EP1858534A2 - Bacteriocins and novel bacterial strains - Google Patents
Bacteriocins and novel bacterial strainsInfo
- Publication number
- EP1858534A2 EP1858534A2 EP05730719A EP05730719A EP1858534A2 EP 1858534 A2 EP1858534 A2 EP 1858534A2 EP 05730719 A EP05730719 A EP 05730719A EP 05730719 A EP05730719 A EP 05730719A EP 1858534 A2 EP1858534 A2 EP 1858534A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- nrrl
- bacteriocin
- seq
- amino acid
- therapeutic
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/335—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Lactobacillus (G)
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K10/00—Animal feeding-stuffs
- A23K10/10—Animal feeding-stuffs obtained by microbiological or biochemical processes
- A23K10/16—Addition of microorganisms or extracts thereof, e.g. single-cell proteins, to feeding-stuff compositions
- A23K10/18—Addition of microorganisms or extracts thereof, e.g. single-cell proteins, to feeding-stuff compositions of live microorganisms
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/142—Amino acids; Derivatives thereof
- A23K20/147—Polymeric derivatives, e.g. peptides or proteins
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K50/00—Feeding-stuffs specially adapted for particular animals
- A23K50/70—Feeding-stuffs specially adapted for particular animals for birds
- A23K50/75—Feeding-stuffs specially adapted for particular animals for birds for poultry
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N1/00—Microorganisms; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
- C12N1/20—Bacteria; Culture media therefor
- C12N1/205—Bacterial isolates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K2035/11—Medicinal preparations comprising living procariotic cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12R—INDEXING SCHEME ASSOCIATED WITH SUBCLASSES C12C - C12Q, RELATING TO MICROORGANISMS
- C12R2001/00—Microorganisms ; Processes using microorganisms
- C12R2001/01—Bacteria or Actinomycetales ; using bacteria or Actinomycetales
- C12R2001/225—Lactobacillus
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12R—INDEXING SCHEME ASSOCIATED WITH SUBCLASSES C12C - C12Q, RELATING TO MICROORGANISMS
- C12R2001/00—Microorganisms ; Processes using microorganisms
- C12R2001/01—Bacteria or Actinomycetales ; using bacteria or Actinomycetales
- C12R2001/46—Streptococcus ; Enterococcus; Lactococcus
Definitions
- This invention relates to the control of disease in animals, especially poultry, through the use of novel bacteriocin- producing lactic acid-producing bacteria and/or novel bacteriocins produced by these species. It also relates to novel bacteriocins, amino acid sequences of the novel bacteriocins, and to the strains of lactic acid producing bacteria producing the novel bacteriocins. Furthermore, the invention relates to therapeutic compositions containing the novel bacteriocins and/or the strains of lactic acid producing bacteria producing them and to uses of the therapeutic compositions . Description of the Related Art
- Snoeyenbos et al (United States Patent No. 4,335,107, June, 1982) developed a competitive exclusion (CE) microflora technique for preventing Salmonella colonization by lyophilizing fecal droppings and culturing this preparation anaerobically.
- Mikola et al. (United States Patent No. 4,657,762, April, 1987) used intestinal fecal and cecal contents as a source of CE microflora for preventing Salmonella colonization.
- Stern et al (United States Patent No. 5,451,400, September, 1995 and United States Patent No.
- Bacteriocins consists of bactericidal proteins with a mechanism of action similar to ionophore antibiotics. Bacteriocins are often active against species which are closely related to the producer. Their widespread occurrence in bacterial species isolated from complex microbial communities such as the intestinal tract, the oral or other epithelial surfaces, suggests that bacteriocins may have a regulatory role in terms of population dynamics within bacterial ecosystems. Bacteriocins are defined as compounds produced by bacteria that have a biologically active protein moiety and bactericidal action (Tagg et al . , Bacteriological Reviews, Volume 40, 722-256, 1976).
- bacteriocin-like substances Some bacteriocins effective against Gram-positive bacteria, in contrast to Gram-negative bacteria, have wider spectrum of activity. It has been suggested that the term bacteriocin, when used to describe inhibitory agents produced by Gram-positive bacteria, should meet the minimum criteria of (1) being a peptide and (2) possessing bactericidal activity (Tagg et al . , supra) .
- Lactic acid bacteria are among the most important probiotic microorganisms. They are Gram-positive, nonsporing, catalase- negative organisms devoid of cytochromes. They are anaerobic but are aerotolerant , fastidious, acid-tolerant, and strictly- fermentative with lactic acid as the major end-product of sugar fermentation. Lactic acid producing bacteria include Lactobacillus species, Bifidobacterium species, Enterococcus faecalis, Enterococcus faecium, Lactococcus lactis, Leuconostoc mesenteroides, Pediococcus acidilactici, Sporolactobacillus inulinus, Streptococcus thermophilus, etc.
- bacteriocins are of particular interest in terms of widespread occurrence of bacteriocins within the group and are also in wide use throughout the fermented dairy, food and meat processing industries. Their role in the preservation and flavour characteristics of foods has been well documented. Most of the bacteriocins produced by this group are active only against other lactic acid bacteria, but several display anti-bacterial activity towards more phylogenetically distant Gram-positive bacteria and, under certain conditions, Gram-negative bacteria.
- Lactobacilli have been extensively studied for production of antagonists. These include the well characterized bacteriocins (DeKlerk, 1967; Upreti and Hinsdill 1975; Barefoot and Klaenhammer 1983; Joerger- and Klaenhammer 1986); potential bacteriocin-like substances (Vincent et al . , 1959), and other antagonists not necessarily related to bacteriocins (Vakil and Shahni 1965; Hamdan and Mikolajcik 1974; Mikolajcik and Hamdan 1975; and Shahni et al . , 1976).
- Class I- Lantibiotics which are small peptides of ⁇ 5kDa containing the unusual amino acids lanthionine and /3-methyl lanthionine. These are of particular interest in that they have very broad spectra of activity relative to other bacteriocins. Examples include Nisin, Nisin Z, carnocin U 149, lacticin 481, and lactocin 5.
- Class II-Small non-lanthionine containing peptides a heterogeneous group of small peptides of ⁇ 10kDa. This group includes peptides active against Listeria spp.
- An example is Helveticin.
- Class IV-Complex bacteriocins-proteins containing additional moieties such as lipids and carbohydrates.
- the present invention provides novel compositions containing at least one novel strain of a lactic acid-producing bacterial strain and/or novel bacteriocins produced by the at least one novel strain; a method of using the strain or bacteriocin, the novel strains, amino acid sequences for the novel bacteriocins, and methods of use, all of which are different from related art strains, bacteriocins, and methods of using.
- a further object of the present invention is to provide a novel Lactobacillus salivarius strain PVD32 having the identifying characteristics of .NRRL B-30514.
- a still further object of the present invention is to provide a novel Lactobacillus acidophilus LWP320 having the identifying characteristics of NRRL B-30510.
- a still further object of the present invention is to provide a novel Enterococcus faecalis LWP21 having the identifying characteristics of NRRL B-30645.
- a still further object of the present invention is to provide a novel Enterococcus durans strain LWP26 having the identifying characteristics of NRRL B-30511.
- a further object of the present invention is to provide novel bacteriocins produced by novel strains of Lactobacillus and Enterococcus .
- a still further object of the present invention is to provide a novel bacteriocin 0R7 having an amino acid sequence as set forth in SEQ ID NO 1.
- a still i further object of the present invention is to provide a novel bacteriocin LWP320 having an amino acid sequence as set forth in SEQ ID NO 2.
- a still further object of the present invention is to provide a novel bacteriocin LWP21 having an amino acid sequence as set forth in SEQ ID NO 3.
- a still further object of the present invention is to provide a novel bacteriocin LWP26 having an amino acid sequence as set forth in SEQ ID NO 4.
- Another object of the present invention is to provide a method for at least reducing the levels of colonization of at least one target bacteria in animals by administering to the animal a therapeutic composition including at least one novel strain of Lactobacillus or Enterococcus that produces a novel bacteriocin, at least one novel bacteriocin produced by a novel strain of Lactobacillus or Enterococcus, or a combination of the novel strains and/or novel bacteriocins .
- a further object of the present invention is to provide a method for at least reducing levels of colonization by at least one target bacteria in animals by administering to the animal a therapeutic composition including a novel strain of Lactobacillus having the characteristics of NRRL Deposit No. B-30514 and B- 30510; Enterococcus having the identifying characteristics of NRRL B-30511 and NRRL B-30645; and mixtures thereof.
- a still further object of the present invention is to provide a method for at least reducing the levels of colonization of at least one target bacteria in animals by administering to the animal a therapeutic composition including at least one novel strain with the identifying characteristics of NRRL B-30510, NRRL B-30511, NRRL 30514, NRRL B-30645, and mixtures thereof; at least one novel bacteriocin having an amino acid sequence as set forth in SEQ ID NO 1, SEQ ID NO 2, SEQ ID NO 3, SEQ ID NO 4, and mixtures thereof; or a combination of novel strains and novel bacteriocins .
- a still further object of the present invention is to provide a method for at least reducing the levels of colonization by at least one target bacteria in animals by administering to the animal a therapeutic composition including a novel bacteriocin having an amino acid sequence as set forth in SEQ ID NO 1.
- a still further object of the present invention is to provide a method for at least reducing the levels of colonization by at least on target bacteria in animals by administering to the animal a therapeutic composition including a novel bacteriocin having an amino acid sequence as set forth in SEQ ID NO 2.
- a still further object of the present invention is to provide a method for at least reducing the levels of colonization by at least on target bacteria in animals by administering to the animal a therapeutic composition including a novel bacteriocin having an amino acid sequence as set forth in SEQ ID NO 3.
- a still further object of the present invention is to provide a method for at least reducing the levels of colonization by at least one target bacteria in animals by administering to the animal a therapeutic composition including a novel bacteriocin having an amino acid sequence as set forth in SEQ ID NO 4.
- Another object of the present invention is to provide a method for at least reducing the levels of colonization by at least one target bacteria in an animal by administering to the animal a therapeutic composition comprising a bacteriocin produced by a novel strain of a Lactobacillus bacteria having the identifying characteristics of NRRL B-30510 or NRRL B-30514, ; a novel strain of Enterococcus having the identifying characteristics of NRRL B-30511 or NRRL B-30645, and mixtures thereof .
- Lactobacillus salivarius designated NRRL B-30514 (Strain PVD32)
- Lactobacillus acidophilus designated NRRL B-30510
- Enterococcus durans designated NRRL B-30511
- Enterococcus faecalis designated NRRL B-30645 (Strain LWP21)
- All of the above strains have been deposited under the provisions of the Budapest Treaty, with the U. S. D.A. Agricultural Research Service Patent Culture Collection (National Center for Agricultural Utilization Research, 1815 N. University Street, Peoria, Illinois 61604) .
- Figure 1 is a photograph showing direct detection of OR7 after SDS-PAGE.
- the gel was overlaid with Campylobacter jejuni to determine which band(s) correspond to antimicrobial activity and the molecular weight of the band with activity.
- Lane 1- Molecular Weight Markers MMW Range 6,500-97,000 AMERSHAM PHARMACIA BIOTECH: 97,000, 66,000, 43,000, 30,000, 21,000, 14,400, and 6,500 Da.
- Figure 2 is a photograph showing direct detection of bacteriocin LWP320 and LWP26 after SDS-PAGE.
- the gel was overlaid with Campylobacter jejuni to determine which band(s) corresponds to the antimicrobial activity and the molecular weight associated with the activity.
- Figure 3 is a photograph showing the direct detection of enterocin LWP21 after SDS-PAGE.
- the gel was overlaid with Campylobacter jejuni to determine which band(s) corresponds to the antimicrobial activity and molecular weight of the active band.
- Lane 4-Molecular Weight Markers LMW Range 1060-43,000 AMERSHAM PHARMACIA BIOTECH: 1,060, 2,500, 3,500, 14,400, 20,000, 30,000, and 43,000 Da.
- the band in lane 1 entero LWP21 after SP-Sepharose
- the band in lane 2 peak 2 after phenyl-Sepharose CL-4B which corresponds to the antimicrobial activity, the zone of growth inhibition (see arrow)
- the band in lane 3 peak after phenyl- Sepharose CL-4B
- Other bands did not show antimicrobial activity.
- enteric infections have been increasingly well recognized and the relationship of poultry contamination and human infection is well documented.
- the ability to diminish this health hazard by interventions at poultry processing plants is also well known.
- fecal materials containing pathogens are transferred onto meat and persist in the food processing kitchens .
- Metabolites of competing organisms may contribute to the control of pathogens such as Campylobacter jejuni and Salmonella.
- the novel antagonistic strains of the present invention were isolated from cecal and crop mucosal surfaces of broilers.
- the native components of characterized antagonist are low molecular weight peptides, bacteriocins, which have a wide spectrum of antagonistic activity.
- the present invention provides novel Lactobacillus and Enterococcus strains, novel bacteriocins, amino acid sequences of said bacteriocins, therapeutic compositions containing the novel bacteriocins and/or strains producing them, and methods for using the novel therapeutic compositions.
- the Lactobacillus acidophilus LWP320 isolate is a facultative anaerobe (microaerophile) , catalase-negative, Gram- positive nonmotile pleomorphic rods which has delayed growth on MRS agar at about 37° C. When grown on MRS agar, the isolate produces albescent, semiopaque colonies that are about 0.5mm to about 0.8 mm in diameter after about a 24 hour microaerophile incubation. In MRS broth the strain LWP320 grows only at the bottom of a culture tube .
- the Lactobacillus salivarius PVD32 strain is a facultative anaerobe (microaerophile) , Gram-positive, catalase-negative, nonmotile, pleomorphic rods.
- the colonies produce circular to regular-shaped, smooth, convex colonies with sharp margins that are about lmm to about 3 mm in diameter after microaerophile incubation for about 18-24 hours at about 37° C.
- the strains produce lactic acid and H 2 O 2 .
- the Enterococcus faecalis LWP21 strain is a factultative anaerobe (microaerophile) , Gram-positive cocci, catalase negative.
- the growth is delayed on MRS agar at 37° C.
- MRS agar When cultured on MRS agar, the strain produces albescent, setniopaque colonies that are about 0.2 mm in diameter after microaerophile incubation for about 24 hours at about 37° C. After about 48 hours microaerophile incubation at about 37° C, the colonies are about lmm to about 1.2 mm in diameter.
- the strain grows in MRS broth only in about 2/3 of the volume at the bottom of the culture tube .
- the Enterococcus durans LWP26 strain is a facultative anaerobe (microaerophile) , Gram-positive cocci, catalase negative with delayed growth on MRS agar at about 37°C.
- MRS agar When grown on ,MRS agar, the strain produces albescent, semiopaque colonies that are opaque after about 24 hours of microaerophilic incubation at about 37°C. After about 48 hours of microaerophilic incubation at about 37°C, colony sizes average from about 0.8mm to about 1.0 mm.
- MRS broth the strain grows into all volumes of the tube.
- Tests for activity against Campylobacter jejuni is carried out under microaerobic conditions of about 5% O 2 , about 10% CO 2 , and about 85% N 2 for about 24-48 hours at about 42°C.
- Approximately 0.2 ml of the antagonistic bacteria suspended in normal saline is plated onto Lactobacillus agar and incubated for about 24 hours .
- Agar blocks of about 0.5 cm 3 are cut out and transferred onto brucella or Campylobacter agar supplemented with lysed blood, about 10 micrograms /ml rifampicin, about 2.4 U/ml of polymyxin, and seeded with about 10 7 cells of Campylobacter jejuni. Plates are incubated at about 42°C for approximately 24-48 hours under microaerobic conditions. Activity is evaluated by measuring zones of growth inhibition.
- CAPs Crude antimicrobial preparations
- CAP crude antimicrobial preparation
- CAP samples are filtered through 0.22 ⁇ filters (Millipore, Bedford, MA, USA) .
- Enterococcus isolates found to be antagonistic are evaluated for bacteriocin production.
- Crude antimicrobial preparations are prepared by ammonium sulfate precipitation only from cultures of antagonistic strains grown in MRS broth: MRS broth 15.0 grams Lactose 0.05 gram
- Antagonistic peptides are isolated from supernatant by a combination of ammonium sulfate precipitation, desalting chromatography and gel filtration to produce a crude antimicrobial preparation (CAP) .
- CAP samples are filtered through 0.22 ⁇ filters (Millipore, Bedford, MA, USA).
- Molecular weights of all of the peptides are determined by SDS-PAGE electrophoresis, pis of the peptides are determined by isoelectric focusing. Amino acid sequences are determined by Edman degradation using, for example, a 491 cLC Automatic Sequencer (Applied Biosystems, Inc.) .
- peptide means a compound of at least two or more amino acids or amino acid analogs .
- the amino acids or amino acid analogs may be linked by peptide bonds. In another embodiment, the amino acids may be linked by other bonds, e.g., ester, ether, etc.
- Peptides can be in any structural configuration including linear, branched, or cyclic configurations.
- amino acids refers to either natural or synthetic amino acids, including both the D or L optical isomers, and amino acid analogs.
- Peptide derivatives and analogs of the present invention include, but are not limited to, those containing, as a primary amino acid sequence, all or part of the amino acid sequence of the peptide including altered sequences in which functionally equivalent amino acid residues are substituted for residues within the sequence resulting in conservative amino acid substitution.
- one or more amino acid residues within the sequence can be substituted by another amino acid of a similar polarity, which acts as a functional equivalent, resulting in a silent alteration.
- Substitutes for an amino acid within the sequence may be selected from other members of the class to which the amino acid belongs.
- the nonpolar (hydrophobic) amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan, and methionine.
- Amino acids containing aromatic ring structures are phenylalanine, tryptophan, and tyrosine.
- the polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine, and glutamine.
- the positively charged (basic) amino acids include arginine, lysine, and histidine.
- the negatively charged (acidic) amino acids include aspartic acid and glutamic acid.
- Non-conservative amino acid substitutions may also be introduced to substitute an amino acid with a particularly preferable property. For example, Cys may be introduced at a potential site for disulfide bridges with another Cys. Pro may be introduced because of its particularly planar structure .
- the peptides of the present invention can be chemically synthesized.
- Synthetic peptides can be prepared using the well known techniques of solid phase, liquid phase, or peptide condensation techniques, or any combination thereof, and can include natural and/or synthetic amino acids.
- Amino acids used for peptide synthesis may be standard Boc (N a -amino protected N ⁇ - t-butyloxycarbonyl) amino acid resin with the standard deprotecting, neutralization, coupling, and wash protocols of the original solid phase procedure of Merrifield (J. Am. Chem.
- the peptides and/or the novel bacterial strains can be administered in a therapeutically acceptable carrier topically, parenterally, transmucosally, such as for example, orally, nasally, or rectally, or transdermaHy.
- a therapeutically acceptable carrier topically, parenterally, transmucosally, such as for example, orally, nasally, or rectally, or transdermaHy.
- the peptides of the present invention can be modified if necessary to increase the ability of the peptide to cross cellular membranes such as by increasing the hydrophobic nature of the peptide, introducing the peptide as a conjugate to a carrier, such as a ligand to a specific receptor, etc.
- the present invention also provides for conjugating a targeting molecule to a peptide of the invention.
- Targeting molecules for purposes of the present invention mean a molecule which when administered in vivo, localizes to a desired location or locations.
- the targeting molecule can be a peptide or protein, antibody, lectin, carbohydrate, or steroid.
- the targeting molecule can be a peptide ligand of a receptor on the target cell or an antibody such as a monoclonal antibody.
- the antibody can be reduced to two heavy and light chain heterodimers, or the F(ab')a fragment can be reduced, and crosslinked to the peptide via the reduced sulfhydryl.
- compositions may be for oral, nasal, pulmonary administration, injection, etc.
- the therapeutic compositions include effective amounts of at least one bacteriocin of the present invention and their derivatives and/or at least one novel strain to at least reduce the levels of colonization by at least one target bacteria together with acceptable diluents, preservatives, solubilizers, emulsifiers, adjuvants, and/or carriers.
- Diluents can include buffers such as Tris-HCl, acetate, phosphate, for example; additives can include detergents and solubilizing agents such as Tween 80, Polysorbate 80, etc., for example; antioxidants include, for example, ascorbic acid, sodium metabisulfite, etc.; preservatives can include, for example, Thimersol, benzyl alcohol, etc.; and bulking substances such as lactose, mannitol, etc .
- buffers such as Tris-HCl, acetate, phosphate
- additives can include detergents and solubilizing agents such as Tween 80, Polysorbate 80, etc., for example
- antioxidants include, for example, ascorbic acid, sodium metabisulfite, etc.
- preservatives can include, for example, Thimersol, benzyl alcohol, etc.
- bulking substances such as lactose, mannitol, etc .
- the therapeutic composition of the present invention can be incorporated into particulate preparation of polymeric compounds such as polyvinylpyrrolidone, polylactic acid, polyglycolic acid, etc., or into liposomes.
- Liposomal encapsulation includes encapsulation by various polymers.
- a wide variety of polymeric carriers may be utilized to contain and/or deliver one or more of the therapeutic agents discussed above, including for example both biodegradable and nonbiodegradable compositions.
- biodegradable compositions include albumin, collagen, gelatin, hyaluronic acid, starch, cellulose (methylcellulose, hydroxypropylcellulose, hydroxypropylmethylcellulose, carboxymethylcellulose, cellulose acetate phthalate, cellulose acetate succinate, hydroxypropylmethylcellulose phthalate), casein, dextrans, polysaccharides, fibrinogen, poly(D,L lactide) , poly (D, L- lactide-co-glycolide) , poly (glycolide) , poly (hydroxybutyrate) , poly (alkylcarbonate) and poly (orthoesters) , polyesters, poly (hydroxyvaleric acid), polydioxanone, poly (ethylene terephthalate) , poly (malic acid), poly (tartronic acid), polyanhydrides , polyphosphazenes, poly (amino acids) and their copolymers (see generally, Ilium, L., Davids, S.
- nondegradable polymers include poly (ethylene-vinyl acetate) (“EVA”) copolymers, silicone rubber, acrylic polymers (polyacrylic acid, polymethylacrylic acid, polymethylmethacrylate, polyalkylcynoacrylate) , polyethylene, polypropylene, polyamides (nylon 6,6), polyurethane, poly(ester urethanes) , poly(ether urethanes) , poly (ester-urea) , polyethers (poly (ethylene oxide), poly (propylene oxide), Pluronics and poly (tetramethylene glycol) ) , silicone rubbers and vinyl polymers such as polyvinylpyrrolidone, poly (vinyl alcohol), poly (vinyl acetate phthalate) .
- EVA ethylene-vinyl acetate
- silicone rubber acrylic polymers
- acrylic polymers polyacrylic acid, polymethylacrylic acid, polymethylmethacrylate, polyalkylcynoacrylate
- polyethylene
- Polymers may also be developed which are either anionic (e.g., alginate, carrageenin, carboxymethyl cellulose and poly(acrylic acid), or cationic (e.g., chitosan, poly-L-lysine, polyethylenimine, and poly (allyl amine) ) (see generally, Dunn et al., J. Applied Polymer Sci. 50:353-365, 1993; Cascone et al., J. Materials Sci.: Materials in Medicine 5:770-774, 1994; Shiraishi et al., Biol. Pharm. Bull. 16 (11) : 1164-1168, 1993; Thacharodi and Rao, Int'l J. Pharm. 120:115-118, 1995; Miyazaki et al., Int ' 1 J. Pharm. 118:257-263, 1995).
- anionic e.g., alginate, carrageenin, carboxymethyl cellulose and poly(acrylic acid
- cationic
- Polymeric carriers can be fashioned in a variety of forms, with desired release characteristics and/or with specific desired properties.
- polymeric carriers may be fashioned to release a therapeutic agent upon exposure to a specific triggering event such as pH (see e.g., Heller et al . , "Chemically Self-Regulated Drug Delivery Systems," in Polymers in Medicine III, Elsevier Science Publishers B. V., Amsterdam, 1988, pp. 175- 188; Rang et al . , J. Applied Polymer Sci. 48:343-354, 1993; Dong et al., J. Controlled Release 19:171-178, 1992; Dong and Hoffman, J. Controlled Release 15:141-152, 1991; Kim et al .
- pH-sensitive polymers include poly (acrylic acid) and its derivatives (including for example, homopolymers such as poly (aminocarboxylic acid); poly (acrylic acid); poly (methyl acrylic acid), copolymers of such homopolymers, and copolymers of poly (acrylic acid) and acrylmonomers such as those discussed above.
- pH sensitive polymers include polysaccharides such as cellulose acetate phthalate; hydroxypropylmethylcellulose phthalate; hydroxypropylmethylcellulose acetate succinate; cellulose acetate trimellilate; and chitosan.
- pH sensitive polymers include any mixture of a pH sensitive polymer and a water soluble polymer.
- polymeric carriers can be fashioned which are temperature sensitive (see e.g., Chen et al., "Novel Hydrogels of a Temperature-Sensitive Pluronic Grafted to a Bioadhesive Polyacrylic Acid Backbone for Vaginal Drug Delivery, " in Proceed. Intern. Symp. Control. ReI. Bioact . Mater.
- thermogelling polymers and their gelatin temperature (LCST (.degree. C)
- LCST gelatin temperature
- homopolymers such as poly (N-methyl-N-n-propylacrylamide) , 19.8; poly(N-n- propylacrylamide) , 21.5; poly (N-methyl-N-isopropylacrylamide) , 22.3; poly (N-n-propylmethacrylamide) , 28.0; poly (N- isopropylacrylamide) , 30.9; poly (N, n-diethylacrylamide) , 32.0; poly (N-isopropylmethacrylamide) , 44.0; poly (N- cyclopropylacrylamide) , 45.5; poly (N-ethylmethyacrylamide) , 50.0; poly (N-methyl-N-ethylacrylamide) , 56.0; poly (N- cyclopropylmethacrylamide) , 59.0; poly (N-ethy
- thermogelling polymers may be made by preparing copolymers between (among) monomers of the above, or by combining such homopolymers with other water soluble polymers such as acrylmonomers (e.g., acrylic acid and derivatives thereof such as methylacrylic acid, acrylate and derivatives thereof such as butyl methacrylate, acrylamide, and N-n-butyl acrylamide) .
- acrylmonomers e.g., acrylic acid and derivatives thereof such as methylacrylic acid, acrylate and derivatives thereof such as butyl methacrylate, acrylamide, and N-n-butyl acrylamide
- Other representative examples of thermogelling polymers include cellulose ether derivatives such as hydroxypropyl cellulose, 41. degree. C; methyl cellulose, 55. degree. C; hydroxypropylmethyl cellulose, 66. degree. C; and ethylhydroxyethyl cellulose, and Pluronics such as F-127, 10- 15. degree. C
- a wide variety of forms may be fashioned by the polymeric carriers of the present invention, including for example, rod- shaped devices, pellets, slabs, or capsules (see e.g., Goodell et al., Am. J. Hosp. Pharm. 43:1454-1461, 1986; Langer et al . , "Controlled release of macromolecules from polymers", in Biomedical Polymers, Polymeric Materials and Pharmaceuticals for Biomedical Use, Goldberg, E. P., Nakagim, A. (eds.) Academic Press, pp. 113-137, 1980; Rhine et • al . , J. Pharm. Sci. 69:265- 270, 1980; Brown et al . , J. Pharm. Sci. 72:1181-1185, 1983; and Bawa et al . , J. Controlled Release 1:259-267, 1985).
- Therapeutic agents may be linked by occlusion in the matrices of the polymer, bound by covalent linkages, or encapsulated in microcapsules.
- therapeutic compositions are provided in non-capsular formulations such as microspheres (ranging from nanometers to micrometers in size) , pastes, threads of various size, films and sprays.
- Another aspect of the present invention is to provide a therapeutic composition and animal feed.
- the therapeutic composition of the present invention can be encapsulated using a polymeric carrier as described above and then added to a feed by any known means of applying it to feed such as for example, by mechanical mixing, spraying, etc.
- the therapeutic composition includes, for example, an amount of at least one bacteriocin and/or antagonistic bacteria effective to at least reduce the levels of colonization by at least one target bacteria in an animal, such as for example approximately 0.5 grams each of a lactocin and/or enterocin/1000 grams, approximately 1.25 grams of a polymeric carrier such as polyvinylpyrrolidone/1000 grams, and about 8.6% of a diluent such as water/1000 grams mixed with any granular component that is digestable, such as for example, milled maize grain; ground grains such as for example oats, wheat, buckwheat; ground fruits such as for example, pears, etc.
- an amount of at least one bacteriocin and/or antagonistic bacteria effective to at least reduce the levels of colonization by at least one target bacteria in an animal, such as for example approximately 0.5 grams each of a lactocin and/or enterocin/1000 grams, approximately 1.25 grams of a polymeric carrier such as polyvinylpyrrol
- the therapeutic composition is then added to any type of animal feed in amounts effective to at least reduce the levels of colonization of at least one target bacteria such as for example in ratios of bacteriocin to feed of about 1:10 to about 1:100.
- animal feed include green fodder, silages, dried green fodder, roots, tubers, fleshy fruits, grains, seeds, brewer's grains, pomace, brewer's yeast, distillation residues, milling byproducts, byproducts of the production of sugar, starch or oil production, and various food wastes .
- the product can be added to the animal feedstuffs for cattle, poultry, rabbit, pig, or sheep rearing, etc.. It can be used mixed with other feed additives for these stock.
- NRRL B-30514 Lactobacillus salivarius designated NRRL B-30514 (Strain PVD32) and Lactobacillus acidophilus, designated NRRL B-30510 (Strain LWP320) , producing bacteriocins were isolated from the ceca and crop of broilers.
- the ceca and crop were preliminarily emptied and washed twice with approximately 100 ml of sterile 0.85% w/v saline solution (normal saline) .
- the ceca and crop material was suspended in sterile saline solution, pH about 7.0. About 0.1 ml of a 10-fold diluted suspension was plated directly onto selective MRS agar.
- Plates were anaerobically incubated at about 37°C for about 16-18 hours. At least 10 colonies specific for Lactobacillus spp. were selected from each sample. Lactobacilli were identified using the APO 50 CHL microtest system (bioMerieux, France) .
- Strains Lactobacillus salivarius PVD 32 and Lactobacillus acidophilus LWP320 were grown at approximately 37° C for about 24 hours on MRS Agar. The two strains are facultative anaerobes, Gram-positive nonmotile rods capable of growth at about 30°, 37°, and 42° C.
- Strain PVD 32 grows on MRS agar producing circular to regular-shaped, smooth, convex colonies with sharp margins that are about 1-3 mm in diameter after microaerophilic incubation for about 18-24 hours at about 37° C.
- Strain LWP320 grows on MRS agar producing albescent, semiopaque colonies that are about 0.5 to about 0.8 mm in diameter after microaerophilic incubation for about 24 hours at 37° C.
- Enterococcus faecalis LWP21 and Enterococcus durans LWP26 were grown at about 37°C for about 24 hours on MRS agar. They are Gram-positive, facultative anaerobes, nonmotile cocci capable of growth at about 30°, 37°, and 42°C.
- Strain LWP21 grows on MRS agar producing albescent semiopaque colonies that are opaque after microaerophilic incubation for about 24 hours. After about 48 hours microaerophilic incubation at about 37°C, the colonies are about 0.8 to about 1.0 mm in diameter.
- results in the API 50CHL and EN-COCCUS galleries using API 50 CHL suspension medium are presented below in Table 1.
- Results shown below in Table 2 indicate that strain PVD32 is Lactobacillus salivarius, strain LWP320 is Lactobacillus acidophilus, strain LWP21 as Enterococcus faecalis, and strain LWP26 as Enterococcus durans.
- Target bacteria for assessing antagonistic activity of antagonistic isolates included strains of L4 and Bl of C. jejuni isolated from broilers in Russia and Campylobacter jejuni ATCC 11168, several species from the family Enterobacteriaceae, Pseudomonas aeruginosa strain ATCC 9027, Staphylococcus aureus, and Listeria monocytongenes, were used as test cultures to evaluate isolates for antagonistic activity. Cultures of C.
- jejuni were grown either on brucella agar or Campylobacter agar supplemented with about 0.02% sodium bisulfite, about 0.05% ferrous sulfate, and about 5% partially lysed sheep blood at about 37°C for approximately 18-24 hours under microaerobic conditions of about 5% O 2 , about 10% CO 2 , and about 85% N 2 .
- the other strains were cultured on nutrient agar at about 37° C or about 28° C for Y. enterocolitica and Y. pseudotuberculosis for about 18-24 hours under aerobic conditions. Antagonistic activity of the isolates against Campylobacter was evaluated.
- Approximately 0.2 ml of the suspensions in normal saline was plated onto MRS agar and incubated at about 37°C for about 24 hours.
- Agar cubes of about 0.5 cm 3 were cut out and transferred onto brucella agar or Campylobacter agar supplemented with about 5%-10% partially lysed sheep blood, about 10 micrograms/ml rifampicin, and about 2.5 u/ml of polymyxin and inoculated with approximately 10 7 cells of Campylobacter jejuni per plate. Plates were incubated at about 42° C for approximately 24 hours under microaerobic conditions as described above. Antagonistic activity was evaluated by measuring the size of the diameter of the zones of C. jejuni inhibition.
- Enterococcus faecalis 21 (NRRL B-30645)
- Enterococcus durans 26 (NRRL B-30511)
- bacteriocins were isolated from cecal and crop smears of healthy broilers.
- Ceca and crops were emptied and washed twice with sterile 0.085% w/v saline solution (Normal saline) at about pH 7.0.
- the ceca and crop material were suspended in sterile normal saline at about pH 7.0.
- About 0.1 ml of a 10 CT - l fold diluted suspension was plated directly onto MRS selective medium and plates were incubated at about 37°C. for about 24-48 hours. Enterococci were identified using the microtest kit EN- COCCUS .
- Campylobacter jejuni ATCC 11168 was used as a test culture to evaluated isolates for antagonistic activity as described above in Example 1. Thirty-three other strains were used as test cultures to evalutate isolate antagonistic activity as described above in Example 1. Antagonistic activity of the isolates against Campylobacter was also evaluated as described above in Example 1.
- Antagonistic activity to Campylobacter jejuni was evaluated using 1,200 isolates derived from about 125 broilers. Out of these, 63 isolates exhibited antagonism to C. jejuni ATCC 11168. The ability to produce bacteriocins during cultivation in MRS broth was studied for the 12 most active isolates (See Tables 1-3 above) .
- the culture fluids were centrifuged at about 12,000 X g, for
- CAP sterile crude antimicrobial preparation
- phosphate- sodium buffer pH about 7.0
- Approximately 10 microliters of each sample were plated onto blood-supplemented Campylobacter agar or Nutrient agar previously seeded with cells of target bacteria. Plates containing cultures of C. jejuni were grown at about 42°C under microaerobic conditions, Y. enterocolitica. and Y.
- pseudotuberculosis were cultured aerobically at about 28°C, and other bacterial strains were incubated aerobically at about 37° C for about 24 or 48 hours. Identification was based on inhibition areas produced by the target bacteria. Activity of CAP was expressed in arbitrary units (AU) per one milliliter of the preparation at which a visible zone of inhibition of the growth of culture appears (Henderson et al . , Archives of Biochemistry and Biophysics, Volume 295, 5-12, 1992; herein incorporated by reference) . All experiments were conducted in duplicate.
- Tables 4 and 5 below show the antagonistic activity of the crude antimicrobial preparations prepared for Lactobacillus in Example 3 , and Enterococcus in Example 4.
- Lactobacillus species Two isolates of Lactobacillus species inhibited the growth of Campylobacter jejuni (Table 3) .
- the isolates were identified using the API 50CHL test (bioMerieux, France) and are Lactobacillus salivarius -PVD32 (NRRL B-30514) and Lactobacillus acidophilus LWP320 (NRRL B-30510) .
- all these strains produce lactocin with a wide spectrum of antibacterial activity. They inhibit growth of both Gram-positive and Gram-negative microorganisms. Lactocin OR-7 is most active against C. jejuni.
- Enterocin 21 produced by E. faecalis is unique in that it inhibits the growth of all 33 test strains including Proteus vulgaris and Morganella morganii which are especially resistant to bacteriocins of different origins.
- CAPs and bacteriocins were electrophoresed by SDS-PAGE using about 15% agarose gel weight and about 1% SDS (9 X 12 cm) in Tri- glycine buffer. After electrophoresis at about 10OmA for approximately 4 hours, gels were fixed with a solution containing approximately 15% ethanol and approximately 1% acetic acid. The gels were then washed with distilled water for approximately 4 hours. To determine molecular weights of protein fractions, the gel was stained with a solution containing approximately 0.15% Coomassi Brilliant Blue R-250 (Sigma,USA) about 40% ethanol, and about 7% acetic acid.
- Gels were washed sequentially with phosphate buffered saline (PBS) for about 1.5 hours and deionized water for about 3 hours. Washed gels were tested against three target bacteria, C. jejuni ATCC 11168, E. coli 0157 :H7 904, and S. enteritidis 237 by the method of Bhunia et al . (Journal of Industrial Microbiology, Volume 2, 319-322, 1987; herein incorporated by reference) . The gels were placed in Petri dishes, covered with about 5% lysed sheep blood-semi-solid Campylobacter agar (about 0.75%) or semi-solid agar (0.7%), and seeded with cells of the test strains.
- PBS phosphate buffered saline
- IEF gels pH approximately 3.1-10.0
- the gels were run at about 10OV for about 1 hour, 200V for about 2 hour, and 500V for about 30 minutes in XCM II Mini-Cell (Novex) .
- Gels were washed with distilled water for about 30 seconds without fixation followed by staining with Coomassie Brilliant Blue R-250 (Sigma, USA) to determine isoelectric points (pi) of the bacteriocins and their ability to inhibit the growth of the test strains as presented below in Tables 6 for lactocins and Table 7 for enterocins .
- the CAP 0R7 of L. salivarius PVD 32 contains three protein fractions of about 6 kDa, about 16 kDa, and about 40 kDa.
- stained electrophoretic strips comprising the peptides were placed onto semisolid Campylobacter agar inoculated with cells of C. jejuni ATCC 11168, S. enteritidis, and E. coli 0157 :H7.
- the pure lactocin LWP320 of L. acidophilus LWP320 and the pure enterocin LWP26 of E. durans LWP26 contains protein fractions of about 6 kDa and about 3 kDa, respectively.
- stained electrophoretic strips comprising the peptides were placed onto semisolid Campylobacter agar inoculated with cells of C. jejuni ATCC 11168, S. enteritidis, and E. coli 0157 :H7.
- the isolated enterocin LWP21 of E. faecalis LWP21 comprises two protein fractions of about 3.0 kDa (peak 1) and about 6.0 kDa (peak 2).
- the electrophoretic bands were placed onto semi-solid Campylobacter agar inoculated with C. jejuni ATTC 11168, S. enter! tidis, and E. coli 0157 :H7.
- the about 6.0 kDa fraction was active against all three strains. No antibacterial activity was observed for the about 3.0 kDa fraction.
- enterocin LWP26 isoelectrofocusing identified a single protein fraction of pi of about 7.8 which was antagonistic to all three tested strains (Table 7) .
- the highest activity was associated with enterocin LWP21 peak 1 + peak 2 fractions in the spot-test while the lowest activity was shown with the SDS-PAGE and IEF
- jejuni were further purified by cation exchange chromatography using a CM-Sepharose column (Pharmacia, 2.5 X 20 cm) .
- the CM-Sepharose column was equilibrated with buffer C (50 mM citrate-phosphate buffer pH about 5.0) at a flow rate of about 8 ml/min.
- Bacteriocins were eluted with about 8 mM of buffer C in the presence of NaCl at concentrations of from about 0.1% to about 0.8% at a flow rate of about 8 ml/min.
- Antimicrobial activity and protein concentrations for each fraction were determined.
- the purified fractions were designated lactocins OR7 and LWP320.
- the purified 0R7 and LWP320 were evaluated using SDS-PAGE and isoelectrofocusing as described above in example 4.
- the most active fraction (0R7) was a peptide with a molecular weight of about 6 kDa and a pi of about 9.0 ( Figure 1 and Table 6) and active fraction LWP320 was a peptide with a molecular weight of about 6 kDa, pi of about 8.5 ( Figure 3 and Table 6) .
- Enterococcus bacteriocins from CAPs were purified using a two- step procedure: ion exchange chromatography and hydrophobic chromatography.
- Active CAP fractions obtained in Example 4 were injected into a SP-Sepharose Fast Flow Column (V-30 ml) equilibrated with buffer C (20 mM phosphate-sodium, pH about 7.8) at a flow rate of about 18 ml/minute. The column was washed with four volumes of buffer C and fractions were eluted with about 100 ml of 0.5 M NaCl in buffer C. Fraction activity was determined using the spot test as described above in Example 5 using C. jejuni ATCC 11168. The fractions capable of inhibiting the growth of C.
- jejuni were injected in a Phenyl-Sepharose CL-4B column equilibrated with buffer D (0.06 M borate buffer, pH about 8.5) containing 0.2 M NaCl .
- buffer D (0.06 M borate buffer, pH about 8.5) containing 0.2 M NaCl .
- the column was washed with four volumes of buffer D.
- Fractions were eluted with about 4 ml of buffer D containing about 70% ethanol (vol/vol) .
- Antagonism of each fraction was measured using the spot test. Pure preparations were obtained by methods of cation-exchange rechromatography on SP- Sepharose, as well as on Phenyl-Sepharose CL-4B.
- the concentration of protein was determined using the method of Lowry (supra) .
- the isolated fractions were designated as enterocins LWP21 and LWP26.
- the isolated LWP21 and LWP26 fractions were evaluated using SDS-PAGE and isoelectrofocusing as described above in Example 4.
- the most active fraction 2 for LWP21 was a peptide with a molecular weight of about 6 kDa and a pi of about 8.4 ( Figure 2 and Table 7) and nonactive fraction 1 for LWP21 was a peptide with a molecular weight of about 3 kDa, PI of about 5.6 ( Figure2 and Table 7) .
- the most active fraction for LWP26 was a peptide with a molecular weight of about 3 kDa and a pi of about 7.8 ( Figure 3 and Table 7) .
- the amino acid sequences of purified bacteriocins were determined by Edman degradation using a 491 cLC automatic sequencer (Applied Biosystems, USA) .
- the bacteriocins were hydrolyzed in about 6M HCl under 'a vacuum at approximately 110° C for about 72 hours.
- Molecular weights were determined by mass spectrometry using a Voyager-DERP (Perkin-Elmer, USA) .
- the MALDI-TOF system a matrix-assisted laser desorption ionization time of flight system, was used along with matrix, 2-cyano-hydroxycinnamic acid.
- the amino acid sequences for the four bacteriocins are :
- LWP320 ARKYGNGVCGSKWINNGGFQVIGNNAAANLTNWGEAFASATKSGCSATTCIINAMA
- LWP21 (FRACTION 1) : FNIRGGYNFGKSVRHWDAIGNMAGIIKL SEQ ID NO 3 LWP21 (FRACTION 2) :
- bacteriocin activity was determined. About 10 ⁇ l of one of the following enzymes were transferred into tubes containing about 20 ml of bacteriocins : beta-chymotrypsin-about 100 mg/ml, proteinase K- about 200mg/ml, papain-about 60 mg/ml, lysozyme-about 75 mg/ml, and lipase-about 100 mg/ml (all from Sigma-Aldrich Corp., St. Louis MO) . After about a three hour incubation period at about 37°C, the mixture of bacteriocin and enzyme was analyzed for antimicrobial activity using the spot test as in Example 5. Untreated bacteriocins served as positive controls.
- thermostability of bacteriocins about a 2 mg/ml sample was boiled in a water bath for about 15 minutes, cooled, and assessed in terms of their antimicrobial activity using the spot test . Approximately 2 mg/ml of bacteriocin was used to evaluate the effect of pH. About 2 milliliters of sterile solutions, about 1OmM NaOH or about 10 mM HCl was added to samples to test pH from about 3 to about 10. Samples were incubated at about 37° C for about 2 hours and 24 hours, and at about 90° C for about 20 minutes. Samples were adjusted to pH about 7.2 by addition of about 4 mM sterile phosphate buffer and analyzed for their antimicrobial activity using the spot test as described above in Example 5.
- the bacteriocins lost their antimicrobial activity after being treated with beta-chymotrypsin, proteinase K, and papain, but retained it when treated with lysozyme, lipase, or heating to about 90 0 C (Tables 10 and 11) . They were stable at different values of pH ranging from about 3.0 to about 9.0, but became inactive at about pH 10 (Tables 12 and 13) . Enterocins lost their activity at pH about 9.1 and about 10.
- Bacteriocin 0R7 was purified as described in Example 5. Purified bacteriocin 0R7 was added at a concentration of approximately 250 mg per kilogram of commercial poultry feed in polyvinylpyrrolidone as is known in the art. About 100 grams of a therapeutic composition made up with milled maize grain contains approximately 0.5 grams bacteriocin OR7, approximately 1.25 grams of polyvinylpyrrolidone, and approximately 8.6% water. About 100 grams of this composition is added to about 2 kilograms of poultry feed. 1 day-, six day- and 18 day-old chicks were placed in groups in separate isolation units equipped with feeders, water, and filtered air supply. The food and water were supplied ad libitum.
- mice For 1 day-old chicks (Table 14) : Group one chicks served as the control group which received free access to diet without added bacteriocin. These chicks were challenged at day one of life with strains L4 and Bl of C. jejuni, as described above in Example 1. The strains were administered by oral gavages at a concentration of approximately 2 X 10 5 in a volume of 0.2 ml. Five of the chicks were sacrificed at about 7 days after challenge and the remaining five were sacrificed at about 10 days after challenge. Group two chicks were challenged at day 1 of life with C. jejuni strains L4 and Bl as described above for Group one . The chicks were given free access to diet containing approximately 250 mg of bacteriocin
- mice For 6 day-old chicks, the control groups received free access to diet without added bacteriocin. These chicks were challenged on day 2 of the experiment with approximately 10 s CFU in about a 0.2 ml volume) of strains L-4, and B-I of C. jejuni, as described in Example 1. The C. jejuni was administered by oral gavages. Chicks were sacrificed 9 days, 11 days, and 14 days post challenge. Experimental chicks, having two groups, were given free access to diet with bacteriocin 0R7 encapsulated in polyvinylpyrrolidone beginning from day 6 of life. These chicks were challenged on day 2 of the experiment as above for the control chicks. Chicks were sacrificed ( at day 9, 11, and 14 of life. Results are shown in Table 15 below.
- Chicks were challenged with approximately 10 6 CFU of a mixture of strains L4 and Bl C. jejuni by oral gavageS the 1 st day of life. Control chicks were sacrificed at day 17 of life.
- 1-day old chicks were challenged as control chicks, given free access to feed with approximately 0.250 grams of bacteriocin OR7 per kilogram of feed starting at . day 14 of life and sacrificed at about day 17 of life; and group II chicks were challenged as control chicks at day 1 of life and were given free access to feed containing approximately 0.500 grams of bacteriocin OR7 per kilogram of feed at day 14 of life; and sacrificed at day 17 of life. Results are shown below in Table 17.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Polymers & Plastics (AREA)
- Health & Medical Sciences (AREA)
- Zoology (AREA)
- Microbiology (AREA)
- Organic Chemistry (AREA)
- Biochemistry (AREA)
- Biotechnology (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Food Science & Technology (AREA)
- Animal Husbandry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Biomedical Technology (AREA)
- Birds (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Physiology (AREA)
- General Engineering & Computer Science (AREA)
- Virology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Description
Claims
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP11001376A EP2371373A1 (en) | 2005-03-18 | 2005-03-18 | Bacteriocins and novel bacterial strains |
| EP11001377A EP2359836A1 (en) | 2005-03-18 | 2005-03-18 | Bacteriocins and novel bacterial strains |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/US2005/008991 WO2006101486A2 (en) | 2005-03-18 | 2005-03-18 | Bacteriocins and novel bacterial strains |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| EP1858534A2 true EP1858534A2 (en) | 2007-11-28 |
| EP1858534A4 EP1858534A4 (en) | 2009-07-22 |
Family
ID=37024247
Family Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP11001376A Withdrawn EP2371373A1 (en) | 2005-03-18 | 2005-03-18 | Bacteriocins and novel bacterial strains |
| EP05730719A Withdrawn EP1858534A4 (en) | 2005-03-18 | 2005-03-18 | BACTERIOCINS AND NEW BACTERIAL STRAINS |
| EP11001377A Withdrawn EP2359836A1 (en) | 2005-03-18 | 2005-03-18 | Bacteriocins and novel bacterial strains |
Family Applications Before (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP11001376A Withdrawn EP2371373A1 (en) | 2005-03-18 | 2005-03-18 | Bacteriocins and novel bacterial strains |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP11001377A Withdrawn EP2359836A1 (en) | 2005-03-18 | 2005-03-18 | Bacteriocins and novel bacterial strains |
Country Status (10)
| Country | Link |
|---|---|
| EP (3) | EP2371373A1 (en) |
| CN (1) | CN101282743B (en) |
| AP (1) | AP2007004168A0 (en) |
| AU (1) | AU2005329462B2 (en) |
| BR (1) | BRPI0520154A2 (en) |
| CA (1) | CA2601591A1 (en) |
| EA (1) | EA013330B1 (en) |
| MX (1) | MX2007011503A (en) |
| NZ (1) | NZ561654A (en) |
| WO (1) | WO2006101486A2 (en) |
Families Citing this family (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ES2621469T3 (en) * | 2010-12-20 | 2017-07-04 | Nestec S.A. | Flavor modulation by biological treatment using bacterial strains that generate flavor |
| CN102174437B (en) * | 2011-01-25 | 2012-10-24 | 北京农学院 | Lactobacillus delbrueckiisubsp.lactis and preparation method of bacteriocin thereof capable of resisting Listeria monocytogenes |
| FR2999601B1 (en) * | 2012-12-17 | 2015-01-30 | Urgo Lab | METHOD FOR PREVENTING AND / OR TREATING INFECTIONS, COLONIZATIONS OR DISEASES ASSOCIATED WITH STAPHYLOCOCCUS AUREUS, PSEUDOMONAS AERUGINOSA, STREPTOCOCCUS PYOGENES, ENTEROCOCCUS FAECIUM, ENTEROBACTER CLOACAE, PROTEUS MIRABILIS AND / OR BACTEROIDES FRAGILIS |
| CN104593294B (en) * | 2014-12-29 | 2017-12-15 | 东北农业大学 | A kind of high bacteriocinogeny enterococcus faecalis and its application |
| CN104774890B (en) * | 2015-04-13 | 2018-12-14 | 光明乳业股份有限公司 | One Bacillus species bacteriocin crude extract and its preparation method and application |
| RU2692011C1 (en) * | 2018-11-08 | 2019-06-19 | Федеральное государственное бюджетное образовательное учреждение высшего образования "Горский государственный аграрный университет" | Enterococcus durans lactobacillus strain - producer of lactic acid and antibiotic substances |
| CN110484467B (en) * | 2019-08-19 | 2020-11-20 | 山东宝来利来生物工程股份有限公司 | Bacillus polymyxa, antibacterial peptide produced by same and application of antibacterial peptide |
| CN113308408A (en) * | 2021-07-06 | 2021-08-27 | 广东省科学院生物工程研究所 | Leuconostoc mesenteroides for producing bacteriocin and application thereof |
Family Cites Families (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4335107A (en) | 1978-06-05 | 1982-06-15 | Snoeyenbos Glenn H | Mixture to protect poultry from salmonella |
| FI840816A0 (en) | 1984-03-01 | 1984-03-01 | Farmos Oy | BAKTERIEPREPARAT |
| US5478557A (en) | 1992-07-29 | 1995-12-26 | The United States Of America, As Represented By The Secretary Of Agriculture | Probiotic for control of salmonella |
| WO1994021127A1 (en) | 1993-03-16 | 1994-09-29 | The United States Of America, As Represented By The Secretary, U.S. Department Of Agriculture | Mucosal competitive exclusion flora |
| MXPA99007378A (en) * | 1997-02-11 | 2005-04-19 | Entpr Ireland | Probiotic strains from lactobacillus salivarius. |
| US6241335B1 (en) | 1997-12-24 | 2001-06-05 | Canon Kabushiki Kaisha | Method of producing ink jet recording head and ink jet recording head produced by the method |
| CN1245164A (en) * | 1999-08-10 | 2000-02-23 | 南京农业大学 | Echcin and its fermenting extraction process |
| EP1148064A1 (en) * | 2000-04-17 | 2001-10-24 | Vrije Universiteit Brussel | Lactobacillus johnsonii bacteriocin, active against Helicobacter pylori |
| FR2809404B1 (en) * | 2000-05-29 | 2002-08-30 | Rhodia Chimie Sa | BACTERIOCIN ANTI-LISTERIA |
| DE10110431A1 (en) * | 2001-03-05 | 2002-09-19 | Nutrinova Gmbh | Bacteriocin-containing sorbic acid preparation as a feed additive in livestock rearing |
| US6989370B2 (en) * | 2003-05-01 | 2006-01-24 | The United States Of America As Represented By The Secretary Of Agriculture | Bacteriocins and novel bacterial strains |
| US7132102B2 (en) * | 2003-08-21 | 2006-11-07 | The United States Of America As Represented By The Secretary Of Agriculture | Bacteriocins and novel bacterial strains |
| CN100406550C (en) * | 2003-09-02 | 2008-07-30 | 金衣生命科学股份有限公司 | Novel lactic acid bacteria, its bacteriocin, and food processing method using the bacteria |
| US7988958B2 (en) * | 2005-04-05 | 2011-08-02 | The United States Of America As Represented By The Secretary Of Agriculture | Enterococcus and Streptococcus strains and bacteriocins |
| US7354904B2 (en) * | 2005-12-08 | 2008-04-08 | The United States Of America As Represented By The Secretary Of Agriculture | Bacteriocin inducer peptides |
-
2005
- 2005-03-18 BR BRPI0520154-3A patent/BRPI0520154A2/en not_active Application Discontinuation
- 2005-03-18 EP EP11001376A patent/EP2371373A1/en not_active Withdrawn
- 2005-03-18 CA CA002601591A patent/CA2601591A1/en not_active Abandoned
- 2005-03-18 EP EP05730719A patent/EP1858534A4/en not_active Withdrawn
- 2005-03-18 EA EA200701730A patent/EA013330B1/en not_active IP Right Cessation
- 2005-03-18 EP EP11001377A patent/EP2359836A1/en not_active Withdrawn
- 2005-03-18 NZ NZ561654A patent/NZ561654A/en not_active IP Right Cessation
- 2005-03-18 CN CN2005800491680A patent/CN101282743B/en not_active Expired - Fee Related
- 2005-03-18 AU AU2005329462A patent/AU2005329462B2/en not_active Ceased
- 2005-03-18 MX MX2007011503A patent/MX2007011503A/en active IP Right Grant
- 2005-03-18 WO PCT/US2005/008991 patent/WO2006101486A2/en not_active Ceased
- 2005-03-18 AP AP2007004168A patent/AP2007004168A0/en unknown
Also Published As
| Publication number | Publication date |
|---|---|
| AP2007004168A0 (en) | 2007-10-31 |
| CN101282743A (en) | 2008-10-08 |
| WO2006101486A2 (en) | 2006-09-28 |
| AU2005329462A1 (en) | 2006-09-28 |
| EA200701730A1 (en) | 2008-04-28 |
| BRPI0520154A2 (en) | 2009-04-22 |
| EP2371373A1 (en) | 2011-10-05 |
| AU2005329462B2 (en) | 2011-12-01 |
| MX2007011503A (en) | 2008-03-25 |
| EP2359836A1 (en) | 2011-08-24 |
| EP1858534A4 (en) | 2009-07-22 |
| NZ561654A (en) | 2010-07-30 |
| EA013330B1 (en) | 2010-04-30 |
| CN101282743B (en) | 2012-06-20 |
| WO2006101486A3 (en) | 2007-11-22 |
| CA2601591A1 (en) | 2006-09-28 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8029809B2 (en) | Bacteriocins and novel bacterial strains | |
| US7740889B2 (en) | Bacteriocins and novel bacterial strains | |
| US7988958B2 (en) | Enterococcus and Streptococcus strains and bacteriocins | |
| AU2005329462B2 (en) | Bacteriocins and novel bacterial strains | |
| AU2006342396B2 (en) | Novel Enterococcus and Streptococcus strains and bacteriocins | |
| AU2011218596B2 (en) | Bacteriocins and novel bacterial strains | |
| EP2351494A1 (en) | Bacteriocins and novel bacterial strains | |
| NZ585698A (en) | Bacteriocins and Lactobacillis and Enterococcus strains | |
| AU2011218597A1 (en) | Bacteriocins and novel bacterial strains | |
| Kudryavtseva et al. | kk k kkkS kk kkkkS ke Kanatani, K. et al (Isolation and characterization of Acidocin A and | |
| WO2012037015A2 (en) | Novel lactobacillus salivarius and novel bacteriocin | |
| CN102504017A (en) | Novel Enterococcus and Streptococcus strains and bacteriocins | |
| CN102887945A (en) | Bacteriocins and new bacterial strains |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20070920 |
|
| AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LI LT LU MC NL PL PT RO SE SI SK TR |
|
| AX | Request for extension of the european patent |
Extension state: AL BA HR LV MK YU |
|
| R17D | Deferred search report published (corrected) |
Effective date: 20071122 |
|
| RAP1 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: STATE RESEARCH CENTER FOR APPLIED MICROBIOLOGY AND Owner name: THE UNITED STATES OF AMERICA, AS REPRESENTED BY TH |
|
| DAX | Request for extension of the european patent (deleted) | ||
| A4 | Supplementary search report drawn up and despatched |
Effective date: 20090623 |
|
| 17Q | First examination report despatched |
Effective date: 20091016 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20110415 |