EP1831364A1 - Compositions and methods for expression and purification of fatty acid amide hydrolase - Google Patents
Compositions and methods for expression and purification of fatty acid amide hydrolaseInfo
- Publication number
- EP1831364A1 EP1831364A1 EP05818553A EP05818553A EP1831364A1 EP 1831364 A1 EP1831364 A1 EP 1831364A1 EP 05818553 A EP05818553 A EP 05818553A EP 05818553 A EP05818553 A EP 05818553A EP 1831364 A1 EP1831364 A1 EP 1831364A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- faah
- polypeptide
- nucleotide sequence
- nucleic acid
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 238000000034 method Methods 0.000 title claims abstract description 38
- 108010046094 fatty-acid amide hydrolase Proteins 0.000 title claims description 106
- 230000014509 gene expression Effects 0.000 title claims description 36
- 239000000203 mixture Substances 0.000 title abstract description 12
- 102100029111 Fatty-acid amide hydrolase 1 Human genes 0.000 title description 72
- 238000000746 purification Methods 0.000 title description 9
- 229920001184 polypeptide Polymers 0.000 claims abstract description 75
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 75
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 75
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 37
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 35
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 35
- 101000937693 Homo sapiens Fatty acid 2-hydroxylase Proteins 0.000 claims abstract description 17
- 101000918494 Homo sapiens Fatty-acid amide hydrolase 1 Proteins 0.000 claims abstract description 17
- 102100027297 Fatty acid 2-hydroxylase Human genes 0.000 claims abstract 16
- 150000001413 amino acids Chemical class 0.000 claims description 67
- 239000002773 nucleotide Substances 0.000 claims description 62
- 125000003729 nucleotide group Chemical group 0.000 claims description 62
- 239000013598 vector Substances 0.000 claims description 31
- 239000008188 pellet Substances 0.000 claims description 22
- 239000000872 buffer Substances 0.000 claims description 20
- 239000003599 detergent Substances 0.000 claims description 18
- 239000006228 supernatant Substances 0.000 claims description 18
- 230000001580 bacterial effect Effects 0.000 claims description 13
- 239000012528 membrane Substances 0.000 claims description 13
- 238000004113 cell culture Methods 0.000 claims description 8
- 230000006698 induction Effects 0.000 claims description 8
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 claims description 8
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 claims description 7
- 239000000725 suspension Substances 0.000 claims description 7
- 238000005199 ultracentrifugation Methods 0.000 claims description 7
- SRBFZHDQGSBBOR-HWQSCIPKSA-N L-arabinopyranose Chemical compound O[C@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-HWQSCIPKSA-N 0.000 claims description 5
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 claims description 5
- 150000001768 cations Chemical class 0.000 claims description 5
- 230000001939 inductive effect Effects 0.000 claims description 4
- 238000002955 isolation Methods 0.000 claims description 4
- 239000006166 lysate Substances 0.000 claims description 4
- 230000002934 lysing effect Effects 0.000 claims description 4
- 238000004519 manufacturing process Methods 0.000 claims description 4
- 230000001131 transforming effect Effects 0.000 claims description 4
- 238000004440 column chromatography Methods 0.000 claims description 3
- 230000003381 solubilizing effect Effects 0.000 claims description 3
- 239000011324 bead Substances 0.000 claims description 2
- 238000012258 culturing Methods 0.000 claims description 2
- 238000013518 transcription Methods 0.000 abstract description 3
- 230000035897 transcription Effects 0.000 abstract description 3
- 241000588724 Escherichia coli Species 0.000 description 21
- 235000014113 dietary fatty acids Nutrition 0.000 description 13
- 229930195729 fatty acid Natural products 0.000 description 13
- 239000000194 fatty acid Substances 0.000 description 13
- 210000004027 cell Anatomy 0.000 description 12
- 150000004665 fatty acids Chemical class 0.000 description 12
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 12
- 102000002669 Small Ubiquitin-Related Modifier Proteins Human genes 0.000 description 10
- 108010043401 Small Ubiquitin-Related Modifier Proteins Proteins 0.000 description 10
- 108090000623 proteins and genes Proteins 0.000 description 10
- 108020004705 Codon Proteins 0.000 description 9
- 102000004169 proteins and genes Human genes 0.000 description 9
- 108091028043 Nucleic acid sequence Proteins 0.000 description 8
- 230000001413 cellular effect Effects 0.000 description 8
- 241000282414 Homo sapiens Species 0.000 description 7
- 108010052285 Membrane Proteins Proteins 0.000 description 7
- 102000004190 Enzymes Human genes 0.000 description 6
- 108090000790 Enzymes Proteins 0.000 description 6
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 6
- LGEQQWMQCRIYKG-DOFZRALJSA-N anandamide Chemical compound CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(=O)NCCO LGEQQWMQCRIYKG-DOFZRALJSA-N 0.000 description 6
- 238000005119 centrifugation Methods 0.000 description 6
- 229940088598 enzyme Drugs 0.000 description 6
- 229930027917 kanamycin Natural products 0.000 description 6
- 229960000318 kanamycin Drugs 0.000 description 6
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 6
- 229930182823 kanamycin A Natural products 0.000 description 6
- 239000000047 product Substances 0.000 description 6
- LGEQQWMQCRIYKG-UHFFFAOYSA-N arachidonic acid ethanolamide Natural products CCCCCC=CCC=CCC=CCC=CCCCC(=O)NCCO LGEQQWMQCRIYKG-UHFFFAOYSA-N 0.000 description 5
- 238000010367 cloning Methods 0.000 description 5
- 238000011537 Coomassie blue staining Methods 0.000 description 4
- 239000013504 Triton X-100 Substances 0.000 description 4
- 229920004890 Triton X-100 Polymers 0.000 description 4
- 230000000692 anti-sense effect Effects 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 239000002299 complementary DNA Substances 0.000 description 4
- 230000000694 effects Effects 0.000 description 4
- 102000037865 fusion proteins Human genes 0.000 description 4
- 108020001507 fusion proteins Proteins 0.000 description 4
- 239000002184 metal Substances 0.000 description 4
- 229910052751 metal Inorganic materials 0.000 description 4
- 238000005457 optimization Methods 0.000 description 4
- 230000000717 retained effect Effects 0.000 description 4
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- 102000018697 Membrane Proteins Human genes 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 101000702488 Rattus norvegicus High affinity cationic amino acid transporter 1 Proteins 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- -1 fatty acid primary amides Chemical class 0.000 description 3
- 238000000464 low-speed centrifugation Methods 0.000 description 3
- FATBGEAMYMYZAF-KTKRTIGZSA-N oleamide Chemical compound CCCCCCCC\C=C/CCCCCCCC(N)=O FATBGEAMYMYZAF-KTKRTIGZSA-N 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 230000009465 prokaryotic expression Effects 0.000 description 3
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 3
- 208000019901 Anxiety disease Diseases 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- 102000004157 Hydrolases Human genes 0.000 description 2
- 108090000604 Hydrolases Proteins 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 230000036506 anxiety Effects 0.000 description 2
- 230000000975 bioactive effect Effects 0.000 description 2
- 210000004556 brain Anatomy 0.000 description 2
- 125000002091 cationic group Chemical group 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 239000013613 expression plasmid Substances 0.000 description 2
- 239000003940 fatty acid amidase inhibitor Substances 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 230000007062 hydrolysis Effects 0.000 description 2
- 238000006460 hydrolysis reaction Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 210000002569 neuron Anatomy 0.000 description 2
- 229910052759 nickel Inorganic materials 0.000 description 2
- FATBGEAMYMYZAF-UHFFFAOYSA-N oleicacidamide-heptaglycolether Natural products CCCCCCCCC=CCCCCCCCC(N)=O FATBGEAMYMYZAF-UHFFFAOYSA-N 0.000 description 2
- 230000036407 pain Effects 0.000 description 2
- 230000006337 proteolytic cleavage Effects 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 2
- 108700010070 Codon Usage Proteins 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 241000672609 Escherichia coli BL21 Species 0.000 description 1
- 108700007698 Genetic Terminator Regions Proteins 0.000 description 1
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 108010034546 Serratia marcescens nuclease Proteins 0.000 description 1
- 208000013738 Sleep Initiation and Maintenance disease Diseases 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- PYMYPHUHKUWMLA-VAYJURFESA-N aldehydo-L-arabinose Chemical compound OC[C@H](O)[C@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-VAYJURFESA-N 0.000 description 1
- 230000036592 analgesia Effects 0.000 description 1
- 230000000202 analgesic effect Effects 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000003542 behavioural effect Effects 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 229940041514 candida albicans extract Drugs 0.000 description 1
- 238000006555 catalytic reaction Methods 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 229910017052 cobalt Inorganic materials 0.000 description 1
- 239000010941 cobalt Substances 0.000 description 1
- GUTLYIVDDKVIGB-UHFFFAOYSA-N cobalt atom Chemical compound [Co] GUTLYIVDDKVIGB-UHFFFAOYSA-N 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 238000012866 crystallographic experiment Methods 0.000 description 1
- 210000005220 cytoplasmic tail Anatomy 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000002050 diffraction method Methods 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 238000013537 high throughput screening Methods 0.000 description 1
- 230000003301 hydrolyzing effect Effects 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 206010022437 insomnia Diseases 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- HZAXFHJVJLSVMW-UHFFFAOYSA-N monoethanolamine hydrochloride Natural products NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 1
- 230000003227 neuromodulating effect Effects 0.000 description 1
- 238000007899 nucleic acid hybridization Methods 0.000 description 1
- 229920002113 octoxynol Polymers 0.000 description 1
- 210000003463 organelle Anatomy 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 229930182490 saponin Natural products 0.000 description 1
- 150000007949 saponins Chemical class 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 230000009131 signaling function Effects 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 238000000638 solvent extraction Methods 0.000 description 1
- 230000002557 soporific effect Effects 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 230000005062 synaptic transmission Effects 0.000 description 1
- 239000012137 tryptone Substances 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 239000012138 yeast extract Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/78—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
- C12N9/80—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5) acting on amide bonds in linear amides (3.5.1)
Definitions
- the invention relates to compositions and methods for enhanced expression and purification of fatty acid amide hydrolase (FAAH).
- FAAH fatty acid amide hydrolase
- Fatty acid amides represent a growing family of bioactive lipids with diverse cellular and physiological effects (Cravatt, B. F. et al. (1995), Science 268:1506-1509); (Devane, W. A. et al. (1992), Science 258:1946-1949); (Facci, L et al. (1995), Proc. Natl. Acad. Sci. 92:3376-3380).
- Fatty acid amides are hydrolyzed to their corresponding fatty acids by enzymes known as fatty acid amide hydrolases (FAAH) (Ueda et al. (2000), Chem Phys Lipids 108(1 -2):107-21).
- FAAH fatty acid amide hydrolases
- FAAH is a mammalian integral membrane serine hydrolase responsible for the hydrolysis of a number of primary and secondary fatty acid amides, including the neuromodulatory compounds anandamide and oleamide.
- Anandamide (arachidonoyl ethanolamide) has been shown to possess cannabinoid-like analgesic properties and is released by stimulated neurons. The effects and endogenous levels of anandamide increase with pain stimulation, implying its role in suppressing pain neurotransmission and behavioral analgesia. Supporting this, FAAH inhibitors that elevate brain anandamide levels have demonstrated efficacy in animal models of anxiety.
- a second fatty acid amide, oleamide (9-Z-octadecenamide) has been shown to induce sleep.
- FAAH is highly expressed in neurons within the central nervous system where the enzyme appears poised to inactivate fatty acid amides at their presumed sites of action.
- the fatty acid amides are hydrophobic in nature and interact between the enzyme and cell membrane for efficient rates of substrate hydrolysis and product release.
- FAAH is an integral membrane protein that degrades bioactive fatty acid amides thereby terminating the signaling functions of the fatty acid amides. Defining the nature of FAAH's membrane interactions can provide a greater understanding of how FAAH participates in the regulation of fatty acid amide signaling. Given the role of FAAHs in fatty acid amide metabolism, there is a need for further characterization of this enzyme. However, obtaining sufficient quantities of purified, active enzyme for functional- and high-resolution crystallographic studies has been difficult.
- the present invention encompasses nucleic acid compositions encoding truncated human FAAH polypeptides, methods of expressing recombinant human FAAH in E. coli, and purifying the expressed polypeptide.
- the nucleic acid sequences are optimized for transcription in a prokaryotic host.
- the invention is an isolated nucleic acid molecule consisting of a nucleotide sequence selected from the group consisting of: a. A nucleotide sequence set forth in SEQ ID NO:1 ; b. A nucleotide sequence that is 95 to 99% identical to the nucleotide sequence set forth in SEQ ID NO:1 ; c. A nucleotide sequence set forth in SEQ ID NO:2; d. A nucleotide sequence that is at least 70% identical to the nucleotide sequence set forth in SEQ ID NO:2; e. A nucleotide sequence encoding amino acids 30-579 of SEQ ID NO: 4; and f. A nucleotide sequence encoding amino acids 32-579 of SEQ ID NO: 4.
- the invention is a vector comprising the isolated nucleic acid described above.
- the invention is a host cell transformed with the vector described above.
- the invention is a bacterial host-cell transformed with the vector described above.
- the invention is a method for expression of a FAAH protein comprising transforming E. coli host-cells with a vector comprising a nucleic acid molecule encoding a FAAH polypeptide and inducing expression of said polypeptide wherein said expression yields at least 0.13 to 50 mg of FAAH polypeptide per 1 liter of cell culture. In one embodiment, said expression yields 0.13 to 26 mg of FAAH polypeptide per 1 liter of cell culture.
- the invention is a method for the expression of a FAAH protein comprising culturing the host cells described above.
- the invention is a method of producing purified FAAH polypeptide, comprising: a. expressing a heterologous FAAH polypeptide in a host-cell, and b. isolating the membrane fraction of said host-cells by at least one ultracentrifugation step in absence of detergent.
- the invention is a method for producing purified FAAH polypeptide, comprising: a. expressing a heterologous FAAH polypeptide in a host-cell; b. lysing said host-cells in the absence of a detergent; c. centrifuging the lysate of Step (b) at a low speed and retaining supernatant; d. ultracentrifuging said supernatant and retaining pellet; e. re-suspending said pellet in a buffer lacking detergent, f. ultracentrifuging said re-suspension and retaining pellet, g.
- FIGURE 1 depicts human FAAH, SUMO-human FAAH and rat FAAH with greater than 98% purity as estimated by Coomassie Blue staining.
- the present invention encompasses nucleic acid molecules comprising sequences that encode truncated human FAAH polypeptides, methods of expressing recombinant human FAAH in a prokaryotic host, and methods of purifying the expressed polypeptide.
- the nucleic acid sequences are optimized for transcription in Escherichia coli (E. coli).
- the provided nucleic acid compositions comprise those having a deletion of the region corresponding to the nucleotides encoding the transmembrane domain of the FAAH polypeptide. That is, the expression of the nucleic acid compositions of the invention produces a functional FAAH polypeptide that lacks a membrane-spanning domain.
- the nucleotide compositions are further optimized for expression in a prokaryotic host.
- the prokaryotic host is £. coli.
- the eukaryotic transcriptional codons are replaced with prokaryotic transcriptional codons.
- the nucleic acid molecules of the invention comprise a first nucleotide sequence encoding the truncated FAAH polypeptide as described herein, and a second nucleotide sequence encoding a polypeptide that enhances the expression of the FAAH polypeptide; wherein the first and the second nucleotide sequences are operably linked.
- the present invention encompasses a fusion protein that comprises a first truncated FAAH polypeptide and an optional second polypeptide and nucleic acids encoding these fusion proteins.
- the second polypeptide enhances the proper folding of the truncated FAAH.
- the second polypeptide is SUMO (small ubiquitin-related modifier).
- the nucleic acid molecules of the invention further comprise a third nucleotide sequence that encodes a polypeptide that facilitates purification of the expressed protein comprising said tag.
- the tag is a histidine (His) tag.
- operably linked means that the expression of the nucleic acid molecule comprising the first, second and/or third nucleotide sequences in a host-cell capable of expressing said nucleotide sequences produces a fusion protein that comprises the polypeptides encoded by the first, second and/or third nucleotide sequence.
- proteolytic cleavage sites can readily be engineered in order to optionally cleave the polypeptide encoded by the second and/or third nucleotide sequence from the FAAH polypeptide encoded by the first nucleotide sequence.
- the first and/or second nucleotide sequence can be operably linked to the 5' or the 3' end. It is further recognized that each linkage can be optionally contiguous with the third nucleotide sequence.
- Methods of enhanced FAAH polypeptide expression and purification are also provided as further described below.
- the methods are applicable to mammalian FAAH including those set forth herein.
- compositions and methods of the invention are useful for producing functional recombinant FAAH polypeptides.
- the compositions and methods of the invention are useful for producing the polypeptides in quantities that can be needed for high resolution crystallography; for screening for molecules that modulate FAAH activity, including high through-put screening of peptide- and small molecule libraries; and for facilitating structure-based FAAH inhibitor design for the treatment of disorders including anxiety and insomnia.
- the invention is an isolated nucleic acid molecule consisting of a nucleotide sequence selected from the group consisting of: a. A nucleotide sequence set forth in SEQ ID NO:1 ; b. A nucleotide sequence that is 95 to 99% identical to the nucleotide sequence set forth in SEQ ID NO:1 ; c. A nucleotide sequence set forth in SEQ ID NO:2; d. A nucleotide sequence that is at least 70% identical to the nucleotide sequence set forth in SEQ ID NO:2; e. A nucleotide sequence encoding amino acids 30-579 of SEQ ID NO: 4; and f. A nucleotide sequence encoding amino acids 32-579 of SEQ ID NO: 4.
- the nucleotide set forth in SEQ ID NO.1 encodes a truncated form of the human FAAH. That is, the transmembrane domain, amino acids 1-29 of wildtype human FAAH, are deleted and amino acids 30-579 corresponding to the cytosolic domain of human FAAH, are retained.
- the nucleotide sequence set forth in SEQ ID NO.2 encodes a truncated form of the FAAH polypeptide wherein the transmembrane domain, amino acids
- nucleotide sequence in SEQ ID NO 2 is optimized for expression in a prokaryotic host-cell with regard to codon usage.
- the nucleotide sequence set forth in SEQ ID NO 2 is at least 70% identical to the sequence set forth in SEQ ID NO.1.
- the nucleic acid molecules of the present invention encode a functional and soluble FAAH polypeptide, in that the encoded polypeptides lack a transmembrane spanning domain and catalyze a hydrolytic conversion between soporific fatty acid primary amides and their corresponding fatty acids. This catalysis is a function of wildtype FAAH and can be tested by methods known in the art (Kathuria, S. et.al. (2003), Nature Medicine 9:76-81 ); (Patricelli, M. et.al. (1998), Biochemistry 37:15177-15187); or otherwise described in the EXAMPLES described herein.
- the invention is a vector comprising a nucleic acid molecule consisting of a nucleotide sequence selected from the group consisting of the nucleotide sequence of the present invention described in a) to f) as described above.
- the vector comprises a nucleic acid molecule encoding a histidine tag. It is recognized that the sequence encoding the histidine tag can optionally and operably be linked to the 5' or to the 3' end of the sequences encoding FAAH set forth herein. It is further recognized that a proteolytic cleavage site can be optionally and operably contained between the nucleotides encoding the histidine tag and those encoding FAAH.
- the invention is a vector comprising a nucleic acid molecule consisting of a nucleotide sequence selected from the group consisting of the nucleotide sequence of the present invention described in a) to f) above, and further comprising a nucleic acid molecule encoding a SUMO polypeptide sequence.
- the SUMO-encoding nucleotide can be optionally ligated to the 5' end of the sequence encoding FAAH.
- "SUMO” means a small ubiquitin- related modifier polypeptide. Attachment of a SUMO polypeptide to the N-terminus of under-expressed proteins enhances protein expression in E.coli. Nucleotides encoding SUMO and methods for operably linking them to desired coding sequence are available; for example, from Invitrogen (Carlsbad, CA).
- the vector further comprises a promoter sequence operably linked to said nucleic acid molecule.
- "operably linked” means that the promoter is linked to the polypeptide-encoding nucleotide sequence such that a suitable polymerase that binds the promoter transcribes the polypeptide-encoding nucleotide sequence. Methods for such operable linkage are readily recognized by the ordinarily skilled artisan.
- a coding sequence ligated in the correct orientation in a multiple cloning site of a commercially available vector is operably linked to the promoter comprised by the vector.
- said promoter is a T7 promoter or a Trc promoter. In yet another embodiment, said promoter is T7 promoter.
- Expression plasmids containing a T7 promoter include, but are not limited to pET-9a, pET-17b, pET-11a, pET-24a-d(+), pET-28a-c(+) are available from Invitrogen (Carlsbad,
- Plasmids pET-28a-c(+) comprise, in sequence, a T7 promoter, a ribosome binding site, restriction sites to allow insertion of the structural gene and a T7 terminator sequence.
- the pET-28a(+) vector is utilized to transfect the host bacterial cell.
- Expression plasmids containing a Trc promoter, including but not limited to pTrcHis, can also be used in the practice of this aspect of the invention.
- the invention is a bacterial host-cell transformed with the vector comprising the nucleic acid molecule consisting of a nucleotide sequence selected from the group consisting of a) to f) as described above.
- the bacterial host-cell is an E .coli strain.
- the E. constrains including, but not limited to BL21 , BL21-AI, BL21 (DE3), and the like, can be used in the practice of this invention.
- the E.coli strain is BL21-AI.
- the invention is a method for expression of a FAAH polypeptide comprising transforming E. coli host-cells with a vector comprising a nucleic acid molecule encoding a FAAH polypeptide and inducing expression of said polypeptide wherein said induced expression yields at least 0.13 to 26mg of FAAH polypeptide per 1 liter of cell culture. Methods for determining the yield is readily recognizable by the ordinary skilled artisan, and/or otherwise described in the EXAMPLES set forth herein.
- the expression method of the invention yields 0.13, 0.5, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22,
- the method yields 0.13 to 26 mg of functional and soluble FAAH protein per 1 Liter of cell culture.
- the invention is a method for the expression of a FAAH protein comprising transforming E. coli host-cells and inducing expression of a FAAH protein with a vector comprising an isolated nucleic acid molecule consisting of a nucleotide sequence selected from the group consisting of a) to f) as described above.
- the induction is in the presence of 50, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 220, 240, 260, 280, or
- IPTG means isopropyl thiogalactoside.
- the induction is at a temperature of 25, 26, 27, 28, 29, or 3O 0 C.
- the induction is for 16, 17, 18, 19, 20, 21 , 22, 23, or 24 hours.
- the induction is in the presence of 100 ⁇ M
- the transformed E. coli bacterial cells can be grown in culture media including but not limited to LB or SuperBroth.
- the SuperBroth media contains tryptone, sodium chloride, yeast extract, and a buffering agent.
- the vectors of the invention further comprise kanamycin resistance sequences.
- the transformed E. coli of the present invention is grown in SuperBroth culture media in the presence of kanamycin.
- the concentration of the kanamycin is 30 ⁇ g/ml. It is recognized that the choice of antibiotic resistance sequences comprised by the vector and the corresponding antibiotics can be varied by the ordinarily skilled artisan.
- the invention is a method for producing purified FAAH polypeptide, comprising: a. Expressing a heterologous FAAH polypeptide in a host-cell, and b. Isolating the membrane fraction of said host-cells by at least one ultracentrifugation step in absence of detergent.
- Heterologous FAAH polypeptide means that the polypeptide is not native to the bacterial host-cell transformed with the nucleic acid encoding said polypeptide.
- FAAH polypeptide is encoded by a nucleic acid molecule consisting of a nucleotide sequence selected from the group consisting of a) to f) as described above.
- the host-cell is a bacterial host-cell.
- the invention is a method for producing purified FAAH polypeptide, comprising: a. expressing a heterologous FAAH polypeptide in a host-cell; b. lysing said host-cells in the absence of a detergent; c. centrifuging the lysate of Step (b) at a low speed and retaining supernatant; d. ultracentrifuging said supernatant and retaining pellet; e. re-suspending said pellet in a buffer lacking detergent, f. ultracentrifuging said re-suspension and retaining pellet, g.
- the isolation is done by adding said supernatant onto a cationic metal column to obtain the purified FAAH protein.
- the host-cell is a bacterial host-cell.
- the bacterial host-cell is E.coli.
- the bacterial host-cells can be lysed with a microfluidizer to disrupt the cellular membrane.
- "low speed” means a centrifugation speed that typically produces a pellet comprising cellular debris and organelles, but not the cellular membrane fraction.
- the particular speed selected for such low speed centrifugation may vary and is readily selectable by the ordinarily skilled artisan. In one embodiment of this invention, the low speed centrifugation is at 5000 x g.
- “ultracentrifuging” means centrifugation of the supernatant of the low speed centrifugation step at a speed that typically produces a pellet comprising the cellular membrane fraction.
- the "cellular membrane fraction” as used herein, is intended as the fraction comprising membranes and integral- and associated membrane proteins thereof.
- integral membrane proteins as used herein, is intended to mean proteins comprising at least one transmembrane domain.
- associated membrane proteins as used herein, is intended to mean proteins that lack a transmembrane domain but are otherwise comprised by the above cellular membrane fraction. It is recognized that the FAAH polypeptides encoded by the nucleic acids of the invention are associated membrane proteins.
- the polypeptides lack a transmembrane domain; and nevertheless are contained in the cellular membrane fraction of the ultracentrifugation step.
- ultracentrifuging is at speeds of 50,000 to 100,000 x g.
- the supernatant is centrifuged at 100,000 x g for 1 hour.
- the pellet obtained following ultracentifugation is retained and re-suspended in buffer in absence of detergent, at least one time.
- the ultracentrifugation and re- suspension is repeated one, two, or three times.
- the ultracentrifugation is repeated three times.
- the buffer is 20 mM NaPi, pH 7.8/10O mM NaCI.
- Detergent encompasses ionic, cationic, and non-ionic detergents.
- Non-ionic detergents include, but are not limited to Brij, Igepal, Saponin, Tergitol, Triton CF, Triton
- the non-ionic detergent is Triton X-100.
- isolation of said FAAH polypeptide following ultracentrifugation comprises column chromatography.
- the FAAH polypeptide is fused to a histidine tag, and the column chromatography comprises utilizing a column comprising beads charged with a cation.
- the metal cation has an affinity towards the Histidine His-tag.
- the cation is nickel.
- Cationic metals include but are not limited to nickel or cobalt.
- PTrcHis A-hFAAH (encoding human (h) FAAH amino acids 30-579)
- the following cDNAs were custom-synthesized and subcloned into a pUC119 vector
- hFAAH encoding hFAAH, amino acids 30-105
- the pUC119-hFAAH (encoding hFAAH, amino acids 1 -579) was digested with Xho I - EcoR I and the insert was subcloned into a Xho I - EcoR l-digested pTrcHis A vector (Invitrogen, Cat # V360-20) to generate pTrcHis A-hFAAH (encoding amino acid 1 -579).
- the pTrcHis A-hFAAH vector was digested with Xho I-Hind III, and the resulting Xho I-
- Hind III (approximately 4.5 kb) and Hind Ill-Hind III (approximately 1.5 kb) pieces were ligated with the Xho I-Hind III fragment (225 bp) generated from digesting the pUC119- hFAAH (encoding amino acids 30-105) construct with Xho I-Hind III to generate an NH 2 - terminally His-tagged pTrcHis A-hFAAH (encoding amino acids 30-579).
- pET28a-hFAAH (encoding hFAAH, amino acids 32-579)
- the human FAAH construct for subcloning into the prokaryotic expression vector pET28a(+) was generated by PCR from the pTrcHis A- hFAAH (amino acids 30-579) construct using the following primers: sense primer, 5'- GGAATTCCATATGTCAGGTCGTCGTACCGCACGTG-3' (SEQID NO:8) ; and antisense primer, ⁇ '-CCGCTCGAGTTATGAGGATTGTTT TTCCGGAGTCAT-S' (SEQ ID NO: 9).
- the resulting PCR product was digested with Nde I-Xho I, and subcloned into a Nde I- Xho I -digested pET28a(+) vector to generate an NH 2 -terminally His-tagged pET28a- hFAAH (encoding amino acids 32-579).
- the human FAAH construct for subcloning into the prokaryotic expression vector pET- SUMO (Invitrogen, Catalog #K300-01) was generated by PCR from the pET28a-hFAAH
- pET28a-hFAAH encodes hFAAH, amino acids (32-579): MGSSHHHHHHSSGLVPRGSHM— -hFAAH
- pET-SUMO-hFAAH encodes hFAAH, amino acids (30-579):
- the pET28a-hFAAH construct encoding amino acids corresponding to amino acids 32- 579 of wild-type human FAAH was expressed in E. coli BL21-AI.
- the cultures were grown in SuperBroth media in the presence of 30 ⁇ g/ml kanamycin at 37 0 C and induced at OD 600 of 0.6 - 0.65 with 100 ⁇ M IPTG and 0.2% L-arabinose at RT or 30 0 C. Under the conditions of this EXAMPLE, an optimal expression of human FAAH was obtained after 20 hours of induction at RT.
- the final concentrations of NaPi, pH 7.4, EDTA, Triton X-100, and substrate were 50 mM, 1 mM, 0.075%, and 10 ⁇ M, respectively.
- the reaction was stopped and the products were separated by organic solvent extraction (400 ⁇ l, choloroform: methanol, 1 :1).
- the mixture was vortexed thoroughly and centrifuged for 10 min at 10,000 x g.
- the cells were re-suspended in 100 ml of buffer A (20 mM NaPi, pH 7.8/100 mM NaCI) with stirring. After adding 500 units of benzonase, the cell suspension was stirred for an additional 15 minutes before lysing the cells by passing through the microfluidizer (Microfluidics Corp., Newton, MA) according to manufacturer's instructions. The cell debris was removed by centrifugation at 5000 x g for 20 minutes and the supernatant was centrifuged at 100,000 x g for 1 hour. The resulting pellet was re-suspended in 100 ml buffer A and centrifuged again at 100,000 x g for 1 hour.
- buffer A 20 mM NaPi, pH 7.8/100 mM NaCI
- the pellet was re-suspended in 80 ml of buffer B (20 mM NaPi, pH 7.8/500 mM NaCI/1% Triton X) and centrifuged at 100,000 x g for 1 hour and the resulting supernatant was loaded at 0.5 - 1 ml/min onto a 1 ml Ni column that has been equilibrated with buffer B.
- the column was washed with 20 ml of buffer B at 0.2 ml/min.
- the column was further washed with 10 ml of buffer B containing 20 mM imidazole and then with 10 ml of buffer B containing 50 mM imidazole at 0.2 ml/min.
- pET-SUMO-hFAAH For pET-SUMO-hFAAH, two-liter cultures were prepared using the pET-SUMO hFAAH in the same way as described above for that of pET28a-hFAAH except that the induction was carried out for 16 hours instead of 20 hours.
- SUMO-FAAH was purified using the same procedure as described above for that of pET28a-hFAAH with the following modifications. The elution from a 5 mi Ni column was carried out using a 40 ml gradient (buffer B, 50 - 350 mM imidazole). SDS-PAGE (4-20% gradient) visualized by Coomassie Blue staining revealed a predominant single band corresponding to the expressed SUMO-fused hFAAH as shown in FIGURE 1 (labeled as SUMO-hFAAH).
- nucleotide encoding human FAAH polypeptide operably linked to the pTrcHis A vector promoter yielded 0.13- 0.23 mg FAAH per liter of culture.
- a nucleotide encoding human FAAH polypeptide operably linked to the pET28a vector promoter yielded 2.5-4.5 mg FAAH per liter of culture.
- a nucleotide encoding human FAAH polypeptide operably linked to a SUMO fusion protein and a pET vector promoter yielded 14-26 mg FAAH per liter of culture.
- EXAMPLE 6 Cloning, Expression and Purification of a truncated rat (r) FAAH: pTrcHis A-rFAAH (amino acids 32-579): The rat FAAH cDNA that encodes rFAAH amino acids 32-579 (encoded by residue 7 to end of SEQ ID NO:3) was amplified from the rat brain Quick-clone cDNA library (BD Biosciences Clontech) using the following primers: sense primer, ⁇ '-GCCTCGAGACCGGGCGCCAGAAGG-S' (SEQ ID NO:12); and antisense primer, 5'-GCGAATTCTCACGATGGCTGC TTTTGAGG-3' (SEQ ID NO:13).
- the resulting PCR product was digested with Xho-l-EcoR I, and subcloned into a Xho I- EcoR l-digested pTrcHis A vector to generate an NH 2 -teminally His-tagged pTrcHis A- rFAAH (amino acids 32-579).
- pET28a-rFAAH amino acids 30-579 of rat FAAH is encoded by SEQ ID NO:3: The rat
- FAAH construct for subcloning into the prokaryotic expression vector pET28a(+) was generated by PCR from the pTrcHis A-rFAAH (amino acids 32-579) construct using the following primers: sense primer, 5'- AAAAAAAAAAGCTAGCCGATGGACCGGGCGCCAGAAGGC-S' (SEQ ID NO:14), and antisense primer, ⁇ '-AAAAAAAAAAAACTCGAGTCACGATGG CTGCTTTTGAGGGGTC-3'
- the resulting PCR product was digested with Nhe I-Xho I 1 and subcloned into a Nhe I- Xho l-digested pET28a(+) vector to generate an NH 2 -terminally His-tagged pET28a- rFAAH (amino acids 30-579).
- constructs were made comprising the truncated rFAAH sequences. These constructs were used to express, purify and assay the rFAAH by methods similar to those described above. The results obtained with rFAAH are summarized in Table 2. SDS PAGE (4-20% gradient) visualized by Coomassie Blue staining revealed a predominant single band corresponding to the expressed rFAAH as shown in FIGURE 1 (labeled as rFAAH)
- Sequence Listing Guide SEQ ID NO. 1 Nucleotide sequence encoding amino acids 30 to 579 of wild-type homo sapien FAAH.
- SEQ ID NO. 2 Nucleotide sequence encoding amino acids 30 to 579 of homo sapien FAAH, optimized for expression in E.coli.
- SEQ ID NO. 4 Amino acid sequence of the wild-type homo sapien FAAH.
- SEQ ID NO: 5 Nucleotide sequence encoding full length rat FAAH (amino acids 1-579)
- SEQ ID NO: 6 The DNA sequence of the E. coli codon optimized sequence of hFAAH (amino acids 1-579) with a 5'-Xho I site, 3' stop codon, and 3'-EcoR I site.
- SEQ ID NO:7 The DNA sequence of the E. coli codon optimized sequence of hFAAH (amino acids 30-105) with a 5'-Xho I site and 3'-Hind III site.
- SEQ ID NO: 17 Amino acid sequence expressed contiguously with amino acids 30-579 of hFAAH, as encoded by pTrcHisA-hFAAH
- SEQ ID NO: 18 Amino acid sequence expressed contiguously with amino acids 32-579 of hFAAH as encoded by pET28a-hFAAH.
- SEQ ID NO: 19 Amino acid sequence expressed contiguously with amino acids 30-579 of hFAAH, as encoded by pET-SUMO-hFAAH.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Enzymes And Modification Thereof (AREA)
Abstract
The invention relates to nucleic acid compositions encoding truncated FAAH polypeptides, methods of expressing recombinant FAAH, and methods of purifying recombinant FAAH. The nucleic acid compositions comprise sequences that are optimized for transcription in a prokaryotic host.
Description
COMPOSITIONS AND METHODS FOR EXPRESSION AND PURIFICATION OF FATTY
ACID AMIDE HYDROLASE
FIELD OF THE INVENTION
The invention relates to compositions and methods for enhanced expression and purification of fatty acid amide hydrolase (FAAH).
BACKGROUND OF THE INVENTION
Fatty acid amides represent a growing family of bioactive lipids with diverse cellular and physiological effects (Cravatt, B. F. et al. (1995), Science 268:1506-1509); (Devane, W. A. et al. (1992), Science 258:1946-1949); (Facci, L et al. (1995), Proc. Natl. Acad. Sci. 92:3376-3380). Fatty acid amides are hydrolyzed to their corresponding fatty acids by enzymes known as fatty acid amide hydrolases (FAAH) (Ueda et al. (2000), Chem Phys Lipids 108(1 -2):107-21). FAAH is a mammalian integral membrane serine hydrolase responsible for the hydrolysis of a number of primary and secondary fatty acid amides, including the neuromodulatory compounds anandamide and oleamide. Anandamide (arachidonoyl ethanolamide) has been shown to possess cannabinoid-like analgesic properties and is released by stimulated neurons. The effects and endogenous levels of anandamide increase with pain stimulation, implying its role in suppressing pain neurotransmission and behavioral analgesia. Supporting this, FAAH inhibitors that elevate brain anandamide levels have demonstrated efficacy in animal models of anxiety. A second fatty acid amide, oleamide (9-Z-octadecenamide) has been shown to induce sleep. FAAH is highly expressed in neurons within the central nervous system where the enzyme appears poised to inactivate fatty acid amides at their presumed sites of action. The fatty acid amides are hydrophobic in nature and interact between the enzyme and cell membrane for efficient rates of substrate hydrolysis and product release. FAAH is an integral membrane protein that degrades bioactive fatty acid amides thereby terminating the signaling functions of the fatty acid amides. Defining the nature of FAAH's membrane interactions can provide a greater understanding of how FAAH participates in the regulation of fatty acid amide signaling. Given the role of FAAHs in fatty acid amide metabolism, there is a need for further characterization of this enzyme. However, obtaining sufficient quantities of purified, active enzyme for functional- and high-resolution crystallographic studies has been difficult.
Primary sequence analysis of the mouse, rat, and human FAAH proteins predicts that these enzymes are Type 1 integral membrane proteins with a single transmembrane domain and a large cytoplasmic tail containing the majority of the protein sequence
(Patricelli, et al., Biochemistry, 1998 vol.37, 15177). Rat FAAH was cloned {Nature 1996, 384, 83-7) and expressed in E. coli (Biochemistry 1998, 37, 15177-15187). Human FAAH has also been cloned (US2002/0187542 A1). Human FAAH shares 82% amino acid identity with rat FAAH and the human FAAH expression in E. coli has been minimal at best, due to difficulties in obtaining soluble active human FAAH.
SUMMARY OF THE INVENTION
The present invention encompasses nucleic acid compositions encoding truncated human FAAH polypeptides, methods of expressing recombinant human FAAH in E. coli, and purifying the expressed polypeptide. In particular embodiments of the present invention set forth below, the nucleic acid sequences are optimized for transcription in a prokaryotic host.
In one aspect, the invention is an isolated nucleic acid molecule consisting of a nucleotide sequence selected from the group consisting of: a. A nucleotide sequence set forth in SEQ ID NO:1 ; b. A nucleotide sequence that is 95 to 99% identical to the nucleotide sequence set forth in SEQ ID NO:1 ; c. A nucleotide sequence set forth in SEQ ID NO:2; d. A nucleotide sequence that is at least 70% identical to the nucleotide sequence set forth in SEQ ID NO:2; e. A nucleotide sequence encoding amino acids 30-579 of SEQ ID NO: 4; and f. A nucleotide sequence encoding amino acids 32-579 of SEQ ID NO: 4.
In another aspect, the invention is a vector comprising the isolated nucleic acid described above. In another aspect, the invention is a host cell transformed with the vector described above.
In one embodiment, the invention is a bacterial host-cell transformed with the vector described above.
In another aspect, the invention is a method for expression of a FAAH protein comprising transforming E. coli host-cells with a vector comprising a nucleic acid molecule encoding a FAAH polypeptide and inducing expression of said polypeptide wherein said expression yields at least 0.13 to 50 mg of FAAH polypeptide per 1 liter of cell culture. In one embodiment, said expression yields 0.13 to 26 mg of FAAH polypeptide per 1 liter of cell culture. In another aspect, the invention is a method for the expression of a FAAH protein comprising culturing the host cells described above.
In another aspect, the invention is a method of producing purified FAAH polypeptide, comprising: a. expressing a heterologous FAAH polypeptide in a host-cell, and b. isolating the membrane fraction of said host-cells by at least one ultracentrifugation step in absence of detergent.
In another aspect, the invention is a method for producing purified FAAH polypeptide, comprising: a. expressing a heterologous FAAH polypeptide in a host-cell; b. lysing said host-cells in the absence of a detergent; c. centrifuging the lysate of Step (b) at a low speed and retaining supernatant; d. ultracentrifuging said supernatant and retaining pellet; e. re-suspending said pellet in a buffer lacking detergent, f. ultracentrifuging said re-suspension and retaining pellet, g. solubilizing soluble polypeptides comprised in said pellet of Step (f) by re- suspending said pellet in a buffer comprising non-ionic detergent; h. ultracentrifuging said re-suspension of Step (g) and retaining supernatant, and i. isolating FAAH polypeptide from the supernatant of Step (h).
BRIEF DESCRIPTION OF THE DRAWINGS
FIGURE 1. depicts human FAAH, SUMO-human FAAH and rat FAAH with greater than 98% purity as estimated by Coomassie Blue staining.
DETAILED DESCRIPTION OF THE INVENTION The present invention encompasses nucleic acid molecules comprising sequences that encode truncated human FAAH polypeptides, methods of expressing recombinant human FAAH in a prokaryotic host, and methods of purifying the expressed polypeptide. In particular embodiments of the present invention set forth below, the nucleic acid sequences are optimized for transcription in Escherichia coli (E. coli). The provided nucleic acid compositions comprise those having a deletion of the region corresponding to the nucleotides encoding the transmembrane domain of the FAAH polypeptide. That is, the expression of the nucleic acid compositions of the invention produces a functional FAAH polypeptide that lacks a membrane-spanning domain. In particular embodiments of the present invention, the nucleotide compositions are further optimized for expression in a prokaryotic host. In a particular embodiment, the prokaryotic host is £. coli. In this optimization, the eukaryotic transcriptional codons are
replaced with prokaryotic transcriptional codons. In other embodiments, the nucleic acid molecules of the invention comprise a first nucleotide sequence encoding the truncated FAAH polypeptide as described herein, and a second nucleotide sequence encoding a polypeptide that enhances the expression of the FAAH polypeptide; wherein the first and the second nucleotide sequences are operably linked. Thus, the present invention encompasses a fusion protein that comprises a first truncated FAAH polypeptide and an optional second polypeptide and nucleic acids encoding these fusion proteins. It is envisioned that the second polypeptide enhances the proper folding of the truncated FAAH. In one embodiment, the second polypeptide is SUMO (small ubiquitin-related modifier). For example, see Malakov et al. (2004) 5(1-2): 75-86. In another embodiment, the nucleic acid molecules of the invention further comprise a third nucleotide sequence that encodes a polypeptide that facilitates purification of the expressed protein comprising said tag. In one embodiment, the tag is a histidine (His) tag. In such embodiments that are in the context of nucleotide sequence encoding polypeptides, "operably linked" means that the expression of the nucleic acid molecule comprising the first, second and/or third nucleotide sequences in a host-cell capable of expressing said nucleotide sequences produces a fusion protein that comprises the polypeptides encoded by the first, second and/or third nucleotide sequence. It is recognized that proteolytic cleavage sites can readily be engineered in order to optionally cleave the polypeptide encoded by the second and/or third nucleotide sequence from the FAAH polypeptide encoded by the first nucleotide sequence. It is also recognized that the first and/or second nucleotide sequence can be operably linked to the 5' or the 3' end. It is further recognized that each linkage can be optionally contiguous with the third nucleotide sequence.
Methods of enhanced FAAH polypeptide expression and purification are also provided as further described below. The methods are applicable to mammalian FAAH including those set forth herein.
The compositions and methods of the invention are useful for producing functional recombinant FAAH polypeptides. The compositions and methods of the invention are useful for producing the polypeptides in quantities that can be needed for high resolution crystallography; for screening for molecules that modulate FAAH activity, including high through-put screening of peptide- and small molecule libraries; and for facilitating structure-based FAAH inhibitor design for the treatment of disorders including anxiety and insomnia.
In one aspect, the invention is an isolated nucleic acid molecule consisting of a nucleotide sequence selected from the group consisting of: a. A nucleotide sequence set forth in SEQ ID NO:1 ; b. A nucleotide sequence that is 95 to 99% identical to the nucleotide sequence set forth in SEQ ID NO:1 ; c. A nucleotide sequence set forth in SEQ ID NO:2;
d. A nucleotide sequence that is at least 70% identical to the nucleotide sequence set forth in SEQ ID NO:2; e. A nucleotide sequence encoding amino acids 30-579 of SEQ ID NO: 4; and f. A nucleotide sequence encoding amino acids 32-579 of SEQ ID NO: 4.
The nucleotide set forth in SEQ ID NO.1 encodes a truncated form of the human FAAH. That is, the transmembrane domain, amino acids 1-29 of wildtype human FAAH, are deleted and amino acids 30-579 corresponding to the cytosolic domain of human FAAH, are retained. The nucleotide sequence set forth in SEQ ID NO.2 encodes a truncated form of the FAAH polypeptide wherein the transmembrane domain, amino acids
1-29, are similarly deleted and amino acids 30-579 are retained. Furthermore, the nucleotide sequence in SEQ ID NO 2 is optimized for expression in a prokaryotic host-cell with regard to codon usage. The nucleotide sequence set forth in SEQ ID NO 2 is at least 70% identical to the sequence set forth in SEQ ID NO.1. The nucleic acid molecules of the present invention encode a functional and soluble FAAH polypeptide, in that the encoded polypeptides lack a transmembrane spanning domain and catalyze a hydrolytic conversion between soporific fatty acid primary amides and their corresponding fatty acids. This catalysis is a function of wildtype FAAH and can be tested by methods known in the art (Kathuria, S. et.al. (2003), Nature Medicine 9:76-81 ); (Patricelli, M. et.al. (1998), Biochemistry 37:15177-15187); or otherwise described in the EXAMPLES described herein.
In one embodiment, the invention is a vector comprising a nucleic acid molecule consisting of a nucleotide sequence selected from the group consisting of the nucleotide sequence of the present invention described in a) to f) as described above.
In another embodiment, the vector comprises a nucleic acid molecule encoding a histidine tag. It is recognized that the sequence encoding the histidine tag can optionally and operably be linked to the 5' or to the 3' end of the sequences encoding FAAH set forth herein. It is further recognized that a proteolytic cleavage site can be optionally and operably contained between the nucleotides encoding the histidine tag and those encoding FAAH.
In another embodiment, the invention is a vector comprising a nucleic acid molecule consisting of a nucleotide sequence selected from the group consisting of the nucleotide sequence of the present invention described in a) to f) above, and further comprising a nucleic acid molecule encoding a SUMO polypeptide sequence. The SUMO-encoding nucleotide can be optionally ligated to the 5' end of the sequence encoding FAAH. For purposes of the present invention, "SUMO" means a small ubiquitin-
related modifier polypeptide. Attachment of a SUMO polypeptide to the N-terminus of under-expressed proteins enhances protein expression in E.coli. Nucleotides encoding SUMO and methods for operably linking them to desired coding sequence are available; for example, from Invitrogen (Carlsbad, CA).
In another embodiment of this aspect of the invention, the vector further comprises a promoter sequence operably linked to said nucleic acid molecule. In this and other embodiments of this aspect of the invention, in the context of operable linkage of a promoter and a polypeptide-encoding nucleotide sequences, "operably linked" means that the promoter is linked to the polypeptide-encoding nucleotide sequence such that a suitable polymerase that binds the promoter transcribes the polypeptide-encoding nucleotide sequence. Methods for such operable linkage are readily recognized by the ordinarily skilled artisan. Typically, a coding sequence ligated in the correct orientation in a multiple cloning site of a commercially available vector, is operably linked to the promoter comprised by the vector.
In another embodiment of this aspect of the invention, said promoter is a T7 promoter or a Trc promoter. In yet another embodiment, said promoter is T7 promoter. Expression plasmids containing a T7 promoter include, but are not limited to pET-9a, pET-17b, pET-11a, pET-24a-d(+), pET-28a-c(+) are available from Invitrogen (Carlsbad,
CA 92008) can be used in the practice of this invention. Plasmids pET-28a-c(+) comprise, in sequence, a T7 promoter, a ribosome binding site, restriction sites to allow insertion of the structural gene and a T7 terminator sequence. In a particular embodiment, the pET-28a(+) vector is utilized to transfect the host bacterial cell. Expression plasmids containing a Trc promoter, including but not limited to pTrcHis, can also be used in the practice of this aspect of the invention.
In one aspect, the invention is a bacterial host-cell transformed with the vector comprising the nucleic acid molecule consisting of a nucleotide sequence selected from the group consisting of a) to f) as described above.
In one embodiment, the bacterial host-cell is an E .coli strain. The E. constrains including, but not limited to BL21 , BL21-AI, BL21 (DE3), and the like, can be used in the practice of this invention. In another embodiment, the E.coli strain is BL21-AI.
In one aspect, the invention is a method for expression of a FAAH polypeptide comprising transforming E. coli host-cells with a vector comprising a nucleic acid molecule encoding a FAAH polypeptide and inducing expression of said polypeptide wherein said induced expression yields at least 0.13 to 26mg of FAAH polypeptide per 1
liter of cell culture. Methods for determining the yield is readily recognizable by the ordinary skilled artisan, and/or otherwise described in the EXAMPLES set forth herein.
In one embodiment of this invention, the expression method of the invention yields 0.13, 0.5, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22,
23, 24, 25 or 26 mg of functional FAAH protein per 1 liter of cell culture. In another embodiment, the method yields 0.13 to 26 mg of functional and soluble FAAH protein per 1 Liter of cell culture.
In one aspect, the invention is a method for the expression of a FAAH protein comprising transforming E. coli host-cells and inducing expression of a FAAH protein with a vector comprising an isolated nucleic acid molecule consisting of a nucleotide sequence selected from the group consisting of a) to f) as described above. In one embodiment of the present invention, the induction is in the presence of 50, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 220, 240, 260, 280, or
300 μM IPTG. In one embodiment, the induction is further in the presence of L- arabinose. For the purposes of the present invention, "IPTG" means isopropyl thiogalactoside. In another embodiment, the induction is at a temperature of 25, 26, 27, 28, 29, or 3O0C. In another embodiment, the induction is for 16, 17, 18, 19, 20, 21 , 22, 23, or 24 hours. In a particular embodiment, the induction is in the presence of 100 μM
IPTG and 0.2% L-Arabinose at 25°C for 16 hours.
The transformed E. coli bacterial cells can be grown in culture media including but not limited to LB or SuperBroth. The SuperBroth media contains tryptone, sodium chloride, yeast extract, and a buffering agent. In a particular embodiment, the vectors of the invention further comprise kanamycin resistance sequences. Accordingly, in one embodiment, the transformed E. coli of the present invention is grown in SuperBroth culture media in the presence of kanamycin. In another embodiment, the concentration of the kanamycin is 30 μg/ml. It is recognized that the choice of antibiotic resistance sequences comprised by the vector and the corresponding antibiotics can be varied by the ordinarily skilled artisan.
In one aspect, the invention is a method for producing purified FAAH polypeptide, comprising: a. Expressing a heterologous FAAH polypeptide in a host-cell, and b. Isolating the membrane fraction of said host-cells by at least one ultracentrifugation step in absence of detergent.
"Heterologous FAAH polypeptide" means that the polypeptide is not native to the bacterial host-cell transformed with the nucleic acid encoding said polypeptide.
In one embodiment of this aspect of the invention, FAAH polypeptide is encoded by a nucleic acid molecule consisting of a nucleotide sequence selected from the group consisting of a) to f) as described above. In another embodiment, the host-cell is a bacterial host-cell.
In one aspect, the invention is a method for producing purified FAAH polypeptide, comprising: a. expressing a heterologous FAAH polypeptide in a host-cell; b. lysing said host-cells in the absence of a detergent; c. centrifuging the lysate of Step (b) at a low speed and retaining supernatant; d. ultracentrifuging said supernatant and retaining pellet; e. re-suspending said pellet in a buffer lacking detergent, f. ultracentrifuging said re-suspension and retaining pellet, g. solubilizing soluble polypeptides comprised in said pellet of Step (f) by re- suspending said pellet in a buffer comprising non-ionic detergent; h. ultracentrifuging said re-suspension of Step (g) and retaining supernatant, and i. isolating FAAH polypeptide from the supernatant of Step (h).
In one embodiment, the isolation is done by adding said supernatant onto a cationic metal column to obtain the purified FAAH protein.
In one embodiment of this invention, the host-cell is a bacterial host-cell. In a particular embodiment of this invention, the bacterial host-cell is E.coli.
The bacterial host-cells can be lysed with a microfluidizer to disrupt the cellular membrane. In this aspect of the invention, "low speed" means a centrifugation speed that typically produces a pellet comprising cellular debris and organelles, but not the cellular membrane fraction. The particular speed selected for such low speed centrifugation may vary and is readily selectable by the ordinarily skilled artisan. In one embodiment of this invention, the low speed centrifugation is at 5000 x g.
In this aspect of the invention, "ultracentrifuging" means centrifugation of the supernatant of the low speed centrifugation step at a speed that typically produces a pellet comprising the cellular membrane fraction. The "cellular membrane fraction" as used herein, is intended as the fraction comprising membranes and integral- and associated membrane proteins thereof. By "integral membrane proteins" as used herein, is intended to mean proteins comprising at least one transmembrane domain. By "associated membrane proteins", as used herein, is intended to mean proteins that lack a transmembrane domain but are otherwise comprised by the above cellular membrane fraction. It is recognized that the FAAH polypeptides encoded by the nucleic acids of the
invention are associated membrane proteins. That is, the polypeptides lack a transmembrane domain; and nevertheless are contained in the cellular membrane fraction of the ultracentrifugation step. In one embodiment of this invention, ultracentrifuging is at speeds of 50,000 to 100,000 x g. In another embodiment, the supernatant is centrifuged at 100,000 x g for 1 hour.
In another embodiment of this invention, the pellet obtained following ultracentifugation is retained and re-suspended in buffer in absence of detergent, at least one time. In a particular embodiment of this invention, the ultracentrifugation and re- suspension is repeated one, two, or three times. In another embodiment, the ultracentrifugation is repeated three times. In another embodiment, the buffer is 20 mM NaPi, pH 7.8/10O mM NaCI.
Detergent encompasses ionic, cationic, and non-ionic detergents. Non-ionic detergents include, but are not limited to Brij, Igepal, Saponin, Tergitol, Triton CF, Triton
X-100, Tween, and Tyloxapal. Detergent is added to the re-suspended pellet to release the membrane bound protein fractions. In one embodiment, the non-ionic detergent is Triton X-100.
In one embodiment of this invention, isolation of said FAAH polypeptide following ultracentrifugation comprises column chromatography. In a further embodiment, the FAAH polypeptide is fused to a histidine tag, and the column chromatography comprises utilizing a column comprising beads charged with a cation. The metal cation has an affinity towards the Histidine His-tag. Thus, the His-tagged human FAAH polypeptide is separated from the nascent bacterial membrane proteins and is retained on the metal cation column. Following this isolation, the tagged protein is readily eluted from the column.
In another embodiment of this aspect of the invention, the cation is nickel. Cationic metals include but are not limited to nickel or cobalt.
The present invention is described in further detail in the following non-limiting EXAMPLES.
EXAMPLES
EXAMPLE 1. Cloning and Construction of hFAAH plasmids
Known molecular biological techniques are utilized to carry out the cloning and construction of constructs described herein. Such techniques are referred to, for example, in Davis et al., Basic Methods in Molecular Biology, Elsevir Sciences Publishing, Inc., New York, NY.1986; Hames et al., Nucleic Acid Hybridization, IL Press, 1985; Molecular Cloning, Sambrook et al., Current Protocols in Molecular Biology, Eds. Ausubel et al., John Wiley and Sons; Current Protocols in Human Genetics, Eds. Dracopoli et al., John Wiley and Sons; Current Protocols in Protein Science, Eds. John E. Coligan et al.,
John Wiley and Sons; and Current Protocols in Immunology, Eds. John E. Coligan et al., John Wiley and Sons).
PTrcHis A-hFAAH (encoding human (h) FAAH amino acids 30-579) The following cDNAs were custom-synthesized and subcloned into a pUC119 vector
(Blue Heron Biotechnology (Bothell, WA)). The E. coli codon optimization was carried out by using an optimization algorithm (Blue Heron Biotechnology (Bothell, WA)).
- pUC119-hFAAH (encoding hFAAH, amino acids 1-579): A cDNA containing the E. coli codon optimized DNA sequence of hFAAH (encoding amino acids 1-579) with a
5'-Xho I site, 3' stop codon , and 3'-EcoR I site. (SEQ ID NO: 6).
- pUC119-hFAAH (encoding hFAAH, amino acids 30-105): A cDNA containing the E. coli codon optimized DNA sequence of hFAAH (amino acids 30-105) with a 5'-Xho I site and 3'- Hind III site (SEQ ID NO: 7).
The pUC119-hFAAH (encoding hFAAH, amino acids 1 -579) was digested with Xho I - EcoR I and the insert was subcloned into a Xho I - EcoR l-digested pTrcHis A vector (Invitrogen, Cat # V360-20) to generate pTrcHis A-hFAAH (encoding amino acid 1 -579). The pTrcHis A-hFAAH vector was digested with Xho I-Hind III, and the resulting Xho I-
Hind III (approximately 4.5 kb) and Hind Ill-Hind III (approximately 1.5 kb) pieces were ligated with the Xho I-Hind III fragment (225 bp) generated from digesting the pUC119- hFAAH (encoding amino acids 30-105) construct with Xho I-Hind III to generate an NH2- terminally His-tagged pTrcHis A-hFAAH (encoding amino acids 30-579).
pET28a-hFAAH (encoding hFAAH, amino acids 32-579)
The human FAAH construct for subcloning into the prokaryotic expression vector pET28a(+) (Novagen, Catalog # 69864-3) was generated by PCR from the pTrcHis A-
hFAAH (amino acids 30-579) construct using the following primers: sense primer, 5'- GGAATTCCATATGTCAGGTCGTCGTACCGCACGTG-3' (SEQID NO:8) ; and antisense primer, δ'-CCGCTCGAGTTATGAGGATTGTTT TTCCGGAGTCAT-S' (SEQ ID NO: 9). The resulting PCR product was digested with Nde I-Xho I, and subcloned into a Nde I- Xho I -digested pET28a(+) vector to generate an NH2-terminally His-tagged pET28a- hFAAH (encoding amino acids 32-579).
pET-SUMO-hFAAH (encoding hFAAH, amino acids 30-579)
The human FAAH construct for subcloning into the prokaryotic expression vector pET- SUMO (Invitrogen, Catalog #K300-01) was generated by PCR from the pET28a-hFAAH
(amino acids 32-579) construct using the following primers: sense primer, 5'- CGTTGGTCAGGTCGTCGTACCGCACG-3' (SEQID NO:10); and antisense primer, 5'- TTATGAGGATTGTmTCCGGAGTC-3' (SEQID NO:11). The resulting PCR product was subcloned into a pET-SUMO vector by TA cloning according to the manufacturer's instructions to generate an NH2-terminally His- and SUMO-tagged pET-SUMO-hFAAH
(encoding human amino acids 30-579).
Summary of Human FAAH Constructs: pTrcHis A-hFAAH encodes hFAAH, amino acids (30-579): MGGSHHHHHHGMASMTGGQQMGRTLYDDDDKDRWGSELE — hFAAH
pET28a-hFAAH encodes hFAAH, amino acids (32-579): MGSSHHHHHHSSGLVPRGSHM— -hFAAH
pET-SUMO-hFAAH encodes hFAAH, amino acids (30-579):
MGSSHHHHHHGSGLVPRRGSASMSDSEVNQEAKPEVKPEVKPETHI NLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDME DNDIIEAHREQIGG — hFAAH
"----" Does not represent amino acid positions. Each indicated hFAAH position is contiguous with the specifically indicated leading amino acid sequence comprising
HHHHHH.
EXAMPLE 2. Expression of Truncated hFAAH "RT" describes room temperature which is typically 25°C ± 3°.
The pET28a-hFAAH construct encoding amino acids corresponding to amino acids 32- 579 of wild-type human FAAH was expressed in E. coli BL21-AI. The cultures were grown in SuperBroth media in the presence of 30 μg/ml kanamycin at 37 0C and induced at OD600 of 0.6 - 0.65 with 100 μM IPTG and 0.2% L-arabinose at RT or 30 0C. Under the
conditions of this EXAMPLE, an optimal expression of human FAAH was obtained after 20 hours of induction at RT.
EXAMPLE 3. Expression of the Truncated hFAAH utilizing SUMO Construct The pET-SUMO-hFAAH construct encoding amino acids corresponding to amino acids
30-579 of wildtype human FAAH was expressed in E. coli BL21 -Al. The cultures were grown in SuperBroth media in the presence of 30 μg/ml kanamycin at 37 0C and induced at OD600 of 0.6 - 0.65 with 100 μM IPTG and 0.2% L-arabinose at RT. Under conditions of this EXAMPLE, an optimal expression was obtained at 16 hours.
For producing time courses, 10 ml cultures were taken out at desired time points and pelleted at 5000 x g. The cells were washed by re-suspending in 10 ml PBS and collected by centrifugation at 5000 x g. The cells were re-suspended in 0.5 ml buffer A (20 mM NaPi, pH 7.8/100 mM NaCI) containing 1% Triton X-100, and lysozyme was added to a final concentration of 1 mg/ml. After incubation on ice for 30 minutes, the lysate was sonicated with 10 second pulses and centrifuged at 10,000 x g for 30 minutes. The resulting supernatant was used for analyzing the FAAH expression by the FAAH activity assay set forth below or by Western blot.
FAAH Activity Assay
The FAAH assay was carried out as previously described (Omeir, R. et al. (1995) Life
Sciences 56: 1999-2005) with several modifications. The typical reactions were carried out in polypropylene tubes in a total volume of 200 μl. To a reaction mixture (165 μl) containing NaPi, pH 7.4 and EDTA, was added 15 μl of [3H]anandamide (40,000 cpm) dissolved in 67% ethanol. For the initiation of the enzyme reaction, a solution of 20 μl of FAAH diluted in a buffer containing 20 mM NaPi, pH 7.4 /1 mM EDTA/0.5% Triton X-100 was added. The final concentrations of NaPi, pH 7.4, EDTA, Triton X-100, and substrate were 50 mM, 1 mM, 0.075%, and 10 μM, respectively. After incubation at 37 0C for 1 hour, the reaction was stopped and the products were separated by organic solvent extraction (400 μl, choloroform: methanol, 1 :1). The mixture was vortexed thoroughly and centrifuged for 10 min at 10,000 x g. The aqueous layer (200 μl) containing
[3H]ethanolamine was quantitated by the scintillation counter.
EXAMPLE 4. Purification of hFAAH
Human FAAH plasmid, pET28a-hFAAH, was transformed into the E. co// BL21-AI strain. Two-liter cultures of the freshly transformed expressing strains were grown in
SuperBroth media in the presence of 30 μg/ml kanamycin at 37 0C. At OD600 of
approximately 0.12, the cultures were transferred to RT and induced at OD600 of 0.6 - 0.65 with 100 μM IPTG and 0.2% L-arabinose for 20 hours at RT. All operations below were at 4 °C unless otherwise noted. The cells were then harvested by centrifugation at 5000 x g and the cell pellets were washed by re-suspending in 700 ml of PBS and collected by centrifugation at 5000 x g. At this point, the cell paste is optionally frozen and stored at - 80 0C until needed. The cells were re-suspended in 100 ml of buffer A (20 mM NaPi, pH 7.8/100 mM NaCI) with stirring. After adding 500 units of benzonase, the cell suspension was stirred for an additional 15 minutes before lysing the cells by passing through the microfluidizer (Microfluidics Corp., Newton, MA) according to manufacturer's instructions. The cell debris was removed by centrifugation at 5000 x g for 20 minutes and the supernatant was centrifuged at 100,000 x g for 1 hour. The resulting pellet was re-suspended in 100 ml buffer A and centrifuged again at 100,000 x g for 1 hour. After repeating the last step two more times, the pellet was re-suspended in 80 ml of buffer B (20 mM NaPi, pH 7.8/500 mM NaCI/1% Triton X) and centrifuged at 100,000 x g for 1 hour and the resulting supernatant was loaded at 0.5 - 1 ml/min onto a 1 ml Ni column that has been equilibrated with buffer B. The column was washed with 20 ml of buffer B at 0.2 ml/min. The column was further washed with 10 ml of buffer B containing 20 mM imidazole and then with 10 ml of buffer B containing 50 mM imidazole at 0.2 ml/min. Elution was achieved with a 20 ml gradient (buffer B, 50 - 200 mM imidazole) at 0.2 ml/min. Fractions of 1 ml were collected. Peak fractions were dialyzed immediately against buffer C (20 mM NaPi, pH 7.8/500 mM NaCI) overnight. SDS-PAGE (4-20% gradient) visualized by Coomassie Blue staining revealed a predominant single band corresponding to the expressed hFAAH as shown in FIGURE 1 (labeled as hFAAH).
EXAMPLE 5 - Purification of SUMO-hFAAH
For pET-SUMO-hFAAH, two-liter cultures were prepared using the pET-SUMO hFAAH in the same way as described above for that of pET28a-hFAAH except that the induction was carried out for 16 hours instead of 20 hours. SUMO-FAAH was purified using the same procedure as described above for that of pET28a-hFAAH with the following modifications. The elution from a 5 mi Ni column was carried out using a 40 ml gradient (buffer B, 50 - 350 mM imidazole). SDS-PAGE (4-20% gradient) visualized by Coomassie Blue staining revealed a predominant single band corresponding to the expressed SUMO-fused hFAAH as shown in FIGURE 1 (labeled as SUMO-hFAAH).
Under the conditions described in the above methods, nucleotide encoding human FAAH polypeptide operably linked to the pTrcHis A vector promoter yielded 0.13- 0.23 mg FAAH per liter of culture. A nucleotide encoding human FAAH polypeptide operably linked to the pET28a vector promoter yielded 2.5-4.5 mg FAAH per liter of culture. A nucleotide encoding human FAAH polypeptide operably linked to a SUMO fusion protein and a pET vector promoter yielded 14-26 mg FAAH per liter of culture.
EXAMPLE 6 - Cloning, Expression and Purification of a truncated rat (r) FAAH: pTrcHis A-rFAAH (amino acids 32-579): The rat FAAH cDNA that encodes rFAAH amino acids 32-579 (encoded by residue 7 to end of SEQ ID NO:3) was amplified from the rat brain Quick-clone cDNA library (BD Biosciences Clontech) using the following primers: sense primer, δ'-GCCTCGAGACCGGGCGCCAGAAGG-S' (SEQ ID NO:12); and antisense primer, 5'-GCGAATTCTCACGATGGCTGC TTTTGAGG-3' (SEQ ID NO:13).
The resulting PCR product was digested with Xho-l-EcoR I, and subcloned into a Xho I- EcoR l-digested pTrcHis A vector to generate an NH2-teminally His-tagged pTrcHis A- rFAAH (amino acids 32-579).
pET28a-rFAAH (amino acids 30-579 of rat FAAH is encoded by SEQ ID NO:3): The rat
FAAH construct for subcloning into the prokaryotic expression vector pET28a(+) was generated by PCR from the pTrcHis A-rFAAH (amino acids 32-579) construct using the following primers: sense primer, 5'- AAAAAAAAAAGCTAGCCGATGGACCGGGCGCCAGAAGGC-S' (SEQ ID NO:14), and antisense primer, δ'-AAAAAAAAAACTCGAGTCACGATGG CTGCTTTTGAGGGGTC-3'
(SEQ ID NO-.15).
The resulting PCR product was digested with Nhe I-Xho I1 and subcloned into a Nhe I- Xho l-digested pET28a(+) vector to generate an NH2-terminally His-tagged pET28a- rFAAH (amino acids 30-579).
Using the methods described above, constructs were made comprising the truncated rFAAH sequences. These constructs were used to express, purify and assay the rFAAH by methods similar to those described above. The results obtained with rFAAH are summarized in Table 2. SDS PAGE (4-20% gradient) visualized by Coomassie Blue staining revealed a predominant single band corresponding to the expressed rFAAH as shown in FIGURE 1 (labeled as rFAAH)
Table 2: Optimization of rFAAH Expression
* Based on purification with a yield of 60%, 28 mg corresponds to 47 mg expressed per liter of culture (28mg x 100/60).
All publications mentioned hereinabove are hereby incorporated in their entirety by reference.
Sequence Listing Guide: SEQ ID NO. 1 Nucleotide sequence encoding amino acids 30 to 579 of wild-type homo sapien FAAH.
SEQ ID NO. 2 Nucleotide sequence encoding amino acids 30 to 579 of homo sapien FAAH, optimized for expression in E.coli.
SEQ ID NO. 3 Nucleotide sequence encoding amino acids 30-579 of full length rat FAAH
SEQ ID NO. 4 Amino acid sequence of the wild-type homo sapien FAAH.
SEQ ID NO: 5 Nucleotide sequence encoding full length rat FAAH (amino acids 1-579)
SEQ ID NO: 6 The DNA sequence of the E. coli codon optimized sequence of hFAAH (amino acids 1-579) with a 5'-Xho I site, 3' stop codon, and 3'-EcoR I site.
SEQ ID NO:7 The DNA sequence of the E. coli codon optimized sequence of hFAAH (amino acids 30-105) with a 5'-Xho I site and 3'-Hind III site.
SEQ ID NO: 8-15 primers
SEQ ID NO: 16 Nucleotide sequence encoding wild-type homosapien FAAH
SEQ ID NO: 17 - Amino acid sequence expressed contiguously with amino acids 30-579 of hFAAH, as encoded by pTrcHisA-hFAAH
SEQ ID NO: 18 - Amino acid sequence expressed contiguously with amino acids 32-579 of hFAAH as encoded by pET28a-hFAAH.
SEQ ID NO: 19 - Amino acid sequence expressed contiguously with amino acids 30-579 of hFAAH, as encoded by pET-SUMO-hFAAH.
Claims
1. An isolated nucleic acid molecule consisting of a nucleotide sequence selected from the group consisting of: a. A nucleotide sequence set forth in SEQ ID NO:1 ; b. A nucleotide sequence that is 95 to 99% identical to a nucleotide sequence set forth in SEQ ID NO:1 ; c. A nucleotide sequence set forth in SEQ ID NO:2; d. A nucleotide sequence that is at least 70% identical to a nucleotide sequence set forth in SEQ ID NO:2; e. A nucleotide sequence encoding amino acids 30-579 of SEQ ID NO: 4; and f. A nucleotide sequence encoding amino acids 32-579 of SEQ ID NO: 4.
2. A vector comprising the nucleic acid molecule of Claim 1.
3. An isolated polypeptide encoded by the nucleic acid molecule of claim 1.
4. A vector comprising the nucleic acid molecule of Claim 1 , and further comprising a nucleic acid molecule encoding a SUMO polypeptide sequence.
5. A vector comprising the nucleic acid molecule of Claim 1 , and further comprising a promoter sequence operably linked to said nucleic acid molecule wherein said promoter is a T7 promoter.
6. A bacterial host-cell transformed with the vector according to claim 2.
7. A method for expression of a FAAH protein comprising transforming bacterial host-celis with a vector comprising a nucleic acid molecule encoding a FAAH polypeptide and inducing expression of said polypeptide wherein said induced expression yields at least 0.13 to 50 mg of FAAH polypeptide per 1 liter of cell culture.
8. The method of Claim 7, wherein said polypeptide is human FAAH and said induced expression yields at least 0.13 to 26 mg of active and soluble FAAH per
1 liter of cell culture.
9. The method of Claim 7, wherein said induction is in the presence of 50 to 300 μM of IPTG and in the presence of L-arabinose.
10. The method of Claim 7, wherein said polypeptide is rat FAAH and said induced expression yields at least 10-50 mg of active and soluble FAAH per 1 liter of cell culture.
11. A method for the expression of a FAAH protein comprising culturing the host cell of claim 6.
12. A method of producing purified FAAH polypeptide, comprising: a. Expressing a heterologous FAAH polypeptide in a host-cell, and b. Isolating the membrane fraction of said host-cells by at least one ultracentrifugation step in absence of detergent.
13. The method of Claim 12, wherein said FAAH polypeptide is encoded by a nucleic acid molecule according to claim 1.
14. A method for producing purified FAAH polypeptide, comprising: a. expressing a heterologous FAAH polypeptide in a host-cell; b. lysing said host-cells in the absence of a detergent; c. centrifuging the lysate of Step (b) at a low speed and retaining supernatant; d. ultracentrifuging said supernatant and retaining pellet; e. re-suspending said pellet in a buffer lacking detergent, f. ultracentrifuging said re-suspension and retaining pellet, g. solubilizing soluble polypeptides comprised in said pellet of Step (f) by re- suspending said pellet in a buffer comprising non-ionic detergent; h. ultracentrifuging said re-suspension of Step (g) and retaining supernatant, and i. isolating FAAH polypeptide from the supernatant of Step (h).
15. The method of Claim 14 wherein said FAAH polypeptide is fused to a histidine tag, and wherein said isolation of step i comprises column chromatography utilizing a column comprising beads charged with a cation.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US63872704P | 2004-12-22 | 2004-12-22 | |
| PCT/IB2005/003930 WO2006067613A1 (en) | 2004-12-22 | 2005-12-14 | Compositions and methods for expression and purification of fatty acid amide hydrolase |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP1831364A1 true EP1831364A1 (en) | 2007-09-12 |
Family
ID=36121340
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP05818553A Withdrawn EP1831364A1 (en) | 2004-12-22 | 2005-12-14 | Compositions and methods for expression and purification of fatty acid amide hydrolase |
Country Status (4)
| Country | Link |
|---|---|
| EP (1) | EP1831364A1 (en) |
| JP (1) | JP2008529481A (en) |
| CA (1) | CA2592138A1 (en) |
| WO (1) | WO2006067613A1 (en) |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6271015B1 (en) * | 1995-06-12 | 2001-08-07 | The Scripps Research Institute | Fatty-acid amide hydrolase |
| WO2004037371A2 (en) * | 2002-10-21 | 2004-05-06 | Janssen Pharmaceutica N.V. | Assay for determining the activity of fatty acid amide hydrolase |
-
2005
- 2005-12-14 WO PCT/IB2005/003930 patent/WO2006067613A1/en not_active Ceased
- 2005-12-14 JP JP2007547702A patent/JP2008529481A/en not_active Withdrawn
- 2005-12-14 CA CA002592138A patent/CA2592138A1/en not_active Abandoned
- 2005-12-14 EP EP05818553A patent/EP1831364A1/en not_active Withdrawn
Non-Patent Citations (1)
| Title |
|---|
| See references of WO2006067613A1 * |
Also Published As
| Publication number | Publication date |
|---|---|
| CA2592138A1 (en) | 2006-06-29 |
| WO2006067613A1 (en) | 2006-06-29 |
| JP2008529481A (en) | 2008-08-07 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CA2605140C (en) | Production of recombinant proteins by autoproteolytic cleavage of a fusion protein | |
| CN110139930A (en) | Mutant nitrile hydratase, nucleic acid encoding the mutant nitrile hydratase, expression vector and transformant containing the nucleic acid, method for producing the mutant nitrile hydratase, and method for producing an amide compound | |
| EP0941338B1 (en) | Methods for preparing nucleotide integrases | |
| JP5516664B2 (en) | N-acetyl- (R, S) -β-amino acid acylase gene | |
| JP5919192B2 (en) | Preparation of β-amino acids | |
| EP1292697B1 (en) | Method for preparing a physiologically active il-18 polypeptide | |
| KR20210044241A (en) | Epimerase enzyme and uses thereof | |
| EP1831364A1 (en) | Compositions and methods for expression and purification of fatty acid amide hydrolase | |
| US20150291683A1 (en) | Modified apol1 polypeptides | |
| US7109015B2 (en) | Removal of N-terminal methionine from proteins by engineered methionine aminopeptidase | |
| KR20090007699A (en) | Novel β-galactoside-α2,6-sialic acid transferase, genes encoding the same and methods for producing the same | |
| CA3072620A1 (en) | Compositions and methods using methanotrophic s-layer proteins for expression of heterologous proteins | |
| JP5119783B2 (en) | N-acetyl- (R, S) -β-amino acid acylase gene | |
| WO1998054353A1 (en) | Methods of making an rnp particle having nucleotide integrase activity | |
| Na et al. | Expression and purification of ubiquitin-specific protease (UBP1) of Saccharomyces cerevisiae in recombinant Escherichia coli | |
| EP4202044A2 (en) | Polypeptide having cephalosporin c acylase activity and use thereof | |
| WO2013066264A1 (en) | Enzymatic synthesis of cyclic and linear diadenosine monophosphate | |
| JP5008067B2 (en) | Novel isoprimebellose-producing oligoxyloglucan hydrolase, gene encoding the same, and method for producing the enzyme | |
| EP3676370B1 (en) | Compositions and methods using methanotrophic s-layer proteins for expression of heterologous proteins | |
| KR101423713B1 (en) | Vector for Mass Producing of Recombinant Protein Using Barley Ribosome-inactivating Protein and Method for Mass Producing of Protein Using the Same | |
| JP4686090B2 (en) | Mannose isomerase gene | |
| JP2003274952A (en) | Novel xyloglucan oligosaccharide-degrading enzyme, gene encoding the same, and method for producing the enzyme | |
| JP2004024189A (en) | Dna encoding heat-resistant keratanase | |
| Unzueta et al. | Giulia Accardi, Rosa Mendoza, Verónica Toledo-Rubio, Maria Giuliani, Filomena Sannino, et al. | |
| EP1694834A1 (en) | Modified carbohydrate processing enzyme |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20070723 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LI LT LU LV MC NL PL PT RO SE SI SK TR |
|
| 17Q | First examination report despatched |
Effective date: 20071026 |
|
| DAX | Request for extension of the european patent (deleted) | ||
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20091029 |