDKSRWQ EGNVFSCSVM HEALHNHYTQ KSLSLSLG
[0665] The murine variable domain is residues 1-122, the human IgG4 heavy chain constant domain is residues 123-459. [0666] The sequence of the chimeric 20C8 light chain cDNA insert (from the signal sequence's initiator ATG through the terminator TAG) is shown below as SEQ ID
NO:142: 1 ATGGAGACAG ACACACTCCT GTTATGGGTA CTGCTGCTCT GGGTTCCAGG
51 TTCCACTGGT GACATTGTGC TGACACAGTC TCCTGCTTCC TTAGCTGTAT
101 CTCTGGGGCA GAGGGCCACC ATCTCATGCA GGGCCAGCAA AAGTGTCAGT
151 ACATCTGCCT ATAGTTATAT GCACTGGTAC CAACAGAAAC CAGGACAGCC
201 ACCCAAACTC CTCATCTATC TTGCATCCAA CCTAGAATCT GGGGTCCCTG
251 CCAGGTTCAG TGGCAGTGGG TCTGGGACAG ACTTCACCCT CAACATCCAT
301 CCTGTGGAGG AGGAGGATGC TGCAACCTAT TACTGTCAGC ACAGTAGGGA
351 GCTTCCGTAT ACGTTCGGAG GGGGGACCAA GCTGGAAATC AAACGTACGG
401 TGGCTGCACC ATCTGTCTTC ATCTTCCCGC CATCTGATGA GCAGTTGAAA
451 TCTGGAACTG CCTCTGTTGT GTGCCTGCTG AATAACTTCT ATCCCAGAGA
501 GGCCAAAGTA CAGTGGAAGG TGGATAACGC CCTCCAATCG GGTAACTCCC
551 AGGAGAGTGT CACAGAGCAG GACAGCAAGG ACAGCACCTA CAGCCTCAGC
601 AGCACCCTGA CGCTGAGCAA AGCAGACTAC GAGAAACACA AAGTCTACGC
651 CTGCGAAGTC ACCCATCAGG GCCTGAGCTC GCCCGTCACA AAGAGCTTCA
701 ACAGGGGAGA GTGTTAG
[0667] The predicted mature ch20C8 light chain protein sequence is shown below as SEQ
ID NO: 143:
1 DIVLTQSPAS LAVSLGQRAT ISCRASKSVS TSAYSYMHWY QQKPGQPPKL
51 LIYIiASNLES GVPARFSGSG SGTDFTLNIH PVEEEDAATY YCQHSRELPY
101 TFGGGTKLEI KRTVAAPSVF IFPPSDEQLK SGTASWCLL NNFYPREAKV
151 QWKVDNALQS GNSQESVTEQ DSKDSTYSLS STLTLSKADY EKHKVYACEV
201 THQGLSSPVT KSFNRGEC
[0668] The murine variable domain is residues 1-111 above, while the human kappa constant domain is residues 112-218 in the above sequence.
[0669] The ch20C8 heavy chain expression vector and ch20C8 light chain expression vector were co-transfected into 293-EBNA cells and transfected cells were tested for antibody secretion and specificity. Empty vector- and hu5c8-S228P/T299A IgG4 (a molecularly cloned CD40L-specific mAb)-transfected cells served as controls. Western blot analysis (developed with anti-human heavy and light chain antibodies) of conditioned medium indicated that ch20C8-transfected cells synthesized and efficiently secreted heavy and light chains. FACS analysis of IGF-lR-expressing MCF7 human mammary adenocarcinoma cells stained with conditioned medium from transfected cells indicated that the ch20C8 antibody bound with a titratable dose response, while conditioned medium from mock- and hu5c8-transfected cells failed to stain MCF7 cells (detected with PE-conjugated anti-human heavy and light chain antibodies). CHO cells were co-transfected with the ch20C8 heavy chain expression vector and ch20C8 light chain expression vector to generate stable lines expressing chimeric 20C8-aglycosylated huIgG4, kappa mAb.
Cloning of anti-IGF-lR mAb 20D8.24B11 immunoglobulin variable regions
[0670] The mAb 20D8.24B11 appears to be a sister clone of 20C8.3B8 (both were derived from fusion 7): sharing a common light chain and having a heavy chain that differs from that of 20C8 by a single residue in FR4. The predicted mature sequence of the 20D8.24B11 mAb heavy chain variable domain, belonging to murine subgroup I(A), is shown below with its CDRs underlined:
1 DVQLQESGPD LVKPSQSLSL TCTVTGYSIT SGYSWHWIRQ FPGNKLEWMG 51 YIHYSGGTNY NPSLKSRISI TRDTSKNQFF IiQLNSVTTED TATYYCARSG 101 YGYRSAYYFD YWGQGTTLTV SS (SEQ ID NO: 53)
[0671] An alignment of the 20D8 (upper) and 20C8 (lower) heavy chain variable domains, highlighting the single conservative difference corresponding to FR4 Kabat residue 109 (residue 118 below) is shown below:
1 DVQLQESGPDLVKPSQSLSLTCTVTGYSITSGYSWHWIRQFPGNKLEWMG 50 (SEQ ID NO : 53 )
1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 ! 1 1 1 1 1 1 1 1 1 1 1 1 1 1
1 DVQLQESGPDLVKPSQSLSLTCTVTGYSITSGYSWHWIRQFPGNKLEWMG 50 (SEQ ID NO:43) 51 YIHYSGGTNYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCARSG 100 (SEQ ID NO: 53)
1111111 Il 11111111 Il 111111111111111 Il 11111111111111
51 YIHYSGGTNYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCARSG 100 (SEQ ID N0:43) 101 YGYRSAYYFDYWGQGTTLTVSS 122 (SEQ ID NO: 53)
1 1 1 [ 1 1 1 1 ! M i I M 1 1 - 1 1 M
101 YGYRSAYYFDYWGQGTTVTVSS 122 (SEQ ID NO : 43 ) An expression vector for chimeric 20D8 heavy chain cDNA was constructed and the heavy chain cDNA insert in plasmid pCN380 was confirmed by DNA sequencing. The sequence of the chimeric 20D8 heavy chain cDNA insert (from the signal sequence's initiator ATG through the terminator TGA) is shown below as SEQ ID NO:144:
1 ATGGACTGGA CCTGGAGGGT CTTCTGCTTG CTGGCTGTAG CACCAGGTGC
51 CCACTCCGAC GTCCAACTGC AGGAGTCTGG ACCTGACCTG GTGAAACCTT
101 CTCAGTCACT TTCACTCACC TGCACTGTCA CTGGCTACTC CATCACCAGT
151 GGTTATAGCT GGCACTGGAT CCGGCAGTTT CCAGGAAACA AACTGGAATG
201 GATGGGCTAC ATACACTACA GTGGTGGCAC TAACTACAAC CCATCTCTCA
251 AAAGTCGAAT CTCTATCACT CGAGACACAT CCAAGAACCA GTTCTTCCTC
301 CAGTTGAATT CTGTGACTAC TGAGGACACA GCCACATATT ACTGTGCAAG
351 ATCGGGGTAC GGCTACAGGA GTGCGTACTA TTTTGACTAC TGGGGCCAAG
401 GGACCACGTT GACAGTCTCC TCAGCTTCCA CCAAGGGCCC ATCCGTCTTC
451 CCCCTGGCGC CCTGCTCCAG ATCTACCTCC GAGAGCACAG CCGCCCTGGG
501 CTGCCTGGTC AAGGACTACT TCCCCGAACC GGTGACGGTG TCGTGGAACT
551 CAGGCGCCCT GACCAGCGGC GTGCACACCT TCCCGGCTGT CCTACAGTCC
601 TCAGGACTCT ACTCCCTCAG CAGCGTGGTG ACCGTGCCCT CCAGCAGCTT
651 GGGCACGAAG ACCTACACCT GCAACGTAGA TCACAAGCCC AGCAACACCA
701 AGGTGGACAA GAGAGTTGAG TCCAAATATG GTCCCCCATG CCCACCGTGC
751 CCAGCACCTG AGTTCCTGGG GGGACCATCA GTCTTCCTGT TCCCCCCAAA
801 ACCCAAGGAC ACTCTCATGA TCTCCCGGAC CCCTGAGGTC ACGTGCGTGG
851 TGGTGGACGT GAGCCAGGAA GACCCCGAGG TCCAGTTCAA CTGGTACGTG
901 GATGGCGTGG AGGTGCATAA TGCCAAGACA AAGCCGCGGG AGGAGCAGTT
951 CAACAGCGCG TACCGTGTGG TCAGCGTCCT CACCGTCCTG CACCAGGACT
1001 GGCTGAACGG CAAGGAGTAC AAGTGCAAGG TCTCCAACAA AGGCCTCCCG
1051 TCCTCCATCG AGAAAACCAT CTCCAAAGCC AAAGGGCAGC CCCGAGAGCC
1101 ACAAGTGTAC ACCCTGCCCC CATCCCAGGA GGAGATGACC AAGAACCAGG
1151 TCAGCCTGAC CTGCCTGGTC AAAGGCTTCT ACCCCAGCGA CATCGCCGTG
1201 GAGTGGGAGA GCAATGGGCA GCCGGAGAAC AACTACAAGA CCACGCCTCC
1251 CGTCCTCGAT TCCGACGGCT CCTTCTTCCT CTACAGCAGG CTAACCGTGG 1301 ACAAGAGCAG GTGGCAGGAG GGGAATGTCT TCTCATGCTC CGTGATGCAT 1351 GAGGCTCTGC ACAACCACTA CACACAGAAG AGCCTCTCCC TGTCTCTGGG 1401 TTGA
[0673] The predicted mature ch20D8 heavy chain protein sequence encoded by the above sequence is shown below as SEQ ID NO: 145:
1 DVQLQESGPD LVKPSQSLSL TCTVTGYSIT SGYSWHWIRQ FPGNKLEWMG
51 YIHYSGGTNY NPSLKSRISI TRDTSKNQFF LQLNSVTTED TATYYCARSG
101 YGYRSAYYFD YWGQGTTLTV SSASTKGPSV FPLAPCSRST SESTAALGCL
151 VKDYFPEPVT VSWNSGALTS GVHTFPAVLQ SSGLYSLSSV VTVPSSSLGT
201 KTYTCNVDHK PSNTKVDKRV ESKYGPPCPP CPAPEFLGGP SVFLFPPKPK
251 DTLMISRTPE VTCWVDVSQ EDPEVQFNWY VDGVEVHNAK TKPREEQFNS
301 AYRWSVLTV LHQDWLNGKE YKCKVSNKGL PSSIEKTISK AKGQPREPQV
351 YTLPPSQEEM TKNQVSLTCL VKGFYPSDIA VEWESNGQPE NNYKTTPPVL
401 DSDGSFFLYS RLTVDKSRWQ EGNVFSCSVM HEALHNHYTQ KSLSLSLG
[0674] The murine variable domain is residues 1-122, the human S228P/T299A IgG4 heavy chain constant domain is residues 123-458. [0675] The 20D8 light chain variable sequence is identical to that of 20C8: please see the information previously described for 20C8.
Cloning of anti-IGF-lR mAb P1G10.2B8 immunoglobulin variable regions
[0676] The predicted sequence of the mature PlGlO heavy chain variable domain is shown below as SEQ ID NO:58, with its CDRs underlined:
1 QIQLVQSGPD LKKPGETVKI SCKASGYTFT NHGMNWVKQA PGKDLKWMGW 51 INTNTGEPTY ADDFKGRFAF SLETSASTAY LQINNLKNED TATYFCASPL 101 YYRNGRYFDV WGAGTTVTVS S
[0677] PlGlO appears to belong to the murine heavy chain variable domain subgroup
H(A), but with only 55% identity to the heavy II(A) consensus sequence.
[0678] An expression vector for the chimeric PlGlO heavy chain cDNA was constructed and its cDNA insert was sequence confirmed. The sequence of the chimeric PlGlO heavy chain cDNA insert (from the signal sequence's initiator ATG through the terminator TGA is shown below as SEQ ID NO: 146:
1 ATGGGTTGGA TCTGTATCTT TCTATTCTTG GTGGCAGCTG CCCAAAGTGC
51 CCAAGCACAG ATCCAGTTGG TGCAGTCTGG ACCTGACCTG AAGAAGCCTG
101 GAGAGACAGT CAAGATCTCC TGCAAGGCTT CTGGGTATAC CTTCACAAAC
151 CATGGAATGA ACTGGGTGAA GCAGGCTCCA GGAAAGGATT TAAAGTGGAT
201 GGGCTGGATA AACACCAACA CTGGAGAGCC AACATATGCT GATGACTTCA
251 AGGGACGGTT TGCCTTCTCT TTGGAAACCT CTGCCAGCAC TGCCTATTTG
301 CAGATCAACA ACCTCAAAAA TGAGGACACG GCTACATATT TCTGTGCAAG
351 TCCCCTCTAC TATAGGAACG GGCGATACTT CGATGTCTGG GGCGCAGGGA
401 CCACGGTCAC CGTCTCCTCA GCTTCCACCA AGGGCCCATC CGTCTTCCCC
451 CTGGCGCCCT GCTCCAGATC TACCTCCGAG AGCACAGCCG CCCTGGGCTG
501 CCTGGTCAAG GACTACTTCC CCGAACCGGT GACGGTGTCG TGGAACTCAG
551 GCGCCCTGAC CAGCGGCGTG CACACCTTCC CGGCTGTCCT ACAGTCCTCA
601 GGACTCTACT CCCTCAGCAG CGTGGTGACC GTGCCCTCCA GCAGCTTGGG
651 CACGAAGACC TACACCTGCA ACGTAGATCA CAAGCCCAGC AACACCAAGG
701 TGGACAAGAG AGTTGAGTCC AAATATGGTC CCCCATGCCC ACCGTGCCCA
751 GCACCTGAGT TCCTGGGGGG ACCATCAGTC TTCCTGTTCC CCCCAAAACC
801 CAAGGACACT CTCATGATCT CCCGGACCCC TGAGGTCACG TGCGTGGTGG
851 TGGACGTGAG CCAGGAAGAC CCCGAGGTCC AGTTCAACTG GTACGTGGAT
901 GGCGTGGAGG TGCATAATGC CAAGACAAAG CCGCGGGAGG AGCAGTTCAA
951 CAGCGCGTAC CGTGTGGTCA GCGTCCTCAC CGTCCTGCAC CAGGACTGGC
1001 TGAACGGCAA GGAGTACAAG TGCAAGGTCT CCAACAAAGG CCTCCCGTCC
1051 TCCATCGAGA AAACCATCTC CAAAGCCAAA GGGCAGCCCC GAGAGCCACA
1101 AGTGTACACC CTGCCCCCAT CCCAGGAGGA GATGACCAAG AACCAGGTCA
1151 GCCTGACCTG CCTGGTCAAA GGCTTCTACC CCAGCGACAT CGCCGTGGAG
1201 TGGGAGAGCA ATGGGCAGCC GGAGAACAAC TACAAGACCA CGCCTCCCGT
1251 CCTCGATTCC GACGGCTCCT TCTTCCTCTA CAGCAGGCTA ACCGTGGACA
1301 AGAGCAGGTG GCAGGAGGGG AATGTCTTCT CATGCTCCGT GATGCATGAG
1351 GCTCTGCACA ACCACTACAC ACAGAAGAGC CTCTCCCTGT CTCTGGGTTG 1401 A
[0679] The predicted mature chPlGlO heavy chain protein sequence encoded the sequence above is shown below as SEQ ID NO: 147:
1 QIQLVQSGPD LKKPGETVKI SCKASGYTFT NHGMNWVKQA PGKDLKWMGW
51 INTNTGEPTY ADDFKGRFAF SLETSASTAY LQINNLKNED TATYFCASPL
101 YYRNGRYFDV WGAGTTVTVS SASTKGPSVF PLAPCSRSTS ESTAALGCLV
151 KDYFPEPVTV SWNSGALTSG VHTFPAVLQS SGLYSLSSW TVPSSSLGTK
201 TYTCNVDHKP SNTKVDKRVE SKYGPPCPPC PAPEFLGGPS VFLFPPKPKD
251 TLMISRTPEV TCWVDVSQE DPEVQFNWYV DGVEVHNAKT KPREEQFNSA
301 YRWSVLTVL HQDWLNGKEY KCKVSNKGLP SSIEKTISKA KGQPREPQVY
351 TLPPSQEEMT KNQVSLTCLV KGFYPSDIAV EWESNGQPEN NYKTTPPVLD
401 SDGSFFLYSR LTVDKSRWQE GNVFSCSVMH EALHNHYTQK SLSLSLG
[0680] The murine variable domain is residues 1-121, the human S228P/T299A IgG4 heavy chain constant domain is residues 122-457. [0681] The predicted sequence of the mature PlGlO light chain variable domain, belonging to murine kappa subgroup V, is shown below as SEQ ID NO: 113, with its
CDRs underlined:
1 DIQMTQTTSS LSASLGDRVT ISCRASQDIS NYLNWYQQKP DGSVKLLIYY 51 TSRLHSGVPS RFSGSGSGTD YSLTISNLEQ EDIATYFCQQ GKTLPWTFGG 101 GTKLEIK
[0682] An expression vector for the chimeric PlGlO light chain cDNA was constructed and its cDNA insert was sequence confirmed. The sequence of the chimeric PlGlO light chain cDNA insert (from the signal sequence's initiator ATG through the terminator TAG) is shown below as SEQ ID NO: 148:
1 ATGAGGTCCC CTGCTCAGTT TCTTGGTCTC CTGTTGCTCT GTTTTCAAGG 51 TGCCAGATGT GATATCCAGA TGACACAGAC TACATCCTCC CTGTCTGCCT 101 CTCTGGGAGA CAGAGTCACC ATCAGTTGCA GGGCAAGTCA GGACATTAGT
151 AATTATTTAA ATTGGTATCA GCAGAAACCA GATGGATCTG TTAAACTCCT
201 GATCTACTAC ACATCAAGAT TACACTCAGG AGTCCCATCA AGGTTCAGTG
251 GCAGTGGGTC TGGAACAGAT TATTCTCTCA CCATTAGCAA CCTGGAACAA
301 GAAGATATTG CCACTTACTT TTGCCAACAG GGAAAGACGC TTCCGTGGAC
351 GTTCGGTGGA GGCACCAAGC TGGAAATCAA ACGTACGGTG GCTGCACCAT
401 CTGTCTTCAT CTTCCCGCCA TCTGATGAGC AGTTGAAATC TGGAACTGCC
451 TCTGTTGTGT GCCTGCTGAA TAACTTCTAT CCCAGAGAGG CCAAAGTACA
501 GTGGAAGGTG GATAACGCCC TCCAATCGGG TAACTCCCAG GAGAGTGTCA
551 CAGAGCAGGA CAGCAAGGAC AGCACCTACA GCCTCAGCAG CACCCTGACG
601 CTGAGCAAAG CAGACTACGA GAAACACAAA GTCTACGCCT GCGAAGTCAC
651 CCATCAGGGC CTGAGCTCGC CCGTCACAAA GAGCTTCAAC AGGGGAGAGT
701 GTTAG
[0683] The predicted mature chPlGlO light chain protein sequence encoded by the sequence above is shown below as SEQ ID NO: 149:
1 DIQMTQTTSS LSASLGDRVT ISCRASQDIS NYLNWYQQKP DGSVKLLIYY
51 TSRLHSGVPS RFSGSGSGTD YSLTISNLEQ EDIATYFCQQ GKTLPWTFGG
101 GTKLEIKRTV AAPSVFIFPP SDEQIiKSGTA SWCLLNNFY PREAKVQWKV
151 DNALQSGNSQ ESVTEQDSKD STYSLSSTLT LSKADYEKHK VYACEVTHQG
201 LSSPVTKSFN RGEC
[0684] The murine variable domain is residues 1-107 above, while the human kappa constant domain is residues 108-214 in the above sequence.
[0685] The chPlGlO heavy chain expression vector and chPlGlO light chain expression vector were co-transfected into 293-EBNA cells and transfected cells were tested for antibody secretion and specificity (empty vector- and hu5c8-S228P/T299A IgG4 (a molecularly cloned CD40L-specific mAb)-transfected cells served as controls). Western blot analysis (developed with anti-human heavy and light chain antibodies) of conditioned medium indicated that chPlGlO-transfected cells synthesized and efficiently secreted heavy and light chains. FACS analysis of IGF-lR-expressing MCF7 human mammary adenocarcinoma cells stained with conditioned medium from transfected cells indicated that the chPlGlO antibody bound with a titratable dose response, while conditioned medium from mock- and hu5c8-transfected cells failed to stain MCF7 cells (detected with PE-conjugated anti-human heavy and light chain antibodies). CHO cells were co-transfected with the chPlGlO heavy chain expression vector and chPlGlO light chain expression vector to generate stable lines expressing chimeric PlGlO-aglycosylated huIgG4, kappa mAb.
Cloning of anti-IGF-lR mAb P1A2.2B11 immunoglobulin variable regions
[0686] The predicted sequence of the mature P1A2 heavy chain variable domain, belonging to murine subgroup U(A) is shown below as SEQ ID NO:48:
1 QIQLVQSGPE LKKPGETVKI SCKASGYTFT NHGMNWVKQA PGKGLKWMGW 51 NTSTGEPTYA DDFKGRFAFS LETSASTAFL QINNLKNEDT ASYFCASPLY 101 YMYGRYIDVW GAGTAVTVSS
[0687] The Pl A2 heavy chain is 92.6% identical to that of PlGlO (both were derived from fusion 5), with one FRl, one FR2, two CDR2, two FR3, two CDR3, and 1 FR4 differences. The alignment of the P1A2 (upper line) and PlGlO (lower line) heavy chain variable domains is shown below:
1 QIQLVQSGPELKKPGETVKISCKASGYTFTNHGMNWVKQAPGKGLKWMGW 50 (SEQ ID NO : 48)
1 1 1 1 1 1 1 1 i ^ 1 1 1 1 ! E 1 1 1 1 1 1 1 1 1 1 1 M 1 1 1 1 1 1 1 1 1 1 1 1 1 1 I M I I I
1 QIQLVQSGPDLKKPGETVKISCKASGYTFTNHGMNWVKQAPGKDLKWMGW 50 (SEQ ID NO: 58) 51 .NTSTGEPTYADDFKGRFAFSLETSASTAFLQINNLKNEDTASYFCASPL 99 (SEQ ID NO:48)
51 INTNTGEPTYADDFKGRFAFSLETSAΞTAYLQINNLKNEDTATYFCASPL 100 (SEQ ID NO: 58)
100 YYMYGRYIDVWGAGTAVTVSS 120 (SEQ ID NO:48)
I l I I I I M M M M i l l
101 YYRNGRYFDVWGAGTTVTVSS 121 (SEQ ID NO : 58 )
[0688] An expression vector for the chimeric P1A2 heavy chain is constructed by the methods described above. The predicted sequence of the chPlA2 heavy chain encoded by that plasmid (SEQ ID NO: 150) is:
1 QIQLVQSGPE LKKPGETVKI SCKASGYTFT NHGMNWVKQA PGKGLKWMGW
51 NTSTGEPTYA DDFKGRFAFS LETSASTAFL QINNLKNEDT ASYFCASPLY 101 YMYGRYIDVW GAGTAVTVSS ASTKGPSVFP LAPCSRSTSE STAALGCLVK
151 DYFPEPVTVS WNSGALTSGV HTFPAVLQSS GLYSLSSWT VPSSSLGTKT
201 YTCNVDHKPS NTKVDKRVES KYGPPCPPCP APEFLGGPSV FLFPPKPKDT
251 LMISRTPEVT CVWDVSQED PEVQFNWYVD GVEVHNAKTK PREEQFNSAY
301 RWSVLTVLH QDWLNGKEYK CKVSNKGLPS SIEKTISKAK GQPREPQVYT
351 LPPSQEEMTK NQVSLTCLVK GFYPSDIAVE WESNGQPENN YKTTPPVLDS
401 DGSFFLYSRL TVDKSRWQEG NVFSCSVMHE ALHNHYTQKS LSLSLG
[0689] The murine variable domain is residues 1-120, the human S228P/T299A IgG4 heavy chain constant domain is residues 121-456. [0690] The predicted sequence of the mature P1A2 light chain variable domain, belonging to murine kappa subgroup V, is shown below as SEQ ID NO: 108, with its
CDRs underlined:
1 DIQMTQTTSS LSASLGDRVT ISCRASQDIS NYLNWYQQKP DGTIKLLIYY 51 TSRLHSGVPS RFSGSGSGTD YSLTISNLEQ EDFATYFCQQ GKTLPWTFGG 101 GTKLEIK
[0691] The Pl A2 light chain is 97.2% identical to that of PlGlO (both were derived from fusion 5), with two FR2 and one FR3 difference, but sharing identical CDRs. The alignment of the P1A2 (upper line) and PlGlO (lower line) light chain variable domains is shown below:
1 DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTIKLLIYY 50 (SEQ ID NO: 108)
111 i 1111111 ! 111111111111111111111 i ! 1 i 11111 - ^ 111111
1 DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGSVKLLIYY 50 (SEQ ID NO: 113) 51 TSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDFATYFCQQGKTLPWTFGG 100 (SEQ ID NO: 108)
1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 f 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 I I M I I I I I I I M I I I I
51 TSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGKTLPWTFGG 100 (SEQ ID NO: 113) 101 GTKLEIK 107 (SEQ ID NO: 108)
MIIIII
101 GTKLEIK 107 (SEQ ID NO: 113)
[0692] An expression vector for the chimeric P1A2 light chain cDNA was constructed and its cDNA insert was sequence confirmed. The sequence of the chimeric P1A2 light chain cDNA insert (from the signal sequence's initiator ATG through the terminator TAG) is shown below as SEQ ID NO: 151:
1 ATGAGGTCCC CTGCTCAGTT TCTTGGAGAC CTGTTGCTCT GTTTTCAAGG
51 TACCAGATGT GATATCCAGA TGACACAGAC TACATCCTCC CTATCTGCCT
101 CTCTGGGAGA CAGAGTCACC ATCAGTTGCA GGGCAAGTCA GGACATTAGC
151 AATTATTTAA ACTGGTATCA GCAGAAACCA GATGGAACTA TTAAACTCCT
201 GATCTACTAC ACATCAAGAT TACACTCAGG AGTCCCATCA AGGTTCAGTG
251 GCAGTGGGTC TGGAACAGAT TATTCTCTCA CCATTAGCAA CCTGGAACAA
301 GAAGATTTTG CCACTTACTT TTGCCAACAG GGTAAAACGC TTCCGTGGAC
351 GTTCGGTGGA GGCACCAAGC TGGAAATCAA ACGTACGGTG GCTGCACCAT
401 CTGTCTTCAT CTTCCCGCCA TCTGATGAGC AGTTGAAATC TGGAACTGCC
451 TCTGTTGTGT GCCTGCTGAA TAACTTCTAT CCCAGAGAGG CCAAAGTACA
501 GTGGAAGGTG GATAACGCCC TCCAATCGGG TAACTCCCAG GAGAGTGTCA
551 CAGAGCAGGA CAGCAAGGAC AGCACCTACA GCCTCAGCAG CACCCTGACG
601 CTGAGCAAAG CAGACTACGA GAAACACAAA GTCTACGCCT GCGAAGTCAC
651 CCATCAGGGC CTGAGCTCGC CCGTCACAAA GAGCTTCAAC AGGGGAGAGT
701 GTTAG
[0693] The predicted mature chPl A2 light chain protein sequence encoded by pCN379 is shown below as SEQ ID NO: 152:
1 DIQMTQTTSS LSASLGDRVT ISCRASQDIS NYLNWYQQKP DGTIKLLIYY
51 TSRLHSGVPS RFSGSGSGTD YSLTISNLEQ EDFATYFCQQ GKTLPWTFGG
101 GTKLEIKRTV AAPSVFIFPP SDEQLKSGTA SWCLIiNNFY PREAKVQWKV
151 DNALQSGNSQ ESVTEQDSKD STYSLSSTLT LSKADYEKHK VYACEVTHQG
201 LSSPVTKSFN RGEC
[0694] The murine variable domain is residues 1-107 above, while the human kappa constant domain is residues 108-214 in the above sequence. Cloning ofanti-IGF-lR mAb P1E2.3B12 immunoglobulin variable regions
[0695] Cloning of the P1E2 variable domains is carried out by the methods described above.
Example 19
IGF-IR Fab antibodies bind soluble IGF-IR with high affinity
[0696] Method: The binding activity of M13-C06, M14-C03, and M14-G11 Fabs to soluble IGF-IR was measured using surface plasmon resonance. Biotinylated PENTA- His Antibody (Qiagen, Inc.) was immobilized onto a Streptavidin coated Sensor Chip. Soluble/Dimeric IGF-1R-His ectodomain (R&D systems, Inc.) was captured on the surface via the PENTA-His antibody. Secondary injections of M13-C06, M14-C03, or M14-G11 Fabs (0.5 nM - lOOOnM) were performed. The surfaces were regenerated with three short injections of acetate, pH 4.0.
[0697] Results: The M13-C06 Fab bound recombinant IGF-IR with the highest affinity at
KD = 1.3 nM, whereas M14-G11 Fab bound with a KD = 4.0 nM, and M14-C03 Fab bound with a KD = 4.9 nM (data not shown).
Example 20
Inhibition of IGF-I and IGF-2 stimulated tumor cell growth by fully human IGF-IR antibodies
[0698] Method: The effect of antibody on tumor growth in vitro was measured using a
CELL TITER-GLO™ assay (Promega Corporation, 2800 Woods Hollow Rd., Madison, WI 53711 USA). BxPC3 cells in 10% FBS containing RPMI medium were cultured in Wallac 96-well clear bottom TC-treated plates (8000 cell/well). After 24 hours, culture medium was changed to serum free condition and antibodies at different concentrations (100 nM, 10 nM, 1 nM, and 0.1 nM) were added. Following 30 minute incubation, IGF-I or IGF-2 was added at 100 ng/ml. The cells were incubated for another 48 hours until lysed to determine the amount of ATP present using the CELL TITER-GLO™ reagent. Inhibition was calculated as [l-(Ab-SFM)/( IGF -SFM)] x 100%. An isotype matched antibody, IDEC-151 (human G4), antibody was used as a negative control. [0699] Results: Fully human antibodies M13-C06.G4.P.agly, M14-G11.G4.P and M14-
C03.G4.P.agly inhibited BxPC3 (human pancreas adenocarcinoma) cell proliferation driven with recombinant human IGF-I and IGF-2 (Figure 16). Similar growth inhibition results were obtained with these antibodies against cell proliferation driven with recombinant human IGF-I and IGF-2 in human lung cancer cell line NCI-H23 (Figure 17; M13-C06.G4.P.agly antibody) and human lung cancer cell line A549 (Figure 18; M13-C06.G4.P.agly antibody). In all three cell lines M14-G11.G4.P,agly showed similar results as M14.G11.G4.P version (data not shown).
Example 21
Cell-cycle arrest of tumor cell growth in vitro by fully human IGF-IR antibodies
[0700} Method: The ability of fully human IGF-IR antibodies to arrest cell cycle progression was assessed by FACS analysis; monitoring incorporation of propidium iodide in cultured BxPC3 cells. BxPC3 cells (4 x 105 cells/well) were plated into 6 well plates. After 24 hours, cells were changed to serum-free media (SFM) for the following 24 hours. Next the IGF-IR antibodies at a final concentration of 133.3 nM (20 micrograms/ml) and IGF-I at 200 ng/ml was added to the media. After 24 hours, the cells were trypsinized and fixed with ethanol. DNA content was stained with propidium iodide (PI) prior to FACS analysis. An isotype matched antibody, IDEC-151 (human G4), was used as a negative control.
[0701] Results: Fully human antibodies M13-C06.G4.P.agly (Table 11), M14-
Gl l.G4.P.agly and M14-C03.G4.P.agly arrested the BxPC3 tumor cells at the G0/G1 phase of the cell cycle.
Table 11:
Example 22
In vivo inhibition of tumor growth in a pancreatic cancer model.
[0702] Methods: Single agent in vivo efficacy of M13.C06.G4.P.agly antibody was evaluated in a xenograft pancreatic cancer model system using BxPC3 (pancreatic cancer) cells. CB17 SCID mice were inoculated with 2 x 106 cells and monitored for tumor growth. Mean tumor volume at the start of the therapy was ~ 200mm . The M13.C06.G4.P.agly antibody "was administered intraperitoneally (i.p.) at 60, 30 and 15 mg/kg administered one time per week for 5 weeks. An isotype matched antibody, EDEC-151 (human G4), was administered as a negative control at 60 mg/kg one time per week for 5 weeks. Tumors were extracted at the indicated intervals post-inoculation (Figure 20) and total tumor volume was measured.
[0703] Results: The fully human Ml 3.C06.G4.P.agly antibody inhibited tumor growth in a dose dependent manner (Figure 20). The antibody demonstrated statistically significant single agent efficacy at 60, 30 and 15 mg/kg administered weekly for 5 weeks. Moreover, the antibody was efficacious at doses as low as 15 mg/kg administered once a week (Figure 20).
Example 23
In vivo inhibition of tumor growth in a lung cancer model.
[0704] Methods: Single agent in vivo efficacy of M13.C06.G4.P.agly antibody was evaluated in a xenograft lung cancer model system using A549 (lung cancer) cells. CB 17 SCID mice were inoculated with 3-5 x 106 cells and monitored for tumor growth. Mean tumor volume at the start of the therapy was ~ 150mm3. The M13.C06.G4.P.agly antibody was administered intraperitoneally (i.p.) at 30 and 15 mg/kg administered two times per week per week for 4 weeks. An isotype matched antibody, IDEC-151 (human G4), was administered as a negative control at 30 mg/kg. Tumors were extracted at the indicated intervals post-inoculation (Figure 21) and total tumor volume was measured.
[0705] Results: The fully human Ml 3.C06.G4.P.agly antibody inhibited tumor growth in a dose dependent manner (Figure 21). The antibody demonstrated statistically significant single agent efficacy at 30 and 15 mg/kg doses administered over a 4 week period (Figure 21). Additional studies performed in this model showed that C06 is efficacious at doses as low as 7.5 mg/kg weekly injections (data not shown).
Example 24
In vivo inhibition of tumor growth using combination therapy
[0706] Method: The efficacy of M13.C06.G4.P.agly antibody in inhibiting tumor growth in combination with gemcitabine (a drug commonly used to treat non-small cell lung cancer, pancreatic, bladder and breast cancer) was tested in a BxPC3 xenograft model. The efficacy of M13.C06.G4.P.agly antibody administered intraperitoneally (i.p.) two times per week at 30 mg/kg for 7 weeks (data not shown) or one time per week at 60 mg/kg for 5 weeks (Figure 22) was evaluated in combination with gemcitabine administered according to the current standard of care (i.e., 80 mg/kg every 3 days for 4 weeks). Gemcitabine alone, M13.C06.G4.P.agly antibody alone, and sham injections of the delivery vehicle alone were administered as negative controls. Tumor volume at the start of the therapy was approximately 200mm3.
[0707] Results: M13-C06.G4.P.agly antibody and gemcitabine as a single agent (i.e., administered alone) showed similar efficacy. In combination with Gemcitabine, the M13-C06.G4.P.agly antibody at 30 mg/kg on twice a week schedule (data not shown) or 60 mg/kg on a weekly schedule (Figure 22) showed additive efficacy compared to the single agent treatments. In addition, combination with 15mg/kg also showed additive efficacy (data not shown)
Example 25
Fully human IGF-IR antibody binds to cynomolgus macaque fibroblast cell line
[0708] Methods: The M13.C06.G4.P.agly antibody binds to a fibroblast cell line established from cynomolgus macaque. The fibroblast cell line was generated from a skin biopsy. Antibody binding was assessed by lifting the fibroblast cells with cell disassociation buffer and incubating with biotinylated M13.C06.G4.P.agly for 45 minutes at 40C. After washing the cells, streptavidin-PE was added and incubated for additional 30 minutes at 4°C in the dark. The cells were then washed and 200ul cold PBS was added followed by fixation with 1% formaldehyde and gentle vortexing. Antibody binding was assessed by FACS analysis.
[0709] Results: The M13-C06.G4.P.agly antibody binds to IGF-IR expressed on the cynomolgus fibroblast cell line in a concentration dependent manner (Figure 23).
Example 26
Part I: Summary of Biological Characteristics of Fully Human M13.C06.G4.P.agly
Antibody
[0710] Biological characteristics assessed for fully human M13.C06.G4.P.agly antibody are presented in Tables 11 and 12. These characteristics were ascertained by methods, experiments, and examples described herein and/or as may be routinely determined via methods and experiments known and performed by those of ordinary skill in the art.
Table 11:
Ml 3.C06.G4.P.agly Antibody Serum Half-Life
[0711] A pharmacokinetic (PK) study in non-tumor bearing mice was performed using 3 mg/kg of M13.C06.G4.P.agly antibody (one dose level, intraperitoneal injections) in SCID mice. M13.C06.G4.P.agly antibody in SCID mouse serum was detected using IgG specific ELISA. Goat anti-human IgG (100 ng/well) was immobilized on immulon plates. Serums were titrated in triplicate starting at 1 :25 with two fold serial dilutions. Binding was determined using Goat anti-human Kappa-HRP. Results of this study indicate a serum-half life of ~11.5 days in this mouse model system (data not shown).
[0712] Serum concentrations of M13.C06.G4.P.agly were assessed after intraperitoneal injections in MCF-7 tumor bearing animals (antibody at 30ug/kg) and BxPC3 tumor bearing animals (antibody at 15ug/kg). Binding of M13.C06.G4.P.agly antibody to Goat anti-Human IgG (100 ng/well) immobilized on 96-well (IMMULON2 HB, Dynax Technologies, Inc., Cat. #3455) was measured via ELISA. Standard curves were titrated starting at 10 ug/ml with 3 fold serial dilutions. Serum was titrated starting at 1 :25 dilutions with 2 fold serial dilutions. M13.C06.G4.P.agly antibody was detected using Goat anti-human Kappa-HRP. SOFTMAX PRO software package version 4.3 LS (Molecular Devices Corp.) was used to determine antibody concentrations.
[0713] Average serum concentrations were observed as shown below:
[0714] The pharmocokinetics of M13.C06.G4.P.agly antibody has also been investigated in cynomolgus monkeys after lOmg/kg and 25mg/kg dose injections, where the serum half-life was observed to be — 10 to 12 days (data not shown).
[0715] Tables 12 and 13 show the dose dependent inhibition (percent inhibition) of in vitro cell growth observed for various lung, pancreas, and colon tumor cell lines when M13-C06.G4.P.agly antibody is added to cell culture media supplemented with IGF-I or IGF-2 (Table 12) or supplemented with 10% fetal calf serum (FCS) or fetal bovine serum (FBS) (Table 13).
Table 12:
Table 13:
Part II: Antibody Affinity Measurements
Objective: [0716] The objective was to measure the binding affinity of IGF-IR antibodies.
Methods:
Preparation of M13-C06, M14-C03, and M14-G11 Fabs
[07171 M13-C06, M14-C03, and M14-G11 Fab antibodies were prepared by digestion with immobilized papain (Pierce Cat. No. 20341). The papain resin was washed with 2OmM sodium phosphate pH 7.0; 1OmM EDTA; 2OmM Cysteine. Antibodies were mixed with the papain resin in 50OmM EDTA, 10OmM Cysteine pH 7.0 and digested for three hours in a 37°C water bath followed by mixing on an inverting shaker overnight at room temperature. Completion of each digestion was determined by analytical size exclusion chromatography (SEC). The resin was removed from the digested protein with a sintered glass funnel filter and washed with 2OmM acetate pH 5.0. The flowthrough was collected and diluted 10-fold with 2OmM acetate pH 5.0. Fab fragments were purified by S-SEPHAROSE™ cation exchange chromatography using a linear salt gradient. Analytical SEC was performed on the eluted fractions and the desired fractions were pooled and dialyzed into PBS. The Fabs were subsequently alkylated to inhibit the re-formation of hinge disulfides resulting in (Fab)2 production. Alkylation was carried out by diluting IM Tris; 20OmM Iodoacetate pH 8.5 10-fold into the Fab solutions. The mixtures were incubated on an inverting shaker for twenty minutes at room temperature followed by exhaustive dialysis into IxPBS. Final purification of each Fab was performed using preparative size exclusion chromatography.
Surface Plasmon Resonance (SPR) Affinity Measurements
[0718] All surface plasmon resonance (SPR) experiments were performed on a Biacore
3000 set to 25 0C using HBS-EP (Biacore, Cat. No. BR-1001-88) as the running buffer. A biotin-labeled anti-HisTag antibody (biotin-PENTA-His, Qiagen Cat. No. 34440) was immobilized to saturation on a Biacore SA chip (Cat. No. BR- 1000-32) surface by injection at 500 nM in HBS-EP buffer. Recombinant human IGF-I R- lOHis (R&D Systems, Cat. No. 305-GR-050) was captured on the biotin-PENTA-His surface by injecting 20 μL of 40 nM protein at 2 μL/min. Subsequent to IGF-IR injections, flow rates were increased to 20 μL/min. A second, 130 μL injection of anti-IGF-lR antibody or Fab was performed to investigate interactions with the receptor. Each antibody and Fab was serially diluted from 64 nM to 0.5 nM to obtain concentration dependent kinetic binding curves. Each injection series was regenerated using 3x10 μL injections of 10 mM Acetate, pH 4.0, at 20 μL/min. Each curve was double referenced using (1) data obtained from a streptavidin surface devoid of IGF-IR and (2) data from a primary injection of IGF-IR followed by a secondary injection of HBS-EP buffer. The concentration series for each antibody and Fab was fit to the 1:1 binding model provided within the BiaE valuation software of the manufacturer.
Results Three recombinant anti-IGF-lR antibodies, M13-C06, M14-C03, and M14-G11, were tested for binding to IGF-IR using surface plasmon resonance as described above. All three antibodies demonstrated strong binding to the receptor. Concentration dependent binding of each antibody (64 nM serially diluted to 0.5 nM) to immobilized recombinant human IGF-IR was observed (data not shown). The rates at which the antibodies accumulate on the IGF-IR coated surface when applied at various concentrations as well as the rates at which they dissociated during applications of pure buffer were investigated by fitting the data to a 1 :1 binding model. Approximate kinetic rate constants and equilibrium dissociation constant were calculated (Table 14).
Table 14
Table 15
[0720] To obtain discrete affinities, Fab fragments of each antibody were generated using papain digestion as described above. Due to the presence of a single antigen binding site, the Fabs uniformly demonstrated monophasic binding and dissociation curves when applied to the IGF-IR receptor in an identical fashion as described for the full-length antibodies (data not shown). The affinities of each Fab for IGF-IR are provided in Table 15.
Example 27
Part I: M13.C06.G4.P.agIy Antibody Has Unique Epitope Binding Characteristics
Compared to Other IGF-IR Antibodies
[0721] A cross-competition antibody binding study was performed to compare the IGF-
IR antibody binding epitopes of M13.C06.G4.P.agly and other IGF-IR antibodies. See, Figure 24. Unlabeled competitor antibodies were analyzed for their ability to cross- compete with five different labeled antibodies for binding to soluble IGF-IR. The five labeled antibodies used were biotin-labeled M13.C06.G4.P.agly ("Biotin-C06"), biotin labeled M14-G11 ("Biotin-Gl l"), zenon-labeled P1B10-1A10 ("Zenon-O"), zenon- labeled 20C8-3B4 ("Zenon-M"), or zenon-labeled IR3 antibody ("Zenon-IR3"). See, Figure 24.
[0722] Antibodies were labeled with Biotin using a Biotinylation kit from Pierce
Chemical (#21335).
[0723] Zenon labeling was performed using Zenon mouse IgG labeling kit from
Molecular Probes (Z25000).
= antibody binding competition relative to itself (90-100%)
N/A = results not available. [0724] The results of this analysis indicate that M13.C06.G4.P.agly and
M14.C03.G4.P.agly antibodies bind to the same or a similar region of IGF-IR, which is distinct from all other antibodies tested. In particular, only biotin-labeled M13.C06.G4.P.agly antibody was effectively competed from IGF-IR binding by unlabeled M13.C06.G4.P.agly or by unlabeled M14.C03.G4.P.agly. It is also notable that M13.C06.G4.P.agly does not cross-compete with the well-studied IR3 antibody. Hence, these two antibodies, in particular, bind to different IGF-IR epitopes.
Part II: M13-C06 allosterically decreases the binding affinity of IGF-I for IGF-IR via antibody binding to the N-terminal region of the FnIII-I domain
Objective:
[0725] The objective was to elucidate the binding epitope of M13-C06 antibody on IGF-
IR and the mechanism behind inhibition of IGF-l/IGF-2 binding to IGF-IR.
Background:
[0726] IGF-IR consists of 6 domains (Figure 29A). It has been published that mutations in the first three domains of IGF-IR, denoted Ll (leucine rich repeat domain 1), CR (cysteine rich repeat domain), and L2, as well as a peptidic loop region in domain 5 (FnIII-2, Fibronectin type in domain 2) have a negative impact on IGF-I and IGF-2 binding (Whittaker 2001; Sorensen 2004). Here, we demonstrate that M13-C06 antibody does not block IGF-I and IGF-2 binding to IGF-IR by competitively interacting with the growth factor binding site, but instead binds to FnIII-I and allosterically inhibits IGF- l/IGF-2 signaling. FnIII-I is believed to facilitate receptor homodimerization of both IGF-IR and INSR (McKern 2006) and, upon binding ligand, transmit an activating signal through the transmembrane region to the C-terminal tyrosine kinase domains via a quarternary structure change. The data from this example suggests M13-C06 antibody inhibits conformational changes induced by IGF-l/IGF-2 that lead to downstream receptor signaling. Methods:
IGF-I /IGF-I R binding experiments in the presence and absence of M13-C06 antibody
[0727] Several constructs were used to investigate antibody/IGF- 1 binding to the IGF-IR receptor or insulin receptor: human IGF-1R(1-9O2)-Hisio (denoted hIGF-lR-Hisio, from R&D systems), human INSR(28-956)-Hisi0 (denoted INSR, from R&D systems), human IGF- IR(I -903)-Fc (denoted hIGF-lR-Fc, generated by Biogen Idee), human IGF-IR(I- 462)-Fc (denoted hIGF-lR(l-462)-Fc, generated by Biogen Idee), and murine IGF-IR(I- 903)-Fc (denoted mIGF-lR-Fc, generated by Biogen Idee). "Hisio" denotes a 10-residue histidine tag on the C-terminus of the constructs. "Fc" denotes a C-terminal human IgGl- Fc tag.
[0728] Human IGF-I was purchased from Millipore. The affinity of IGF-I for MGF-IR-
Hisio was determined using surface plasmon resonance (SPR). A biotin-labeled anti- HisTag antibody (biotin-PENTA-His, Qiagen Cat. No. 34440) was immobilized to saturation on a Biacore SA chip (Cat. No. BR-1000-32) surface by injection at 500 nM in HBS-EP buffer. For each sensorgram, hIGF-lR-Hisio (described in Example 5 (Part II)) was captured on the biotin-PENTA-His surface by injecting 20 μL of 40 nM protein at 2 μL/min. Subsequent to hlGF-lR-Hisn) injection, the flow rate was increased to 20 μL/min. A second, 130 μL injection containing IGF-I was performed to investigate interaction of the growth hormone with its receptor. IGF-I was serially diluted from 64 nM to 0.125 nM to obtain concentration dependent kinetic binding curves. Each injection series was regenerated using 3x10 μL injections of 10 mM Acetate, pH 4.0, at 20 μL/min. Each curve was double referenced using (1) data obtained from a streptavidin surface devoid of PENTA-His antibody and (2) data from a primary injection of hIGF-lR-Hisio followed by a secondary injection of HBS-EP buffer. The concentration series for IGF-I was fit to the 1:1 binding model provided within the BiaE valuation software of the manufacturer. Two sets of data were obtained, one in the absence and another in the presence of 400 nM M13-C06 in the running buffer, hIGF-lR-Hisio injection buffer, and IGF-I injection buffer. Pull-down and Western Blot analysis of IGF-1/IGF-lR/ M13-C06 antibody ternary complexes
[0729] Resuspended Protein A/G beads (300 μl, Pierce Cat. No. 20422) were washed with IxPBS and mixed with 1.0 mg M13-C06 in a 1.5ml Eppendorf tube on a rotary shaker for two hours at room temperature. In a separate tube, 12μg hIGF-lR-Hisio (R&D systems) and 460ng human IGF-I (Chemicon International Cat. No. GF006) were mixed (1:1 protein :protein ratio) for one hour at room temperature. Protein A/G with bound M13-C06 was washed with PBS and incubated with the hIGF-lR-Hisio/IGF-1 mixture for 30 minutes at room temperature. Protein A/G with bound protein was washed with PBS followed by elution of bound protein with 300μL 10OmM glycine, pH 3.0. For the negative control, the addition of 12μg human IGF-1R(1-902)-Hisio was omitted. Eluted proteins were detected by Western Blot with an anti-human IGF-I antibody (Rabbit anti- Human IGF-I Biotin, USBiological Cat. No. I7661-01B) and an anti-human IGF-IR antibody (IGF-lRα 1H7, Santa Cruz Biotechnology Cat. No. sc-461) as primary antibodies followed by HRP-labeled streptavidin (Southern Biotech Cat. No. 7100-05) and HRP-labeled goat anti -mouse IgG (USBiological Cat. No. 11904-40 J) as secondary antibodies. To demonstrate the ability of IGF-1/IGF-1R/M13-C06 to form a ternary complex the concentrations of the IGF-I and IGF-IR used in this experiment were well in excess (>15-fold above) the normal physiological levels of these proteins (particularly IGF-I in the serum) as well as the measured equilibrium dissociation constant for IGF- lR/IGF-1. See, for example, Hankinson et al., 1997.
Construction of IGF-I R(l-462)- Fc and comparative antibody binding studies versus the full-length receptor ectodomain
[0730] Construction of the IGF-l/IGF-2 binding domains, L1-CR-L2 (residues 1-462), of human IGF-IR was published previously (McKern 1997). Utilizing this information, we subcloned human IGF-IR residues 1-462 (along with the N-terminal signal sequence) into the same in-house PV90 vector that was used to produce the full-length human ectodomain (residues 1-903, hIGF- IR-Fc). Expression in CHO was facilitated using methods described previously (Brezinsky 2003). The protein was purified from CHO supernatant s by passage over a protein A affinity column as described previously for other Fc-fusion proteins (Demarest 2006). The protein construct is denoted MGF-IR(I- 462)-Fc. [0731] The ability of M13-C06, M14-C03, and M14-G11 antibodies to bind WGF-IR(I-
462)-Fc and the full-length ectodomain construct, hlGF- IR-Fc, was determined by SPR using a Biacore3000. The instrument was set to 25 0C and the running buffer was HBS- EP, pH 7.2 (Biacore, Cat. No. BR-1001-88). The fully human antibodies, M13-C06, M14-C03, and M14-G11, were immobilized to -10,000 RU on Biacore CM5 Research Grade SensorChip (Cat. No. BR-1000-14) surfaces using the standard NHS/EDC-amine reactive chemistry according to protocols supplied by Biacore. For immobilization, the antibodies were diluted to 40 μg/mL in a 10 mM Acetate pH 4.0 buffer. To investigate the relative kinetics of association and dissociation of hlGF- IR-Fc and MGF-IR(I -462)- Fc to each of the human antibodies, increasing concentrations of each receptor construct were injected over the sensorchip surfaces. The hIGF-lR-Fc concentration series ranged from 1.0 nM to 100 nM while the hIGF-lR(l-462)-Fc concentration series ranged from 1.0 nM to 2 μM. All antibody surfaces were reliably regenerated with 100 mM Glycine, pH 2.0. Repeated regenerations did not lead to activity losses for any of the antibody surfaces. Flow rates were 20 μl/min.
Epitope mapping mutations
[07321 The choice of mutants to probe for the epitope of M13-C06 antibody on IGF-IR were based on the observation that the binding affinity of M13-C06 to mouse IGF-IR was significantly reduced or non-detectable in Biacore and FRET binding experiments (Example 5 (Part III)). Mouse and human IGF-IR share 95% primary amino acid sequence identity. Human IGF-IR and human INSR share 57% identity (73% similarity). We identified 33 residues that differ between mouse and human IGF-IR in the ectodomain (Table 16). Twenty of these residues were targeted for mutation because the homologous positions within the INSR ectodomain were exposed to solvent based on the recent INSR crystal structure (pdb code 2DTG, McKern 2006). Accessible surface areas were calculated using StrucTools (http://molbio.info.nih.gov/structbio/basic.html) with a 1.4 A probe radius. Four additional residues not in the structure of INSR were also chosen for mutagenesis as they resided in the unstructured loop region of the FnHI-2 domain that has been demonstrated to be important for IGF-l/IGF-2 binding (Whittaker 2001; Sorensen 2004). The list of the 24 mutations chosen for the epitope mapping study are shown in Table 17. Table 16: Amino acid differences between human and mouse IGF-IR. Solvent accessibility of each residue position was determined based on the publicly available structure of the homologous INSR ectodomain. Residues shown in bold/italics exposed greater than 30% of their surface area to solvent and were mutagenized to screen for the IGF-IR epitope of M13-C06.
The 24 mutant epitope mapping library was constructed by mutagenizing the wild-type hIGF- IR-Fc PV-90 plasmid using the Stratagene site-directed mutagenesis kit following the manufacturer's protocols. Incorporation of each mutant (or double mutant in the case of the SD004, SDOI l, SD014, SD016, and SD019 library members) into the PV-90 vector was confirmed by our in-house DNA sequencing facility. Plasmids were miniprepped and maxiprepped using the Qiagen Miniprep Kit and Qiagen Endotoxin-Free Maxikits, respectively. 200 μg of each mutant plasmid was transiently tranfected into 100 mL HEK293 T cells at 2x106 cells/mL using the PolyFect transfection kit (Qiagen) for soluble protein secretion into the media. Cells were cultured in DMEM (IvrineScientific), 10% FBS (low IgG bovine serum, Invitrogen - further depleted of bovine IgG by passage over a 20 mL protein A column) at 37 0C in a CO2 incubator. After 7 days, supernatants containing each IGF-IR-Fc mutant were collected by centrifugation at 1200 rpm and filtration through a 0.2 μm filter. Each mutant was affinity purified by passage of the supernatants over a 1.2 mL protein A Sepharose FF column pre-equilibrated with IXPBS. The mutants were eluted from the column using 0.1 M glycine, pH 3.0, neutralized with 1 M Tris, pH 8.5, 0.1% Tween-80, and concentrated to -300 μL using VivaSpin 6 MWCO 30,000 centrifugal concentration devices (Sartorius, Cat. No. VS0621).
Western Blot Analysis of IGF-IR mutants hIGF- IR-Fc mutant samples were run on 4-20% Tris-Glycine gels (Invitrogen
Cat. No. EC6028) using Xcell SureLock Mini Cell (Invitrogen Cat. No. EIOOOl) following standard manufacturer protocol. Samples were transferred to nitrocellulose using the iBlot Dry Blotting System (Invitrogen Cat. No. IBlOOl) and Transfer Stacks (Invitrogen Cat. No. IB3010-01 or 3010-02) following standard manufacturer protocol. Membranes were blocked overnight at 4°C in 25 ml of PBST; 5 mg/ml non-fat dry milk. After blocking, membranes were washed once with 25 ml PBST for 5 min at room temperature. Membranes were incubated with a primary anti-IGF-lRβ antibody (Santa Cruz Biotechnology Cat. No. sc-9038) at 1:100 in 10 ml PBST for 1 hr at room temperature. The membranes were subsequently washed three times in 25 ml PBST for 5 min. For detection, membranes were incubated with a secondary HRP-conjugated Goat anti-Rabbit IgG-Fc antibody (US Biological Cat. No. I1904-40J) at a 1:1000 dilution in 10 ml PBST for 1 hr at room temperature. Membranes were washed three times in 25 ml PBST for 5 min followed by one wash in 25 ml PBST for 20min. Protein bands were detected using the Amersham ECL Western Blotting Analysis System (GE Healthcare Cat. No. RPN2108) following standard manufacturer protocol.
Biacore Analysis of the IGF-IR-Fc mutant library [0735] Both mIGF- IR-Fc and hIGF- IR-Fc bind with high apparent affinity to the Ml 3-
C06, M14-C03, and M14-G11 sensorchip surfaces described above due to their highly multivalent nature induced by the incorporation of two separate homodimeric regions (IGF-IR and IgGl-Fc). To distinguish between the actual high affinity binding hIGF-lR- Fc to M13-C06 and the low affinity binding of mIGF-lR-Fc to M13-C06, the receptor-Fc fusions were captured on the M13-C06 sensorchip surface followed by an additional soluble M13-C06 Fab binding event. Receptor-Fc constructs were captured to the Ml 3- C06 chip surface (prepared as described above) by injection of 60 μL of the affinity purified, concentrated material at a 1 μl/min flow rate. After, completion of the receptor- Fc loading step, flow rates were elevated to 5 μl/min. 10 nM, 3 nM, and 1 nM M13-C06 Fab concentrations were injected (50 μL) subsequent to the loading of each receptor-Fc construct. At the end of each sensorgram, the flow rate was elevated to 30 μl/min and the chip surface was regenerated by 2x10 μL injections of 0.1 M glycine, pH 2.
Time- resolved fluorescence resonance energy transfer (tr-FRET) assay for IGF-IR- Fc mutant screening
[0736] Serial dilutions of mutant receptor, starting at 0.25-0.5 μg (25 μl) were mixed with
0.05 μg IGFlR-Hisio-CyS (12.5 μl) and 0.00375 μg Eu:C06 (12.5 μl) in 384-well microtiter plates (white from Costar). The conjugation levels for IGF1R-Hisio-Cy5 were 6.8:1 Cy5:IGFlR-Hisi0, and for Eu-C06 were 10.3:1 Eu:C06. The total volume was 50 μl for each sample. Plates were incubated for 1 hr at room temperature on a plate agitator. Fluorescence measurements were carried out on a Wallac Victor2 fluorescent plate reader (Perkin Elmer) using the LANCE protocol with the excitation wavelength at 340 nm and emission wavelength at 665 nm. All data were fitted to a one-site binding model from which the corresponding IC50 values were determined.
Results
[0737] Inhibition of IGF-I and/or IGF-2 binding to hIGF-lR-Fc by M13-C06 was demonstrated as previously described in Example 3. Even at saturating conditions, most antibodies do not fully inhibit IGF-I or IGF-2 binding to hIGF-lR-Fc. Particularly for M13-C06, we hypothesized that inhibition of ligand binding might be non-competitive or allosteric. To test this hypothesis, we determined the affinity of IGF-I for hIGF-lR-Hisio in the presence and absence of 400 nM M13-C06 antibody (~ 4000-fold above the affinity of the antibody for hIGF-lR-Hisio). Using SPR hIGF-lR-Hisio was immobilized to chip surfaces using an anti-Histag antibody followed by injection of increasing concentrations of IGF-I (up to 64 nM). IGF-I binding to hIGF-lR-Hisio was evident in the absence and presence of 400 nM M13-C06. {Data not shown: Surface plasmon resonance demonstrating binding of IGF-I to hIGF-lR-Hisio in the absence and presence of 400 nM M13-C06. The SPR association phase was between 1400-1800 seconds while the dissociation phase was between 1800-3000 seconds. In the absence of M13-C06, IGF-I bound to hIGF-lR-Hisio with KD =17 nM (ka =2.4 x 10"5/M*s). In the presence, of 400 nM M13-C06, IGF-I bound to hIGF-lR-Hisi0 with KD =59 nM (Ic3 =7.1 x 10'4/M*s).) The kinetic association rate constant of IGF-I binding to hIGF-lR-Hisio was reduced approximately 3-fold in the presence of M13-C06, suggesting that M13-C06 allosterically reduces the affinity of the ligand for the receptor.
[0738] Supporting evidence that M13-C06 does not directly compete with IGF-I for binding to hIGF-lR-Hisio was generated by performing a co-immunoprecipitation of hIGF-lR-Hisio and IGF-I using M13-C06 at concentrations well above the apparent affinities of both IGF-I and M13-C06 for hIGF- IR-HiS10. Western blot analysis demonstrated that -70-100% of the IGF-I material mixed with hIGF-lR-Hisio was pulled down with M13-C06, thereby demonstrating that co-engagement of M13-C06 and IGF-I with hIGF-lR-Hisio to form the ternary complex is possible (data not shown). These results demonstrate the allosteric nature of M13-C06 inhibition of IGF-I binding at normal IGF-I serum concentrations and suggest that the binding site of M13-C06 does not overlap with the IGF-IR ligand-binding pocket.
[07391 Next, we investigated whether M13-C06 binds the putative ligand binding domains of IGF-IR (L1-CR-L2). We generated a truncated version of the receptor containing the N-terminal three domains (residues 1-462) fused to an IgGl-Fc and compared its ability to bind M13-C06, M14-C03, and M14-G11 to that of the full-length receptor ectodomain construct, hIGF-lR-Fc, using surface plasmon resonance (SPR). M14-G11 demonstrated equivalent binding to the truncated version of the receptor, while the binding of M13-C06 and M14-C03 was dramatically reduced. (Data not shown: Surface immobilized M13-C06, M14-C03, and M14-G11 antibodies were tested for binding to hIGF-lR(l-903)Fc and truncated MGF-IR(I -462)-Fc at concentrations ranging from 2 μM, 100 nM, 30 nM, 10 nM, 5 nM and 1 nM. The SPR association phase was between 480-960 seconds while the dissociation phase was between 960-1170 seconds.) Residual binding was apparent for both M13-C06 and M14-C03; however, the data suggests that at least a good portion of the epitopes of these antibodies resides in an IGF-IR region outside the ligand binding domains.
[0740] We utilized the fact that murine IGF-IR does not bind M13-C06 antibody to design a library of mouse mutations within hIGF-lR-Fc to assess the location of the M13- C06 binding site on IGF-IR. The various mutations in hIGF-lR tested are shown in Table 17. Western blot analysis was used to confirm expression of each MGF- IR-Fc mutant and to develop a standard curve to approximate the relative concentration of each mutant protein; using purified hIGF-lR-Fc as a positive control (data not shown).
Table 17: Affect of mutations on IGF-IR binding to M13-C06. SD015 is bold-faced as it was the only residue to demonstrate little to no binding to M13-C06 in the two assa formats. ND = not determined.
[0741] SPR and tr-FRET was used to screen for mutations that inhibit the binding of IGF-
IR-Fc to M13-C06. Except for the SD015 mutant, all mutant IGF-IR constructs demonstrated M13-C06 binding activity, or M13-C06 Fab binding activity in the SPR experiments. See: Figure 28; Table 17; and, data not shown (competitive inhibition analysis was used to establish binding curves for displacement of Eu-Ml 3-C06 bound to Cy5-labeled IGFlR by increasing concentrations of unlabeled MGFlR-Fc (SDWT), mouse IGFlR-Fc (mIGFlR-Fc) and mutant hlGFlR-Fc constructs).
[0742] There was some deviation in the IC50 values determined using tr-FRET and relative binding strengths determined using SPR due to natural variations in expression and quantitation by Western Blot; however, SDO 15 was the only mutant to demonstrate virtually no binding activity toward M13-C06 in both assays and to parallel the results determined for the mIGF- IR-Fc control. His464 is located 2 amino acids C-terminal in primary amino acid sequence to the C-terminus of the truncated version of hIGF-lR-Fc construct (i.e., hIGF-lR(l-462)-Fc). The residual binding activity of M13-C06 to truncated WGF-IR(I -462) suggests that the M13-C06 binding epitope minimally encompasses residues Val462-His464. Additional residues are likely involved in the antibody-epitope binding interaction as evidence indicates that M13-C06's epitope is conformationally dependent. Notably, however, residues Val462 and His464 are predicted to reside on the exterior surface of the FnHI-I domain (Figure 29).
[0743] In an attempt to characterize the extent of the M13-C06 epitope (i.e., what residues periperhal to 462-464 are important for antibody binding and activity), we took a structural modeling approach. Human IGF-IR and human INSR share 57% identity (73% similarity) and a similar tertiary structure. Previous analyses of X-ray crystal structure protein antigenrantibody binding surfaces has suggested an average binding surface of 700 A2 (angstroms-squared) with an approximate radius of 14 A from the center of the binding epitope (Davies 1996). Using the X-ray crystal structure of the homologous ectodomain of INSR (pdb code 2DTG, (McKem 2006)), we calculated the residues on the surface of the FnIII-I domain within a 14 A radius of residues 462-464 by mapping the IGF-IR residues V462 through H464 to INSR residues L472 and K474. The distances cut-off was applied for any atom-to-atom distance within 14 A, while the average distance was calculated from the Ca to Ca distance of L472 and K474 to each residue within the surface patch. The average distance calculated is listed as 14 A for residues for which the Ca to Ca distance was greater than 14 A but in which the sidechains are within the 14 A cut-off. Residues of likely importance for M13-C06 binding and activity are listed in Table 18.
[0744] Table 18. Residues within IGF-IR predicted to be important for M13-C06 binding and activity. Residues 462 and 464 are italicized as these represent the predicted center of the IGF-IR binding epitope and experimental data demonstrates the importance of these residues in M13-C06 binding. Table 18
[0745] Published work has shown that antibodies that recognize residues 440-586 can be both inhibitory and agonistic to IGF-I binding (Soos 1992; Keynhanfar 2007). 440-586 represents all of L2 and FnIII-I with many potential non-overlapping surfaces accessible to anti-IGF-lR antibodies. Our study is the first study that we are aware of where the inhibitory epitope of IGF-IR has been mapped to a particular residue(s). A recent structure of INSR was co-crystallized with anti-INSR antibody known to inhibit insulin binding to its receptor (Soos 1986; McKem 2006). The homologous residue to His464 of IGF-IR (K474 of INSR) is part of the binding surface of this antibody with INSR. It is possible that M13-C06 shares a similar inhibitory mechanism for inhibiting IGF-I binding to IGF-IR as the antagonistic anti-INSR antibody.
Example 28
M13.C06.G4.P.agly antibody effectively localizes in vivo to tumor cells, inhibits Ki67 expression, and downregulates expression of IGF-IR
M13.C06.G4.P.agly antibody effectively localizes to tumor cells in vivo
[0746] Methods: SCID Beige mice were injected with 2x106 MCF-7 cells (in matrigel) in the presence of estrogen (0.36mg pellet, 90 day release (Innovative Research of America)). Tumors were grown to 300-500mm3 then mice were injected intraperitoneally with 30mg/kg of M13.C06.G4.P.agly antibody. Mice were sacrificed and tumors were removed at 2, 6, 12, 24, and 48 hours post injection frozen in OCT and sectioned at 6μm for immunohistochemical analysis (IHC). A tumor with no antibody injection was excised as a control. Tumors were frozen in OCT and sectioned at 6μm for IHC. Substrate is Vector VIP, a purple stain. Bound antibody was detected using goat anti-human IgG H+L (Human Elite ABC kit, Vector Labs) on M13.C06.G4.P.agly or IDECl 51 (negative control antibody) treated tumors. IGF-IR expression was detected using an α-IGF-lR Mab (clone 24-31, NeoMarkers/Lab Vision) on M13.C06.G4.P.agly or IDEC151 treated tumors. Similar studies were conducted in BxPC3 pancreatic cancer xenograft model. [0747] Results (data not shown): In vivo efficacy experiments using a mouse MCF-7 breast or BxPC3 pancreatic tumor xenograft models revealed that intraperitoneal injection of M13.C06.G4.P.agly was effective at inhibiting tumor cell growth at 30 and 15mg/kg. A time-course experiment was performed to study the pharmacodynamics of a single 30mg/kg or 15 mg/kg dose of M13.C06.G4.P.agly in either MCF-7 or BX-Pc3 tumor- bearing mice, respectively. M13.C06.G4.P.agly localized to tumors as early as 6 hours post treatment, with maximum localization at 48 hours as determined by immunohistochemical analysis (IHC). The expression of IGF-IR as determined by Western and IHC analysis showed significant loss of IGF-IR in M13.C06.G4.P.agly treated tumors 6 hours post-treatment, with almost complete loss of IGF-IR at 24 hours. No change was observed in tumors treated with isotype-matched control antibody. Analysis of tumor lysates for signaling pathways revealed transient reduction of phosphorylated Erk and Akt in 2-12 hours.
M13.C06.G4.P.agly antibody inhibits Ki67 expression
[0748] Ki67 staining of M13.C06.G4.P.agly treated tumors also showed a reduced number of proliferating cells compared to control antibody treated tumors (data not shown). These data indicate that M13.C06.G4.P.agly effectively localizes to tumors in vivo, and inhibits tumor growth by downregulation of IGF-IR and inhibition of IGF-IR mediated signaling.
M13.C06.G4.P.agly downregulates and degrades IGF-IR in tumors
[0749] IGF-IR was immunoblotted from lysates of SCID mouse tumors generated with human pancreatic cells (BxPC3; Figure 30(A)) and breast cancer cells (MCF-7; Figure 30(B)). Tumors were excised at designated time points after treatment with M13.C06.G4.P.agly or IDEC-151 negative control antibody. Tumors were snap frozen, pulverized and lysed. Protein concentration of tumor cell lysates were normalized and separated on 4-12% NuP AGE® gel (Invitrogen Inc., SD, CA). The gel was blotted to nitrocellulose filter, probed with polyclonal anti-IGF-lRβ and detected by enzymatic reaction with anti-rabbit-horse radish peroxidase antibody. Results show that M13.C06.G4.P.agly resulted in down-regulation and degradation of IGF-IR compared to negative control antibody.
Example 29
M13.C06.G4.P.agly antibody demonstrates in vivo anti-tumor activity in a variety of tumor model systems.
[0750] In addition to the in vivo inhibiton of tumor growth demonstrated for
M13.C06.G4.P.agly in lung and pancreatic model systems as described in previous examples, the following experiments further demonstrate the diversity of tumor cell models in which M13.C06.G4.P.agly exhibits activity.
[0751] Anti-tumor activity of M13.C06.G4.P.agly in tumors generated with MiaPaCa2 pancreatic carcinoma cells.
[0752] Female SCID mice were innoculated in the right flank with 2x106 MiaPaCa2 pancreatic carcinoma cells in 50% Matrigel (BD Biosciences)/PBS. Tumors were allowed to reach a volume of 150mm3 (LxW2/2) and mice were sorted and dosed intraperitoneally with single agent (antibody alone) and combination treatments (M13.C06.G4.P.agly antibody and gemcitabine). Gemcitabine alone (20mg/kg, Q4D x 3) and in combination with M13.C06.G4.P.agly (30 mg/kg) as well as M13.C06.G4.P.agly alone (at both 15 mg/kg and 30mg/kg; 1 x week x 6) inhibited tumor growth.
[0753] hi addition to gemcitabine, many other combination therapies could also be tested and used in conjunction with antibodies of the present invention. For example, combination therapies of compounds in the following categories, to list a small exemplary sampling, could be utilized with antibodies of the present invention:
EGFR tyrosine kinase inhibitors, for example:
Tarceva (Erlotinib)
Iressa (Gefitinib) EGFR antibodies, for example:
Erbitux (cetuximab)
Victibix (panitumumab) mTOR inhibitors, for example: temsirolimus, rapamycin and other anti-cancer compounds, for example:
Gleevec (Imatinib)
Sutent (Sunitinib)
Sorafenib (Bay-439006)
SAHA (HDAC inhibitor)
HSP90 inhibitors
M200 (Volociximab).
[0754] Anti-tumor activity of Ml 3.C06.G4.P.agly in tumors generated with cells derived from a primary human colon adenocarcinoma.
[0755] Female SCID mice were innoculated in the right flank with lmm3 of colon tumor fragments. The tumor fragment was derived by serial passage (5x) of colon tumor tissue obtained following surgical resection of a tumor from a patient with colon adenocarcinoma. Tumors were allowed to reach a volume of 150mm3 (LxW2/2) and mice were sorted and dosed with the indicated treatments (n=6) (Figure 31). Antibodies at 15 mg/kg or 30 mg/kg were dosed intraperitoneally Ix weekly.
10756] Results: M13.C06.G4.P.agly effectively inhibited primary colon tumor (CT3) growth in SCID mice (Figure 31).
[0757] Anti-tumor activity of Ml 3.C06.G4.P.agly in tumors generated with MCF-7 breast carcinoma cells.
[0758] Female SCID Beige mice were innoculated in the right flank with 2x106 MCF-7 cells (estrogen dependent) in 50% Matrigel/PBS. An estradiol pellet was implanted in the left flank 24hours prior to cell inoculation (0.36mg pellet estradiol, 90 day release (Innovative Research of America)). Tumors were allowed to reach a volume of 150mm3 (LxW2/2) and mice were sorted and dosed with the indicated treatments (n=10) (Figure 32). Antibodies were dosed intraperitoneally lx/week, while Tamoxifen Citrate (Sigma Inc.) in peanut oil was dosed sub-cutaneously 5 times a week for each regimen. Statistical analysis was performed using a paired student t test.
[0759] Results: M13.C06.G4.P.agly effectively inhibited growth of MCF-7 breast carcinoma tumors (Figure 32).
[0760] Of course, the tumor inhibiting efficacy antibodies of the invention could also be readily tested in numerous other cancer cell types (such as: lung cancer cell lines H- 1299, H-460, H-23; colon cancer cell lines Colo205 and HT-29; pancreatic cancer cell lines such as Panc-1; and, prostate cancer cell lines such as PC-3 to name a small exemplary sampling).
Example 30
M13.C06.G4.P.agly antibody does not exhibit in vitro ADCC activity.
Method:
[0761] Human peripheral blood mononuclear cells were purified from heparinized whole blood by standard Ficoll-paque separation. The cells were resuspended in GIBCO™ RPMIl 640 media containing 10% FBS and 200 U/ml of human IL-2 and incubated overnight at 37°C. The following day, the cells were collected and washed once in culture media and resuspended at 1 X 107 cells/ml.
[0762] Target cells (MCF-7, breast carcinoma cells) were incubated with lOOμCi 51Cr for
1 hour at 37°C. The target cells were washed once to remove the unincorporated 51Cr, and plated at a volume of 1 x 104 cells/well. Target cells were incubated with 50 μl of effector cells and 50 μl of antibody. A target to effector ratio of 1:50 was used throughout the experiments. Controls included were incubated with and without antibodies, these include M13.C06.G4.P.agly, Herceptin (positive control) and IDEC-151 (negative control - macaque/human chimeric IgGl monoclonal antibody specific to CD4). Following a 4-hour incubation at 370C, the supernatants were collected and counted on a gamma counter (Isodata Gamma Counter, Packard Instruments). The % lysis was determined using the following calculation:
[0763] % Lysis = [Sample Release (CPM) - spontaneous release (CPM)] ÷ [Maximum release (CPM) - spontaneous release (CPM)] x 100%
[0764] Results: hi contrast to the Herceptin antibody positive control, neither M13-C06 or IDEC-151 antibodies exhibited ADCC activity, thereby indicating a lack of effector function for these latter antibodies (Figure 33).
Example 31
Treatment of Human Cancer Using Anti-IGF-1R Antibodies
[0765] This example describes methods for treating cancer using antibodies against IGF-
IR to target malignant cells, for example, hyperproliferating cells in which IGF-IR expression has been detected.
[0766] In certain embodiments, M13.C06.G4.P.agly antibody (or another antibody of the present invention) is purified and formulated with a suitable pharmaceutical vehicle for injection. A human patient with a hyperproliferative disorder is given multiple doses of M13.C06.G4.P.agly antibody (or another antibody of the present invention) by intravenous infusion at about 1 mg/kg body weight to about 100 mg/kg body weight, e.g., once per every two weeks or once a month, for at least six months. Intervals can also be irregular as indicated by measuring prognostic indicators in the patient.
[0767] Antibodies can be administered prior to, concurrently with, or after standard radiotherapy regimens as described herein. The patient is monitored to determine whether treatment has resulted in an anti-tumor response, for example, based on tumor regression, reduction in the incidences of new tumors, lower tumor antigen expression, or other means of evaluating disease prognosis. References:
[0768J Brezinsky, S. C. G., Chiang, G.G., Szilvasi, A., Mohan, S., Shapiro, R.I.,
MacLean, A., Sisk, W., and Thill, G. (2003). "A simple method for enriching populations of transfected CHO cells for cells of higher specific productivity." J. Immunol. Methods
277: 141-155. [0769] Davies, D. R., and Cohen, G.H. (1996). "Interactions of protein antigens with antibodies." Proc. Natl. Acad. Sci. USA 93: 7-12. [0770] Demarest, SJ., Chen, G., Kimmel, B.E., Gustafson, D., Wu, J., Salbato, J.,
Poland, J., Short, J., Hansen, G. (2006) Protein Engng. Pes. Select. 19, 325-336. [0771] Demarest, S. J., Hopp, J., Chung, J., Hathaway, K., Mertsching, E., Cao, X.,
George, J., Miatkowski, K., LaBarre, M.J., Shields, M., and Kehry, M.R. (2006). "An intermediate pH unfolding transition abrogates the ability of IgE to interact with its high affinity receptor FceRIa." J. Biol. Chem. 281: 30755-30767. [0772] Keynhanfar, M., Booker, G. W., Whittaker, J., Wallace, J.C., and Forbes, B.E.
(2007). "Precise mapping of an IGF-1-binding site on IGF-IR." Biochem. J. 401: 269-
277. [0773] McKem, N. M., Lawrence, M.C., Streltsov, V.A., Lou, M.-Z., Adams, T.E.,
Lovrecz, G.O., Elleman, T.C., Richards, K.M., Bentley, J.D., Pilling, P., Hoyne, P.A.,
Cartledge, K.A., Pham, T.M., Lewis, J.L., Sankovich, S.E., Stoichevska, V., Da Silva, E.,
Robinson, C.P., Frenkel, M.J., Sparrow, L.G., Fernley, R.T., Epa, V.C., and Ward, CW.
(2006). "Structure of the insulin receptor ectodomain reveals a folded-over conformation." Nature 443: 218-221. [0774] McKem, N. M., Lou. M., Frenkel, MJ., Verkuylen, A., Bentley, J.D., Lovrecz,
G.O., Ivancic, N., Elleman, T.C., Garrett, T.P.J., Cosgrove, L. J., and Ward, CW. (1997).
"Crystallization of the first three domains of the human insulin-like growth factor- 1 receptor." Protein Sci. 6: 2663-2666. [0775] Soos, M. A., Field, C.E., Lammers, R., Ullrich, A., Zhang, B., Roth, R.A.,
Andersen, A.S., Kjeldsen, T., Siddle, K. (1992). "A panel of monoclonal antibodies for the type I insulin-like growth factor receptor." J. Biol. Chem. 267: 12955-12963. [0776] Soos, M. A., Siddle, K., Baron, M.D., Heward, J.M., Luzio, J.P., Bellatin, J., and
Lennox, E.S. (1986). "Monoclonal antibodies reacting with multiple epitopes on the human insulin receptor." Biochem. J. 235: 199-208. [0777] Sorensen, H., Whittaker, L., Hinrichsen, J., Groth, A., and Whittaker, J. (2004).
"Mapping of the insulin-like growth factor II binding site of the Type I insulin-like growth factor receptor by alanine scanning mutagenesis." FEBS Lett. 565: 19-22.
[0778] Whittaker, J., Groth, A. V., Mynarcik, D.C., Pluzek, L., Gadsboll, V.L., and
Whittaker, LJ. (2001). "Alanine scanning mutagenesis of a type 1 insulin-like growth factor receptor ligand binding site." J. Biol. Chem. 276: 43980-43986.

Claims

WHAT IS CLAIMED IS:
1. An isolated antibody or antigen-binding fragment thereof which specifically binds to the same insulin-like growth factor receptor-1 (IGF-Rl) epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14- C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8,
Pl A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8.
2. An isolated antibody or antigen-binding fragment thereof which specifically binds to IGF-Rl, wherein said antibody or fragment thereof competitively inhibits a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M 14- Gl 1, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody . produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, Pl A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8 from binding to IGF-Rl.
3. An isolated antibody or antigen-binding fragment thereof which specifically binds to IGF-Rl, wherein said antibody or fragment thereof is comprises an antigen binding domain identical to that of a monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3Ell, 20C8.3B8, PlA2.2Bll, 20D8.24Bll, PlE2.3B12, and PlG10.2B8.
4. An isolated antibody or fragment thereof which specifically binds to IGF-Rl, wherein the heavy chain variable region (VH) of said antibody or fragment thereof comprises an amino acid sequence at least 90% identical to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ED NO: 9, SEQ ID NO: 14, SEQ ID NO: 20, SEQ ID NO: 26, SEQ ID NO: 32, SEQ ID NO: 38, SEQ ID NO: 43, SEQ ID NO: 48, SEQ DD NO: 53, SEQ ID NO: 58, and SEQ ID NO: 63.
5. An isolated antibody or fragment thereof which specifically binds to IGF-Rl, wherein the light chain variable region (VL) of said antibody or fragment thereof comprises an amino acid sequence at least 90% identical to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 68, SEQ ID NO: 73, SEQ ID NO: 78, SEQ ID NO: 83, SEQ ID NO: 88, SEQ ID NO: 93, SEQ ID NO: 98, SEQ ID NO: 103, SEQ ID NO: 108, SEQ ID NO: 113, and SEQ ID NO: 118.
6. An isolated antibody or fragment thereof which specifically binds to IGF-Rl, wherein the VH of said antibody or fragment thereof comprises an amino acid sequence identical, except for 20 or fewer conservative amino acid substitutions, to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 9, SEQ ED NO: 14, SEQ ID NO: 20, SEQ ID NO: 26, SEQ ID NO: 32, SEQ ID NO: 38, SEQ ID NO: 43, SEQ ID NO: 48, SEQ BD NO: 53, SEQ ID NO: 58, and SEQ ID NO: 63.
7. An isolated antibody or fragment thereof which specifically binds to IGF-Rl, wherein the VL of said antibody or fragment thereof comprises an amino acid sequence identical, except for 20 or fewer conservative amino acid substitutions, to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 68, SEQ ID NO: 73, SEQ ID NO: 78, SEQ ID NO: 83, SEQ ID NO: 88, SEQ ID NO: 93, SEQ ID NO: 98, SEQ ID NO: 103, SEQ ID NO: 108, SEQ ID NO: 113, and SEQ ID NO: 118.
8. An isolated antibody or fragment thereof which specifically binds to IGF-Rl, wherein the VH of said antibody or fragment thereof comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 9, SEQ ID NO: 14, SEQ ID NO: 20, SEQ ID NO: 26, SEQ ID NO: 32, SEQ ID NO: 38, SEQ ID NO: 43, SEQ ID NO: 48, SEQ ID NO: 53, SEQ ID NO: 58, and SEQ ID NO: 63.
9. An isolated antibody or fragment thereof which specifically binds to IGF-Rl, wherein the VL of said antibody or fragment thereof comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 68, SEQ ID NO: 73, SEQ ID NO: 78, SEQ ED NO: 83, SEQ ID NO: 88, SEQ ID NO: 93, SEQ ID NO: 98, SEQ ID NO: 103, SEQ ID NO: 108, SEQ ID NO: 113, and SEQ ID NO: 118.
10. An isolated antibody or fragment thereof which specifically binds to IGF-Rl, wherein the VH and VL of said antibody or fragment thereof comprise, respectively, amino acid sequences at least 90% identical to reference amino acid sequences selected from the group consisting of: SEQ ED NO: 4 and SEQ ED NO: 68; SEQ DD NO: 8 and SEQ ID NO:
73; SEQ DD NO: 14 and SEQ DD NO: 78; SEQ DD NO: 20 and SEQ DD NO: 83; SEQ DD NO: 26 and SEQ ID NO: 88; SEQ ID NO: 32 and SEQ ID NO: 93; SEQ JD NO: 38 and SEQ ID NO: 98; SEQ DD NO: 43 and SEQ ID NO: 103; SEQ ID NO: 48 and SEQ ID NO: 108; SEQ ID NO: 53 and SEQ ID NO: 103; SEQ ID NO: 58 and SEQ ID NO: 113; and SEQ ID NO: 63 and 118.
11. An isolated antibody or fragment thereof which specifically binds to IGF-Rl, wherein the VH and VL of said antibody or fragment thereof comprise, respectively, amino acid sequences identical, except for 20 or fewer conservative amino acid substitutions each, to reference amino acid sequences selected from the group consisting of: SEQ ID NO: 4 and SEQ ID NO: 68; SEQ ID NO: 8 and SEQ ID NO: 73; SEQ ID NO: 14 and SEQ ID NO: 78; SEQ ID NO: 20 and SEQ ID NO: 83; SEQ ID NO: 26 and SEQ ID NO: 88; SEQ ID NO: 32 and SEQ ID NO: 93; SEQ ID NO: 38 and SEQ ID NO: 98; SEQ ID NO: 43 and SEQ ID NO: 103; SEQ ID NO: 48 and SEQ ID NO: 108; SEQ ID NO: 53 and SEQ ID NO: 103; SEQ ED NO: 58 and SEQ ID NO: 113; and SEQ ID NO: 63 and 118.
12. An isolated antibody or fragment thereof which specifically binds to IGF-Rl, wherein the VH and VL of said antibody or fragment thereof comprise, respectively, amino acid sequences selected from the group consisting of: SEQ ID NO: 4 and SEQ ID NO: 68; SEQ ID NO: 8 and SEQ ID NO: 73; SEQ ED NO: 14 and SEQ ID NO: 78; SEQ ID NO: 20 and SEQ ID NO: 83; SEQ ID NO: 26 and SEQ ID NO: 88; SEQ ID NO: 32 and SEQ ID NO: 93; SEQ ID NO: 38 and SEQ ID NO: 98; SEQ ID NO: 43 and SEQ ID NO: 103; SEQ ID NO: 48 and SEQ ID NO: 108; SEQ ID NO: 53 and SEQ ID NO: 103; SEQ ID NO: 58 and SEQ ID NO: 113; and SEQ ED NO: 63 and 118.
13. An isolated antibody or fragment thereof which specifically binds to IGF-Rl , wherein the VH of said antibody or fragment thereof comprises a Kabat heavy chain complementarity determining region-1 (VH-CDRl) amino acid sequence identical, except for two or fewer amino acid substitutions, to a reference VH-CDRl amino acid sequence selected from the group consisting of: SEQ ID NO: 5, SEQ ID NO: 10, SEQ ID NO: 15, SEQ ED NO: 21, SEQ ED NO: 27, SEQ ED NO: 33, SEQ EO NO: 39, SEQ ED NO: 44, SEQ ID NO: 49, SEQ ED NO: 54, SEQ ED NO: 59, and SEQ ED NO: 64.
14. The antibody or fragment thereof of claim 13, wherein said VH-CDRl amino acid sequence is selected from the group consisting of: SEQ ED NO: 5, SEQ ED NO: 10, SEQ ID NO: 15, SEQ ID NO: 21, SEQ ID NO: 27, SEQ ID NO: 33, SEQ ID NO: 39, SEQ ID NO: 44, SEQ ID NO: 49, SEQ ID NO: 54, SEQ ID NO: 59, and SEQ ID NO: 64.
15. An isolated antibody or fragment thereof which specifically binds to IGF-Rl, wherein the VH of said antibody or fragment thereof comprises a Kabat heavy chain complementarity determining region-2 (VH-CDR2) amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VH-CDR2 amino acid sequence selected from the group consisting of: SEQ ID NO: 6, SEQ ID NO: 11, SEQ ID NO: 16, SEQ ID NO: 22, SEQ ID NO: 28, SEQ ID NO: 34, SEQ ID NO: 40, SEQ ID NO: 45, SEQ ID NO: 50, SEQ ID NO: 55, SEQ ID NO: 60, and SEQ ID NO: 65.
16. The antibody or fragment thereof of claim 15, wherein said VH-CDR2 amino acid sequence is selected from the group consisting of: SEQ ID NO: 6, SEQ ID NO: 11, SEQ ID NO: 16, SEQ ID NO: 22, SEQ ID NO: 28, SEQ ID NO: 34, SEQ ID NO: 40, SEQ ID NO: 45, SEQ ID NO: 50, SEQ ID NO: 55, SEQ ID NO: 60, and SEQ ID NO: 65.
17. An isolated antibody or fragment thereof which specifically binds to IGF-Rl , wherein the VH of said antibody or fragment thereof comprises a Kabat heavy chain complementarity determining region-3 (VH-CDR3) amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VH-CDR3 amino acid sequence selected from the group consisting of: SEQ ID NO: 7, SEQ ID NO: 12, SEQ ID NO: 17, SEQ ED NO: 23, SEQ ID NO: 29, SEQ ID NO: 35, SEQ ID NO: 41, SEQ ID NO: 46, SEQ ID NO: 51, SEQ ID NO: 56, SEQ ID NO: 61, and SEQ ID NO: 66.
18. The antibody or fragment thereof of claim 17, wherein said VH-CDR3 amino acid sequence is selected from the group consisting of: SEQ ID NO: 7, SEQ ID NO: 12, SEQ ID NO: 17, SEQ ID NO: 23, SEQ ID NO: 29, SEQ ID NO: 35, SEQ ID NO: 41, SEQ ID NO: 46, SEQ ID NO: 51, SEQ ID NO: 56, SEQ ID NO: 61, and SEQ ID NO: 66.
19. An isolated antibody or fragment thereof which specifically binds to IGF-Rl, wherein the VL of said antibody or fragment thereof comprises a Kabat light chain complementarity determining region-1 (VL-CDRl) amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VL-CDRl amino acid sequence selected from the group consisting of: SEQ ID NO: 69, SEQ ID NO: 74, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 89, SEQ ID NO: 94, SEQ ID NO: 99, SEQ ED NO: 104, SEQ ID NO: 109, SEQ ID NO: 114, and SEQ ID NO: 119.
20. The antibody or fragment thereof of claim 19, wherein said VL-CDRl amino acid sequence is selected from the group consisting of: SEQ ID NO: 69, SEQ ID NO: 74, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 89, SEQ ID NO: 94, SEQ ID NO: 99, SEQ ID NO: 104, SEQ ID NO: 109, SEQ ID NO: 114, and SEQ ID NO: 119.
21. An isolated antibody or fragment thereof which specifically binds to IGF-Rl , wherein the VL of said antibody or fragment thereof comprises a Kabat light chain complementarity determining region-2 (VL-CDR2) amino acid sequence identical, except for two or fewer amino acid substitutions, to a reference VL-CDR2 amino acid sequence selected from the group consisting of: SEQ ID NO: 70, SEQ ID NO: 75, SEQ ID NO: 80, SEQ ID NO: 85, SEQ ID NO: 90, SEQ ID NO: 95, SEQ ID NO: 100, SEQ ID NO: 105, SEQ ID NO: 110, SEQ ID NO: 115, and SEQ ID NO: 120.
22. The antibody or fragment thereof of claim 21 , wherein said VL-CDR2 amino acid sequence is selected from the group consisting of: SEQ ID NO: 70, SEQ ID NO: 75, SEQ ID NO: 80, SEQ ID NO: 85, SEQ ID NO: 90, SEQ BD NO: 95, SEQ ID NO: 100, SEQ ED NO: 105, SEQ ED NO: 110, SEQ ID NO: 115, and SEQ ED NO: 120.
23. An isolated antibody or fragment thereof which specifically binds to IGF-Rl, wherein the VL of said antibody or fragment thereof comprises a Kabat light chain complementarity determining region-3 (VL-CDR3) amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VL-CDR3 amino acid sequence selected from the group consisting of: SEQ ED NO: 71, SEQ ED NO: 76, SEQ ED NO: 81, SEQ ED NO: 86, SEQ ED NO: 91, SEQ ED NO: 96, SEQ ED NO: 101, SEQ ED NO: 106, SEQ ED NO: 111, SEQ ED NO: 116, and SEQ ED NO: 121.
24. The antibody or fragment thereof of claim 23, wherein said VL-CDR3 amino acid sequence is selected from the group consisting of: SEQ ED NO: 71, SEQ ED NO: 76, SEQ ED NO: 81, SEQ ED NO: 86, SEQ ED NO: 91, SEQ ED NO: 96, SEQ ED NO: 101, SEQ ED NO: 106, SEQ ED NO: 111, SEQ ED NO: 116, and SEQ ED NO: 121.
25. An isolated antibody or fragment thereof which specifically binds to IGF-Rl, wherein the VH of said antibody or fragment thereof comprises VH-CDRl, VH-CDR2, and VH- CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 5, 6, and 7; SEQ ED NOs: 10, 11, and 12; SEQ ID NOs: 15, 16, and 17; SEQ ID NOs: 21, 22, and 23; SEQ ID NOs: 27, 28, and 29; SEQ ID NOs: 33, 34, and 35; SEQ ED NOs: 39, 40, and 41;. SEQ ED NOs: 44, 45, and 46; SEQ ED NOs: 49, 50, and 51; SEQ ED NOs: 54, 55, and 56; SEQ ED NOs: 59, 60, and 61; and SEQ ED NOs: 64, 65, and 66, except for one, two, three, or four amino acid substitutions in at least one of said VH-CDRs.
26. An isolated antibody or fragment thereof which specifically binds to IGF-Rl, wherein the VH of said antibody or fragment thereof comprises VH-CDRl, VH-CDR2, and VH- CDR3 amino acid sequences selected from the group consisting of: SEQ ED NOs: 5, 6, and 7; SEQ ID NOs: 10, 11, and 12; SEQ ED NOs: 15, 16, and 17; SEQ ED NOs: 21, 22, and 23; SEQ ED NOs: 27, 28, and 29; SEQ ED NOs: 33, 34, and 35; SEQ ED NOs: 39, 40, and 41;. SEQ ED NOs: 44, 45, and 46; SEQ ED NOs: 49, 50, and 51; SEQ ED NOs: 54, 55, and 56; SEQ ED NOs: 59, 60, and 61; and SEQ ID NOs: 64, 65, and 66.
27. An isolated antibody or fragment thereof which specifically binds to IGF-Rl, wherein the VL of said antibody or fragment thereof comprises VL-CDRl, VL-CDR2, and VL-CDR3 amino acid sequences selected from the group consisting of: SEQ ED NOs: 69, 70, and 71; SEQ ID NOs: 74, 75, and 76; SEQ ID NOs: 79, 80, and 81; SEQ ED NOs: 84, 85, and 86; SEQ ID NOs: 89, 90, and 91 ; SEQ ID NOs: 94, 95, and 96; SEQ ED NOs: 99, 100, and 101; SEQ ED NOs: 104, 105, and 106; SEQ ED NOs: 109, 110, and 111; SEQ ED NOs: 114, 115, and 116; and SEQ ED NOs: 119, 120, and 121, except for one, two, three, or four amino acid substitutions in at least one of said VL-CDRs.
28. An isolated antibody or fragment thereof which specifically binds to IGF-Rl, wherein the VL of said antibody or fragment thereof comprises VL-CDRl, VL-CDR2, and VL-CDR3 amino acid sequences selected from the group consisting of: SEQ ED NOs: 69, 70, and 71; SEQ ID NOs: 74, 75, and 76; SEQ ED NOs: 79, 80, and 81; SEQ ED NOs: 84, 85, and 86; SEQ ED NOs: 89, 90, and 91; SEQ ED NOs: 94, 95, and 96; SEQ ED NOs: 99, 100, and 101; SEQ ID NOs: 104, 105, and 106; SEQ ED NOs: 109, 110, and 111; SEQ ID NOs: 114, 115, and 116; and SEQ ED NOs: 119, 120, and 121.
29. The antibody or fragment thereof of any one of claims 1 to 28, wherein the VH framework regions are human, except for five or fewer amino acid substitutions.
30. The antibody or fragment thereof of any one of claims 1 to 29, wherein the VL framework regions are human, except for five or fewer amino acid substitutions.
31. The antibody or fragment thereof of any one of claims 1 to 30, which binds to a nonlinear conformational epitope.
32. An isolated antibody or antigen-binding fragment thereof which specifically binds to an IGF-Rl epitope comprising amino acid residue valine-462.
33. An isolated antibody or antigen-binding fragment thereof which specifically binds to an IGF-Rl epitope comprising amino acid residue histidine-464.
34. An isolated antibody or antigen-binding fragment thereof which specifically binds to an IGF-Rl epitope comprising amino acid residues valine-462 and histidine-464.
35. An isolated antibody or antigen-binding fragment thereof which specifically binds to an IGF-Rl epitope comprising a solvent accessible surface radius of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 angstroms from residue valine-462.
36. An isolated antibody or antigen-binding fragment thereof which specifically binds to an IGF-Rl epitope comprising a solvent accessible surface radius of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 angstroms from residue histidine-464.
37. An isolated antibody or antigen-binding fragment thereof which specifically binds to an IGF-Rl epitope comprising a solvent accessible surface radius of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 angstroms from residues valine-462 and histidine-464.
38. An isolated antibody or antigen-binding fragment thereof which specifically binds to an IGF-Rl epitope comprising a solvent accessible surface radius of 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 angstroms from the center of residues valine-462 and histidine-464 of human IGF-IR.
39. The antibody or fragment thereof of any one of claims 1 to 30, which binds to a linear epitope.
40. The antibody or fragment thereof of any one of claims 1 to 39, which is a multivalent, and comprises at least two heavy chains and at least two light chains.
41. The antibody or fragment thereof of any one of claims 1 to 40, which is multispeciflc.
42. The antibody or fragment thereof of claim 41 , which is bispecific.
43. The antibody or fragment thereof of any one of claims 1 to 42, which is bispecific.
44. The antibody or fragment thereof of any one of claims 1 to 43, wherein the heavy and light chain variable domains are fully human.
45. The antibody or fragment thereof of claim 44, wherein said heavy and light chain variable domains are from a monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04.
46. The antibody or fragment thereof of any one of claims 1 to 43, wherein the heavy and light chain variable domains are murine.
47. The antibody or fragment thereof of claim 46, wherein said heavy and light chain variable domains are from a monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, Pl A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8.
48. The antibody or fragment thereof of any one of claims 1 to 43 and 46-47, which is humanized.
49. The antibody or fragment thereof of any one of claims 1 to 43 and 46-47, which is chimeric.
50. The antibody or fragment thereof of any one of claims 1 to 43 and 46-47, which is primatized.
51. The antibody or fragment thereof of any one of claims 1 to 45 , which is fully human.
52. The antibody or fragment thereof of any one of claims 1 to 51, which is an Fab fragment.
53. The antibody or fragment thereof of any one of claims 1 to 51, which is an Fab' fragment.
54. The antibody or fragment thereof of any one of claims 1 to 51, which is an F(ab)2 fragment.
55. The antibody or fragment thereof of any one of claims 1 to 51, which is an Fv fragment.
56. The antibody or fragment thereof of any one of claims 1 to 51, which is a single chain antibody.
57. The antibody or fragment thereof of any one of claims 1 to 54 and 56, which comprises a light chain constant regions selected from the group consisting of a human kappa constant region and a human lambda constant region.
58. The antibody or fragment thereof of any one of claims 1 to 54 and 56, which comprises at a heavy chain constant region or fragment thereof.
59. The antibody or fragment thereof of claim 58, wherein said heavy chain constant region or fragment thereof is human IgG4.
60. The antibody or fragment thereof of claim 59, wherein said IgG4 is mutagenized to remove glycosylation sites.
61. The antibody or fragment thereof of claim 60, wherein said mutations comprise S241P and T318A using the Kabat numbering system.
62. The antibody or fragment thereof of any one of claims 1 to 61, which specifically binds to an IGF-Rl polypeptide or fragment thereof, or an IGF-Rl variant polypeptide, with an affinity characterized by a dissociation constant (KD) which is less than the KD for said reference monoclonal antibody.
63. The antibody or fragment thereof of any one of claims 1 to 62, which specifically binds to an IGF-Rl polypeptide or fragment thereof, or an IGF-Rl variant polypeptide with an affinity characterized by a dissociation constant (KD) no greater than 5 x 10~2 M, 10"2 M, 5 x 10° M, 10° M, 5 x 10^ M, 10"4 M, 5 x 10~5 M, 10"5 M, 5 x 1(T6 M, 1(T6 M, 5 x 10"7 M, 10"7 M, 5 x 108 M, 10 * M, 5 x 10"9 M, 10"9 M, 5 x 10 10 M, 10"10 M, 5 x IO 11 M, 1(T11 M, 5 x 10~12 M, 10"12 M, 5 x 10~13 M, 10"13 M, 5 x 10"14 M, 10"14 M, 5 x 10"15 M, or 1(T15 M.
64. The antibody or fragment thereof of any one of claims 1 to 63, wherein said affinity is characterized by a dissociaton constant (KD) in a range of about 1 x 10"10 to about 5 x 10"9 M.
65. The antibody or fragment thereof of any one of claims 1 to 64, wherein said affinity is characterized by a dissociaton constant (KD) selected from the group consisting of:
(a) about 1.1 x 10"10 M;
(b) about 1.3 x 10 10 M;
(c) about 3.6 x 10"10 M;
(d) about 1.3 x 10"9 M;
(e) about 4.0 x 10"9 M; and,
(f) about 4.9 x 10"9 M.
66. The antibody or fragment thereof of any one of claims 1 to 65, wherein said affinity is characterized by a dissociaton constant (KD) selected from the group consisting of:
(a) 1.1 x 10"10 M;
(b) 1.3 x 10"10 M; (c) 3.6 x 10"10 M;
(d) 1.3 x 10'9 M;
(e) 4.0 x 10"9 M; and,
(f) 4.9 x 10'9 M.
67. The antibody or fragment thereof of any one of claims 1 to 66, which preferentially binds to a human IGF-Rl polypeptide or fragment thereof, relative to a murine IGF-Rl polypeptide or fragment thereof or a non-human primate IGF-Rl polypeptide or fragment thereof.
68. The antibody or fragment thereof of any one of claims 1 to 66, which binds to human IGF-Rl polypeptide or fragment thereof, and also binds to a non-human primate IGF-Rl polypeptide or fragment thereof.
69. The antibody or fragment thereof of any one of claims 1 to 68, which binds to IGF-Rl expressed on the surface of a cell.
70. The antibody or fragment thereof of claim 69, wherein said cell is a malignant cell, a neoplastic cell, a tumor cell, or a metastatic cell.
71. The antibody or fragment thereof of any one of claims 1 to 70, which blocks insulin growth factor from binding to IGF-Rl .
72. The antibody or fragment thereof of claim 71 , wherein said insulin growth factor is insulin growth factor- 1 (IGF-I).
73. The antibody or fragment thereof of claim 71, wherein said insulin growth factor is insulin growth factor-2 (IGF-2).
74. The antibody or fragment thereof of claim 71, which blocks both IGF-I and IGF-2 from binding to IGF-Rl.
75. The antibody or fragment thereof of any one of claims 1 to 74, which inhibits IGF-Rl- mediated cell proliferation.
76. The antibody or fragment thereof of any one of claims 1 to 75, which inhibits IGF-I or IGF-2 -mediated IGF-Rl phosphorylation.
77. The antibody or fragment thereof of any one of claims 1 to 76, which inhibits tumor cell growth.
78. The antibody or fragment thereof of any one of claims 1 to 77, which inhibits IGF-Rl internalization.
79. The antibody or fragment thereof of any one of claims 1 to 78, further comprising a heterologous polypeptide fused thereto.
80. The antibody or fragment thereof of any one of claims 1 to 79, wherein said antibody is conjugated to an agent selected from the group consisting of cytotoxic agent, a therapeutic agent, cytostatic agent, a biological toxin, a prodrug, a peptide, a protein, an enzyme, a virus, a lipid, a biological response modifier, pharmaceutical agent, a lymphokine, a heterologous antibody or fragment thereof, a detectable label, polyethylene glycol (PEG), and a combination of two or more of any said agents.
81. The antibody or fragment thereof of claim 80, wherein said cytotoxic agent is selected from the group consisting of a radionuclide, a biotoxin, an enzymatically active toxin, a cytostatic or cytotoxic therapeutic agent, a prodrugs, an immunologically active ligand, a biological response modifier, or a combination of two or more of any said cytotoxic agents.
82. The antibody or fragment thereof of claim 80, wherein said detectable label is selected from the group consisting of an enzyme, a fluorescent label, a chemiluminescent label, a bioluminescent label, a radioactive label, or a combination of two or more of any said detectable labels.
83. A composition comprising the antibody or fragment thereof of any one of claims 1 to 82, and a earner.
84. An isolated polynucleotide comprising a nucleic acid which encodes an antibody VH polypeptide, wherein the amino acid sequence of said VH polypeptide is at least 90% identical to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 9, SEQ ID NO: 14, SEQ ID NO: 20, SEQ ID NO: 26, SEQ ID NO: 32, SEQ ID NO: 38, SEQ ID NO: 43, SEQ ID NO: 48, SEQ ID NO: 53, SEQ ID NO: 58, and SEQ ID NO: 63; and wherein an antibody or antigen binding fragment thereof comprising said VH polypeptide specifically binds to IGF-Rl.
85. The polynucleotide of claim 84, wherein the amino acid sequence of said VH polypeptide is selected from the group consisting of: SEQ ED NO: 4, SEQ ID NO: 9, SEQ ID NO: 14, SEQ ID NO: 20, SEQ ID NO: 26, SEQ ID NO: 32, SEQ ID NO: 38, SEQ ID NO: 43, SEQ ID NO: 48, SEQ ID NO: 53, SEQ ID NO: 58, and SEQ ID NO: 63.
86. The polynucleotide of claim 84 or 85, wherein the nucleotide sequence encoding said VH polypeptide is optimized for increased expression without changing the amino acid sequence of said VH polypeptide.
87. The polynucleotide of claim 86, wherein said optimization comprises identification and removal of splice donor and splice acceptor sites.
88. The polynucleotide of claim 86 or 87, wherein said optimization comprises optimization of codon usage for the cells expressing said polynucleotide.
89. The polynucleotide of any one of claims 84 to 88, wherein said nucleic acid comprises a nucleotide sequence selected from the group consisting of: SEQ ID NO: 3, SEQ ID NO: 8, SEQ ID NO: 13, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 42, SEQ ID NO: 47, SEQ ID NO: 52, SEQ ID NO: 57, and SEQ ID NO: 62.
90. An isolated polynucleotide comprising a nucleic acid which encodes an antibody VL polypeptide, wherein the amino acid sequence of said VL polypeptide is at least 90% identical to a reference amino acid sequence selected from the group consisting of: SEQ ID NO: 68, SEQ ID NO: 73, SEQ JD NO: 78, SEQ ID NO: 83, SEQ ID NO: 88, SEQ ID NO: 93, SEQ ID NO: 98, SEQ ID NO: 103, SEQ ID NO: 108, SEQ ID NO: 113, and SEQ ID NO: 118; and wherein an antibody or antigen binding fragment thereof comprising said VL polypeptide specifically binds to IGF-Rl.
91. The polynucleotide of claim 90, wherein the amino acid sequence of said VL polypeptide is selected from the group consisting of: SEQ ID NO: 68, SEQ ID NO: 73, SEQ ID NO: 78, SEQ ID NO: 83, SEQ ID NO: 88, SEQ ID NO: 93, SEQ ID NO: 98, SEQ ID NO: 103, SEQ ID NO: 108, SEQ ID NO: 113, and SEQ ID NO: 118.
92. The polynucleotide of claim 90 or 91, wherein the nucleotide sequence encoding said VL polypeptide is optimized for increased expression without changing the amino acid sequence of said VL polypeptide.
93. The polynucleotide of claim 92, wherein said optimization comprises identification and removal of splice donor and splice acceptor sites.
94. The polynucleotide of claim 92 or 93, wherein said optimization comprises optimization of codon usage for the cells expressing said polynucleotide.
95. The polynucleotide of any one of claims 90 to 94, wherein said nucleic acid comprises a nucleotide sequence selected from the group consisting of: SEQ ID NO: 67, SEQ ID NO: 72, SEQ ID NO: 77, SEQ ID NO: 82, SEQ ID NO: 87, SEQ ID NO: 92, SEQ ID NO: 97, SEQ ID NO: 102, SEQ ID NO: 107, SEQ ID NO: 112, and SEQ ID NO: 117.
96. An isolated polynucleotide comprising a nucleic acid which encodes an antibody VH polypeptide, wherein the amino acid sequence of said VH polypeptide is identical, except for 20 or fewer conservative amino acid substitutions, to a reference amino acid sequence selected from the group consisting of: SEQ ED NO: 4, SEQ ID NO: 9, SEQ ID NO: 14, SEQ ID NO: 20, SEQ ID NO: 26, SEQ ED NO: 32, SEQ ED NO: 38, SEQ ED NO: 43, SEQ ED NO: 48, SEQ ID NO: 53, SEQ ED NO: 58, and SEQ ED NO: 63; and wherein an antibody or antigen binding fragment thereof comprising said VH polypeptide specifically binds to IGF-Rl .
97. An isolated polynucleotide comprising a nucleic acid which encodes an antibody VL polypeptide, wherein the amino acid sequence of said VL polypeptide is identical, except for 20 or fewer conservative amino acid substitutions, to a reference amino acid sequence selected from the group consisting of: SEQ ED NO: 68, SEQ ID NO: 73, SEQ ID NO: 78, SEQ ID NO: 83, SEQ ID NO: 88, SEQ ID NO: 93, SEQ ID NO: 98, SEQ ID NO: 103, SEQ ID NO: 108, SEQ ID NO: 113, and SEQ ID NO: 118; and wherein an antibody or antigen binding fragment thereof comprising said VL polypeptide specifically binds to IGF-Rl.
98. An isolated polynucleotide comprising a nucleic acid which encodes a VH-CDRl amino acid sequence identical, except for two or fewer amino acid substitutions, to a reference VH-CDRl amino acid sequence selected from the group consisting of: SEQ ED NO: 5, SEQ ID NO: 10, SEQ ID NO: 15, SEQ BD NO: 21, SEQ ID NO: 27, SEQ ID NO: 33, SEQ ED NO: 39, SEQ ED NO: 44, SEQ ED NO: 49, SEQ ID NO: 54, SEQ ID NO: 59, and SEQ ED NO: 64; and wherein an antibody or antigen binding fragment thereof comprising said VH-CDRl specifically binds to IGF-Rl.
99. The polynucleotide or fragment thereof of claim 98, wherein said VH-CDRl amino acid sequence is selected from the group consisting of: SEQ ED NO: 5, SEQ ID NO: 10, SEQ ID NO: 15, SEQ ID NO: 21, SEQ ID NO: 27, SEQ ID NO: 33, SEQ ED NO: 39, SEQ ED NO: 44, SEQ ID NO: 49, SEQ ED NO: 54, SEQ ID NO: 59, and SEQ ID NO: 64.
100. An isolated polynucleotide comprising a nucleic acid which encodes a VH-CDR2 amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VH-CDR2 amino acid sequence selected from the group consisting of: SEQ ED NO: 6, SEQ ED NO: 11, SEQ ED NO: 16, SEQ ID NO: 22, SEQ ID NO: 28, SEQ ID NO: 34, SEQ ID NO: 40, SEQ ID NO: 45, SEQ ID NO: 50, SEQ ID NO: 55, SEQ ID NO: 60, and SEQ ED NO: 65; and wherein an antibody or antigen binding fragment thereof comprising said VH-CDR2 specifically binds to IGF-Rl.
101. The polynucleotide or fragment thereof of claim 100, wherein said VH-CDR2 amino acid sequence is selected from the group consisting of: SEQ ID NO: 6, SEQ ED NO: 11, SEQ ID NO: 16, SEQ ID NO: 22, SEQ ID NO: 28, SEQ ID NO: 34, SEQ ID NO: 40, SEQ ID NO: 45, SEQ ID NO: 50, SEQ ID NO: 55, SEQ ID NO: 60, and SEQ ID NO: 65.
102. An isolated polynucleotide comprising a nucleic acid which encodes a VH-CDR3 amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VH-CDR3 amino acid sequence selected from the group consisting of: SEQ ID NO: 7, SEQ ID NO: 12, SEQ ID NO: 17, SEQ ID NO: 23, SEQ ID NO: 29, SEQ ID NO: 35, SEQ ID NO: 41, SEQ ID NO: 46, SEQ ID NO: 51, SEQ ID NO: 56, SEQ ID NO: 61, and SEQ ID NO: 66; and wherein an antibody or antigen binding fragment thereof comprising said VH-CDR3 specifically binds to IGF-Rl.
103. The polynucleotide or fragment thereof of claim 102, wherein said VH-CDR3 amino acid sequence is selected from the group consisting of: SEQ ID NO: 7, SEQ ID NO: 12, SEQ ID NO: 17, SEQ ID NO: 23, SEQ ID NO: 29, SEQ ID NO: 35, SEQ ID NO: 41, SEQ ID NO: 46, SEQ ID NO: 51, SEQ ID NO: 56, SEQ ID NO: 61, and SEQ ID NO: 66.
104. An isolated polynucleotide comprising a nucleic acid which encodes a VL-CDRl amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VL-CDRl amino acid sequence selected from the group consisting of: SEQ ID NO: 69, SEQ ID NO: 74, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 89, SEQ ID NO: 94, SEQ ID NO: 99, SEQ ID NO: 104, SEQ ID NO: 109, SEQ ID NO: 114, and SEQ ID NO: 119; and wherein an antibody or antigen binding fragment thereof comprising said VL- CDRl specifically binds to IGF-Rl.
105. The polynucleotide or fragment thereof of claim 104, wherein said VL-CDRl amino acid sequence is selected from the group consisting of: SEQ ID NO: 69, SEQ ID NO: 74, SEQ ID NO: 79, SEQ ID NO: 84, SEQ ID NO: 89, SEQ ID NO: 94, SEQ ID NO: 99, SEQ ID NO: 104, SEQ ID NO: 109, SEQ ID NO: 114, and SEQ ID NO: 119.
106. An isolated polynucleotide comprising a nucleic acid which encodes a VL-CDR2 amino acid sequence identical, except for two or fewer amino acid substitutions, to a reference VL-CDR2 amino acid sequence selected from the group consisting of: SEQ ID NO: 70, SEQ ID NO: 75, SEQ ED NO: 80, SEQ ID NO: 85, SEQ ID NO: 90, SEQ ID NO: 95, SEQ ID NO: 100, SEQ ID NO: 105, SEQ ID NO: 110, SEQ ID NO: 115, and SEQ ID NO: 120; and wherein an antibody or antigen binding fragment thereof comprising said VL-CDR2 specifically binds to IGF-Rl.
107. The polynucleotide or fragment thereof of claim 106, wherein said VL-CDR2 amino acid sequence is selected from the group consisting of: SEQ ID NO: 70, SEQ ED NO: 75, SEQ ID NO: 80, SEQ ID NO: 85, SEQ ID NO: 90, SEQ ID NO: 95, SEQ ID NO: 100, SEQ ID NO: 105, SEQ ID NO: 110, SEQ ID NO: 115, and SEQ ID NO: 120.
108. An isolated polynucleotide comprising a nucleic acid which encodes a VL-CDR3 amino acid sequence identical, except for four or fewer amino acid substitutions, to a reference VL-CDR3 amino acid sequence selected from the group consisting of: SEQ ID NO: 71, SEQ ID NO: 76, SEQ ID NO: 81, SEQ ID NO: 86, SEQ ID NO: 91, SEQ ID NO: 96, SEQ ID NO: 101, SEQ ID NO: 106, SEQ ID NO: 111, SEQ ID NO: 116, and SEQ ID NO: 121; and wherein an antibody or antigen binding fragment thereof comprising said VL-CDR3 specifically binds to IGF-Rl.
109. The polynucleotide or fragment thereof of claim 108, wherein said VL-CDR3 amino acid sequence is selected from the group consisting of: SEQ ID NO: 71, SEQ ED NO: 76, SEQ ED NO: 81, SEQ ED NO: 86, SEQ ED NO: 91, SEQ ED NO: 96, SEQ ED NO: 101, SEQ ED NO: 106, SEQ ED NO: 111, SEQ ED NO: 116, and SEQ ED NO: 121.
110. An isolated polynucleotide comprising a nucleic acid which encodes an antibody VH polypeptide, wherein said VH polypeptide comprises VH-CDRl, VH-CDR2, and VH- CDR3 amino acid sequences selected from the group consisting of: SEQ ED NOs: 5, 6, and 7; SEQ ED NOs: 10, 11, and 12; SEQ ED NOs: 15, 16, and 17; SEQ ED NOs: 21, 22, and 23; SEQ ED NOs: 27, 28, and 29; SEQ ED NOs: 33, 34, and 35; SEQ ED NOs: 39, 40, and 41;. SEQ ED NOs: 44, 45, and 46; SEQ ED NOs: 49, 50, and 51; SEQ ED NOs: 54, 55, and 56; SEQ ED NOs: 59, 60, and 61; and SEQ ED NOs: 64, 65, and 66; and wherein an antibody or antigen binding fragment thereof comprising said VL-CDR3 specifically binds to IGF-Rl.
111. An isolated polynucleotide comprising a nucleic acid which encodes an antibody VL polypeptide, wherein said VL polypeptide comprises VH-CDRl, VH-CDR2, and VH- CDR3 amino acid sequences selected from the group consisting of: SEQ ED NOs: 69, 70, and 71; SEQ ID NOs: 74, 75, and 76; SEQ ID NOs: 79, 80, and 81; SEQ ID NOs: 84, 85, and 86; SEQ ID NOs: 89, 90, and 91; SEQ ID NOs: 94, 95, and 96; SEQ BD NOs: 99, 100, and 101; SEQ ID NOs: 104, 105, and 106; SEQ ID NOs: 109, 110, and 111; SEQ ID NOs: 114, 115, and 116; and SEQ ID NOs: 119, 120, and 121; and wherein an antibody or antigen binding fragment thereof comprising said VL-CDR3 specifically binds to IGF- Rl.
112. The polynucleotide of any one of claims 84 to 111, further comprising a nucleic acid encoding a signal peptide fused to said antibody VH polypeptide.
113. The polynucleotide of any one of claims 84 to 111, further comprising a nucleic acid encoding a signal peptide fused to said antibody VL polypeptide.
114. The polynucleotide of any one of claims 84 to 113, further comprising a nucleic acid encoding a heavy chain constant region CHl domain fused to said VH polypeptide.
115. The polynucleotide of any one of claims 84 to 114, further comprising a nucleic acid encoding a heavy chain constant region CH2 domain fused to said VH polypeptide.
116. The polynucleotide of any one of claims 84 to 115, further comprising a nucleic acid encoding a heavy chain constant region CH3 domain fused to said VH polypeptide.
117. The polynucleotide of any one of claims 84 to 116, further comprising a nucleic acid encoding a heavy chain hinge region fused to said VH polypeptide.
118. The polynucleotide of any one of claims 114 to 117, wherein said heavy chain constant region is human IgG4.
119. The polynucleotide of claim 118, wherein said IgG4 is mutagenized to remove glycosylation sites.
120. The polynucleotide of claim 119, wherein said mutations comprise S241P and T318A using the Kabat numbering system.
121. The polynucleotide of any one of claims 84 to 120, further comprising a nucleic acid encoding a light chain constant region domain fused to said VL polypeptide.
122. The polynucleotide of claim 121, wherein said light chain constant region is human kappa.
123. The polynucleotide of any one of claims 84 to 122, wherein an antibody or antigen- binding fragment thereof comprising a polypeptide encoded by said nucleic acid specifically binds the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M 14- BOl, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, Pl A2.2B11, 20D8.24B11, P1E2.3B12, and PlG10.2B8.
124. The polynucleotide of any one of claims 84 to 123, wherein an antibody or antigen- binding fragment thereof comprising a polypeptide encoded by said nucleic acid competitively inhibits a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8.
125. The polynucleotide of any one of claims 84 to 124, wherein the framework regions of said VH polypeptide are human, except for five or fewer amino acid substitutions.
126. The polynucleotide of any one of claims 84 to 125, wherein the framework regions of said VL polypeptide are human, except for five or fewer amino acid substitutions.
127. The polynucleotide of any one of claims 84 to 126, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid binds to a linear epitope.
128. The polynucleotide of any one of claims 84 to 126, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid binds to a non-linear conformational epitope.
129. The polynucleotide of any one of claims 84 to 128, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid is a multivalent, and comprises at least two heavy chains and at least two light chains.
130. The polynucleotide of any one of claims 84 to 129, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid is multispecific.
131. The polynucleotide of any one of claims 84 to 130, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid is bispecific.
132. The polynucleotide of any one of claims 84 to 131, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid comprises heavy and light chain variable domains which are fully human.
133. The polynucleotide of claim 132, wherein said heavy and light chain variable domains are identical to those of a monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04.
134. The polynucleotide of any one of claims 84 to 131, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid comprises heavy and light chain variable domains which are murine.
135. The polynucleotide of claim 134, wherein said heavy and light chain variable domains are identical to those of a monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8.
136. The polynucleotide of any one of claims 84 to 131 and 134 to 135, wherein an antibody or antigen-binding fragment thereof comprising the polypeptide encoded by said nucleic acid is humanized.
137. The polynucleotide of any one of claims 84 to 131 and 134 to 135, wherein an antibody or antigen-binding fragment thereof comprising the polypeptide encoded by said nucleic acid is chimeric.
138. The polynucleotide of any one of claims 84 to 131 and 134 to 135, wherein an antibody or antigen-binding fragment thereof comprising the polypeptide encoded by said nucleic acid is primatized.
139. The polynucleotide of any one of claims 84 to 133, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid is fully human.
140. The polynucleotide of any one of claims 84 to 139, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid is an Fab fragment.
141. The polynucleotide of any one of claims 84 to 139, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid is an Fab' fragment.
142. The polynucleotide of any one of claims 84 to 139, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid is an F(ab)2 fragment.
143. The polynucleotide of any one of claims 84 to 139, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid is an Fv fragment.
144. The polynucleotide of any one of claims 84 to 139, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid is a single chain antibody.
145. The polynucleotide of any one of claims 84 to 144, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid specifically binds to an IGF-Rl polypeptide or fragment thereof, or an IGF-Rl variant polypeptide, with an affinity characterized by a dissociation constant (KD) no greater than 5 x 102 M, 102 M, 5 x 1(T3 M, 1(T3 M, 5 x 10^ M, 10"4 M, 5 x 105 M, 1O-5 M, 5 x 10"6 M, Kr6 M, 5 x 107 M, 10"7 M, 5 x 10"8 M, lO'8 M, 5 x 109 M, 10"9 M, 5 x 10 10 M, 10 10 M, 5 x lθ" M, 10"n M, 5 x 1(T12 M, 10 12 M, 5 x 10 13 M, 10"13 M, 5 x 10 14 M, 1(T14 M, 5 x 10"15 M, or 1(T15 M.
146. The polynucleotide of any one of claims 84 to 145, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid preferentially binds to a human IGF-Rl polypeptide or fragment thereof, relative to a murine IGF-Rl polypeptide or fragment thereof or a non-human primate IGF-Rl polypeptide or fragment thereof.
147. The polynucleotide of any one of claims 84 to 145, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid binds to a human IGF-Rl polypeptide or fragment thereof, and also binds to a non-human primate IGF-Rl polypeptide or fragment thereof.
148. The polynucleotide of any one of claims 84 to 147, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid binds to IGF-Rl expressed on the surface of a cell.
149. The polynucleotide of claim 148, wherein said cell is a malignant cell, a neoplastic cell, a tumor cell, or a metastatic cell.
150. The polynucleotide of any one of claims 84 to 149, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid blocks insulin growth factor from binding to IGF-Rl .
151. The polynucleotide of claim 150, wherein said insulin growth factor is insulin growth factor-1 (IGF-I).
152. The polynucleotide of claim 150, wherein said insulin growth factor is insulin growth factor-2 (IGF-2).
153. The polynucleotide of claim 150, which blocks both IGF-I and IGF-2 from binding to IGF-Rl.
154. The polynucleotide of any one of claims 84 to 153, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid inhibits IGF-Rl -mediated cell proliferation.
155. The polynucleotide of any one of claims 84 to 154, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid inhibits IGF-I or IGF-2-mediated IGF-Rl phosphorylation.
156. The polynucleotide of any one of claims 84 to 155, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid inhibits tumor cell growth.
157. The polynucleotide of any one of claims 84 to 156, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid inhibits IGF-Rl internalization.
158. The polynucleotide of any one of claims 84 to 157, further comprising a nucleic acid encoding a heterologous polypeptide.
159. The polynucleotide of any one of claims 84 to 158, wherein an antibody or antigen- binding fragment thereof comprising the polypeptide encoded by said nucleic acid is conjugated to an agent selected from the group consisting of cytotoxic agent, a therapeutic agent, cytostatic agent, a biological toxin, a prodrug, a peptide, a protein, an enzyme, a virus, a lipid, a biological response modifier, pharmaceutical agent, a lymphokine, a heterologous antibody or fragment thereof, a detectable label, polyethylene glycol (PEG), and a combination of two or more of any said agents. .
160. The polynucleotide of claim 159, wherein said cytotoxic agent is selected from the group consisting of a radionuclide, a biotoxin, an enzymatically active toxin, a cytostatic or cytotoxic therapeutic agent, a prodrugs, an immunologically active ligand, a biological response modifier, or a combination of two or more of any said cytotoxic agents.
161. The polynucleotide of claim 159, wherein said detectable label is selected from the group consisting of an enzyme, a fluorescent label, a chemiluminescent label, a bioluminescent label, a radioactive label, or a combination of two or more of any said detectable labels.
162. A composition comprising the polynucleotide any one of claims 84 to 161, and a carrier.
163. A vector comprising the polynucleotide of any one of claims 84 to 161.
164. The vector of claim 163, wherein said polynucleotide is operably associated with a promoter.
165. A host cell comprising the vector of claim 163 or claim 164.
166. A method of producing an antibody or fragment thereof which specifically binds IGF- 1 R, comprising culturing the host cell of claim 165, and recovering said antibody, or fragment thereof.
167. An isolated polypeptide produced by the method of claim 166.
168. An isolated polypeptide encoded by the polynucleotide of any one of claims 84 to 161.
169. The isolated polypeptide of claim 168, wherein an antibody or fragment thereof comprising said polypeptide specifically binds to IGF-IR.
170. An isolated antibody or fragment thereof comprising the polypeptide of claim 168 or 169.
171. A composition comprising an isolated VH encoding polynucleotide and an isolated VL encoding polynucleotide, wherein said VH encoding polynucleotide and said VL encoding polynucleotide, respectively, comprise nucleic acids encoding amino acid sequences at least 90% identical to reference amino acid sequences selected from the group consisting of: SEQ ID NO: 4 and SEQ ED NO: 68; SEQ ID NO: 8 and SEQ ID NO: 73; SEQ ID NO: 14 and SEQ ID NO: 78; SEQ ID NO: 20 and SEQ ED NO: 83; SEQ ID NO: 26 and SEQ ID NO: 88; SEQ ID NO: 32 and SEQ ID NO: 93; SEQ ID NO: 38 and SEQ ID NO: 98; SEQ ID NO: 43 and SEQ ID NO: 103; SEQ ID NO: 48 and SEQ ID NO: 108; SEQ ID NO: 53 and SEQ ID NO: 103; SEQ ID NO: 58 and SEQ ID NO: 113; and SEQ ID NO: 63 and 118; and wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides specifically binds IGF-Rl.
172. The composition of claim 171, wherein said VH encoding polynucleotide and said VL encoding polynucleotide, respectively, comprise nucleic acids encoding amino acid sequences selected from the group consisting of: SEQ ID NO: 4 and SEQ ID NO: 68; SEQ ID NO: 8 and SEQ ID NO: 73; SEQ ID NO: 14 and SEQ ID NO: 78; SEQ ID NO: 20 and SEQ ID NO: 83; SEQ ID NO: 26 and SEQ ID NO: 88; SEQ ID NO: 32 and SEQ ID NO: 93; SEQ ID NO: 38 and SEQ ID NO: 98; SEQ ID NO: 43 and SEQ ID NO: 103; SEQ ID NO: 48 and SEQ ID NO: 108; SEQ ID NO: 53 and SEQ ID NO: 103; SEQ ID NO: 58 and SEQ ID NO: 113; and SEQ ID NO: 63 and 118
173. A composition comprising an isolated VH encoding polynucleotide and an isolated VL encoding polynucleotide, wherein said VH encoding polynucleotide and said VL encoding polynucleotide, respectively, comprise nucleic acids encoding amino acid sequences identical, except for less than 20 conservative amino acid substitutions, to reference amino acid sequences selected from the group consisting of: SEQ ID NO: 4 and SEQ ID NO: 68; SEQ ID NO: 8 and SEQ ID NO: 73; SEQ ID NO: 14 and SEQ ID NO: 78; SEQ ID NO: 20 and SEQ ID NO: 83; SEQ ID NO: 26 and SEQ ID NO: 88; SEQ ID NO: 32 and SEQ ID NO: 93; SEQ ID NO: 38 and SEQ ID NO: 98; SEQ ID NO: 43 and SEQ ID NO: 103; SEQ ID NO: 48 and SEQ ID NO: 108; SEQ ID NO: 53 and SEQ ID NO: 103; SEQ ID NO: 58 and SEQ ID NO: 113; and SEQ ID NO: 63 and 118; and wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides specifically binds IGF-Rl .
174. A composition comprising an isolated VH encoding polynucleotide and an isolated VL encoding polynucleotide, wherein said VH encoding polynucleotide encodes a VH polypeptide comprising VH-CDRl, VH-CDR2, and VH-CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 5, 6, and 7; SEQ ID NOs: 10, 11, and 12; SEQ ID NOs: 15, 16, and 17; SEQ ID NOs: 21, 22, and 23; SEQ ID NOs: 27, 28, and 29; SEQ ID NOs: 33, 34, and 35; SEQ ID NOs: 39, 40, and 41;. SEQ ID NOs: 44, 45, and 46; SEQ ID NOs: 49, 50, and 51; SEQ ID NOs: 54, 55, and 56; SEQ ID NOs: 59, 60, and 61; and SEQ ID NOs: 64, 65, and 66; wherein said VL encoding polynucleotide encodes a VL polypeptide comprising VL-CDRl, VL-CDR2, and VL-CDR3 amino acid sequences selected from the group consisting of: SEQ ID NOs: 69, 70, and 71; SEQ ID NOs: 74, 75, and 76; SEQ ID NOs: 79, 80, and 81; SEQ ID NOs: 84, 85, and 86; SEQ ID NOs: 89, 90, and 91; SEQ ID NOs: 94, 95, and 96; SEQ ED NOs: 99, 100, and 101; SEQ ED NOs: 104, 105, and 106; SEQ ID NOs: 109, 110, and 111; SEQ ID NOs: 114, 115, and 116; and SEQ ID NOs: 119, 120, and 121 ; and wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides specifically binds IGF-Rl.
175. The composition of any one of claims 171 - 174, wherein said VH encoding polynucleotide further comprises a nucleic acid encoding a signal peptide fused to said antibody VH polypeptide.
176. The composition of any one of claims 171-174, wherein said VL encoding polynucleotide further comprises a nucleic acid encoding a signal peptide fused to said antibody VL polypeptide.
177. The composition of any one of claims 171 to 176, wherein said VH encoding polynucleotide further comprises a nucleic acid encoding a heavy chain constant region CHl domain fused to said VH polypeptide.
178. The composition of any one of claims 171 to 177, wherein said VH encoding polynucleotide further comprises a nucleic acid encoding a heavy chain constant region CH2 domain fused to said VH polypeptide.
179. The composition of any one of claims 171 to 178, wherein said VH encoding polynucleotide further comprises a nucleic acid encoding a heavy chain constant region CH3 domain fused to said VH polypeptide.
180. The composition of any one of claims 171 to 179, wherein said VH encoding polynucleotide further comprises a nucleic acid encoding a heavy chain hinge region fused to said VH polypeptide.
181. The composition of any one of claims 177 to 180, wherein said heavy chain constant region is human IgG4.
182. The composition of claim 181, wherein said IgG4 is mutagenized to remove glycosylation sites.
183. The composition of claim 182, wherein said mutations comprise S241P and T318A using the Kabat numbering system.
184. The composition of any one of claims 171 to 183, wherein said VL encoding polynucleotide further comprises a nucleic acid encoding a light chain constant region domain fused to said VL polypeptide.
185. The composition of claim 174, wherein said light chain constant region is human kappa.
186. The composition of any one of claims 171 to 185, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides specifically binds the same IGF-Rl epitope as a reference monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8.
187. The composition of any one of claims 171 to 185, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides competitively inhibits a reference monoclonal Fab antibody fragment selected from the group consisting of Ml 3- C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04, or a reference monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, P1A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8 from binding to IGF-Rl.
188. The composition of any one of claims 171 to 187, wherein the framework regions of said VH and VL polypeptides are human, except for five or fewer amino acid substitutions.
189. The composition of any one of claims 171 to 188, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides binds to a linear epitope.
190. The composition of any one of claims 171 to 188, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides binds to a non-linear conformational epitope.
191. The composition of any one of claims 171 to 188, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides is multivalent, and comprises at least two heavy chains and at least two light chains.
192. The composition of any one of claims 171 to 191, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides is multispecific.
193. The composition of any one of claims 171 to 192, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides is bispecific.
194. The composition of any one of claims 171 to 193, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides comprises heavy and light chain variable domains which are fully human.
195. The composition of claim 194, wherein said heavy and light chain variable domains are identical to those of a monoclonal Fab antibody fragment selected from the group consisting of M13-C06, M14-G11, M14-C03, M14-B01, M12-E01, and M12-G04.
196. The composition of any one of claims 171 to 193, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides comprises heavy and light chain variable domains which are murine.
197. The composition of claim 196, wherein said heavy and light chain variable domains are identical to those of a monoclonal antibody produced by a hybridoma selected from the group consisting of P2A7.3E11, 20C8.3B8, Pl A2.2B11, 20D8.24B11, P1E2.3B12, and P1G10.2B8.
198. The composition of any one of claims 171 to 193 and 196 to 197, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides is humanized.
199. The composition of any one of claims 171 to 193 and 196 to 197, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides is chimeric.
200. The composition of any one of claims 171 to 193 and 196 to 197, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides is primatized.
201. The composition of any one of claims 171 to 195, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides is fully human.
202. The composition of any one of claims 171 to 201 , wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides is an Fab fragment.
203. The composition of any one of claims 171 to 201, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides is an Fab1 fragment.
204. The composition of any one of claims 171 to 201, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides is an F(ab)2 fragment.
205. The composition of any one of claims 171 to 201, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides is an Fv fragment.
206. The composition of any one of claims 171 to 201, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides is a single chain antibody.
207. The composition of any one of claims 171 to 206, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides specifically binds to an IGF-Rl polypeptide or fragment thereof, or an IGF-Rl variant polypeptide, with an affinity characterized by a dissociation constant (KD) no greater than 5 x 10"2 M, 10"2 M, 5 x 103 M, 10"3 M, 5 x 10^ M, 1O-4 M, 5 x 10'5 M, 105 M, 5 x 10"6 M, W6 M, 5 x 107 M, 10'7 M, 5 x 108 M, 10'8 M, 5 x 10'9 M, 10"9 M, 5 x 10 10 M, 10"10 M, 5 x 10"" M, 10"" M, 5 x 10 12 M, 10-12 M, 5 x 10 13 M, 1013 M, 5 x 10 14 M, lO'14 M, 5 x 10 15 M, or 10"15 M.
208. The composition of any one of claims 171 to 207, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides preferentially binds to a human IGF-Rl polypeptide or fragment thereof, relative to a murine IGF-Rl polypeptide or fragment thereof or a non-human primate IGF-Rl polypeptide or fragment thereof.
209. The composition of any one of claims 171 to 207, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides binds to a human IGF-Rl polypeptide or fragment thereof, and also binds to a non-human primate IGF-Rl polypeptide or fragment thereof.
210. The composition of any one of claims 171 to 209, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides binds to IGF-Rl expressed on the surface of a cell.
211. The composition of claim 210, wherein said cell is a malignant cell, a neoplastic cell, a tumor cell, or a metastatic cell.
212. The composition of any one of claims 171 to 211, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides blocks insulin growth factor from binding to IGF-Rl.
213. The composition of claim 212, wherein said insulin growth factor is insulin growth factor-1 (IGF-I).
214. The composition of claim 212, wherein said insulin growth factor is insulin growth factor-2 (IGF-2).
215. The composition of claim 212, which blocks both IGF- 1 and IGF-2 from binding to IGF- Rl.
216. The composition of any one of claims 171 to 215, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides inhibits IGF-Rl -mediated cell proliferation.
217. The composition of any one of claims 171 to 216, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides inhibits IGF-I or IGF-2- mediated IGF-Rl phosphorylation.
218. The composition of any one of claims 171 to 217, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides inhibits tumor cell growth.
219. The composition of any one of claims 171 to 218, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides inhibits IGF-Rl internalization.
220. The composition of any one of claims 171 to 219, wherein said VH encoding polynucleotide, said VL encoding polynucleotide, or both said VH and said VL encoding polynucleotides further comprise a nucleic acid encoding a heterologous polypeptide.
221. The composition of any one of claims 171 to 220, wherein an antibody or fragment thereof encoded by said VH and VL encoding polynucleotides is conjugated to an agent selected from the group consisting of cytotoxic agent, a therapeutic agent, cytostatic agent, a biological toxin, a prodrug, a peptide, a protein, an enzyme, a virus, a lipid, a biological response modifier, pharmaceutical agent, a lymphokine, a heterologous antibody or fragment thereof, a detectable label, polyethylene glycol (PEG), and a combination of two or more of any said agents.
222. The composition of claim 221, wherein said cytotoxic agent is selected from the group consisting of a radionuclide, a biotoxin, an enzymatically active toxin, a cytostatic or cytotoxic therapeutic agent, a prodrugs, an immunologically active ligand, a biological response modifier, or a combination of two or more of any said cytotoxic agents.
223. The composition of claim 221, wherein said detectable label is selected from the group consisting of an enzyme, a fluorescent label, a chemiluminescent label, a bioluminescent label, a radioactive label, or a combination of two or more of any said detectable labels.
224. The composition of any one of claims 171 to 223, wherein said VH encoding polynucleotide is contained on a first vector and said VL encoding polynucleotide is contained on a second vector.
225. The composition of claim 224, wherein said VH encoding polynucleotide is operably associated with a first promoter and said VL encoding polynucleotide is operably associated with a second promoter.
226. The composition of claim 225, wherein said first and second promoters are copies of the same promoter.
227. The composition of claim 225, wherein said first and second promoters non-identical.
228. The composition of any one of claims 224 to 227, wherein said first vector and said second vector are contained in a single host cell.
229. The composition of any one of claims 224 to 227, wherein said first vector and said second vector are contained in a separate host cells.
230. A method of producing an antibody or fragment thereof which specifically binds IGF- 1 R, comprising culturing the host cell of claim 228, and recovering said antibody, or fragment thereof.
231. A method of producing an antibody or fragment thereof which specifically binds IGF- 1 R, comprising co-culturing the separate host cells of claim 229, and recovering said antibody, or fragment thereof.
232. A method of producing an antibody or fragment thereof which specifically binds IGF-IR, comprising separately culturing the separate host cells of claim 229, combining said VH and VL encoding polypeptides, and recovering said antibody, or fragment thereof.
233. An antibody or fragment thereof which specifically binds IGF-IR, produced by the method of any one of claims 230 to 232.
234. The composition of any one of claims 171 to 223, wherein said VH encoding polynucleotide and said VL encoding polynucleotide are on the same vector.
235. The vector of claim 234.
236. The vector of claim 235, wherein said VH encoding polynucleotide and said VL encoding polynucleotide are each operably associated with a promoter.
237. The vector of claim 235, wherein said VH encoding polynucleotide and said VL encoding polynucleotide are fused in frame, are co-transcribed from a single promoter operably associated therewith, and are cotranslated into a single chain antibody or antigen-binding fragment thereof.
238. The vector of claim 235, wherein said VH encoding polynucleotide and said VL encoding polynucleotide are co-transcribed from a single promoter operably associated therewith, but are separately translated.
239. The vector of claim 238, further comprising an IRES sequence disposed between said VH encoding polynucleotide and said VL encoding polynucleotide.
240. The vector of claim 235, wherein said polynucleotide encoding a VH and said polynucleotide encoding a VL are separately transcribed, each being operably associated with a separate promoter.
241. The vector of claim 240, wherein said separate promoters are copies of the same promoter.
242. The vector of claim 240, wherein said separate promoters are non-identical.
243. A host cell comprising the vector of any one of claims 235 to 242.
244. A method of producing an antibody or fragment thereof which specifically binds IGF-IR, comprising culturing the host cell of claim 243, and recovering said antibody, or fragment thereof.
245. An antibody or fragment thereof which specifically binds IGF-IR, produced by the method of claim 244.
246. A method for treating a hyperproliferative disorder in an animal, comprising administering to an animal in need of treatment a composition comprising:
a) the isolated antibody or fragment thereof of any one of claims 1 to 82, 170, 233 and 245; and
b) a pharmaceutically acceptable carrier.
247. The method of claim 246, wherein said hyperproliferative disease or disorder is selected from the group consisting of cancer, a neoplasm, a tumor, a malignancy, or a metastasis thereof.
248. The method of claim 247, wherein said antibody or fragment thereof specifically binds to IGF-IR expressed on the surface of a malignant cell.
249. The method of claim 248, wherein binding of said antibody or fragment thereof to said malignant cell results in growth inhibition of said malignant cell.
250. The method of any one of claims 246 to 249, wherein said antibody or fragment thereof inhibits IGF binding to said malignant cell.
251. The method of claim 250, wherein said IGF is IGF-I .
252. The method of claim 250, wherein said IGF is IGF-2.
253. The method of claim 250, wherein said IGF is IGF-I and IGF-2.
254. The method of claim 253, wherein said antibody or fragment thereof inhibits IGF-I from binding to said malignant cell but does not inhibit IGF-2.
255. The method of claim 253, wherein said antibody or fragment thereof inhibits IGF-2 from binding to said malignant cell but does not inhibit IGF-I .
256. The method of any one of claims 246 to 249, wherein said aid antibody or fragment thereof promotes internalization if IGF-IR into said malignant cell.
257. The method of any one of claims 246 to 249, wherein said aid antibody or fragment thereof inhibits IGF-IR phosphorylation.
258. The method of any one of claims 246 to 249, wherein said aid antibody or fragment thereof inhibits tumor cell proliferation.
259. The method of claim 258, wherein tumor cell proliferation is inhibited through the prevention or retardation of metastatic growth.
260. The method of any one of claims 246 to 249, wherein said aid antibody or fragment thereof inhibits tumor cell migration.
261. The method of claim 258, wherein tumor cell proliferation is inhibited through the prevention or retardation of tumor spread to adjacent tissues.
262. The method of claim 247, wherein said hyperproliferative disease or disorder is a neoplasm located in the: prostate, colon, abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, adrenal gland, parathyroid gland, pituitary gland, testicles, ovary, thymus, thyroid, eye, head, neck, central nervous system, peripheral nervous system, lymphatic system, pelvis, skin, soft tissue, spleen, thoracic region, or urogenital tract.
263. The method of claim 247, wherein said hyperproliferative disease is cancer, said cancer selected from the group consisting of: epithelial squamous cell cancer, melanoma, leukemia, myeloma, stomach cancer, brain cancer, lung cancer, pancreatic cancer, cervical cancer, ovarian cancer, liver cancer, bladder cancer, breast cancer, colon cancer, renal cancer, prostate cancer, testicular cancer, thyroid cancer, and head and neck cancer.
264. The method of claim 263, wherein said cancer is selected from the group consisting of stomach cancer, renal cancer, brain cancer, bladder cancer, colon cancer, lung cancer, breast cancer, pancreatic cancer, ovarian cancer, and prostate cancer.
265. The method of any one of claims 246 to 264, wherein said animal is a mammal.
266. The method of claim 265, wherein said mammal is a human.
EP07754217A 2006-03-28 2007-03-28 Anti-igf-ir antibodies and uses thereof Withdrawn EP1999149A4 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US78634706P 2006-03-28 2006-03-28
US87655406P 2006-12-22 2006-12-22
PCT/US2007/007664 WO2007126876A2 (en) 2006-03-28 2007-03-28 Anti-igf-ir antibodies and uses thereof

Publications (2)

Publication Number Publication Date
EP1999149A2 true EP1999149A2 (en) 2008-12-10
EP1999149A4 EP1999149A4 (en) 2010-01-20

Family

ID=38656039

Family Applications (1)

Application Number Title Priority Date Filing Date
EP07754217A Withdrawn EP1999149A4 (en) 2006-03-28 2007-03-28 Anti-igf-ir antibodies and uses thereof

Country Status (13)

Country Link
US (3) US7612178B2 (en)
EP (1) EP1999149A4 (en)
JP (1) JP2009532027A (en)
KR (1) KR20080113268A (en)
AU (1) AU2007245164A1 (en)
BR (1) BRPI0709843A2 (en)
CA (1) CA2646406A1 (en)
EA (1) EA200802061A1 (en)
IL (1) IL194266A0 (en)
MX (1) MX2008012146A (en)
NO (1) NO20084521L (en)
SG (1) SG170799A1 (en)
WO (1) WO2007126876A2 (en)

Families Citing this family (70)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20080152649A1 (en) * 2002-03-01 2008-06-26 Xencor, Inc. Optimized igf-1r antibodies and methods of using the same
US8168181B2 (en) 2006-02-13 2012-05-01 Alethia Biotherapeutics, Inc. Methods of impairing osteoclast differentiation using antibodies that bind siglec-15
CA2822302A1 (en) 2006-02-13 2007-08-23 Alethia Biotherapeutics Inc. Methods of impairing osteoclast differentiation
AU2007245164A1 (en) * 2006-03-28 2007-11-08 Biogen Idec Ma Inc. Anti-IGF-IR antibodies and uses thereof
CN104761637B (en) 2006-03-31 2021-10-15 中外制药株式会社 Methods for modulating antibody hemodynamics
US7846724B2 (en) 2006-04-11 2010-12-07 Hoffmann-La Roche Inc. Method for selecting CHO cell for production of glycosylated antibodies
CL2007002502A1 (en) * 2006-08-31 2008-05-30 Hoffmann La Roche VARIANTS OF THE SIMILAR GROWTH FACTOR TO HUMAN INSULIN-1 (IGF-1) PEGILATED IN LISIN; METHOD OF PRODUCTION; FUSION PROTEIN THAT UNDERSTANDS IT; AND ITS USE TO TREAT ALZHEIMER'S DISEASE.
TWI422594B (en) * 2007-02-02 2014-01-11 Baylor Res Inst Agent for presenting cells via a dendritic cell asialoglycoprotein receptor (DC-ASGPR)
GB0702888D0 (en) * 2007-02-14 2007-03-28 Glaxo Group Ltd Novel Antibodies
PE20090368A1 (en) 2007-06-19 2009-04-28 Boehringer Ingelheim Int ANTI-IGF ANTIBODIES
WO2009018226A2 (en) * 2007-07-27 2009-02-05 Facet Biotech Corporation Pharmaceutical combinations comprising a tyrosine kinase inhibitor and an antibody against integrin alpha 1 beta 5 (cd49e)
KR20100052545A (en) * 2007-08-28 2010-05-19 바이오겐 아이덱 엠에이 인코포레이티드 Compositions that bind multiple epitopes of igf-1r
CA2697612A1 (en) * 2007-08-28 2009-03-12 Biogen Idec Ma Inc. Anti-igf-1r antibodies and uses thereof
ES2595638T3 (en) 2007-09-26 2017-01-02 Chugai Seiyaku Kabushiki Kaisha Method to modify the isoelectric point of an antibody by replacing amino acids in a CDR
JP2010540960A (en) * 2007-10-03 2010-12-24 オーエスアイ・ファーマスーティカルズ・インコーポレーテッド Biological marker predicting anticancer response to insulin-like growth factor-1 receptor kinase inhibitor
WO2009045389A2 (en) * 2007-10-03 2009-04-09 Osi Pharmaceuticals, Inc. Biological markers predictive of anti-cancer response to insulin-like growth factor-1 receptor kinase inhibitors
WO2009080832A1 (en) * 2007-12-26 2009-07-02 Biotest Ag Methods and agents for improving targeting of cd138 expressing tumor cells
CN101965366B (en) * 2007-12-26 2016-04-27 生物测试股份公司 The immunoconjugates of target CD138 and application thereof
WO2009120993A2 (en) * 2008-03-28 2009-10-01 The United States Of America, As Represented By The Secretary, Department Of Health & Human Services Synthetic analogs of the juxtamembrane domain of igf1r and uses thereof
KR102057826B1 (en) 2008-04-11 2019-12-20 추가이 세이야쿠 가부시키가이샤 Antigen-binding molecule capable of binding to two or more antigen molecules repeatedly
CN102065895A (en) * 2008-04-11 2011-05-18 比奥根艾迪克Ma公司 Therapeutic combinations of anti-IGF-1R antibodies and other compounds
SG190572A1 (en) 2008-04-29 2013-06-28 Abbott Lab Dual variable domain immunoglobulins and uses thereof
CA2726087A1 (en) 2008-06-03 2009-12-10 Tariq Ghayur Dual variable domain immunoglobulins and uses thereof
SG2014006860A (en) * 2008-11-12 2014-05-29 Merck Sharp & Dohme ßGI-IGG INTRON FOR ENHANCED ANTI-IGF1 R EXPRESSION
NZ597692A (en) 2008-12-12 2013-08-30 Boehringer Ingelheim Int Anti-IGF antibodies
JP2012513477A (en) * 2008-12-23 2012-06-14 ソーク インスティチュート フォー バイオロジカル スタディーズ Treatment methods for neurodegenerative diseases
JP2012519170A (en) * 2009-02-26 2012-08-23 オーエスアイ・ファーマシューティカルズ,エルエルシー INSITU method for monitoring EMT status of tumor cells in vivo
US20100316639A1 (en) 2009-06-16 2010-12-16 Genentech, Inc. Biomarkers for igf-1r inhibitor therapy
US8926976B2 (en) * 2009-09-25 2015-01-06 Xoma Technology Ltd. Modulators
SI2493922T1 (en) 2009-10-26 2017-06-30 F. Hoffmann-La Roche Ag Method for the production of a glycosylated immunoglobulin
WO2011083391A2 (en) 2010-01-05 2011-07-14 Pfizer Inc. Biomarkers for anti-igf-ir cancer therapy
WO2011090492A1 (en) * 2010-01-19 2011-07-28 Immunomedics, Inc. Novel class of monospecific and bispecific humanized antibodies that target the insulin-like growth factor type i receptor (igf-1r)
CA2783665A1 (en) * 2010-03-03 2011-09-09 OSI Pharmaceuticals, LLC Biological markers predictive of anti-cancer response to insulin-like growth factor-1 receptor kinase inhibitors
WO2011161119A1 (en) * 2010-06-22 2011-12-29 F. Hoffmann-La Roche Ag Antibodies against insulin-like growth factor i receptor and uses thereof
UY33492A (en) 2010-07-09 2012-01-31 Abbott Lab IMMUNOGLOBULINS WITH DUAL VARIABLE DOMAIN AND USES OF THE SAME
EP3252072A3 (en) 2010-08-03 2018-03-14 AbbVie Inc. Dual variable domain immunoglobulins and uses thereof
DE102010035003B4 (en) * 2010-08-20 2015-08-06 PicoQuant GmbH. Unternehmen für optoelektronische Forschung und Entwicklung Spatially and temporally high-resolution microscopy
EP2647706B1 (en) 2010-11-30 2023-05-17 Chugai Seiyaku Kabushiki Kaisha Antigen-binding molecule capable of binding to plurality of antigen molecules repeatedly
MX2013008833A (en) 2011-02-02 2013-12-06 Amgen Inc METHODS AND COMPOSITIONS RELATED TO THE INHIBITION OF RECEIVER OF THE SIMULAR GROWTH FACTOR TO INSULIN 1 (IGF-1R).
WO2012149014A1 (en) 2011-04-25 2012-11-01 OSI Pharmaceuticals, LLC Use of emt gene signatures in cancer drug discovery, diagnostics, and treatment
WO2013071056A2 (en) 2011-11-11 2013-05-16 Duke University Combination drug therapy for the treatment of solid tumors
KR20140100571A (en) 2011-12-08 2014-08-14 바이오테스트 아게 Uses of immunoconjugates targeting cd138
US9249224B2 (en) * 2011-12-22 2016-02-02 Rinat Neuroscience Corp. Human growth hormone receptor antagonist antibodies and methods of use thereof
CA2875543A1 (en) * 2012-06-21 2013-12-27 Sorrento Therapeutics, Inc. Antigen binding proteins that bind igf1r
HK1210192A1 (en) * 2012-07-19 2016-04-15 Alethia Biotherapeutics Inc. Anti-siglec-15 antibodies
US8980259B2 (en) 2012-07-20 2015-03-17 Novartis Ag Combination therapy
SG10201709559PA (en) 2012-08-24 2017-12-28 Chugai Pharmaceutical Co Ltd Fcγriib-specific fc region variant
WO2014030750A1 (en) 2012-08-24 2014-02-27 中外製薬株式会社 MOUSE FcγRII-SPECIFIC Fc ANTIBODY
WO2014107165A1 (en) * 2013-01-05 2014-07-10 R-PHARM, CJSC (Closed Joint Stock Company) Fully human antibodies against human receptor igf-1r
US20140255413A1 (en) 2013-03-07 2014-09-11 Boehringer Ingelheim International Gmbh Combination therapy for neoplasia treatment
CN105246914B (en) 2013-04-02 2021-08-27 中外制药株式会社 Fc region variants
KR101895634B1 (en) * 2013-05-31 2018-09-05 한미약품 주식회사 IgG4 Fc fragment comprising modified hinge region
DK3134438T3 (en) * 2014-04-25 2020-12-07 Pf Medicament IGF-1R antibody and its use as an addressing vehicle in the treatment of cancer
KR101860280B1 (en) 2014-12-19 2018-05-21 추가이 세이야쿠 가부시키가이샤 Anti-myostatin antibodies, polypeptides containing variant fc regions, and methods of use
KR102605798B1 (en) 2015-02-05 2023-11-23 추가이 세이야쿠 가부시키가이샤 Antibodies comprising an ion concentration dependent antigen-binding domain, fc region variants, il-8-binding antibodies, and uses therof
TWI716400B (en) 2015-04-27 2021-01-21 法商皮爾法伯製藥公司 Novel igf-1r antibody and its use for the diagnosis of cancer
AR104413A1 (en) * 2015-04-27 2017-07-19 Pf Medicament IGF-1R ANTIBODY AND ITS USE TO DIAGNOSTIC CANCER
WO2017110981A1 (en) 2015-12-25 2017-06-29 Chugai Seiyaku Kabushiki Kaisha Anti-myostatin antibodies and methods of use
EP3494991A4 (en) 2016-08-05 2020-07-29 Chugai Seiyaku Kabushiki Kaisha COMPOSITION FOR PREVENTING OR TREATING DISEASES RELATING TO IL-8
SG10201607778XA (en) 2016-09-16 2018-04-27 Chugai Pharmaceutical Co Ltd Anti-Dengue Virus Antibodies, Polypeptides Containing Variant Fc Regions, And Methods Of Use
WO2018204872A2 (en) * 2017-05-05 2018-11-08 Fusion Pharmaceuticals Inc. Igf-1r monoclonal antibodies and uses thereof
US20200276273A1 (en) * 2017-09-21 2020-09-03 University Of Miami Method for treating myeloid leukemia
CA3079681A1 (en) * 2017-10-20 2019-04-25 Fred Hutchinson Cancer Research Center Systems and methods to produce b cells genetically modified to express selected antibodies
CN112119090B (en) 2018-03-15 2023-01-13 中外制药株式会社 Anti-dengue virus antibodies cross-reactive to Zika virus and methods of use
US20220088231A1 (en) * 2018-12-03 2022-03-24 Fusion Pharmaceuticals Inc. Radioimmunoconjugates and dna damage and repair inhibitor combination therapy
AU2020337958A1 (en) 2019-08-28 2022-03-17 Horizon Therapeutics Ireland Dac Methods for the treatment of thyroid eye disease
CN119638849A (en) * 2021-10-18 2025-03-18 深圳科兴药业有限公司 Growth hormone fusion protein and application thereof
AU2024287547A1 (en) 2023-07-07 2026-01-22 Viridian Therapeutics, Inc. Methods of treating chronic thyroid eye disease
CN117347626B (en) * 2023-12-06 2024-03-12 安徽惠邦生物工程有限公司 Human insulin-like growth factor binding protein-1 chemiluminescence immunoassay kit and preparation method thereof
JP2025115976A (en) * 2024-01-26 2025-08-07 フューチャージェン・バイオファーマシューティカル(ベイジン)カンパニー・リミテッド Antibodies capable of specifically binding to TL1A and uses thereof

Family Cites Families (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5859205A (en) * 1989-12-21 1999-01-12 Celltech Limited Humanised antibodies
FI941572A7 (en) 1991-10-07 1994-05-27 Oncologix Inc Combination and method of use of anti-erbB-2 monoclonal antibodies
ATE236987T1 (en) 1992-11-13 2003-04-15 Idec Pharma Corp CONSENSUS KOZAK SEQUENCES FOR MAMMAL EXPRESSION
WO1994012520A1 (en) 1992-11-20 1994-06-09 Enzon, Inc. Linker for linked fusion polypeptides
US6262238B1 (en) 1997-01-14 2001-07-17 Roche Diagnostic, Gmbh Process for modifying the stability of antibodies
EP1171468B1 (en) 1999-04-09 2008-07-02 Universität Zürich Method for the Stabilization of Chimeric Immunoglobulins or Immunoglobulin Fragments, and Stabilized Anti-EGP-2-scFv Fragment
CA2409991A1 (en) 2000-05-24 2001-11-29 Imclone Systems Incorporated Bispecific immunoglobulin-like antigen binding proteins and method of production
AU2001297872B2 (en) 2000-11-17 2006-11-09 University Of Rochester In vitro methods of producing and identifying immunoglobulin molecules in eukaryotic cells
ME00502B (en) * 2001-01-05 2011-10-10 Amgen Fremont Inc Antibodies to insulin-like growth factor i receptor
US7553485B2 (en) 2002-01-18 2009-06-30 Pierre Fabre Medicament Anti-IGF-IR and/or anti-insulin/IGF-I hybrid receptors antibodies and uses thereof
EP1506286B1 (en) * 2002-05-24 2014-03-19 Merck Sharp & Dohme Corp. Neutralizing human anti-igfr antibody
US8034904B2 (en) * 2002-06-14 2011-10-11 Immunogen Inc. Anti-IGF-I receptor antibody
JP2007528201A (en) * 2003-03-14 2007-10-11 ファルマシア・コーポレーション Antibodies to the IGF-I receptor for the treatment of cancer
ES2383014T3 (en) * 2003-04-02 2012-06-15 F. Hoffmann-La Roche Ag Antibodies against insulin-like growth factor I and their uses
CA2524305C (en) * 2003-05-01 2015-12-08 Imclone Systems Incorporated Fully human antibodies directed against the human insulin-like growth factor-1 receptor
AR046071A1 (en) * 2003-07-10 2005-11-23 Hoffmann La Roche ANTIBODIES AGAINST RECEIVER I OF THE INSULINAL TYPE GROWTH FACTOR AND THE USES OF THE SAME
WO2005058967A2 (en) * 2003-12-16 2005-06-30 Pierre Fabre Medicament Novel anti-insulin/igf-i hybrid receptor or anti-insulin/igf-i hybrid receptor and igf-ir antibodies and uses thereof
CA2559280A1 (en) 2004-03-15 2005-09-29 Biogen Idec Ma Inc. Methods and constructs for expressing polypeptide multimers in eukaryotic cells using alternative splicing
EP1755660B1 (en) 2004-05-07 2010-03-24 The University of North Carolina at Chapel Hill Method for enhancing or inhibiting insulin-like growth factor-i
JP2008532476A (en) * 2004-08-12 2008-08-21 ダイアックス コーポレーション Complex binding protein
MY146381A (en) 2004-12-22 2012-08-15 Amgen Inc Compositions and methods relating relating to anti-igf-1 receptor antibodies
WO2006074399A2 (en) 2005-01-05 2006-07-13 Biogen Idec Ma Inc. Multispecific binding molecules comprising connecting peptides
US20090030187A1 (en) 2005-03-14 2009-01-29 Tous Guillermo I Macromolecules comprising a thioether cross-link
FR2888850B1 (en) 2005-07-22 2013-01-11 Pf Medicament NOVEL ANTI-IGF-IR ANTIBODIES AND THEIR APPLICATIONS
AU2007245164A1 (en) 2006-03-28 2007-11-08 Biogen Idec Ma Inc. Anti-IGF-IR antibodies and uses thereof
CA2697612A1 (en) 2007-08-28 2009-03-12 Biogen Idec Ma Inc. Anti-igf-1r antibodies and uses thereof
KR20100052545A (en) * 2007-08-28 2010-05-19 바이오겐 아이덱 엠에이 인코포레이티드 Compositions that bind multiple epitopes of igf-1r
CN102065895A (en) 2008-04-11 2011-05-18 比奥根艾迪克Ma公司 Therapeutic combinations of anti-IGF-1R antibodies and other compounds

Also Published As

Publication number Publication date
AU2007245164A1 (en) 2007-11-08
US20100099147A1 (en) 2010-04-22
CA2646406A1 (en) 2007-11-08
WO2007126876A2 (en) 2007-11-08
NO20084521L (en) 2008-12-23
US7612178B2 (en) 2009-11-03
EP1999149A4 (en) 2010-01-20
US20100098710A1 (en) 2010-04-22
KR20080113268A (en) 2008-12-29
IL194266A0 (en) 2011-08-01
BRPI0709843A2 (en) 2011-07-26
US8147829B2 (en) 2012-04-03
JP2009532027A (en) 2009-09-10
SG170799A1 (en) 2011-05-30
US20070243194A1 (en) 2007-10-18
EA200802061A1 (en) 2009-04-28
WO2007126876A3 (en) 2008-04-03
MX2008012146A (en) 2008-10-03

Similar Documents

Publication Publication Date Title
US8147829B2 (en) Anti-IGR-1R antibodies and uses thereof
US20090092614A1 (en) Anti-IGF-1R Antibodies and Uses Thereof
US20090291088A1 (en) Therapeutic combinations of anti-igf-1r antibodies and other compounds
US20090130105A1 (en) Compositions that bind multiple epitopes of igf-1r
JP2009532027A5 (en)
CA2501984C (en) Erythropoietin receptor binding antibodies
KR20200014414A (en) Antibodies that specifically bind to PD-1 and methods of use
US20090226442A1 (en) RON antibodies and uses thereof
US20040175379A1 (en) Erythropoietin receptor binding antibodies
KR20180027566A (en) Tau binding antibody
CN101415728A (en) Anti-IGF-1R antibodies and uses thereof
TW201010726A (en) Recombinant anti-epidermal growth factor receptor antibody compositions
WO2008127655A1 (en) Anti-alpha 6 beta 4 integrin antibodies and uses therof
HK40070151A (en) Bispecific antibody and use thereof

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20080330

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LI LT LU LV MC MT NL PL PT RO SE SI SK TR

AX Request for extension of the european patent

Extension state: AL BA HR MK RS

REG Reference to a national code

Ref country code: HK

Ref legal event code: DE

Ref document number: 1127361

Country of ref document: HK

A4 Supplementary search report drawn up and despatched

Effective date: 20091222

RIC1 Information provided on ipc code assigned before grant

Ipc: C12N 15/13 20060101ALI20091216BHEP

Ipc: C12N 5/20 20060101ALI20091216BHEP

Ipc: A61P 35/00 20060101ALI20091216BHEP

Ipc: A61K 39/395 20060101ALI20091216BHEP

Ipc: C07K 16/46 20060101ALI20091216BHEP

Ipc: C07K 16/00 20060101ALI20091216BHEP

Ipc: C07K 16/28 20060101AFI20091216BHEP

17Q First examination report despatched

Effective date: 20100630

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20121107

REG Reference to a national code

Ref country code: HK

Ref legal event code: WD

Ref document number: 1127361

Country of ref document: HK