EP1851328A1 - Fatty acid amide hydrolase assay - Google Patents

Fatty acid amide hydrolase assay

Info

Publication number
EP1851328A1
EP1851328A1 EP06710346A EP06710346A EP1851328A1 EP 1851328 A1 EP1851328 A1 EP 1851328A1 EP 06710346 A EP06710346 A EP 06710346A EP 06710346 A EP06710346 A EP 06710346A EP 1851328 A1 EP1851328 A1 EP 1851328A1
Authority
EP
European Patent Office
Prior art keywords
ammonia
enzyme
glutamate dehydrogenase
generating
faah
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP06710346A
Other languages
German (de)
French (fr)
Inventor
Kyunghye Ahn Pfizer Global Research and WISNER
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Warner Lambert Co LLC
Original Assignee
Warner Lambert Co LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Warner Lambert Co LLC filed Critical Warner Lambert Co LLC
Publication of EP1851328A1 publication Critical patent/EP1851328A1/en
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/26Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving oxidoreductase
    • C12Q1/32Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving oxidoreductase involving dehydrogenase
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/34Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/90Enzymes; Proenzymes
    • G01N2333/914Hydrolases (3)
    • G01N2333/978Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00Screening for compounds of potential therapeutic value

Definitions

  • the invention relates to methods for determining the activity of an ammonia- generating enzyme and to their applications in identifying compounds that modulate the enzyme activities.
  • Fatty acid amide hydrolase which may also be referred to as oleamide hydrolase and anandamide amidohydrolase, is an integral membrane enzyme.
  • FAAH degrades fatty acid primary amides and ethanolamides, which are known to serve as endogenous signaling lipids. These include the endogenous cannabinoid anandamide and the seep-inducing oleamide.
  • FAAH fatty acid amides
  • FAAH appears to work most effectively on arachidonyl and oleyl substrates (B. F. Cravatt, et al., (1996) Nature 384, 83-87; and D. K. Giang, et al., (1997) Proc. Natl. Acad. ScL USA 94, 2238-2242).
  • Inhibitors of FAAH have been demonstrated to reduce pain, inflammation, and anxiety in animal models.
  • the invention provides a method for measuring the activity of an ammonia-generating enzyme.
  • the method involves two coupled reactions. One of the reactions is catalyzed by the ammonia-generating enzyme that generates ammonia as a product.
  • the other reaction is a reductive animation reaction catalyzed by glutamate dehydrogenase that utilizes ammonia as a substrate.
  • a reaction mixture that comprises (1) the ammonia-generating enzyme, (2) an ammonia-generating substrate for the ammonia-generating enzyme, (3) glutamate dehydrogenase, (4) a reductive amination substrate other than ammonia for the glutamate dehydrogenase, and (5) a reduced form of co-enzyme of glutamate dehydrogenase.
  • the reaction mixture is incubated under conditions that allow for reactions catalyzed by the ammonia-generating enzyme and glutamate dehydrogenase.
  • the activity of the ammonia-generating enzyme is measured by measuring the rate of the reductive amination catalyzed by the glutamate dehydrogenase.
  • the rate of the reductive amination catalyzed by the glutamate dehydrogenase is measured by measuring the consumption of the reduced form of the co-enzyme.
  • the invention provides a method for identifying a compound capable of modulating the activity of an ammonia-generating enzyme.
  • the method employs the method for measuring the activity of an ammonia-generating enzyme provided by the present invention.
  • a test compound is added to the reaction mixture and the activity of the ammonia-generating enzyme is measured.
  • a method for identifying a compound capable of modulating the activity of fatty acid amide hydrolase is provided.
  • Figure 1 is a graphical representation of the effects of altering FAAH concentration in the presence of a constant concentration of oleamide.
  • Figure 2 is a graphical representation demonstrating that the rate of the GDH coupled FAAH reaction follows Michaelis-Menten kinetics.
  • Figure 3 is a graphical representation of a GDH-coupled FAAH assay showing that Compound A inhibits FAAH activity in a dose-responsive manner.
  • ammonia-generating enzyme refers to any enzyme that catalyzes a reaction that yields ammonia as a product.
  • the enzyme may be from any source, in any form, and in any purity, may be naturally occurring or recombinant, and may be a full-length enzyme or an enzymatically active truncated form thereof.
  • ammonia-generating substrate refers to a substrate upon which an ammonia-generating enzyme can act to produce ammonia as a product.
  • glutamate dehydrogenase refers to an enzyme that catalyzes the reductive amination of ⁇ -ketoglutarate to form glutamate.
  • the enzyme may be from any source, in any form, and in any purity, may be naturally occurring or recombinant, and may be a full-length enzyme or an enzymatically active truncated form thereof.
  • reductive amination substrate of glutamate dehydrogenase refers to a substrate, other than ammonia, upon which glutamate dehydrogenase can act in effecting a reductive amination.
  • modulate means to change the activity of an ammonia-generating enzyme in catalyzing the generation of ammonia. Such changes include inhibition of the enzyme or activation of the enzyme, and can be total or partial.
  • test compound refers to any compound or a combination thereof that is being analyzed.
  • the present invention provides a method for measuring the activity of an ammonia- generating enzyme by quantitatively detecting the ammonia generated by the ammonia-generating enzyme using a coupled reductive amination reaction catalyzed by glutamate dehydrogenase.
  • the term "coupled” means that the reductive amination reaction catalyzed by glutamate dehydrogenase is carried out simultaneously and in the same reaction with the reaction catalyzed by the ammonia- generating enzyme.
  • the method comprises: (a) providing a reaction mixture comprising a predetermined amount of (1) the ammonia-generating enzyme, (2) an ammonia-generating substrate for the ammonia-generating enzyme, (3) glutamate dehydrogenase, (4) a reductive amination substrate other than ammonia for glutamate dehydrogenase, and (5) a reduced form of co-enzyme for glutamate dehydrogenase; (b) incubating the reaction mixture under conditions that allow for reactions catalyzed by the ammonia-generating enzyme and glutamate dehydrogenase; and (c) measuring the rate of the reductive amination catalyzed by glutamate dehydrogenase, wherein the rate of the reductive amination catalyzed by glutamate dehydrogenase is indicative of the activity of the ammonia-generating enzyme.
  • enzyme activity assay method This method provided by the present invention may be referred to hereinafter as "enzyme activity assay method.”
  • An example of the reaction scheme utilized in the enzyme activity assay method of present invention is depicted below, wherein the ammonia-generating enzyme is fatty acid amide hydrolase (FAAH) and oleamide is used as the substrate for fatty acid amide hydrolase:
  • FAH fatty acid amide hydrolase
  • GDH glutamate NAD + This method may be used to measure the activity of any ammonia-generating enzyme by using an appropriate substrate that yields ammonia as a product.
  • ammonia-generating enzyme is FAAH.
  • ammonia-generating enzyme is peptidylarginine deaminase, which catalyzes the conversion of the carboxy-terminal Arg residues of various peptides to citrulline residues with the generation of ammonia.
  • the optimal amount of the ammonia-generating enzyme that may be used in the reaction mixture may vary depending on a number of factors, such as the source or specific activity of the enzyme, and incubation conditions, and can be readily determined by a person skilled in the art. This method is particularly useful for measuring the activity of FAAH.
  • the FAAH may be from any source, may be naturally occurring or recombinant, and may be a full-length enzyme or truncated form thereof.
  • the optimal amount of the FAAH used in the reaction mixture may vary depending on a number of factors, such as the source or specific activity of the enzyme, and the substrate used, and can be readily determined by a person skilled in the art. Generally, the concentrations of the FAAH in the reaction mixture are greater than about 2 nM, and preferably greater than 10 nM.
  • Suitable ammonia-generating substrates for FAAH are fatty acid primary amides.
  • primary amides as suitable ammonia-generating substrates of FAAH have the general structure: NH 2 - C(O)-R, where R is an alkyl chain that is optionally unsaturated, and may additionally be linear or branched as well as substituted or unsubstituted, and could contain saturated or unsaturated rings, wherein these rings could be fused or unfused, and contain heteroatoms.
  • the unsaturated bonds of the fatty acid alkyl chain may have a cis configuration, such as in cis-9,10-octadecenomaide, cis-8,9- octadecenoamide, cis-ll,12-octadecendoamide or cis-13, 14-docosenoamide.
  • fatty acid primary amides examples include oleamide, amides of myrtistic acid (tetradecanoic acid), palmitic acid (hexadecanoic acid), stearic acid (octadecanoic acid), caproic acid (hexanoic acid), caprylic acid (octanoic acid), capric acid (decanoic acid), lauric acid (dodecanoic acid), linoleic acid (octadecadienoic acid), linolenic acid (octadecatrienoic acid), arachidic acid (eicosanoic acid), arachidonic acid (eicosatetraenoic acid), behenic acid (docosamoic acid), and lignoceric acid (tetracosanoic acid).
  • myrtistic acid tetradecanoic acid
  • palmitic acid hexadecanoic acid
  • stearic acid octadecanoic
  • Still other fatty acid primary amides such as the primary amides of undecanoic acid, oleic acid, dicaprate, tricaprate, monoolein, dilaurin, glyceryl 1- monocaprate, and l-dodecylazacycloheptan-2-onerespectively.
  • Fatty acid primary amides are widely available commercially and may be obtained from any source.
  • the optimal amount of the fatty acid primary amides in the reaction mixture may vary depending on a number of factors, such as the specific fatty acid primary amide used or its purity, and can be readily determined by a person skilled in the art.
  • the amount of the fatty acid primary amides in the reaction mixture is generally greater than about 10 ⁇ M and typically from about 20 to about 500 ⁇ M. In one embodiment, the amount of the fatty acid primary amides in the reaction mixture is about 50 ⁇ M.
  • GDH glutamate dehydrogenase
  • Glutamate dehydrogenase may also be known by other names, such as glutamic dehydrogenase, glutamic acid dehydrogenase, L-glutamate dehydrogenase, L-glutamic acid dehydrogenase, NAD(P)-glutamate dehydrogenase, NAD(P)H-dependent glutamate dehydrogenase, and the like.
  • the reductive animation by GDH requires ammonia, ⁇ -ketoglutarate and a reduced form of nicotinamide- adenine dinucleotide (NADH or NADPH) as co-enzyme.
  • NADH or NADPH nicotinamide- adenine dinucleotide
  • the amount of the ammonia consumed is in direct proportion to the amount of NADH consumed, or in direct proportion to the amount of glutamate produced or NADP produced.
  • GDH that may be used in the enzyme activity assay method may be from any source, may be naturally occurring or recombinant, and may be a full-length enzyme or truncated forms thereof that are enzymatically active. This enzyme is commercially available. (Cat. 49392; Sigma- Aldrich Chemicals, St. Louis, MO).
  • the amount of GDH in the reaction mixture should be sufficiently high in order for allowing for rapid and complete reaction of the ammonia that is generated by the ammonia-generating enzyme into glutamate.
  • the amount of GDH in the reaction mixture is generally not lower than about 1 unit/ml, and is typically about 7 unit/ml or higher.
  • Any suitable reductive amination substrate of GDH may be used in the enzyme activity assay method of the present invention.
  • suitable reductive amination substrate of GDH include ⁇ -ketoglutarate (also known as “alpha- ketoglutarate,” “2-oxoglutarate,” “ ⁇ -oxoglutarate,” or “2-oxopentanedioate) and 2- keto-6-hydroxyhexanoic acid.
  • the amount of the reductive amination substrate of GDH in the reaction mixture should be sufficiently high in order for allowing for rapid and complete reaction of the ammonia that is generated by the ammonia- generating enzyme into glutamate.
  • the optimal amount may vary depending on a number of factors, such as the activity of the ammonia-generating enzyme, the amount of NADH (NADPH), and the amount or activity of GDH used, and can be readily determined by a person skilled in the art.
  • ⁇ -ketoglutarate is used as the substrate, its amount in the reaction mixture is generally not lower than 0.1 mM, and is typically from about 0.3 to about 10 mM. In one embodiment, the concentration of ⁇ -ketoglutarate in the reaction mixture is about 3 mM.
  • the reduced form of nicotinamide adenine dinucleotide used in the enzyme activity assay method of the present invention may be either NADH or NADPH.
  • the amount of NADH or NADPH in the reaction mixture should be sufficiently high in order for allowing for rapid and complete reaction of the ammonia that is generated by the ammonia-generating enzyme into glutamate. The optimal amount may vary depending on a number of factors, such as the activity of the ammonia-generating enzyme, the amount of ⁇ -ketoglutarate, and the amount or activity of GDH used, and can be readily determined by a person skilled in the art.
  • the amount of NADH or NADPH in the reaction mixture is generally from about 5 ⁇ M to about 1000 ⁇ M, preferably from about 50 ⁇ M to about 300 ⁇ M, and more preferably from about 100 ⁇ M to about 200 ⁇ M.
  • adenosine 5 '-diphosphate (ADP) or guanosin 5 '-diphosphate (GDP) may be included in the reaction mixture to enhance the activity of GDH.
  • the ADP or GDP in the reaction mixture may be in any amount, but is generally greater than 20 ⁇ M.
  • ADP is present in the reaction mixture at about 2 mM.
  • a detergent or other solubilizing agent may also be included in the reaction mixture to increase the solubility of an enzyme, substrate, or any other components in the reaction mixture. Examples of suitable detergent or solubilizing agent include Triton ® X-100 (Sigma-Aldrich Chemicals, St. Louis, MO) and dimethyl sulfoxide (DMSO).
  • the reaction mixture is incubated under conditions that allow for the reactions catalyzed by the ammonia-generating enzyme and GDH to take place.
  • the reaction mixture is incubated at relatively constant temperatures, usually between 15 °C and 50 °C, and more typically at a temperature of between about 20 0 C and about 37 0 C.
  • the reaction mixture is generally maintained at a relatively constant pH that is optimal for the reactions, usually between about 4.0 and about 12. In one embodiment, the reaction mixture is maintained at a pH of from about 7.4 to about 10.5.
  • the pH of the reaction mixture can be adjusted and maintained using a suitable buffer. Examples of suitable buffer include phosphate buffer, a TRIS buffer (Sigma- Aldrich Chemicals, St.
  • the reaction mixture may be incubated for any duration, from a few minutes or shorter to a few hours or longer.
  • An optimal duration may be determined based on a number of factors, such as the activity of the ammonia-generating enzyme or GDH, the temperature of incubation, the initial amount of the substrates in the reaction mixture, and so on, and can be readily determined by a person skilled in the art. .
  • the rate of the reductive animation catalyzed by GDH may be determined by any suitable method known in the art.
  • the rate of the reductive animation may be determined by measuring one or more of the following parameters: (1) the consumption of the reductive animation substrate, (2) the consumption of the reduced form of nicotinamide adenine dinucleotide (NADH or NADPH), (3) the generation of oxidized nicotinamide adenine dinucleotide (NAD + or NADP + ), and (4) the generation of a reductive amination product.
  • One particular method for determining the rate of the reductive amination catalyzed by GDH is to spectrophotometrically measure the consumption of the reduced nicotinamide adenine dinucleotide (NADH or NADPH) in the reaction mixture.
  • NADH and NADPH each absorbs light strongly at wavelengths between about 290 nm and about 380 nm, while NAD + , NADP + , and other substrates or products of the reactions do not.
  • the NADH or NADPH in the reaction mixture is consumed (i.e., oxidized to NAD + , NADP + )
  • the light absorbance of the reaction mixture at the above wavelengths decreases.
  • the rate of the consumption of NADH or NADPH is in directly proportional to the absorbance decrease.
  • the rate of absorbance decrease at the above wavelengths is indicative of the activity of ammonia-generating enzyme, wherein a faster rate of absorbance decrease indicates a higher activity of the ammonia-generating enzyme, and vise versa.
  • the light absorbance of the reaction mixture is measured at wavelengths between about 330 and about 370, and preferably at wavelengths of about 340 nm.
  • the light absorbance can be measured readily by those skilled in the art using conventional spectrophotometric procedures.
  • the measurements of the parameters of the reductive amination may be taken once at the end of the incubation period, at a plurality of time points during the incubation period, or continuously during the incubation period.
  • the ammonia-generating enzyme activity can be quantitated according to methods known in art.
  • the present invention provides a method for identifying a compound capable of modulating the activity of an ammonia-generating enzyme, wherein the activity of the ammonia-generating enzyme is determined using the enzyme activity assay method described above.
  • This method may be referred to hereinafter as "compound screening method" of the invention.
  • a reaction mixture is incubated in the absence and presence of a test compound and the activity of the ammonia-generating enzyme is determined by enzyme activity assay method of the invention described above.
  • the method comprises: (a) providing a reaction mixture comprising a predetermined amount of (1) an ammonia-generating enzyme, (2) an ammonia-generating substrate for the ammonia-generating enzyme, (3) glutamate dehydrogenase, (4) a reductive animation substrate other than ammonia for glutamate dehydrogenase, and (5) a reduced form of co-enzyme for glutamate dehydrogenase; (b) incubating the reaction mixture in the absence and presence of a test compound and under conditions that allow for reactions catalyzed by the ammonia-generating enzyme and glutamate dehydrogenase; and (c) measuring the rate of the reductive animation catalyzed by glutamate dehydrogenase; wherein a difference in the rate of the reductive animation between the presence and absence of the test compound indicates that the test compound is capable of modulating the activity of the ammonia-generating enzyme.
  • test compound is identified as an inhibitor of the ammonia-generating enzyme if the rate of the reductive amination in the presence of the test compound is lower than that in the absence of the test compound. Conversely, a test compound is identified as an activator of ammonia-generating enzyme if the rate of the reductive amination in the presence of the test compound is higher than that in the absence of the test compound.
  • a method for identifying a compound capable of modulating the activity of FAAH comprises: (a) providing a reaction mixture comprising a predetermined amount of (1) FAAH, (2) a fatty acid primary amide as an ammonia-generating substrate for FAAH, (3) glutamate dehydrogenase, (4) ⁇ -ketoglutarate as a reductive amination substrate for glutamate dehydrogenase, (5) NADH or NADPH as co-enzyme for glutamate dehydrogenase; (b) incubating the reaction mixture in the absence and presence of a test compound under conditions that allow for reactions catalyzed by FAAH and glutamate dehydrogenase; and (c) measuring the rate of the reductive amination by measuring the consumption of the NADH or NADPH in the reaction mixture, wherein a consumption of the NADH or NADPH in the presence of the test compound that differs from that in the absence of the test compound indicates that test compound is capable of modulating
  • a test compound will be identified as an inhibitor of FAAH if the consumption of the NADH or NADPH in the presence of the test compound is lower than that in the absence of the test compound. Conversely, a test compound will be identified as an activator of FAAH if the consumption of the NADH or NADPH in the presence of the test compound is higher than that in the absence of the test.
  • the FAAH may be from any source, may be naturally occurring or recombinant, and may be a full-length enzyme or enzymatically active, truncated form thereof.
  • the optimal amount of the FAAH used in the reaction mixture may vary depending on a number of factors, such as the source or specific activity of the enzyme, and the substrate used, and can be readily determined by a person skilled in the art.
  • the concentrations of the FAAH in the reaction mixture are greater than about 2 nM, and preferably greater than 10 nM.
  • oleamide is used as the fatty acid primary amide
  • NADH is used as the co-enzyme of GDH
  • the consumption of NADH is determined by measuring the light absorbance of the reaction mixture at wavelengths of 340 ran.
  • the compound screening method of the present invention is useful for rapid screening of compounds capable of modulating the activity of an ammonia- generating enzyme, such as FAAH, using automated procedures.
  • Such automated methods can be readily performed by using commercially available automated instrumentation and software and known automated observation and detection procedures.
  • Multi-well formats are particularly attractive for high throughput and automated compound screening.
  • Screening methods can be performed, for example, using a standard microplate well format.
  • a microplate reader includes any device that is able to read a signal from a microplate (e.g., 96 and 384-well plates). Such a signal may be detected spectrophotometrically, such as, for instance, reading the optical density of the NADH or NADPH absorbance at a wavelength of 340 nm.
  • detecting means such as fluorometry (standard or time- resolved), luminometry, or photometry in either endpoint or kinetic assays.
  • fluorometry standard or time- resolved
  • luminometry luminometry
  • photometry in either endpoint or kinetic assays.
  • sample handling and detection procedures can be automated using commercially available instrumentation and software systems for rapid, reproducible application of reagents, and automated screening of target compounds.
  • robotic systems such as the BioRobot 9600 from Quagen (Quagen, Inc. Valencia, CA), the Zymate from Zymark (Hopkinton, Mass) or the Biomek from Beckman Instruments (Fullerton, CA), most of which use the multi-well plate format, could be utilized.
  • EXAMPLE 1 Preparation of a Truncated Human FAAH A truncated human FAAH (hFAAH) was prepared by the method described in this Example, and was used in the studies described in Examples 2-4 below.
  • the amino acid sequence of this truncated human FAAH is shown in SEQ ID NO: 1, which comprises amino acids 32-579 of the full length human FAAH.
  • the E. coli codon optimized DNA sequence encoding amino acids 32-579 of the full human FAAH is shown in SEQ ID No: 2.
  • pTrcHis A-hFAAH encoding human (h) FAAH amino acids 30-579
  • the following cDNAs were custom-synthesized and subcloned into a pUCl 19 vector (Blue Heron Biotechnology (Bothell, WA)).
  • the E. coli codon optimization was carried out by using an optimization algorithm (Blue Heron Biotechnology (Bothell, WA)).
  • the pUCl 19-hFAAH (encoding hFAAH, amino acids 1-579) was digested with Xho I - EcoR I and the insert was subcloned into a Xho I - EcoR I-digested pTrcHis A vector (Invitrogen, Cat # V360-20) to generate pTrcHis A-hFAAH
  • the pTrcHis A-hFAAH vector was digested with Xho I-Hind III, and the resulting Xho I-Hind III (approximately 4.5 kb) and Hind Ill-Hind III (approximately 1.5 kb) pieces were ligated with the Xho I-Hind III fragment (225 bp) generated from digesting the pUCl 19-hFAAH (encoding amino acids 30-104) construct to generate an NH 2 -terminally His-tagged pTrcHis A-hFAAH (encoding amino acids 30-579 of the full length hFAAH).
  • pET28a-hFAAH (encoding hFAAH, amino acids 32-579)
  • the human FAAH construct for subcloning into the prokaryotic expression vector pET28a(+) was generated by PCR from the pTrcHis A-hFAAH (amino acids 30-579) construct using the following primers: sense primer, 5 ' -GGAATTCCATATGTCAGGTCGTCGTACCGC ACGTG-3 ' (SEQ ID NO: 5) ; and antisense primer, 5'-CCGCTCGAGTTATGAGGATTGTTT TTCCGG AGTC AT-3' (SEQ ID NO: 6).
  • the resulting PCR product was digested with Nde I-Xho I, and subcloned into a Nde I-Xho I -digested pET28a(+) vector to generate an NH 2 -terminally His-tagged pET28a-hFAAH (encoding amino acids 32- 579).
  • pET28a-hFAAH encodes hFAAH, amino acids (32-579): MGSSHHHHHHSSGLVPRGSHM — hFAAH " — " Does not represent amino acid positions. Each indicated hFAAH position is contiguous with the specifically indicated leading amino acid sequence comprising HHHHHH.
  • Truncated hFAAH "RT” describes room temperature, which is typically 25°C ⁇ 3°.
  • the pET28a- hFAAH construct encoding amino acids corresponding to amino acids 32-579 of wild-type human FAAH was transformed into the E. coli BL21-AI strain.
  • 1.2-liter cultures of the freshly transformed expressing sixains were grown in SuperBroth media in the presence of 30 ⁇ g/ml kanamycin at 37 0 C.
  • OD 60O of approximately 0.12 the cultures were transferred to RT and induced at OD 600 of 0.6 - 0.65 with 100 ⁇ M IPTG and 0.2% L-arabinose for 20 hours at RT. All operations below were at 4 0 C unless otherwise noted.
  • the cells were then harvested by centrifugation at 5000 x g.
  • the cell pellets were washed twice by re-suspending in 700 ml of PBS and collected by centrifugation at 5000 x g. At this point, the cell paste is optionally frozen and stored at - 80 °C until needed.
  • the cells were re-suspended in 60 ml of buffer A (20 mM Tris-HCl, pH 8.0/100 mM NaCyi% Triton X-100) with stirring. After adding DNase and RNase (1 mg per 25 g E.
  • the cell suspension was incubated for 1 hour at RT with mixing intermittently, cooled on ice for 10 min, and was sonicated with approximately 40-60 ten-second pulses.
  • the resulting lysate was centrifuged at 10,000 x g for 35 minutes and the supernatant was loaded at 0.5 - 1 ml/min onto a 5 ml Ni-column (HiTrap chelating HP column from Amersham Biosciences (Cat # 17-0409-01) was charged with Ni according to the manufacturer's instructions) which has been equilibrated with buffer B (20 mM Tris-HCl, pH 8.0/300 mM NaCl/1% Triton X-100). The resulting flow-through was reloaded onto the column.
  • the column was washed with 100 ml of buffer B and further washed in sequence with 50 ml of buffer B containing 10, 20, and 50 mM imidazole, respectively.
  • the elution was performed in sequence with 25 ml of buffer B containing 100, 200, 400, and 700 mM imidazole, respectively.
  • the majority of FAAH was eluted with buffer B containing 100-200 mM imidazole. The eluted
  • FAAH was dialyzed against buffer B overnight, frozen in liquid N 2 , and stored at -80 0 C.
  • the reactions were incubated at 37 0 C and the absorbance at 340 nm was collected over a period of 30 min with readings taken in 10-second intervals using a SpectraMax Microplate Spectrophotometer® (Molecular Devices, Palo Alto, CA) equipped with Softmax Pro® software (Molecular Devices, Palo Alto, CA). As shown in Figure 1, the rate of the reaction increases with increasing concentration of FAAH.
  • Oleamide concentrations are plotted on the x axes and the initial rates are plotted on the y axes.
  • the data were fit to the Michaelis-Menten equation. As shown in Fig. 2, this GDH-coupled FAAH assay allows measuring kinetic constants of FAAH. This data also demonstrates that FAAH follows a typical Michaelis-Menten kinetics.
  • the Km value which is oleamide substrate concentration at which the reaction rate is half of its maximal value, was determined to be 19.8 ⁇ M.
  • EXAMPLE 4 Measurement of FAAH Inhibition by Compound A.
  • the inhibitory effects of 1- oxazolo[4,5-b]pyridin-2-yl-5-phenyl-pentan-l-one ((PNAS, (2000) vol. 97, No. 10:p5042), hereinafter, Compound A) on FAAH activity were examined using the GDH-coupled FAAH assay. The reactions were carried out in 96-well clear polystyrene plates.
  • the reaction mixture (200 ⁇ l) contained 50 mM NaPi, pH 7.4, 50 ⁇ M oleamide, 150 ⁇ M NADH, 3 mM ⁇ -ketoglutarate, 2 mM ADP, 1 mM ethylenediaminetetraacetic acid (EDTA), 12 unit/ml GDH, 0.1% Triton X-100 ® , the concentrations of Compound A indicated on Figure 3, and approximately 10 nM FAAH.
  • Oleamide (500 ⁇ M) dissolved in 25% DMSO and 25% EtOH was used as a stock solution.
  • Compound A stock solutions, dissolved in 50% DMSO, were used.
  • the final concentrations of DMSO and EtOH were each 7.5%.
  • the reactions were incubated at 37 0 C and the data were collected as described in Example 1.
  • the results shown in Figure 3 demonstrate that Compound A inhibits FAAH in a dose-responsive manner.
  • SEQ ID NO: 1 Amino acids 32-579 of full length homo sapien FAAH.
  • SEQ ID NO: 2 Nucleotide sequence encoding amino acids 32 to 579 of full length homo sapien FAAH, optimized for expression in E.coli.
  • SEQ ID NO: 3 The DNA sequence of the E. coli codon optimized sequence of hFAAH (amino acids 1-579) with a 5'-Xho I site, 3' stop codon, and 3'-EcoR I site.
  • SEQ ID NO: 4 The DNA sequence from bp 94 to bp 319 of SEQ ID NO: 3 with a 5'-Xho I site.
  • GIy Ser lie Arg Phe Pro Ser Ser Phe Cys GIy lie Cys GIy Leu Lys 210 215 220
  • Cys Leu Gly Asp Leu VaI Ser lie Leu Lys Leu Pro GIn Trp Leu Lys 370 375 380 GIy Leu Leu Ala Phe Leu VaI Lys Pro Leu Leu Pro Arg Leu Ser Ala 385 390 395 400
  • GIy Asp lie Trp Asp Lys Met Leu GIn Lys GIy Met Lys Lys Ser VaI 500 505 510

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Immunology (AREA)
  • Physics & Mathematics (AREA)
  • Molecular Biology (AREA)
  • Biotechnology (AREA)
  • Biophysics (AREA)
  • Analytical Chemistry (AREA)
  • Biochemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

The invention provides methods for determining the activity of an ammonia­generating enzyme and methods for identifying a compound capable of modulating the activity of such an enzyme.

Description

FATTY ACID AMIDE HYDROLASE ASSAY
FIELD OF THE INVENTION
The invention relates to methods for determining the activity of an ammonia- generating enzyme and to their applications in identifying compounds that modulate the enzyme activities.
BACKGROUND OF THE INVENTION
Fatty acid amide hydrolase (FAAH), which may also be referred to as oleamide hydrolase and anandamide amidohydrolase, is an integral membrane enzyme. FAAH degrades fatty acid primary amides and ethanolamides, which are known to serve as endogenous signaling lipids. These include the endogenous cannabinoid anandamide and the seep-inducing oleamide. (M. P. Patricelli, et al., (1998) Biochemistry 37, 15177-15187; M. Maccarrone, et al., (1998). J. Biol. Chem. 273, 32332-32339). Although FAAH hydrolyzes a range of fatty acid amides (FAAs), FAAH appears to work most effectively on arachidonyl and oleyl substrates (B. F. Cravatt, et al., (1996) Nature 384, 83-87; and D. K. Giang, et al., (1997) Proc. Natl. Acad. ScL USA 94, 2238-2242). Inhibitors of FAAH have been demonstrated to reduce pain, inflammation, and anxiety in animal models.
A number of assays for measuring FAAH activity have been reported. The majority of these assays utilize radiolabeled-substrates and thin-layer chromatography, activated charcoal or mass spectrometry to quantitate FAAH activity. In addition, a spectrophotometric assay using p-nitroanilide as a substrate and a fluorescence displacement assay have been reported. However, all of these assays have limitations such as low throughput, low sensitivity, or a requirement for radioactive material. An assay capable of efficiently, rapidly and accurately measuring FAAH activity and identifying compounds that inhibit or stimulate FAAH and that is also capable of high throughput would be beneficial.
All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes. SUMMARY OF THE INVENTION
In one aspect, the invention provides a method for measuring the activity of an ammonia-generating enzyme. The method involves two coupled reactions. One of the reactions is catalyzed by the ammonia-generating enzyme that generates ammonia as a product. The other reaction is a reductive animation reaction catalyzed by glutamate dehydrogenase that utilizes ammonia as a substrate. To carry out the method, a reaction mixture is provided that comprises (1) the ammonia-generating enzyme, (2) an ammonia-generating substrate for the ammonia-generating enzyme, (3) glutamate dehydrogenase, (4) a reductive amination substrate other than ammonia for the glutamate dehydrogenase, and (5) a reduced form of co-enzyme of glutamate dehydrogenase. The reaction mixture is incubated under conditions that allow for reactions catalyzed by the ammonia-generating enzyme and glutamate dehydrogenase. The activity of the ammonia-generating enzyme is measured by measuring the rate of the reductive amination catalyzed by the glutamate dehydrogenase. In one particular embodiment, the rate of the reductive amination catalyzed by the glutamate dehydrogenase is measured by measuring the consumption of the reduced form of the co-enzyme.
In another aspect, the invention provides a method for identifying a compound capable of modulating the activity of an ammonia-generating enzyme. The method employs the method for measuring the activity of an ammonia-generating enzyme provided by the present invention. To carry out the method, a test compound is added to the reaction mixture and the activity of the ammonia-generating enzyme is measured. In one embodiment, a method for identifying a compound capable of modulating the activity of fatty acid amide hydrolase is provided.
BRIEF DESCRIPTION OF THE FIGURES
Figure 1 is a graphical representation of the effects of altering FAAH concentration in the presence of a constant concentration of oleamide. Figure 2 is a graphical representation demonstrating that the rate of the GDH coupled FAAH reaction follows Michaelis-Menten kinetics.
Figure 3 is a graphical representation of a GDH-coupled FAAH assay showing that Compound A inhibits FAAH activity in a dose-responsive manner.
DETAILED DESCRIPTION OF THE INVENTION
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as is commonly understood by one of ordinary skill in the art to which this invention belongs. As used herein, the following terms have the meanings ascribed to them. The term "ammonia-generating enzyme" refers to any enzyme that catalyzes a reaction that yields ammonia as a product. The enzyme may be from any source, in any form, and in any purity, may be naturally occurring or recombinant, and may be a full-length enzyme or an enzymatically active truncated form thereof.
The term "ammonia-generating substrate" refers to a substrate upon which an ammonia-generating enzyme can act to produce ammonia as a product.
The term "glutamate dehydrogenase" refers to an enzyme that catalyzes the reductive amination of α-ketoglutarate to form glutamate. The enzyme may be from any source, in any form, and in any purity, may be naturally occurring or recombinant, and may be a full-length enzyme or an enzymatically active truncated form thereof.
The term "reductive amination substrate" of glutamate dehydrogenase refers to a substrate, other than ammonia, upon which glutamate dehydrogenase can act in effecting a reductive amination.
The term "modulate," "modulating," or "modulation" means to change the activity of an ammonia-generating enzyme in catalyzing the generation of ammonia. Such changes include inhibition of the enzyme or activation of the enzyme, and can be total or partial.
The term "compound" as used herein refers to any composition of matter, which can be any synthetic or natural compound or composition, and can be organic and inorganic, including small molecules, peptides, proteins, sugars (mono- and polysaccharides), nucleic acids, fatty acids, and the like. The term "test compound" refers to any compound or a combination thereof that is being analyzed.
In one aspect, the present invention provides a method for measuring the activity of an ammonia- generating enzyme by quantitatively detecting the ammonia generated by the ammonia-generating enzyme using a coupled reductive amination reaction catalyzed by glutamate dehydrogenase. The term "coupled" means that the reductive amination reaction catalyzed by glutamate dehydrogenase is carried out simultaneously and in the same reaction with the reaction catalyzed by the ammonia- generating enzyme. The method comprises: (a) providing a reaction mixture comprising a predetermined amount of (1) the ammonia-generating enzyme, (2) an ammonia-generating substrate for the ammonia-generating enzyme, (3) glutamate dehydrogenase, (4) a reductive amination substrate other than ammonia for glutamate dehydrogenase, and (5) a reduced form of co-enzyme for glutamate dehydrogenase; (b) incubating the reaction mixture under conditions that allow for reactions catalyzed by the ammonia-generating enzyme and glutamate dehydrogenase; and (c) measuring the rate of the reductive amination catalyzed by glutamate dehydrogenase, wherein the rate of the reductive amination catalyzed by glutamate dehydrogenase is indicative of the activity of the ammonia-generating enzyme. This method provided by the present invention may be referred to hereinafter as "enzyme activity assay method." An example of the reaction scheme utilized in the enzyme activity assay method of present invention is depicted below, wherein the ammonia-generating enzyme is fatty acid amide hydrolase (FAAH) and oleamide is used as the substrate for fatty acid amide hydrolase:
FAAH
H2N + NH3 oleamide oleic acid α-ketoglutarate NADH
GDH glutamate NAD+ This method may be used to measure the activity of any ammonia-generating enzyme by using an appropriate substrate that yields ammonia as a product. One example of ammonia-generating enzyme is FAAH. Another example of ammonia- generating enzyme is peptidylarginine deaminase, which catalyzes the conversion of the carboxy-terminal Arg residues of various peptides to citrulline residues with the generation of ammonia. The optimal amount of the ammonia-generating enzyme that may be used in the reaction mixture may vary depending on a number of factors, such as the source or specific activity of the enzyme, and incubation conditions, and can be readily determined by a person skilled in the art. This method is particularly useful for measuring the activity of FAAH. The FAAH may be from any source, may be naturally occurring or recombinant, and may be a full-length enzyme or truncated form thereof. The optimal amount of the FAAH used in the reaction mixture may vary depending on a number of factors, such as the source or specific activity of the enzyme, and the substrate used, and can be readily determined by a person skilled in the art. Generally, the concentrations of the FAAH in the reaction mixture are greater than about 2 nM, and preferably greater than 10 nM.
The appropriate ammonia-generating substrate for a particular ammonia- generating enzyme, as well as its optimal amount to be used in the reaction mixture, can be readily selected by a person skilled in the art. Suitable ammonia-generating substrates for FAAH are fatty acid primary amides. In general, primary amides as suitable ammonia-generating substrates of FAAH have the general structure: NH2- C(O)-R, where R is an alkyl chain that is optionally unsaturated, and may additionally be linear or branched as well as substituted or unsubstituted, and could contain saturated or unsaturated rings, wherein these rings could be fused or unfused, and contain heteroatoms. Where present, the unsaturated bonds of the fatty acid alkyl chain may have a cis configuration, such as in cis-9,10-octadecenomaide, cis-8,9- octadecenoamide, cis-ll,12-octadecendoamide or cis-13, 14-docosenoamide. Examples of fatty acid primary amides that may be used in the FAAH activity assay method of the invention include oleamide, amides of myrtistic acid (tetradecanoic acid), palmitic acid (hexadecanoic acid), stearic acid (octadecanoic acid), caproic acid (hexanoic acid), caprylic acid (octanoic acid), capric acid (decanoic acid), lauric acid (dodecanoic acid), linoleic acid (octadecadienoic acid), linolenic acid (octadecatrienoic acid), arachidic acid (eicosanoic acid), arachidonic acid (eicosatetraenoic acid), behenic acid (docosamoic acid), and lignoceric acid (tetracosanoic acid). Still other fatty acid primary amides, such as the primary amides of undecanoic acid, oleic acid, dicaprate, tricaprate, monoolein, dilaurin, glyceryl 1- monocaprate, and l-dodecylazacycloheptan-2-onerespectively. Fatty acid primary amides are widely available commercially and may be obtained from any source. The optimal amount of the fatty acid primary amides in the reaction mixture may vary depending on a number of factors, such as the specific fatty acid primary amide used or its purity, and can be readily determined by a person skilled in the art. The amount of the fatty acid primary amides in the reaction mixture is generally greater than about 10 μM and typically from about 20 to about 500 μM. In one embodiment, the amount of the fatty acid primary amides in the reaction mixture is about 50 μM. The methods of the invention utilize glutamate dehydrogenase (GDH) in the
GDH-coupled assay. Glutamate dehydrogenase may also be known by other names, such as glutamic dehydrogenase, glutamic acid dehydrogenase, L-glutamate dehydrogenase, L-glutamic acid dehydrogenase, NAD(P)-glutamate dehydrogenase, NAD(P)H-dependent glutamate dehydrogenase, and the like. The reductive animation by GDH requires ammonia, α-ketoglutarate and a reduced form of nicotinamide- adenine dinucleotide (NADH or NADPH) as co-enzyme. The reductive amination reaction catalyzed by glutamate dehydrogenase is illustrated below:
NH3 + α-ketoglutarate + NADH + H+ « » glutamate + NAD+ + H2O
In this reductive amination reaction, the amount of the ammonia consumed is in direct proportion to the amount of NADH consumed, or in direct proportion to the amount of glutamate produced or NADP produced. GDH that may be used in the enzyme activity assay method may be from any source, may be naturally occurring or recombinant, and may be a full-length enzyme or truncated forms thereof that are enzymatically active. This enzyme is commercially available. (Cat. 49392; Sigma- Aldrich Chemicals, St. Louis, MO). The amount of GDH in the reaction mixture should be sufficiently high in order for allowing for rapid and complete reaction of the ammonia that is generated by the ammonia-generating enzyme into glutamate. The amount of GDH in the reaction mixture is generally not lower than about 1 unit/ml, and is typically about 7 unit/ml or higher.
Any suitable reductive amination substrate of GDH may be used in the enzyme activity assay method of the present invention. Examples of suitable reductive amination substrate of GDH include α-ketoglutarate (also known as "alpha- ketoglutarate," "2-oxoglutarate," "α-oxoglutarate," or "2-oxopentanedioate) and 2- keto-6-hydroxyhexanoic acid. The amount of the reductive amination substrate of GDH in the reaction mixture should be sufficiently high in order for allowing for rapid and complete reaction of the ammonia that is generated by the ammonia- generating enzyme into glutamate. The optimal amount may vary depending on a number of factors, such as the activity of the ammonia-generating enzyme, the amount of NADH (NADPH), and the amount or activity of GDH used, and can be readily determined by a person skilled in the art. Where α-ketoglutarate is used as the substrate, its amount in the reaction mixture is generally not lower than 0.1 mM, and is typically from about 0.3 to about 10 mM. In one embodiment, the concentration of α-ketoglutarate in the reaction mixture is about 3 mM.
The reduced form of nicotinamide adenine dinucleotide used in the enzyme activity assay method of the present invention may be either NADH or NADPH. The amount of NADH or NADPH in the reaction mixture should be sufficiently high in order for allowing for rapid and complete reaction of the ammonia that is generated by the ammonia-generating enzyme into glutamate. The optimal amount may vary depending on a number of factors, such as the activity of the ammonia-generating enzyme, the amount of α-ketoglutarate, and the amount or activity of GDH used, and can be readily determined by a person skilled in the art. The amount of NADH or NADPH in the reaction mixture is generally from about 5 μM to about 1000 μM, preferably from about 50 μM to about 300 μM, and more preferably from about 100 μM to about 200 μM.
Other components may be optionally included in the reaction mixture in order to enhance the method of the invention. For examples, adenosine 5 '-diphosphate (ADP) or guanosin 5 '-diphosphate (GDP) may be included in the reaction mixture to enhance the activity of GDH. The ADP or GDP in the reaction mixture may be in any amount, but is generally greater than 20 μM. In one embodiment, ADP is present in the reaction mixture at about 2 mM. In addition, a detergent or other solubilizing agent may also be included in the reaction mixture to increase the solubility of an enzyme, substrate, or any other components in the reaction mixture. Examples of suitable detergent or solubilizing agent include Triton® X-100 (Sigma-Aldrich Chemicals, St. Louis, MO) and dimethyl sulfoxide (DMSO).
The reaction mixture is incubated under conditions that allow for the reactions catalyzed by the ammonia-generating enzyme and GDH to take place. Typically, the reaction mixture is incubated at relatively constant temperatures, usually between 15 °C and 50 °C, and more typically at a temperature of between about 20 0C and about 37 0C. The reaction mixture is generally maintained at a relatively constant pH that is optimal for the reactions, usually between about 4.0 and about 12. In one embodiment, the reaction mixture is maintained at a pH of from about 7.4 to about 10.5. The pH of the reaction mixture can be adjusted and maintained using a suitable buffer. Examples of suitable buffer include phosphate buffer, a TRIS buffer (Sigma- Aldrich Chemicals, St. Louis, MO), and a HEPES buffer (Sigma-Aldrich Chemicals, St. Louis, MO). The reaction mixture may be incubated for any duration, from a few minutes or shorter to a few hours or longer. An optimal duration may be determined based on a number of factors, such as the activity of the ammonia-generating enzyme or GDH, the temperature of incubation, the initial amount of the substrates in the reaction mixture, and so on, and can be readily determined by a person skilled in the art. . The rate of the reductive animation catalyzed by GDH may be determined by any suitable method known in the art. For example, the rate of the reductive animation may be determined by measuring one or more of the following parameters: (1) the consumption of the reductive animation substrate, (2) the consumption of the reduced form of nicotinamide adenine dinucleotide (NADH or NADPH), (3) the generation of oxidized nicotinamide adenine dinucleotide (NAD+ or NADP+), and (4) the generation of a reductive amination product. One particular method for determining the rate of the reductive amination catalyzed by GDH is to spectrophotometrically measure the consumption of the reduced nicotinamide adenine dinucleotide (NADH or NADPH) in the reaction mixture. It is known that NADH and NADPH each absorbs light strongly at wavelengths between about 290 nm and about 380 nm, while NAD+, NADP+, and other substrates or products of the reactions do not. Thus, as the NADH or NADPH in the reaction mixture is consumed (i.e., oxidized to NAD+, NADP+), the light absorbance of the reaction mixture at the above wavelengths decreases. The rate of the consumption of NADH or NADPH is in directly proportional to the absorbance decrease. As the rate of consumption of NADH or NADPH is also directly proportional to the rate of ammonia generation and, hence, the activity of the ammonia-generating enzyme, the rate of absorbance decrease at the above wavelengths is indicative of the activity of ammonia-generating enzyme, wherein a faster rate of absorbance decrease indicates a higher activity of the ammonia-generating enzyme, and vise versa.
Typically, the light absorbance of the reaction mixture is measured at wavelengths between about 330 and about 370, and preferably at wavelengths of about 340 nm. The light absorbance can be measured readily by those skilled in the art using conventional spectrophotometric procedures. The measurements of the parameters of the reductive amination may be taken once at the end of the incubation period, at a plurality of time points during the incubation period, or continuously during the incubation period. The ammonia-generating enzyme activity can be quantitated according to methods known in art. In another aspect, the present invention provides a method for identifying a compound capable of modulating the activity of an ammonia-generating enzyme, wherein the activity of the ammonia-generating enzyme is determined using the enzyme activity assay method described above. This method may be referred to hereinafter as "compound screening method" of the invention. To identify a compound capable of modulating the activity of an ammonia- generating enzyme, a reaction mixture is incubated in the absence and presence of a test compound and the activity of the ammonia-generating enzyme is determined by enzyme activity assay method of the invention described above. Specifically, the method comprises: (a) providing a reaction mixture comprising a predetermined amount of (1) an ammonia-generating enzyme, (2) an ammonia-generating substrate for the ammonia-generating enzyme, (3) glutamate dehydrogenase, (4) a reductive animation substrate other than ammonia for glutamate dehydrogenase, and (5) a reduced form of co-enzyme for glutamate dehydrogenase; (b) incubating the reaction mixture in the absence and presence of a test compound and under conditions that allow for reactions catalyzed by the ammonia-generating enzyme and glutamate dehydrogenase; and (c) measuring the rate of the reductive animation catalyzed by glutamate dehydrogenase; wherein a difference in the rate of the reductive animation between the presence and absence of the test compound indicates that the test compound is capable of modulating the activity of the ammonia-generating enzyme. A test compound is identified as an inhibitor of the ammonia-generating enzyme if the rate of the reductive amination in the presence of the test compound is lower than that in the absence of the test compound. Conversely, a test compound is identified as an activator of ammonia-generating enzyme if the rate of the reductive amination in the presence of the test compound is higher than that in the absence of the test compound.
In one embodiment, there is provided a method for identifying a compound capable of modulating the activity of FAAH, which method comprises: (a) providing a reaction mixture comprising a predetermined amount of (1) FAAH, (2) a fatty acid primary amide as an ammonia-generating substrate for FAAH, (3) glutamate dehydrogenase, (4) α-ketoglutarate as a reductive amination substrate for glutamate dehydrogenase, (5) NADH or NADPH as co-enzyme for glutamate dehydrogenase; (b) incubating the reaction mixture in the absence and presence of a test compound under conditions that allow for reactions catalyzed by FAAH and glutamate dehydrogenase; and (c) measuring the rate of the reductive amination by measuring the consumption of the NADH or NADPH in the reaction mixture, wherein a consumption of the NADH or NADPH in the presence of the test compound that differs from that in the absence of the test compound indicates that test compound is capable of modulating the activity of FAAH. A test compound will be identified as an inhibitor of FAAH if the consumption of the NADH or NADPH in the presence of the test compound is lower than that in the absence of the test compound. Conversely, a test compound will be identified as an activator of FAAH if the consumption of the NADH or NADPH in the presence of the test compound is higher than that in the absence of the test. The FAAH may be from any source, may be naturally occurring or recombinant, and may be a full-length enzyme or enzymatically active, truncated form thereof. The optimal amount of the FAAH used in the reaction mixture may vary depending on a number of factors, such as the source or specific activity of the enzyme, and the substrate used, and can be readily determined by a person skilled in the art. Generally, the concentrations of the FAAH in the reaction mixture are greater than about 2 nM, and preferably greater than 10 nM. In one specific embodiment, oleamide is used as the fatty acid primary amide, NADH is used as the co-enzyme of GDH, and the consumption of NADH is determined by measuring the light absorbance of the reaction mixture at wavelengths of 340 ran.
The compound screening method of the present invention is useful for rapid screening of compounds capable of modulating the activity of an ammonia- generating enzyme, such as FAAH, using automated procedures. Such automated methods can be readily performed by using commercially available automated instrumentation and software and known automated observation and detection procedures. Multi-well formats are particularly attractive for high throughput and automated compound screening. Screening methods can be performed, for example, using a standard microplate well format. A microplate reader includes any device that is able to read a signal from a microplate (e.g., 96 and 384-well plates). Such a signal may be detected spectrophotometrically, such as, for instance, reading the optical density of the NADH or NADPH absorbance at a wavelength of 340 nm. However, other detecting means may also be utilized, such as fluorometry (standard or time- resolved), luminometry, or photometry in either endpoint or kinetic assays. Using such techniques, a wide variety of compounds can be rapidly and efficiently screened for their respective effects on an ammonia-generating enzyme, such as FAAH. Sample handling and detection procedures can be automated using commercially available instrumentation and software systems for rapid, reproducible application of reagents, and automated screening of target compounds. To increase the throughput of a compound administration, currently available robotic systems such as the BioRobot 9600 from Quagen (Quagen, Inc. Valencia, CA), the Zymate from Zymark (Hopkinton, Mass) or the Biomek from Beckman Instruments (Fullerton, CA), most of which use the multi-well plate format, could be utilized.
EXAMPLES
The following examples relate to assays for measuring the activity of FAAH and their utility for identifying compounds capable of modulating the activity of FAAH. These examples are for illustrative purposes only and are not offered to limit the claimed invention. Various modifications or changes in light of these examples will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the claims.
EXAMPLE 1. Preparation of a Truncated Human FAAH A truncated human FAAH (hFAAH) was prepared by the method described in this Example, and was used in the studies described in Examples 2-4 below. The amino acid sequence of this truncated human FAAH is shown in SEQ ID NO: 1, which comprises amino acids 32-579 of the full length human FAAH. The E. coli codon optimized DNA sequence encoding amino acids 32-579 of the full human FAAH is shown in SEQ ID No: 2.
A. Cloning and Construction of hFAAH Plasmids
Known molecular biological techniques are utilized to carry out the cloning and construction of constructs described herein. Such techniques are referred to, for example, in Davis et al., Basic Methods in Molecular Biology, Elsevir Sciences Publishing, Inc., New York, NY, 1986; Hames et al., Nucleic Acid Hybridization, IL Press, 1985; Molecular Cloning, Sambrook et al., Current Protocols in Molecular Biology, Eds. Ausubel et al., John Wiley and Sons; Current Protocols in Human Genetics, Eds. Dracopoli et al., John Wiley and Sons; Current Protocols in Protein Science, Eds. John E. Coligan et al., John Wiley and Sons; and Current Protocols in Immunology, Eds. John E. Coligan et al., John Wiley and Sons).
pTrcHis A-hFAAH (encoding human (h) FAAH amino acids 30-579) The following cDNAs were custom-synthesized and subcloned into a pUCl 19 vector (Blue Heron Biotechnology (Bothell, WA)). The E. coli codon optimization was carried out by using an optimization algorithm (Blue Heron Biotechnology (Bothell, WA)).
- pUCl 19-hFAAH (encoding hFAAH, amino acids 1-579): A cDNA containing the E. coli codon optimized DNA sequence of hFAAH (encoding amino acids 1- 579) with a 5'-Xho I site, 3' stop codon , and 3'-EcoR I site. (SEQ ID NO: 3).
- pUCl 19-hFAAH (encoding hFAAH, amino acids 30-104): A cDNA containing the E. coli codon optimized DNA sequence of hFAAH (bp from 94 to 319 of SEQ
ID NO: 3) with a 5'-Xho I site (SEQ ID NO: 4).
The pUCl 19-hFAAH (encoding hFAAH, amino acids 1-579) was digested with Xho I - EcoR I and the insert was subcloned into a Xho I - EcoR I-digested pTrcHis A vector (Invitrogen, Cat # V360-20) to generate pTrcHis A-hFAAH
(encoding amino acids 1-579). The pTrcHis A-hFAAH vector was digested with Xho I-Hind III, and the resulting Xho I-Hind III (approximately 4.5 kb) and Hind Ill-Hind III (approximately 1.5 kb) pieces were ligated with the Xho I-Hind III fragment (225 bp) generated from digesting the pUCl 19-hFAAH (encoding amino acids 30-104) construct to generate an NH2-terminally His-tagged pTrcHis A-hFAAH (encoding amino acids 30-579 of the full length hFAAH).
pET28a-hFAAH (encoding hFAAH, amino acids 32-579)
The human FAAH construct for subcloning into the prokaryotic expression vector pET28a(+) (Novagen, Catalog # 69864-3) was generated by PCR from the pTrcHis A-hFAAH (amino acids 30-579) construct using the following primers: sense primer, 5 ' -GGAATTCCATATGTCAGGTCGTCGTACCGC ACGTG-3 ' (SEQ ID NO: 5) ; and antisense primer, 5'-CCGCTCGAGTTATGAGGATTGTTT TTCCGG AGTC AT-3' (SEQ ID NO: 6). The resulting PCR product was digested with Nde I-Xho I, and subcloned into a Nde I-Xho I -digested pET28a(+) vector to generate an NH2-terminally His-tagged pET28a-hFAAH (encoding amino acids 32- 579).
Summary of Human FAAH Constructs: pTrcHis A-hFAAH encodes hFAAH, amino acids (30-579): MGGSHHHHHHGMASMTGGQQMGRTLYDDDDKDRWGSELE — hFAAH
pET28a-hFAAH encodes hFAAH, amino acids (32-579): MGSSHHHHHHSSGLVPRGSHM — hFAAH " — " Does not represent amino acid positions. Each indicated hFAAH position is contiguous with the specifically indicated leading amino acid sequence comprising HHHHHH.
B. Expression and Purification of Truncated hFAAH "RT" describes room temperature, which is typically 25°C ± 3°. The pET28a- hFAAH construct encoding amino acids corresponding to amino acids 32-579 of wild-type human FAAH was transformed into the E. coli BL21-AI strain. 1.2-liter cultures of the freshly transformed expressing sixains were grown in SuperBroth media in the presence of 30 μg/ml kanamycin at 37 0C. At OD60O of approximately 0.12, the cultures were transferred to RT and induced at OD600 of 0.6 - 0.65 with 100 μM IPTG and 0.2% L-arabinose for 20 hours at RT. All operations below were at 4 0C unless otherwise noted. The cells were then harvested by centrifugation at 5000 x g. The cell pellets were washed twice by re-suspending in 700 ml of PBS and collected by centrifugation at 5000 x g. At this point, the cell paste is optionally frozen and stored at - 80 °C until needed. The cells were re-suspended in 60 ml of buffer A (20 mM Tris-HCl, pH 8.0/100 mM NaCyi% Triton X-100) with stirring. After adding DNase and RNase (1 mg per 25 g E. coli pellet), the cell suspension was incubated for 1 hour at RT with mixing intermittently, cooled on ice for 10 min, and was sonicated with approximately 40-60 ten-second pulses. The resulting lysate was centrifuged at 10,000 x g for 35 minutes and the supernatant was loaded at 0.5 - 1 ml/min onto a 5 ml Ni-column (HiTrap chelating HP column from Amersham Biosciences (Cat # 17-0409-01) was charged with Ni according to the manufacturer's instructions) which has been equilibrated with buffer B (20 mM Tris-HCl, pH 8.0/300 mM NaCl/1% Triton X-100). The resulting flow-through was reloaded onto the column. The column was washed with 100 ml of buffer B and further washed in sequence with 50 ml of buffer B containing 10, 20, and 50 mM imidazole, respectively. The elution was performed in sequence with 25 ml of buffer B containing 100, 200, 400, and 700 mM imidazole, respectively. The majority of FAAH was eluted with buffer B containing 100-200 mM imidazole. The eluted
FAAH was dialyzed against buffer B overnight, frozen in liquid N2, and stored at -80 0C.
EXAMPLE 2. FAAH Dose-Response Curve at 100 uM Oleamide To determine whether the assay provides for quantitative detection of FAAH activity, the assay was carried out with increasing concentrations of FAAH. The reactions were carried out in 96-well clear polystyrene plates. The reaction mixture (250 μl) contained 50 mM Tris-HCl, pH 8.0, 100 μM oleamide, 150 μM NADH, 3 mM α-ketoglutarate, 2 mM ADP, 6.0 unit/ml GDH, 0.1% Triton® X-100, and the indicated volumes of approximately 150 nM FAAH. The reactions were incubated at 37 0C and the absorbance at 340 nm was collected over a period of 30 min with readings taken in 10-second intervals using a SpectraMax Microplate Spectrophotometer® (Molecular Devices, Palo Alto, CA) equipped with Softmax Pro® software (Molecular Devices, Palo Alto, CA). As shown in Figure 1, the rate of the reaction increases with increasing concentration of FAAH.
EXAMPLE 3. FAAH Initial Velocity Dependence on Oleamide
Concentration
An assay was carried out to determine whether the GDH-coupled FAAH assay is compatible with enzyme kinetics and to demonstrate that FAAH follows typical Michaelis-Menten enzyme kinetics. The reactions were carried out in 96-well clear polystyrene plates. The reaction mixture (250 μl) contained 50 mM Tris-HCl, pH 8.0, 150 μM NADH, 3 mM α-ketoglutarate, 2 mM ADP, 12 unit/ml GDH, 0.1% Triton® X-100, the indicated concentrations of oleamide, and approximately 10 nM FAAH. The reactions were incubated at 37 °C and the data were collected as described in Example 1. Oleamide concentrations are plotted on the x axes and the initial rates are plotted on the y axes. The data were fit to the Michaelis-Menten equation. As shown in Fig. 2, this GDH-coupled FAAH assay allows measuring kinetic constants of FAAH. This data also demonstrates that FAAH follows a typical Michaelis-Menten kinetics. The Km value, which is oleamide substrate concentration at which the reaction rate is half of its maximal value, was determined to be 19.8 μM.
EXAMPLE 4. Measurement of FAAH Inhibition by Compound A. To further demonstrate the utility of the assay, the inhibitory effects of 1- oxazolo[4,5-b]pyridin-2-yl-5-phenyl-pentan-l-one ((PNAS, (2000) vol. 97, No. 10:p5042), hereinafter, Compound A) on FAAH activity were examined using the GDH-coupled FAAH assay. The reactions were carried out in 96-well clear polystyrene plates. The reaction mixture (200 μl) contained 50 mM NaPi, pH 7.4, 50 μM oleamide, 150 μM NADH, 3 mM α-ketoglutarate, 2 mM ADP, 1 mM ethylenediaminetetraacetic acid (EDTA), 12 unit/ml GDH, 0.1% Triton X-100®, the concentrations of Compound A indicated on Figure 3, and approximately 10 nM FAAH. Oleamide (500 μM) dissolved in 25% DMSO and 25% EtOH was used as a stock solution. Compound A stock solutions, dissolved in 50% DMSO, were used. The final concentrations of DMSO and EtOH were each 7.5%. The reactions were incubated at 37 0C and the data were collected as described in Example 1. The results shown in Figure 3 demonstrate that Compound A inhibits FAAH in a dose-responsive manner.
SEQUENCE LISTING GUIDE
SEQ ID NO: 1 - Amino acids 32-579 of full length homo sapien FAAH.
SEQ ID NO: 2 - Nucleotide sequence encoding amino acids 32 to 579 of full length homo sapien FAAH, optimized for expression in E.coli.
SEQ ID NO: 3 - The DNA sequence of the E. coli codon optimized sequence of hFAAH (amino acids 1-579) with a 5'-Xho I site, 3' stop codon, and 3'-EcoR I site.
SEQ ID NO: 4 - The DNA sequence from bp 94 to bp 319 of SEQ ID NO: 3 with a 5'-Xho I site.
SEQ ID NO: 5 and 6 - Primers. SEQUENCE LISTING
<110> Warner-Lambert Company LLC Ann, Kyunghye
<120> FATTY ACID AMIDE HYDROLASE ASSAY <130> PC32044A <150> US 60/651 , 710 <151> 2005-02-10
<160> 6 <170> Patentln version 3.3
<210> 1
<211> 548
<212> PRT <213> Homo sapiens
<400> 1
Ser GIy Arg Arg Thr Ala Arg GIy Ala VaI VaI Arg Ala Arg GIn Lys 1 5 10 15
Gin Arg Ala GIy Leu GIu Asn Met Asp Arg Ala Ala GIn Arg Phe Arg 20 25 30
Leu GIn Asn Pro Asp Leu Asp Ser GIu Ala Leu Leu Ala Leu Pro Leu 35 40 45
Pro GIn Leu VaI GIn Lys Leu His Ser Arg GIu Leu Ala Pro GIu Ala 50 55 60
VaI Leu Phe Thr Tyr VaI GIy Lys Ala Trp GIu VaI Asn Lys GIy Thr 65 70 75 80
Asn Cys VaI Thr Ser Tyr Leu Ala Asp Cys GIu Thr Gin Leu Ser GIn 85 90 95
Ala Pro Arg GIn GIy Leu Leu Tyr GIy VaI Pro VaI Ser Leu Lys GIu 100 105 110
Cys Phe Thr Tyr Lys GIy GIn Asp Ser Thr Leu GIy Leu Ser Leu Asn 115 120 125
GIu GIy VaI Pro Ala GIu Cys Asp Ser VaI VaI VaI His VaI Leu Lys 130 135 140 Leu GIn GIy Ala VaI Pro Phe VaI His Thr Asn VaI Pro GIn Ser Met 145 150 155 160
Phe Ser Tyr Asp Cys Ser Asn Pro Leu Phe GIy GIn Thr VaI Asn Pro 165 170 175
Trp Lys Ser Ser Lys Ser Pro GIy GIy Ser Ser GIy GIy GIu GIy Ala 180 185 190
Leu lie GIy Ser GIy GIy Ser Pro Leu GIy Leu GIy Thr Asp lie GIy 195 200 205
GIy Ser lie Arg Phe Pro Ser Ser Phe Cys GIy lie Cys GIy Leu Lys 210 215 220
Pro Thr GIy Asn Arg Leu Ser Lys Ser GIy Leu Lys GIy Cys VaI Tyr 225 230 235 240
GIy GIn GIu Ala VaI Arg Leu Ser VaI GIy Pro Met Ala Arg Asp VaI 245 250 255
GIu Ser Leu Ala Leu Cys Leu Arg Ala Leu Leu Cys GIu Asp Met Phe 260 265 270
Arg Leu Asp Pro Thr VaI Pro Pro Leu Pro Phe Arg GIu GIu VaI Tyr 275 280 285
Thr Ser Ser GIn Pro Leu Arg VaI GIy Tyr Tyr GIu Thr Asp Asn Tyr 290 295 300
Thr Met Pro Ser Pro Ala Met Arg Arg Ala VaI Leu GIu Thr Lys Gin 305 310 315 320
Ser Leu GIu Ala Ala GIy His Thr Leu VaI Pro Phe Leu Pro Ser Asn 325 330 335
lie Pro His Ala Leu GIu Thr Leu Ser Thr GIy GIy Leu Phe Ser Asp 340 345 350
Gly GIy His Thr Phe Leu GIn Asn Phe Lys GIy Asp Phe VaI Asp Pro 355 360 365
Cys Leu Gly Asp Leu VaI Ser lie Leu Lys Leu Pro GIn Trp Leu Lys 370 375 380 GIy Leu Leu Ala Phe Leu VaI Lys Pro Leu Leu Pro Arg Leu Ser Ala 385 390 395 400
Phe Leu Ser Asn Met Lys Ser Arg Ser Ala GIy Lys Leu Trp GIu Leu 405 410 415
GIn His GIu lie GIu VaI Tyr Arg Lys Thr VaI lie Ala GIn Trp Arg 420 425 430
Ala Leu Asp Leu Asp VaI VaI Leu Thr Pro Met Leu Ala Pro Ala Leu 435 440 445
Asp Leu Asn Ala Pro GIy Arg Ala Thr GIy Ala VaI Ser Tyr Thr Met 450 455 460
Leu Tyr Asn Cys Leu Asp Phe Pro Ala GIy VaI VaI Pro VaI Thr Thr 465 470 475 480
VaI Thr Ala GIu Asp GIu Ala GIn Met GIu His Tyr Arg GIy Tyr Phe 485 490 495
GIy Asp lie Trp Asp Lys Met Leu GIn Lys GIy Met Lys Lys Ser VaI 500 505 510
Gly Leu Pro VaI Ala VaI Gin Cys VaI Ala Leu Pro Trp Gin GIu GIu 515 520 525
Leu Cys Leu Arg Phe Met Arg GIu VaI GIu Arg Leu Met Thr Pro GIu 530 535 540
Lys GIn Ser Ser 545
<210> 2 <211> 1647
<212> DNA
<213> Artificial
<220> <223> E . coli codon-optimized human DNA
<400> 2 tcaggtcgtc gtaccgcacg tggtgccgtc gttcgtgctc gccagaaaca acgtgccggc 60 ctggaaaata tggatcgtgc cgcccaacgt tttcgcctgc agaaccccga cctcgactct 120 gaagctctgt tagccttgcc acttccacag ctggtacaga aactgcacag ccgtgaactc 180 gctccagaag ccgtgttatt tacctatgtc gggaaagctt gggaagtgaa taaaggtact 240 aactgtgtta cttcatattt ggctgattgc gaaactcaat tgagtcaagc cccgcgccaa 300 ggcctgttat atggtgtccc ggtatccctg aaagaatgtt ttacttataa aggtcaagat 360 tcaacgctcg gtctgtcatt aaacgaaggc gttcccgcgg aatgcgacag tgtggtcgtc 420 catgttctga aactgcaggg cgctgtcccg ttcgttcaca ctaatgttcc acaatctatg 480 tttagctacg attgcagtaa ccccctcttt ggccagaccg tcaacccatg gaagtcgtcg 540 aaaagccctg gtggaagcag cggtggcgaa ggtgcattaa ttggttctgg aggctctccg 600 ctgggtcttg gtacagatat tggtggctcc attcgtttcc catcctcctt ttgtggtatc 660 tgtggtctga aacctaccgg taatcgtctt tccaaatctg gcctcaaggg ctgcgtgtat 720 ggtcaagaag ccgttcgcct ttccgttgga cctatggcgc gtgatgtcga atctttagct 780 ctgtgtctgc gcgcactgct ttgcgaggat atgttccgcc tggatcctac tgtgcccccc 840 ctcccattcc gcgaagaagt ttacacctcg tctcaacccc tccgtgttgg ctattacgaa 900 actgataact ataccatgcc gtctcctgcc atgcgccgtg cggtattaga aaccaaacag 960 tcgttagaag ccgcaggtca taccctcgta ccgttcctcc cttcgaacat tccacatgca 1020 ttagagactc tttcaaccgg tggtttattc tctgacggtg gacacacttt tctgcaaaac 1080 tttaaaggcg attttgttga tccgtgtctg ggtgacctgg tttcaattct gaaactgccg 1140 caatggctga agggtctgct tgcttttctt gtaaaacctt tgttacctcg tttatctgcc 1200 ttcttatcta atatgaaatc acgttccgcc ggcaaactgt gggaactgca gcatgagatt 1260 gaagtatacc gtaaaactgt catcgctcaa tggcgtgctc ttgacttaga tgttgtcctt 1320 accccaatgt tagcaccagc tctggatctg aacgcccctg gtcgcgccac tggcgcggtg 1380 agttacacca tgttgtataa ctgtctggat ttccctgcgg gtgtcgtgcc tgttaccact 1440 gttacagctg aagatgaagc gcaaatggaa cattatcgtg gctacttcgg tgacatctgg 1500 gataaaatgc tgcaaaaagg aatgaaaaaa tctgtaggct taccagtagc cgtccaatgc 1560 gttgctctgc cctggcaaga agaattgtgc ttgcgtttca tgcgtgaagt agagcgttta 1620 atgactccgg aaaaacaatc ctcataa 1647
<210> 3
<211> 175: I
<212> DNA
<213> Artificial
<220>
<223> E . coli codon-optimized human DNA
<400> 3 ctcgagatgg tccaatacga attgtgggct gctttgccag gagcaagcgg cgttgctctg 60 gcctgctgtt tcgttgctgc cgccgtcgcg ctgcgttggt caggtcgtcg taccgcacgt 120 ggtgccgtcg ttcgtgctcg ccagaaacaa cgtgccggcc tggaaaatat ggatcgtgcc 180 gcccaacgtt ttcgcctgca gaaccccgac ctcgactctg aagctctgtt agccttgcca 240 cttccacagc tggtacagaa actgcacagc cgtgaactcg ctccagaagc cgtgttattt 300 acctatgtcg ggaaagcttg ggaagtgaat aaaggtacta actgtgttac ttcatatttg 360 gctgattgcg aaactcaatt gagtcaagcc ccgcgccaag gcctgttata tggtgtcccg 420 gtatccctga aagaatgttt tacttataaa ggtcaagatt caacgctcgg tctgtcatta 480 aacgaaggcg ttcccgcgga atgcgacagt gtggtcgtcc atgttctgaa actgcagggc 540 gctgtcccgt tcgttcacac taatgttcca caatctatgt ttagctacga ttgcagtaac 600 cccctctttg gccagaccgt caacccatgg aagtcgtcga aaagccctgg tggaagcagc 660 ggtggcgaag gtgcattaat tggttctgga ggctctccgc tgggtcttgg tacagatatt 720 ggtggctcca ttcgtttccc atcctccttt tgtggtatct gtggtctgaa acctaccggt 780 aatcgtcttt ccaaatctgg cctcaagggc tgcgtgtatg gtcaagaagc cgttcgcctt 840 tccgttggac ctatggcgcg tgatgtcgaa tctttagctc tgtgtctgcg cgcactgctt 900 tgcgaggata tgttccgcct ggatcctact gtgccccccc tcccattccg cgaagaagtt 960 tacacctcgt ctcaacccct ccgtgttggc tattacgaaa ctgataacta taccatgccg 1020 tctcctgcca tgcgccgtgc ggtattagaa accaaacagt cgttagaagc cgcaggtcat 1080 accctcgtac cgttcctccc ttcgaacatt ccacatgcat tagagactct ttcaaccggt 1140 ggtttattct ctgacggtgg acacactttt ctgcaaaact ttaaaggcga ttttgttgat 1200 ccgtgtctgg gtgacctggt ttcaattctg aaactgccgc aatggctgaa gggtctgctt 1260 gcttttcttg taaaaccttt gttacctcgt ttatctgcct tcttatctaa tatgaaatca 1320 cgttccgccg gcaaactgtg ggaactgcag catgagattg aagtataccg taaaactgtc 1380 atcgctcaat ggcgtgctct tgacttagat gttgtcctta ccccaatgtt agcaccagct 1440 ctggatctga acgcccctgg tcgcgccact ggcgcggtga gttacaccat gttgtataac 1500 tgtctggatt tccctgcggg tgtcgtgcct gttaccactg ttacagctga agatgaagcg 1560 caaatggaac attatcgtgg ctacttcggt gacatctggg ataaaatgct gcaaaaagga 1620 atgaaaaaat ctgtaggctt accagtagcc gtccaatgcg ttgctctgcc ctggcaagaa 1680 gaattgtgct tgcgtttcat gcgtgaagta gagcgtttaa tgactccgga aaaacaatcc 1740 tcataagaat tc 1752 <210> 4
<211> 232
<212> DNA
<213> Artificial <220>
<223> E . coli codon-optimized human DNA
<400> 4 ctcgagcgtt ggtcaggtcg tcgtaccgca cgtggtgccg tcgttcgtgc tcgccagaaa 60 caacgtgccg gcctggaaaa tatggatcgt gccgcccaac gttttcgcct gcagaacccc 120 gacctcgact ctgaagctct gttagccttg ccacttccac agctggtaca gaaactgcac 180 agccgtgaac tcgctccaga agccgtgtta tttacctatg tcgggaaagc tt 232
<210> 5
<211> 35 <212> DNA
<213> Artificial
<220>
<223> Sense Primer
<400> 5 ggaattccat atgtcaggtc gtcgtaccgc acgtg 35
<210> 6
<211> 36
<212> DNA
<213> Artificial <220>
<223> Antisense Primer
<400> 6 ccgctcgagt tatgaggatt gtttttccgg agtcat 36

Claims

CLAIMSWhat is claimed is:
1. A method for measuring the activity of an ammonia-generating enzyme, comprising the steps of:
(a) providing a reaction mixture comprising a predetermined amount of: (1) the ammonia- generating enzyme,
(2) an ammonia-generating substrate for the ammonia-generating enzyme,
(3) glutamate dehydrogenase,
(4) a reductive animation substrate for glutamate dehydrogenase, and (5) a reduced form of co-enzyme for glutamate dehydrogenase;
(b) incubating the reaction mixture under conditions that allow for reactions catalyzed by the ammonia-generating enzyme and glutamate dehydrogenase; and
(c) measuring the rate of the reductive animation catalyzed by glutamate dehydrogenase, wherein the rate of the reductive amination catalyzed by glutamate dehydrogenase is indicative of the activity of the ammonia- generating enzyme.
2. The method according to claim 1, wherein the reduced form of co-enzyme for glutamate dehydrogenase is selected from NADH or NADPH.
3. The method according to claim 2, wherein the reductive amination substrate for glutamate dehydrogenase is α-ketoglutarate.
4. The method according to claim 2, wherein the rate of the reductive amination catalyzed by the glutamate dehydrogenase is measured by measuring the consumption of the reduced form of the co-enzyme.
5. The method according to claim 4, wherein the consumption of the reduced form of the co-enzyme is measured spectrophotometrically at a wavelength between about 290 nm and about 380 nm.
6. The method according to claims 5, wherein the ammonia-generating enzyme is fatty acid amide hydrolase.
7. A method for identifying a compound capable of modulating the activity of an ammonia-generating enzyme, comprising the steps of:
(a) providing a reaction mixture comprising a predetermined amount of: (1) the ammonia-generating enzyme,
(2) an ammonia-generating substrate for the ammonia-generating enzyme,
(3) glutamate dehydrogenase,
(4) a reductive animation substrate for glutamate dehydrogenase, and (5) a reduced form of co-enzyme for glutamate dehydrogenase;
(b) incubating the reaction mixture in the absence and presence of a test compound and under conditions that allow for reactions catalyzed by the ammonia- generating enzyme and glutamate dehydrogenase; and
(c) measuring the rate of the reductive amination catalyzed by the glutamate dehydrogenase; wherein a difference in the rate of the reductive amination between the presence and absence of the test compound indicates that the test compound is capable of modulating the activity of the ammonia-generating enzyme.
8. The method according to claim 7, wherein the reduced form of co-enzyme for glutamate dehydrogenase is selected from NADH or NADPH.
9. The method according to claim 8, wherein the reductive amination substrate for glutamate dehydrogenase is α-ketoglutarate.
10. The method according to claim 8, wherein the rate of the reductive amination catalyzed by the glutamate dehydrogenase is measured by measuring the consumption of the reduced form of the co-enzyme.
11. The method according to claim 10, wherein the consumption of the reduced form of the co-enzyme is measured spectrophotometrically at a wavelength between about 290 nm and about 380 nm.
12. The method according to claim 11, wherein the ammonia-generating enzyme is fatty acid amide hydrolase.
13. The method according to claim of 12, wherein the reduced form of co-enzyme for glutamate dehydrogenase is NADH.
14. The method according to claim of 13, wherein the consumption of the reduced form of co-enzyme is measured spectrophotometrically at a wavelength of about 340 nm.
15. The method according to claim 14, wherein the ammonia-generating substrate is oleamide.
EP06710346A 2005-02-10 2006-02-01 Fatty acid amide hydrolase assay Withdrawn EP1851328A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US65171005P 2005-02-10 2005-02-10
PCT/IB2006/000251 WO2006085196A1 (en) 2005-02-10 2006-02-01 Fatty acid amide hydrolase assay

Publications (1)

Publication Number Publication Date
EP1851328A1 true EP1851328A1 (en) 2007-11-07

Family

ID=36080627

Family Applications (1)

Application Number Title Priority Date Filing Date
EP06710346A Withdrawn EP1851328A1 (en) 2005-02-10 2006-02-01 Fatty acid amide hydrolase assay

Country Status (4)

Country Link
EP (1) EP1851328A1 (en)
JP (1) JP2008529519A (en)
CA (1) CA2597131A1 (en)
WO (1) WO2006085196A1 (en)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
SI2076508T1 (en) 2006-10-18 2011-04-29 Pfizer Prod Inc Biaryl ether urea compounds

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPS6041500A (en) * 1983-08-12 1985-03-05 Yamasa Shoyu Co Ltd Quantitative determination of ammonia
US5198335A (en) * 1985-06-04 1993-03-30 Fuji Photo Film Co., Ltd. Integral multilayer analytical element for analysis of ammonia-forming substrate
JPH0664056B2 (en) * 1987-04-16 1994-08-22 富士写真フイルム株式会社 Integrated multi-layer analytical element for the determination of ammonia-producing substances
JP2672845B2 (en) * 1988-09-27 1997-11-05 旭化成工業株式会社 Method for producing L-alanine dehydrogenase

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO2006085196A1 *

Also Published As

Publication number Publication date
WO2006085196A1 (en) 2006-08-17
JP2008529519A (en) 2008-08-07
CA2597131A1 (en) 2006-08-17

Similar Documents

Publication Publication Date Title
Collazo et al. A coupled fluorescent assay for histone methyltransferases
Krepkiy et al. Identification of active site residues in mevalonate diphosphate decarboxylase: implications for a family of phosphotransferases
Molnos et al. A continuous coupled enzyme assay for bacterial malonyl–CoA: acyl carrier protein transacylase (FabD)
Berges et al. Enzymes and nitrogen cycling
US20120164670A1 (en) Methods and kits for measuring enzyme activity
Potrykus et al. Estimates of RelSeq, Mesh1, and SAHMex hydrolysis of (p) ppGpp and (p) ppApp by thin layer chromatography and NADP/NADH coupled assays
Wang et al. A rapid fluorescence detecting platform: applicable to sense carnitine and chloramphenicol in food samples
US20100291605A1 (en) Assays for s-adenosylmethionine-dependent methyltransferases
US9708639B2 (en) Method for quantifying amino acids with pyrophosphate
WO2006085196A1 (en) Fatty acid amide hydrolase assay
Li et al. Purification and characterization of the acetyl-CoA synthetase from Mycobacterium tuberculosis
Van Kuilenburg et al. A radiochemical assay for β-ureidopropionase using radiolabeled N-carbamyl-β-alanine obtained via hydrolysis of [2-14C] 5, 6-dihydrouracil
JPH09503131A (en) In vitro assay for detecting inhibitors of protein and / or mRNA biosynthesis
Lee et al. Enhancing ATP-based bacteria and biofilm detection by enzymatic pyrophosphate regeneration
US6746849B1 (en) Assay for nucleoside diphosphate using a modified nucleoside diphosphate kinase comprising a fluorescent label
Berges et al. Enzymes and N cycling
Frick et al. Optimization of a high throughput screening platform to identify inhibitors of asymmetric diadenosine polyphosphatases
US7504234B2 (en) Assays for S-adenosylmethionine (AdoMet)-dependent methyltransferase activity
Šprung et al. Substrate-induced conformational changes of the tyrocidine synthetase 1 adenylation domain probed by intrinsic Trp fluorescence
Takahara et al. Continuous spectrophotometric assays for three regulatory enzymes of the arginine biosynthetic pathway
Zhu et al. High-throughput assay of tyrosine phenol-lyase activity using a cascade of enzymatic reactions
Adina-Zada et al. Insights into the mechanism and regulation of pyruvate carboxylase by characterisation of a biotin-deficient mutant of the Bacillus thermodenitrificans enzyme
Fernley et al. A rapid assay for dihydropteroate synthase activity suitable for identification of inhibitors
de la Cruz Rodríguez et al. Damage of Escherichia coli cells by t-butylhydroperoxide involves the respiratory chain but is independent of the presence of oxygen
CN110779887B (en) Method for determining phosphoglycerate kinase activity

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20070910

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LI LT LU LV MC NL PL PT RO SE SI SK TR

DAX Request for extension of the european patent (deleted)
17Q First examination report despatched

Effective date: 20080123

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20090526