EP1802326A2 - Methods for treating bone tumors using bone morphogenic proteins - Google Patents
Methods for treating bone tumors using bone morphogenic proteinsInfo
- Publication number
- EP1802326A2 EP1802326A2 EP05796502A EP05796502A EP1802326A2 EP 1802326 A2 EP1802326 A2 EP 1802326A2 EP 05796502 A EP05796502 A EP 05796502A EP 05796502 A EP05796502 A EP 05796502A EP 1802326 A2 EP1802326 A2 EP 1802326A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- xaa
- bmp
- res
- bone
- gdf
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 208
- 102000004169 proteins and genes Human genes 0.000 title claims abstract description 190
- 210000000988 bone and bone Anatomy 0.000 title claims abstract description 154
- 230000000921 morphogenic effect Effects 0.000 title claims abstract description 127
- 238000000034 method Methods 0.000 title claims abstract description 58
- 208000018084 Bone neoplasm Diseases 0.000 title claims abstract description 37
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 26
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 26
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 26
- 206010005949 Bone cancer Diseases 0.000 claims abstract description 21
- 210000004881 tumor cell Anatomy 0.000 claims abstract description 21
- 230000001939 inductive effect Effects 0.000 claims abstract description 17
- 230000004069 differentiation Effects 0.000 claims abstract description 9
- 230000004614 tumor growth Effects 0.000 claims abstract description 5
- 230000002401 inhibitory effect Effects 0.000 claims abstract description 4
- -1 OP-3 Proteins 0.000 claims description 52
- 239000013598 vector Substances 0.000 claims description 28
- 241000124008 Mammalia Species 0.000 claims description 24
- 239000000203 mixture Substances 0.000 claims description 23
- 108010049974 Bone Morphogenetic Protein 6 Proteins 0.000 claims description 20
- 102100022545 Bone morphogenetic protein 8B Human genes 0.000 claims description 19
- 201000008968 osteosarcoma Diseases 0.000 claims description 19
- 102100035368 Growth/differentiation factor 6 Human genes 0.000 claims description 18
- 108010049976 Bone Morphogenetic Protein 5 Proteins 0.000 claims description 17
- 102100022526 Bone morphogenetic protein 5 Human genes 0.000 claims description 17
- 239000013603 viral vector Substances 0.000 claims description 16
- 101710117973 Bone morphogenetic protein 8A Proteins 0.000 claims description 13
- 102100035363 Growth/differentiation factor 7 Human genes 0.000 claims description 13
- 108010090250 Growth Differentiation Factor 6 Proteins 0.000 claims description 12
- 102100035379 Growth/differentiation factor 5 Human genes 0.000 claims description 12
- 101710204283 Growth/differentiation factor 7 Proteins 0.000 claims description 12
- 108010027904 cartilage-derived-morphogenetic protein-2 Proteins 0.000 claims description 12
- 108010090254 Growth Differentiation Factor 5 Proteins 0.000 claims description 11
- 108010049931 Bone Morphogenetic Protein 2 Proteins 0.000 claims description 10
- 102100024506 Bone morphogenetic protein 2 Human genes 0.000 claims description 10
- 102100024504 Bone morphogenetic protein 3 Human genes 0.000 claims description 10
- 108010049951 Bone Morphogenetic Protein 3 Proteins 0.000 claims description 9
- 108010049955 Bone Morphogenetic Protein 4 Proteins 0.000 claims description 9
- 102100024505 Bone morphogenetic protein 4 Human genes 0.000 claims description 9
- 238000009472 formulation Methods 0.000 claims description 9
- 238000013268 sustained release Methods 0.000 claims description 9
- 239000012730 sustained-release form Substances 0.000 claims description 9
- 101000899368 Homo sapiens Bone morphogenetic protein 8B Proteins 0.000 claims description 8
- 108010090290 Growth Differentiation Factor 2 Proteins 0.000 claims description 7
- 108090000349 Bone morphogenetic protein 15 Proteins 0.000 claims description 6
- 102000003928 Bone morphogenetic protein 15 Human genes 0.000 claims description 6
- 108010090293 Growth Differentiation Factor 3 Proteins 0.000 claims description 6
- 108090001086 Growth differentiation factor-9 Proteins 0.000 claims description 6
- 102000004858 Growth differentiation factor-9 Human genes 0.000 claims description 6
- 102100040892 Growth/differentiation factor 2 Human genes 0.000 claims description 6
- 102100035364 Growth/differentiation factor 3 Human genes 0.000 claims description 6
- 102100039939 Growth/differentiation factor 8 Human genes 0.000 claims description 6
- 108010056852 Myostatin Proteins 0.000 claims description 6
- 206010039491 Sarcoma Diseases 0.000 claims description 6
- 108010071304 univin Proteins 0.000 claims description 6
- KLXQAXYSOJNJRI-KVTDHHQDSA-N (2s,3s,4r,5r)-5-amino-2,3,4,6-tetrahydroxyhexanal Chemical compound OC[C@@H](N)[C@@H](O)[C@H](O)[C@H](O)C=O KLXQAXYSOJNJRI-KVTDHHQDSA-N 0.000 claims description 5
- 101710204270 Growth/differentiation factor 2 Proteins 0.000 claims description 5
- 101000651373 Homo sapiens Serine palmitoyltransferase small subunit B Proteins 0.000 claims description 5
- 102100027676 Serine palmitoyltransferase small subunit B Human genes 0.000 claims description 5
- 239000012634 fragment Substances 0.000 claims description 5
- 230000001537 neural effect Effects 0.000 claims description 5
- 201000009030 Carcinoma Diseases 0.000 claims description 4
- 239000007864 aqueous solution Substances 0.000 claims description 3
- 101150072730 Bmp6 gene Proteins 0.000 claims description 2
- 208000009889 Herpes Simplex Diseases 0.000 claims description 2
- 206010046865 Vaccinia virus infection Diseases 0.000 claims description 2
- 208000007089 vaccinia Diseases 0.000 claims description 2
- 102100022525 Bone morphogenetic protein 6 Human genes 0.000 claims 2
- 210000004027 cell Anatomy 0.000 abstract description 152
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 4
- 230000003463 hyperproliferative effect Effects 0.000 abstract description 4
- 235000018102 proteins Nutrition 0.000 description 162
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 73
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 68
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 68
- 150000001413 amino acids Chemical group 0.000 description 62
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 59
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 50
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 47
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 43
- 206010028980 Neoplasm Diseases 0.000 description 32
- 238000011282 treatment Methods 0.000 description 31
- 241000282414 Homo sapiens Species 0.000 description 29
- 230000002188 osteogenic effect Effects 0.000 description 29
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 28
- 108090000765 processed proteins & peptides Proteins 0.000 description 26
- 230000000694 effects Effects 0.000 description 25
- 229920001184 polypeptide Polymers 0.000 description 23
- 102000004196 processed proteins & peptides Human genes 0.000 description 23
- 210000001519 tissue Anatomy 0.000 description 21
- 229940024606 amino acid Drugs 0.000 description 19
- 235000001014 amino acid Nutrition 0.000 description 19
- 102000008154 Bone Morphogenetic Protein 6 Human genes 0.000 description 18
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 18
- 210000004899 c-terminal region Anatomy 0.000 description 18
- 102000008186 Collagen Human genes 0.000 description 17
- 108010035532 Collagen Proteins 0.000 description 17
- 229920001436 collagen Polymers 0.000 description 17
- 241000699670 Mus sp. Species 0.000 description 16
- 230000006870 function Effects 0.000 description 16
- 108020004414 DNA Proteins 0.000 description 15
- 235000018417 cysteine Nutrition 0.000 description 15
- 238000001727 in vivo Methods 0.000 description 15
- 239000007924 injection Substances 0.000 description 15
- 238000002347 injection Methods 0.000 description 15
- 239000011159 matrix material Substances 0.000 description 15
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 13
- 230000004663 cell proliferation Effects 0.000 description 12
- 239000000463 material Substances 0.000 description 12
- 238000006467 substitution reaction Methods 0.000 description 12
- 201000011510 cancer Diseases 0.000 description 11
- 229920000642 polymer Polymers 0.000 description 11
- 229920002683 Glycosaminoglycan Polymers 0.000 description 10
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 9
- 125000000539 amino acid group Chemical group 0.000 description 9
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 9
- 238000010348 incorporation Methods 0.000 description 9
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 8
- 125000000998 L-alanino group Chemical group [H]N([*])[C@](C([H])([H])[H])([H])C(=O)O[H] 0.000 description 8
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 8
- 239000002299 complementary DNA Substances 0.000 description 8
- 230000002962 histologic effect Effects 0.000 description 8
- 239000002502 liposome Substances 0.000 description 8
- 238000011580 nude mouse model Methods 0.000 description 8
- 108091033319 polynucleotide Proteins 0.000 description 8
- 102000040430 polynucleotide Human genes 0.000 description 8
- 239000002157 polynucleotide Substances 0.000 description 8
- 229940104230 thymidine Drugs 0.000 description 8
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 7
- 210000001185 bone marrow Anatomy 0.000 description 7
- 239000000969 carrier Substances 0.000 description 7
- 230000002829 reductive effect Effects 0.000 description 7
- 108020004463 18S ribosomal RNA Proteins 0.000 description 6
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 6
- 102000001893 Bone Morphogenetic Protein Receptors Human genes 0.000 description 6
- 108010040422 Bone Morphogenetic Protein Receptors Proteins 0.000 description 6
- 102000037280 Growth Differentiation Factor 2 Human genes 0.000 description 6
- ODKSFYDXXFIFQN-BYPYZUCNSA-N L-arginine Chemical compound OC(=O)[C@@H](N)CCCN=C(N)N ODKSFYDXXFIFQN-BYPYZUCNSA-N 0.000 description 6
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 6
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 6
- 241000700605 Viruses Species 0.000 description 6
- 238000003556 assay Methods 0.000 description 6
- 238000002474 experimental method Methods 0.000 description 6
- 230000012010 growth Effects 0.000 description 6
- 239000000017 hydrogel Substances 0.000 description 6
- 108020004999 messenger RNA Proteins 0.000 description 6
- 229920000747 poly(lactic acid) Polymers 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 241000894007 species Species 0.000 description 6
- 238000007920 subcutaneous administration Methods 0.000 description 6
- 238000013518 transcription Methods 0.000 description 6
- 230000035897 transcription Effects 0.000 description 6
- 238000001890 transfection Methods 0.000 description 6
- 102100025422 Bone morphogenetic protein receptor type-2 Human genes 0.000 description 5
- 108050008407 Bone morphogenetic protein receptor type-2 Proteins 0.000 description 5
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 5
- 101710204281 Growth/differentiation factor 6 Proteins 0.000 description 5
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- 241000700584 Simplexvirus Species 0.000 description 5
- 239000003795 chemical substances by application Substances 0.000 description 5
- 238000004132 cross linking Methods 0.000 description 5
- 230000029087 digestion Effects 0.000 description 5
- 230000007717 exclusion Effects 0.000 description 5
- 238000003780 insertion Methods 0.000 description 5
- 230000037431 insertion Effects 0.000 description 5
- 239000002245 particle Substances 0.000 description 5
- 239000002904 solvent Substances 0.000 description 5
- 241001430294 unidentified retrovirus Species 0.000 description 5
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 4
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 4
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 4
- FERIUCNNQQJTOY-UHFFFAOYSA-N Butyric acid Chemical compound CCCC(O)=O FERIUCNNQQJTOY-UHFFFAOYSA-N 0.000 description 4
- AEMRFAOFKBGASW-UHFFFAOYSA-N Glycolic acid Chemical compound OCC(O)=O AEMRFAOFKBGASW-UHFFFAOYSA-N 0.000 description 4
- 125000000393 L-methionino group Chemical group [H]OC(=O)[C@@]([H])(N([H])[*])C([H])([H])C(SC([H])([H])[H])([H])[H] 0.000 description 4
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 4
- 241000699666 Mus <mouse, genus> Species 0.000 description 4
- 241000699660 Mus musculus Species 0.000 description 4
- 229920000954 Polyglycolide Polymers 0.000 description 4
- GLNADSQYFUSGOU-GPTZEZBUSA-J Trypan blue Chemical compound [Na+].[Na+].[Na+].[Na+].C1=C(S([O-])(=O)=O)C=C2C=C(S([O-])(=O)=O)C(/N=N/C3=CC=C(C=C3C)C=3C=C(C(=CC=3)\N=N\C=3C(=CC4=CC(=CC(N)=C4C=3O)S([O-])(=O)=O)S([O-])(=O)=O)C)=C(O)C2=C1N GLNADSQYFUSGOU-GPTZEZBUSA-J 0.000 description 4
- 239000012736 aqueous medium Substances 0.000 description 4
- 230000001851 biosynthetic effect Effects 0.000 description 4
- 239000012876 carrier material Substances 0.000 description 4
- 210000000845 cartilage Anatomy 0.000 description 4
- 230000024245 cell differentiation Effects 0.000 description 4
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 4
- 229920001577 copolymer Polymers 0.000 description 4
- 229920002674 hyaluronan Polymers 0.000 description 4
- 238000009396 hybridization Methods 0.000 description 4
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- 238000010369 molecular cloning Methods 0.000 description 4
- 230000035772 mutation Effects 0.000 description 4
- 230000007935 neutral effect Effects 0.000 description 4
- 239000008194 pharmaceutical composition Substances 0.000 description 4
- 239000004633 polyglycolic acid Substances 0.000 description 4
- 229950008885 polyglycolic acid Drugs 0.000 description 4
- 239000004626 polylactic acid Substances 0.000 description 4
- 210000000130 stem cell Anatomy 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 241000701161 unidentified adenovirus Species 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 3
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- 108091026890 Coding region Proteins 0.000 description 3
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 3
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 3
- 108010041881 Growth Differentiation Factor 10 Proteins 0.000 description 3
- 102100040895 Growth/differentiation factor 10 Human genes 0.000 description 3
- 241001529936 Murinae Species 0.000 description 3
- 206010060862 Prostate cancer Diseases 0.000 description 3
- 241000125945 Protoparvovirus Species 0.000 description 3
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 3
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 3
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 3
- 241000269370 Xenopus <genus> Species 0.000 description 3
- 239000002671 adjuvant Substances 0.000 description 3
- 239000001506 calcium phosphate Substances 0.000 description 3
- 238000007398 colorimetric assay Methods 0.000 description 3
- 239000003431 cross linking reagent Substances 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 208000035475 disorder Diseases 0.000 description 3
- 231100000673 dose–response relationship Toxicity 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 108020001507 fusion proteins Proteins 0.000 description 3
- 102000037865 fusion proteins Human genes 0.000 description 3
- 239000000499 gel Substances 0.000 description 3
- 238000001415 gene therapy Methods 0.000 description 3
- 229960002989 glutamic acid Drugs 0.000 description 3
- 229960003160 hyaluronic acid Drugs 0.000 description 3
- 229910052739 hydrogen Inorganic materials 0.000 description 3
- 239000001257 hydrogen Substances 0.000 description 3
- 201000005296 lung carcinoma Diseases 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 230000011164 ossification Effects 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 239000011148 porous material Substances 0.000 description 3
- 230000035755 proliferation Effects 0.000 description 3
- 108020003175 receptors Proteins 0.000 description 3
- 102000005962 receptors Human genes 0.000 description 3
- 239000000523 sample Substances 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 125000003831 tetrazolyl group Chemical group 0.000 description 3
- 238000002560 therapeutic procedure Methods 0.000 description 3
- 238000010361 transduction Methods 0.000 description 3
- 230000026683 transduction Effects 0.000 description 3
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 3
- 230000004565 tumor cell growth Effects 0.000 description 3
- XMQUEQJCYRFIQS-YFKPBYRVSA-N (2s)-2-amino-5-ethoxy-5-oxopentanoic acid Chemical compound CCOC(=O)CC[C@H](N)C(O)=O XMQUEQJCYRFIQS-YFKPBYRVSA-N 0.000 description 2
- XMTQQYYKAHVGBJ-UHFFFAOYSA-N 3-(3,4-DICHLOROPHENYL)-1,1-DIMETHYLUREA Chemical compound CN(C)C(=O)NC1=CC=C(Cl)C(Cl)=C1 XMTQQYYKAHVGBJ-UHFFFAOYSA-N 0.000 description 2
- WHBMMWSBFZVSSR-UHFFFAOYSA-N 3-hydroxybutyric acid Chemical compound CC(O)CC(O)=O WHBMMWSBFZVSSR-UHFFFAOYSA-N 0.000 description 2
- ZMRMMAOBSFSXLN-UHFFFAOYSA-N 4-[4-(2,5-dioxopyrrol-1-yl)phenyl]butanehydrazide Chemical compound C1=CC(CCCC(=O)NN)=CC=C1N1C(=O)C=CC1=O ZMRMMAOBSFSXLN-UHFFFAOYSA-N 0.000 description 2
- 229920001287 Chondroitin sulfate Polymers 0.000 description 2
- 208000005243 Chondrosarcoma Diseases 0.000 description 2
- 102000016726 Coat Protein Complex I Human genes 0.000 description 2
- 108010092897 Coat Protein Complex I Proteins 0.000 description 2
- 102000012422 Collagen Type I Human genes 0.000 description 2
- 108010022452 Collagen Type I Proteins 0.000 description 2
- 108091035707 Consensus sequence Proteins 0.000 description 2
- 108090000695 Cytokines Proteins 0.000 description 2
- 102000004127 Cytokines Human genes 0.000 description 2
- 241000702421 Dependoparvovirus Species 0.000 description 2
- 241000206602 Eukaryota Species 0.000 description 2
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 2
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 2
- 102000009123 Fibrin Human genes 0.000 description 2
- 108010073385 Fibrin Proteins 0.000 description 2
- BWGVNKXGVNDBDI-UHFFFAOYSA-N Fibrin monomer Chemical compound CNC(=O)CNC(=O)CN BWGVNKXGVNDBDI-UHFFFAOYSA-N 0.000 description 2
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 2
- WZUVPPKBWHMQCE-UHFFFAOYSA-N Haematoxylin Chemical compound C12=CC(O)=C(O)C=C2CC2(O)C1C1=CC=C(O)C(O)=C1OC2 WZUVPPKBWHMQCE-UHFFFAOYSA-N 0.000 description 2
- 101000766116 Haloarcula vallismortis Cruxrhodopsin-3 Proteins 0.000 description 2
- 239000012981 Hank's balanced salt solution Substances 0.000 description 2
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 2
- 101000762375 Homo sapiens Bone morphogenetic protein 3 Proteins 0.000 description 2
- 101000893545 Homo sapiens Growth/differentiation factor 11 Proteins 0.000 description 2
- 102000018251 Hypoxanthine Phosphoribosyltransferase Human genes 0.000 description 2
- 108010091358 Hypoxanthine Phosphoribosyltransferase Proteins 0.000 description 2
- 102000014150 Interferons Human genes 0.000 description 2
- 108010050904 Interferons Proteins 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 206010027476 Metastases Diseases 0.000 description 2
- 101100165554 Mus musculus Bmp5 gene Proteins 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 241000714474 Rous sarcoma virus Species 0.000 description 2
- 208000037065 Subacute sclerosing leukoencephalitis Diseases 0.000 description 2
- 206010042297 Subacute sclerosing panencephalitis Diseases 0.000 description 2
- 108010022394 Threonine synthase Proteins 0.000 description 2
- 229910052770 Uranium Inorganic materials 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 108010087924 alanylproline Proteins 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 238000003287 bathing Methods 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 229920001222 biopolymer Polymers 0.000 description 2
- 210000002449 bone cell Anatomy 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 238000001516 cell proliferation assay Methods 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 235000012000 cholesterol Nutrition 0.000 description 2
- 210000000349 chromosome Anatomy 0.000 description 2
- 238000000975 co-precipitation Methods 0.000 description 2
- 239000002131 composite material Substances 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 150000001945 cysteines Chemical class 0.000 description 2
- 229940127089 cytotoxic agent Drugs 0.000 description 2
- 230000007547 defect Effects 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 102000004419 dihydrofolate reductase Human genes 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 239000005038 ethylene vinyl acetate Substances 0.000 description 2
- 210000002744 extracellular matrix Anatomy 0.000 description 2
- 239000000835 fiber Substances 0.000 description 2
- 229950003499 fibrin Drugs 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 150000004676 glycans Chemical class 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 238000010438 heat treatment Methods 0.000 description 2
- 229910001385 heavy metal Inorganic materials 0.000 description 2
- 102000044396 human BMP8B Human genes 0.000 description 2
- 239000007943 implant Substances 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 238000011065 in-situ storage Methods 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 239000004310 lactic acid Substances 0.000 description 2
- 235000014655 lactic acid Nutrition 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- 239000004005 microsphere Substances 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 239000002773 nucleotide Substances 0.000 description 2
- 125000003729 nucleotide group Chemical group 0.000 description 2
- 238000013392 nude mouse xenograft model Methods 0.000 description 2
- 108010079892 phosphoglycerol kinase Proteins 0.000 description 2
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 2
- 229920002338 polyhydroxyethylmethacrylate Polymers 0.000 description 2
- 229920001282 polysaccharide Polymers 0.000 description 2
- 239000005017 polysaccharide Substances 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 201000001514 prostate carcinoma Diseases 0.000 description 2
- 230000008439 repair process Effects 0.000 description 2
- 235000010983 sucrose acetate isobutyrate Nutrition 0.000 description 2
- UVGUPMLLGBCFEJ-SWTLDUCYSA-N sucrose acetate isobutyrate Chemical compound CC(C)C(=O)O[C@H]1[C@H](OC(=O)C(C)C)[C@@H](COC(=O)C(C)C)O[C@@]1(COC(C)=O)O[C@@H]1[C@H](OC(=O)C(C)C)[C@@H](OC(=O)C(C)C)[C@H](OC(=O)C(C)C)[C@@H](COC(C)=O)O1 UVGUPMLLGBCFEJ-SWTLDUCYSA-N 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-L sulfate group Chemical group S(=O)(=O)([O-])[O-] QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 230000002459 sustained effect Effects 0.000 description 2
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 2
- 230000001225 therapeutic effect Effects 0.000 description 2
- 230000009772 tissue formation Effects 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 1
- 229940058020 2-amino-2-methyl-1-propanol Drugs 0.000 description 1
- XZKIHKMTEMTJQX-UHFFFAOYSA-N 4-Nitrophenyl Phosphate Chemical compound OP(O)(=O)OC1=CC=C([N+]([O-])=O)C=C1 XZKIHKMTEMTJQX-UHFFFAOYSA-N 0.000 description 1
- BTJIUGUIPKRLHP-UHFFFAOYSA-N 4-nitrophenol Chemical compound OC1=CC=C([N+]([O-])=O)C=C1 BTJIUGUIPKRLHP-UHFFFAOYSA-N 0.000 description 1
- 101710169336 5'-deoxyadenosine deaminase Proteins 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- 102000055025 Adenosine deaminases Human genes 0.000 description 1
- JQDFGZKKXBEANU-IMJSIDKUSA-N Ala-Cys Chemical compound C[C@H](N)C(=O)N[C@@H](CS)C(O)=O JQDFGZKKXBEANU-IMJSIDKUSA-N 0.000 description 1
- WPWUFUBLGADILS-WDSKDSINSA-N Ala-Pro Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(O)=O WPWUFUBLGADILS-WDSKDSINSA-N 0.000 description 1
- MUGAESARFRGOTQ-IGNZVWTISA-N Ala-Tyr-Tyr Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)O)N MUGAESARFRGOTQ-IGNZVWTISA-N 0.000 description 1
- 201000004384 Alopecia Diseases 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- RAKKBBHMTJSXOY-XVYDVKMFSA-N Asn-His-Ala Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(O)=O RAKKBBHMTJSXOY-XVYDVKMFSA-N 0.000 description 1
- IQTUDDBANZYMAR-WDSKDSINSA-N Asn-Met Chemical compound CSCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CC(N)=O IQTUDDBANZYMAR-WDSKDSINSA-N 0.000 description 1
- ZARXTZFGQZBYFO-JQWIXIFHSA-N Asp-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CC(O)=O)N)C(O)=O)=CNC2=C1 ZARXTZFGQZBYFO-JQWIXIFHSA-N 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 208000020084 Bone disease Diseases 0.000 description 1
- 102100028726 Bone morphogenetic protein 10 Human genes 0.000 description 1
- 101710118482 Bone morphogenetic protein 10 Proteins 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 229920001661 Chitosan Polymers 0.000 description 1
- 102000000503 Collagen Type II Human genes 0.000 description 1
- 108010041390 Collagen Type II Proteins 0.000 description 1
- 239000004971 Cross linker Substances 0.000 description 1
- OABOXRPGTFRBFZ-IMJSIDKUSA-N Cys-Cys Chemical compound SC[C@H](N)C(=O)N[C@@H](CS)C(O)=O OABOXRPGTFRBFZ-IMJSIDKUSA-N 0.000 description 1
- HYKFOHGZGLOCAY-ZLUOBGJFSA-N Cys-Cys-Ala Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](C)C(O)=O HYKFOHGZGLOCAY-ZLUOBGJFSA-N 0.000 description 1
- LVNMAAGSAUGNIC-BQBZGAKWSA-N Cys-His Chemical compound SC[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CNC=N1 LVNMAAGSAUGNIC-BQBZGAKWSA-N 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- CKLJMWTZIZZHCS-UWTATZPHSA-N D-aspartic acid Chemical compound OC(=O)[C@H](N)CC(O)=O CKLJMWTZIZZHCS-UWTATZPHSA-N 0.000 description 1
- 230000009946 DNA mutation Effects 0.000 description 1
- 241000450599 DNA viruses Species 0.000 description 1
- 229920000045 Dermatan sulfate Polymers 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 101710134292 Dorsalin-1 Proteins 0.000 description 1
- 108700023899 Drosophila SCW Proteins 0.000 description 1
- 108700003483 Drosophila dpp Proteins 0.000 description 1
- 241000257465 Echinoidea Species 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- KRHYYFGTRYWZRS-UHFFFAOYSA-N Fluorane Chemical compound F KRHYYFGTRYWZRS-UHFFFAOYSA-N 0.000 description 1
- 208000005422 Foreign-Body reaction Diseases 0.000 description 1
- IAJILQKETJEXLJ-UHFFFAOYSA-N Galacturonsaeure Natural products O=CC(O)C(O)C(O)C(O)C(O)=O IAJILQKETJEXLJ-UHFFFAOYSA-N 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 101710194452 Growth/differentiation factor 11 Proteins 0.000 description 1
- 102100040898 Growth/differentiation factor 11 Human genes 0.000 description 1
- 101710204282 Growth/differentiation factor 5 Proteins 0.000 description 1
- 229920002971 Heparan sulfate Polymers 0.000 description 1
- 241000175212 Herpesvirales Species 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000695360 Homo sapiens Bone morphogenetic protein 15 Proteins 0.000 description 1
- 101000762366 Homo sapiens Bone morphogenetic protein 2 Proteins 0.000 description 1
- 101000762379 Homo sapiens Bone morphogenetic protein 4 Proteins 0.000 description 1
- 101000899388 Homo sapiens Bone morphogenetic protein 5 Proteins 0.000 description 1
- 101000899390 Homo sapiens Bone morphogenetic protein 6 Proteins 0.000 description 1
- 101000899364 Homo sapiens Bone morphogenetic protein 8A Proteins 0.000 description 1
- 101000893585 Homo sapiens Growth/differentiation factor 2 Proteins 0.000 description 1
- 101001023964 Homo sapiens Growth/differentiation factor 6 Proteins 0.000 description 1
- 101001023968 Homo sapiens Growth/differentiation factor 7 Proteins 0.000 description 1
- 101000886562 Homo sapiens Growth/differentiation factor 8 Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 108010076876 Keratins Proteins 0.000 description 1
- 102000011782 Keratins Human genes 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 201000011062 Li-Fraumeni syndrome Diseases 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 108091027974 Mature messenger RNA Proteins 0.000 description 1
- PKVZBNCYEICAQP-UHFFFAOYSA-N Mecamylamine hydrochloride Chemical compound Cl.C1CC2C(C)(C)C(NC)(C)C1C2 PKVZBNCYEICAQP-UHFFFAOYSA-N 0.000 description 1
- DCHHUGLTVLJYKA-FXQIFTODSA-N Met-Asn-Ala Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(O)=O DCHHUGLTVLJYKA-FXQIFTODSA-N 0.000 description 1
- 101710159910 Movement protein Proteins 0.000 description 1
- 101100165560 Mus musculus Bmp7 gene Proteins 0.000 description 1
- 101000893544 Mus musculus Growth/differentiation factor 11 Proteins 0.000 description 1
- 101001023990 Mus musculus Growth/differentiation factor 3 Proteins 0.000 description 1
- 101001023989 Mus musculus Growth/differentiation factor 5 Proteins 0.000 description 1
- 101001023965 Mus musculus Growth/differentiation factor 6 Proteins 0.000 description 1
- 101001023969 Mus musculus Growth/differentiation factor 7 Proteins 0.000 description 1
- 101001075141 Mus musculus Growth/differentiation factor 8 Proteins 0.000 description 1
- 101001075109 Mus musculus Growth/differentiation factor 9 Proteins 0.000 description 1
- 101000996033 Mus musculus Nodal Proteins 0.000 description 1
- 108010021466 Mutant Proteins Proteins 0.000 description 1
- 102000008300 Mutant Proteins Human genes 0.000 description 1
- 206010028813 Nausea Diseases 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- WEQJQNWXCSUVMA-RYUDHWBXSA-N Phe-Pro Chemical compound C([C@H]([NH3+])C(=O)N1[C@@H](CCC1)C([O-])=O)C1=CC=CC=C1 WEQJQNWXCSUVMA-RYUDHWBXSA-N 0.000 description 1
- RVQDZELMXZRSSI-IUCAKERBSA-N Pro-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1 RVQDZELMXZRSSI-IUCAKERBSA-N 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 108020005115 Pyruvate Kinase Proteins 0.000 description 1
- 102000013009 Pyruvate Kinase Human genes 0.000 description 1
- 241001068295 Replication defective viruses Species 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- PPQRSMGDOHLTBE-UWVGGRQHSA-N Ser-Phe Chemical compound OC[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 PPQRSMGDOHLTBE-UWVGGRQHSA-N 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 239000012163 TRI reagent Substances 0.000 description 1
- 101150006914 TRP1 gene Proteins 0.000 description 1
- PAOYNIKMYOGBMR-PBCZWWQYSA-N Thr-Asn-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N)O PAOYNIKMYOGBMR-PBCZWWQYSA-N 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 102000006601 Thymidine Kinase Human genes 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- 101100472152 Trypanosoma brucei brucei (strain 927/4 GUTat10.1) REL1 gene Proteins 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- WJKJJGXZRHDNTN-UWVGGRQHSA-N Tyr-Cys Chemical compound SC[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 WJKJJGXZRHDNTN-UWVGGRQHSA-N 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 206010047700 Vomiting Diseases 0.000 description 1
- 241000269368 Xenopus laevis Species 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 239000003929 acidic solution Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- CBTVGIZVANVGBH-UHFFFAOYSA-N aminomethyl propanol Chemical compound CC(C)(N)CO CBTVGIZVANVGBH-UHFFFAOYSA-N 0.000 description 1
- 238000002266 amputation Methods 0.000 description 1
- 238000004873 anchoring Methods 0.000 description 1
- 208000007502 anemia Diseases 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000036528 appetite Effects 0.000 description 1
- 235000019789 appetite Nutrition 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 238000003149 assay kit Methods 0.000 description 1
- 238000011717 athymic nude mouse Methods 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 239000012867 bioactive agent Substances 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 239000003150 biochemical marker Substances 0.000 description 1
- 229920002988 biodegradable polymer Polymers 0.000 description 1
- 239000004621 biodegradable polymer Substances 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 210000002805 bone matrix Anatomy 0.000 description 1
- 230000034127 bone morphogenesis Effects 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 239000008366 buffered solution Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 238000004422 calculation algorithm Methods 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 230000023852 carbohydrate metabolic process Effects 0.000 description 1
- 235000021256 carbohydrate metabolism Nutrition 0.000 description 1
- 210000003321 cartilage cell Anatomy 0.000 description 1
- 230000007355 cartilage morphogenesis Effects 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 230000012292 cell migration Effects 0.000 description 1
- 239000000919 ceramic Substances 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 208000011654 childhood malignant neoplasm Diseases 0.000 description 1
- 229940045110 chitosan Drugs 0.000 description 1
- 229940094517 chondroitin 4-sulfate Drugs 0.000 description 1
- KXKPYJOVDUMHGS-OSRGNVMNSA-N chondroitin sulfate Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](OS(O)(=O)=O)[C@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](C(O)=O)O1 KXKPYJOVDUMHGS-OSRGNVMNSA-N 0.000 description 1
- 238000013375 chromatographic separation Methods 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 238000004891 communication Methods 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 229920003020 cross-linked polyethylene Polymers 0.000 description 1
- 239000004703 cross-linked polyethylene Substances 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 108010004073 cysteinylcysteine Proteins 0.000 description 1
- 230000000120 cytopathologic effect Effects 0.000 description 1
- SUYVUBYJARFZHO-RRKCRQDMSA-N dATP Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-RRKCRQDMSA-N 0.000 description 1
- SUYVUBYJARFZHO-UHFFFAOYSA-N dATP Natural products C1=NC=2C(N)=NC=NC=2N1C1CC(O)C(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-UHFFFAOYSA-N 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 229940051593 dermatan sulfate Drugs 0.000 description 1
- AVJBPWGFOQAPRH-FWMKGIEWSA-L dermatan sulfate Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@H](OS([O-])(=O)=O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](C([O-])=O)O1 AVJBPWGFOQAPRH-FWMKGIEWSA-L 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 230000007120 differential activation Effects 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 125000002228 disulfide group Chemical group 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 239000000890 drug combination Substances 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 230000009881 electrostatic interaction Effects 0.000 description 1
- 230000035194 endochondral ossification Effects 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 239000002532 enzyme inhibitor Substances 0.000 description 1
- YQGOJNYOYNNSMM-UHFFFAOYSA-N eosin Chemical compound [Na+].OC(=O)C1=CC=CC=C1C1=C2C=C(Br)C(=O)C(Br)=C2OC2=C(Br)C(O)=C(Br)C=C21 YQGOJNYOYNNSMM-UHFFFAOYSA-N 0.000 description 1
- GOFLNFPIFZZLIP-UHFFFAOYSA-N ethanol;2,2,2-trifluoroacetic acid Chemical compound CCO.OC(=O)C(F)(F)F GOFLNFPIFZZLIP-UHFFFAOYSA-N 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 238000010228 ex vivo assay Methods 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 206010016256 fatigue Diseases 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 239000012537 formulation buffer Substances 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 230000005021 gait Effects 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229940014259 gelatin Drugs 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000012239 gene modification Methods 0.000 description 1
- 230000005017 genetic modification Effects 0.000 description 1
- 230000030414 genetic transfer Effects 0.000 description 1
- 235000013617 genetically modified food Nutrition 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- AWUCVROLDVIAJX-UHFFFAOYSA-N glycerol 1-phosphate Chemical compound OCC(O)COP(O)(O)=O AWUCVROLDVIAJX-UHFFFAOYSA-N 0.000 description 1
- 229930182470 glycoside Natural products 0.000 description 1
- 150000002338 glycosides Chemical class 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 230000009554 growth spurt Effects 0.000 description 1
- 208000024963 hair loss Diseases 0.000 description 1
- 230000003676 hair loss Effects 0.000 description 1
- 230000003862 health status Effects 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 150000002402 hexoses Chemical group 0.000 description 1
- 235000009200 high fat diet Nutrition 0.000 description 1
- 108010040030 histidinoalanine Proteins 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 239000007970 homogeneous dispersion Substances 0.000 description 1
- 229920001519 homopolymer Polymers 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 102000045896 human BMP2 Human genes 0.000 description 1
- 102000046148 human BMP4 Human genes 0.000 description 1
- 102000046095 human BMP6 Human genes 0.000 description 1
- 102000046041 human GDF2 Human genes 0.000 description 1
- 229940099552 hyaluronan Drugs 0.000 description 1
- KIUKXJAPPMFGSW-MNSSHETKSA-N hyaluronan Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)C1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H](C(O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-MNSSHETKSA-N 0.000 description 1
- 229910000040 hydrogen fluoride Inorganic materials 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 229910052588 hydroxylapatite Inorganic materials 0.000 description 1
- 230000008105 immune reaction Effects 0.000 description 1
- 229940125721 immunosuppressive agent Drugs 0.000 description 1
- 239000003018 immunosuppressive agent Substances 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 238000005462 in vivo assay Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000008297 liquid dosage form Substances 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 210000005265 lung cell Anatomy 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 206010025482 malaise Diseases 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 208000011645 metastatic carcinoma Diseases 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 230000001617 migratory effect Effects 0.000 description 1
- 238000000329 molecular dynamics simulation Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 230000008693 nausea Effects 0.000 description 1
- 239000002687 nonaqueous vehicle Substances 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 238000007899 nucleic acid hybridization Methods 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000001582 osteoblastic effect Effects 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 238000012856 packing Methods 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000011236 particulate material Substances 0.000 description 1
- XYJRXVWERLGGKC-UHFFFAOYSA-D pentacalcium;hydroxide;triphosphate Chemical compound [OH-].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O XYJRXVWERLGGKC-UHFFFAOYSA-D 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 238000003616 phosphatase activity assay Methods 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 210000005267 prostate cell Anatomy 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 238000005057 refrigeration Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 238000004626 scanning electron microscopy Methods 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 239000008299 semisolid dosage form Substances 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000012679 serum free medium Substances 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 230000000391 smoking effect Effects 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000007909 solid dosage form Substances 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 238000004611 spectroscopical analysis Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000008227 sterile water for injection Substances 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000001797 sucrose acetate isobutyrate Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 229920001059 synthetic polymer Polymers 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 230000000451 tissue damage Effects 0.000 description 1
- 231100000827 tissue damage Toxicity 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 230000005758 transcription activity Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 229940078499 tricalcium phosphate Drugs 0.000 description 1
- 229910000391 tricalcium phosphate Inorganic materials 0.000 description 1
- 235000019731 tricalcium phosphate Nutrition 0.000 description 1
- YNJBWRMUSHSURL-UHFFFAOYSA-N trichloroacetic acid Chemical compound OC(=O)C(Cl)(Cl)Cl YNJBWRMUSHSURL-UHFFFAOYSA-N 0.000 description 1
- JOPDZQBPOWAEHC-UHFFFAOYSA-H tristrontium;diphosphate Chemical compound [Sr+2].[Sr+2].[Sr+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O JOPDZQBPOWAEHC-UHFFFAOYSA-H 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 230000001228 trophic effect Effects 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 230000005740 tumor formation Effects 0.000 description 1
- WFKWXMTUELFFGS-UHFFFAOYSA-N tungsten Chemical compound [W] WFKWXMTUELFFGS-UHFFFAOYSA-N 0.000 description 1
- 229910052721 tungsten Inorganic materials 0.000 description 1
- 239000010937 tungsten Substances 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 239000011800 void material Substances 0.000 description 1
- 230000008673 vomiting Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 230000036642 wellbeing Effects 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
- A61K38/1875—Bone morphogenic factor; Osteogenins; Osteogenic factor; Bone-inducing factor
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
Definitions
- the present invention relates to methods of treating bone cancer. More particularly, it relates to methods of inducing differentiation of tumor cells into bone.
- Bone cancer is not as prevalent as other forms of cancer, it represents 5 percent of all childhood cancers. There are 5000 new cases of primary bone cancer diagnosed each year in the U.S., approximately one fifth of which are osteosarcomas. Bone cancers can affect any bone in the body. There are two types of bone cancers - primary and secondary. Primary bone cancer refers to cancers which start in the bone, whereas secondary bone cancers refers to cancers which start in other parts of the body, such as breasts, lung, and prostate, and later metastasize to bone. [0003] There are several types of bone cancer, including osteosarcomas, chondrosarcomas and osteocarcinomas.
- Osteosarcomas are malignant tumors derived from bone cells. Chondrosarcomas are malignant tumors derived from cartilage cells and form in bone. Osteocarcinomas are metastatic carcinomas in bone. [0004] The exact cause of bone cancer is not known, but it is believed to be due to DNA mutations - either inherited or acquired after birth.
- risk factors include but are not limited to, teenage growth spurts, being tall for a specific age, previous treatment with radiation for another type of cancer, presence of a benign (non-cancerous) bone disease, presence of certain rare, inherited cancers, such as Li-Fraumeni syndrome and retinoblastoma, lifestyle factors such as high-fat diets, lack of exercise, smoking and alcohol consumption.
- Treatment depends on the type of cancer, whether the primary tumor has metastasized, and the size and location of the primary tumor.
- the main types of therapy used to treat bone cancers include, but are not limited to, surgery, radiotherapy, chemotherapy, amputation (in the case of tumors in limbs) and replacement with bone graft or metal prostheses.
- the invention provides a method of treating bone cancer in a mammal comprising the step of administering to the mammal a pharmaceutically effective amount of a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein.
- the invention provides a method of inducing differentiation of bone tumor cells in a mammal comprising the step of administering to the mammal a pharmaceutically effective amount of a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein.
- the invention also provides a method or inhibiting bone tumor growth in a mammal comprising the step of administering to the mammal a pharmaceutically effective amount of a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein.
- the invention provides a method of inducing bone tumor regression in a mammal comprising the step of administering to the mammal a pharmaceutically effective amount of a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein.
- the tumor is a sarcoma or a carcinoma.
- the sarcoma is an osteosarcoma.
- the invention provides a method of treating a hyperproliferative cell disorder in a mammal comprising the step of administering to the mammal a pharmaceutically effective amount of a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein.
- the hyperproliferative cell is selected from the group consisting of bone, lung and prostate cells.
- the bone morphogenic protein includes, but is not limited to, OP-I, OP-2, OP-3, BMP-2, BMP-3, BMP-4, BMP-5, BMP-6, BMP-8, BMP-9, BMP-IO, BMP-Il, BMP-12, BMP-13, BMP-15, BMP-16, BMP-17, BMP-18, DPP, VgI, Vgr, 6OA protein, GDF-I, GDF-2, GDF-3, GDF-5, GDF-6, GDF-7, GDF-8, GDF-9, GDF-IO, GDF-11, GDF-12, CDMP-I, CDMP-2, CDMP- 3, NODAL, UNIVIN, SCREW, ADMP, NEURAL, and fragments thereof.
- the bone morphogenic protein is selected from the group consisting of OP-I, BMP-5, BMP-6, GDF-5, GDF-6 and GDF-7, CDMP-I, CDMP-2 and CDMP-3. In some embodiments, the bone morphogenic protein is selected from the group consisting of OP-I, BMP-5 and BMP-6. Preferably, the bone morphogenic protein is OP-I.
- the bone morphogenic protein comprises an amino acid sequence having at least 70% homology with the C-terminal 102-106 amino acids, including the conserved seven cysteine domain, of human OP-I.
- the nucleic acid used in the invention is a viral vector comprising a gene that encodes a bone morphogenic protein, and wherein the viral vector, includes but not limited to, an adenoviral vector, a lentiviral vector, a baculoviral vector, an Epstein Barr viral vector, a papovaviral vector, a vaccinia viral vector and a herpes simplex viral vector.
- the viral vector is an adenoviral vector, a baculoviral vector or a lentiviral vector. More preferably, the viral vector is an adenoviral vector.
- the invention provides a bone morphogenic protein or nucleic acid formulated as a gel, an aqueous solution, a paste or a putty.
- the formulation is a sustained release formulation.
- the bone morphogenic protein or nucleic acid encoding it is formulated for local administration.
- Figure 1 shows the effect of OP-I on cell morphology and cell counts (viable and total cell counts) in the osteosarcoma cell line SaOS-2.
- Cells were treated with either 0.5 ⁇ g/ml or 100 ⁇ g/ml of OP-I for 24 h.
- Cell morphology was monitored using an inverted microscope equipped with a CCD camera.
- Viable and total cell counts were determined using the trypan blue exclusion assay.
- Figure 2 shows the effect of OP-I on cell morphology and cell counts (viable and total cell counts) in the osteosarcoma cell line MG-63.
- Cells were treated with either 0.5 ⁇ g/ml or 100 ⁇ g/ml of OP-I for 24 h.
- Cell morphology was monitored using an inverted microscope equipped with a CCD camera. Viable and total cell counts (value in parentheses) were determined using the trypan blue exclusion assay.
- Figure 3 shows the effect of OP-I on cell morphology and cell counts (viable and total cell counts) in the lung carcinoma cell line A549. Cells were treated with either 0.5 ⁇ g/ml or 100 ⁇ g/ml of OP-I for 24 h.
- Figure 8 shows the effect of OP-I treatment on SaOS-2 cell proliferation.
- Figure 12 shows the effect of OP-I treatment on the alkaline phosphatase activity in SaOS-2 cells. Values are normalized to solvent-treated control cells
- Figure 13 shows the effect of OP-I treatment on the alkaline phosphatase activity in MG-63 cells. Values are normalized to solvent-treated control cells
- Figure 17 shows the in vivo mass growth of PC-3 cells in nude mice injected with control or OP-1-treated cells as a function of post-injection time.
- Figure 18 shows the histological appearance of a subcutaneous bone nodule containing bone marrow in a nude mouse injected with MG-63 cells treated with OP-I.
- the histologic image is represented at a magnification of 200X.
- Figure 19 shows that several tumor cell foci were present within the bone nodule in a nude mouse injected with OP-1-treated MG-63 osteosarcoma cells.
- FIG. 1 The histologic image is represented at a magnification of 10OX.
- Figure 2OA shows the histologic appearance of a subcutaneous mass comprised mainly of bone, bone marrow and focus of tumor cells in a nude mouse injected with OP-1-treated SaOS-02 osteosarcoma cells.
- the histologic image is represented at a magnification of 10OX.
- Figure 2OB shows a higher magnification of the tumor mass shown in Figure 18 A. There is a distinct tumor cell bone marrow interface. The histologic image is represented at a magnification of 200X.
- Figure 21 shows the histologic appearance of a subcutaneous mass comprised mainly of bone, bone marrow and focus of tumor cells in a nude mouse injected with OP-1-treated SaOS-02 osteosarcoma cells.
- the histologic image is represented at a magnification of 200X.
- the term "pharmaceutically effective amount” refers to an amount effective to repair, regenerate, promote, accelerate, prevent degradation, or form bone .
- a “pharmaceutically effective amount” also means the amount required to improve the clinical symptoms of a patient.
- the therapeutic methods or methods of treating cancer described herein are not to be interpreted or otherwise limited to “curing” cancer. Rather, the therapeutic methods and methods of treating cancer are intended to mean effecting a beneficial and/or desirable alteration in the general health of a patient suffering from cancer (e.g., bone cancer, lung cancer or prostate cancer).
- a skilled healthcare practitioner would recognize that such benefits and/or desirable effect include, but are not limited to tumor regression (decrease in tumor size), a decrease in metastasis, improved vital functions of the patient, improved well-being of the patient, decrease in pain, improved appetite, improvement in the patient's weight and any combination thereof.
- tumor regression decrease in tumor size
- a decrease in metastasis improved vital functions of the patient
- improved well-being of the patient decrease in pain
- improved appetite improvement in the patient's weight and any combination thereof.
- patient refers to an animal including a mammal (e.g., a human).
- the term "pharmaceutically acceptable carrier or adjuvant” refers to a non-toxic carrier or adjuvant that may be administered to a patient, together with a morphogenic protein of this invention, and which does not destroy the pharmacological activity thereof.
- the term "bone morphogenic protein (BMP)” refers to a protein belonging to the BMP family of the TGF- ⁇ superfamily of proteins (BMP family) based on DNA and amino acid sequence homology.
- a protein belongs to the BMP family according to this invention when it has at least 50% amino acid sequence identity with at least one known BMP family member within the conserved C- terminal cysteine-rich domain, which characterizes the BMP protein family.
- the protein has at least 70% amino acid sequence identity with at least one known BMP family member within the conserved C-terminal cysteine rich domain.
- Members of the BMP family may have less than 50% DNA or amino acid sequence identity overall.
- amino acid sequence homology is understood to include both amino acid sequence identity and similarity. Homologous sequences share identical and/or similar amino acid residues, where similar residues are conservative substitutions for, or "allowed point mutations" of, corresponding amino acid residues in an aligned reference sequence. Thus, a candidate polypeptide sequence that shares 70% amino acid homology with a reference sequence is one in which any 70% of the aligned residues are either identical to, or are conservative substitutions of, the corresponding residues in a reference sequence.
- Certain particularly preferred morphogenic polypeptides share at least 60%, and preferably 70% amino acid sequence identity with the C-terminal 102- 106 amino acids, defining the conserved seven-cysteine domain of human OP-I and related proteins.
- Amino acid sequence homology can be determined by methods well known in the art. For instance, to determine the percent homology of a candidate amino acid sequence to the sequence of the seven-cysteine domain, the two sequences are first aligned. The alignment can be made with, e.g., the dynamic programming algorithm described in Needleman et ah, J. MoI. Biol., 48, pp. 443 (1970), and the Align Program, a commercial software package produced by
- An initial alignment can be refined by comparison to a multi-sequence alignment of a family of related proteins. Once the alignment is made and refined, a percent homology score is calculated. The aligned amino acid residues of the two sequences are compared sequentially for their similarity to each other. Similarity factors include similar size, shape and electrical charge.
- One particularly preferred method of determining amino acid similarities is the PAM250 matrix described in Dayhoff et al, Atlas of Protein Sequence and Structure, 5, pp. 345-352 (1978 & Supp.), which is incorporated herein by reference.
- a similarity score is first calculated as the sum of the aligned pair wise amino acid similarity scores.
- the raw score is then normalized by dividing it by the geometric mean of the scores of the candidate sequence and the seven-cysteine domain.
- the geometric mean is the square root of the product of these scores.
- the normalized raw score is the percent homology.
- conservative substitutions refers to residues that are physically or functionally similar to the corresponding reference residues. That is, a conservative substitution and its reference residue have similar size, shape, electric charge, chemical properties including the ability to form covalent or hydrogen bonds, or the like. Preferred conservative substitutions are those fulfilling the criteria defined for an accepted point mutation in Dayhoff et ah, supra.
- conservative substitutions are substitutions within the following groups: (a) valine, glycine; (b) glycine, alanine; (c) valine, isoleucine, leucine; (d) aspartic acid, glutamic acid; (e) asparagine, glutamine; (f) serine, threonine; (g) lysine, arginine, methionine; and (h) phenylalanine, tyrosine.
- OP osteoogenic protein
- the term “osteogenic protein (OP)” refers to a morphogenic protein that is capable of inducing a progenitor cell to form cartilage and/or bone.
- the bone may be intramembranous bone or endochondral bone.
- Most osteogenic proteins are members of the BMP protein family and are thus also BMPs.
- osteogenic protein typified by human osteogenic protein (hOP-1).
- Other osteogenic proteins useful in the practice of the invention include osteogenically active forms of OP-I, OP-2, OP-3, BMP-2, BMP-3, BMP-4, BMP- 5, BMP-6, BMP-8, BMP-9, BMP-IO, BMP-Il, BMP-12, BMP-13, BMP-15, BMP-16, BMP-17, BMP-18, DPP, VgI, Vgr-1, 6OA protein, GDF-I, GDF-2, GDF-3, GDF-5, GDF-6, GDF-7, GDF-8, GDF-9, GDF-10, GDF-Il, GDF- 12, CDMP-I, CDMP-2, CDMP-3, UNIVIN, NODAL, SCREW, ADMP or NEURAL, and amino acid sequence variants thereof.
- Osteogenic proteins suitable for use with applicants' invention can be identified by means of routine experimentation using the art-recognized bioassay described by Reddi and Sampath (Sampath et al, Proc. Natl. Acad. Sci., 84, pp. 7109-13, incorporated herein by reference).
- the bone morphogenic proteins and nucleic acids encoding the bone morphogenic proteins of this invention may be used for treating bone cancer.
- a method of inducing differentiation of bone tumors using a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein is provided.
- the invention also provides a method of inhibiting bone tumor growth in a mammal using a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein.
- the invention provides a method of inducing bone tumor regression in a mammal using a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein. In some embodiments, the invention provides a method of treating a hyperproliferative cell disorder using a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein.
- the bone tumors according to this invention may be sarcomas or carcinomas. Preferably, the sarcoma is an osteosarcoma.
- the bone cancer is a primary bone cancer (i.e., cancer which starts in the bone). In other embodiments, the bone cancer is a secondary bone cancer (i.e., the cancer starts in another part of the body and metastasizes to the bone).
- the BMP family named for its representative bone morphogenic/osteogenic protein family members, belongs to the TGF- ⁇ protein superfamily. Of the reported "BMPs" (BMP-I to BMP-18), isolated primarily based on sequence homology, all but BMP-I remain classified as members of the BMP family of morphogenic proteins (Ozkaynak et al, EMBO J., 9, pp. 2085-93 (1990)).
- the BMP family includes other structurally-related members which are morphogenic proteins, including the drosophila decapentaplegic gene complex (DPP) products, the VgI product of Xenopus laevis and its murine homolog, Vgr-1 (see, e.g., Massague, Annu. Rev. Cell Biol, 6, pp. 597-641 (1990), incorporated herein by reference).
- DPP drosophila decapentaplegic gene complex
- Vgr-1 murine homolog
- the C-terminal domains of BMP-3, BMP-5, BMP-6, and OP-I (BMP-7) are about 60% identical to that of BMP-2, and the C-terminal domains of BMP-6 and OP-I are 87% identical.
- BMP-6 is likely the human homolog of the murine Vgr-1 (Lyons et al, Proc. Natl. Acad. Sci. U.S.A., 86, pp. 4554-59 (1989)); the two proteins are 92% identical overall at the amino acid sequence level (U. S. Patent No. 5,459,047, incorporated herein by reference). BMP-6 is 58% identical to the Xenopus Vg-I product.
- the naturally occurring bone morphogenic proteins share substantial amino acid sequence homology in their C-terminal regions (domains).
- the naturally occurring osteogenic proteins are translated as a precursor, having an N-terminal signal peptide sequence typically less than about 30 residues, followed by a "pro" domain that is cleaved to yield the mature C-terminal domain of approximately 97-106 amino acids.
- the signal peptide is cleaved rapidly upon translation, at a cleavage site that can be predicted in a given sequence using the method of Von Heijne Nucleic Acids Research, 14, pp. 4683-4691 (1986).
- the pro domain typically is about three times larger than the fully processed mature C- terminal domain.
- BMP protein family members Another characteristic of the BMP protein family members is their apparent ability to dimerize.
- OPs bone-derived osteogenic proteins
- BMPs bone-derived osteogenic proteins
- the ability of OPs and BMPs to form heterodimers may confer additional or altered morphogenic inductive capabilities on bone morphogenic proteins.
- Heterodimers may exhibit qualitatively or quantitatively different binding affinities than homodimers for OP and BMP receptor molecules. Altered binding affinities may in turn lead to differential activation of receptors that mediate different signaling pathways, which may ultimately lead to different biological activities or outcomes. Altered binding affinities could also be manifested in a tissue or cell type-specific manner, thereby inducing only particular progenitor cell types to undergo proliferation and/or differentiation.
- the pair of osteogenic polypeptides have amino acid sequences each comprising a sequence that shares a defined relationship with an amino acid sequence of a reference bone morphogenic protein.
- preferred osteogenic polypeptides share a defined relationship with a sequence present in osteogenically active human OP-I, SEQ ID NO: 1.
- any one or more of the naturally occurring or biosynthetic sequences disclosed herein similarly could be used as a reference sequence.
- Preferred osteogenic polypeptides share a defined relationship with at least the C-terminal six cysteine domain of human OP-I, residues 335-431 of SEQ ID NO: 1.
- osteogenic polypeptides share a defined relationship with at least the C-terminal seven cysteine domain of human OP-I, residues 330-431 of SEQ ID NO: 1. That is, preferred polypeptides in a dimeric protein with bone morphogenic activity each comprise a sequence that corresponds to a reference sequence or is functionally equivalent thereto.
- Functionally equivalent sequences include functionally equivalent arrangements of cysteine residues disposed within the reference sequence, including amino acid insertions or deletions which alter the linear arrangement of these cysteines, but do not materially impair their relationship in the folded structure of the dimeric bone morphogenic protein, including their ability to form such intra- or inter-chain disulfide bonds as may be necessary for morphogenic activity.
- Functionally equivalent sequences further include those wherein one or more amino acid residues differs from the corresponding residue of a reference sequence, e.g., the C-terminal seven cysteine domain (also referred to herein as the conserved seven cysteine skeleton) of human OP-I, provided that this difference does not destroy bone morphogenic activity. Accordingly, conservative substitutions of corresponding amino acids in the reference sequence are preferred. Amino acid residues that are conservative substitutions for corresponding residues in a reference sequence are those that are physically or functionally similar to the corresponding reference residues, e.g., that have similar size, shape, electric charge, chemical properties including the ability to form covalent or hydrogen bonds, or the like.
- osteogenic protein OP-I has been described (see, e.g., Oppermann et al, U. S. Patent No. 5,354,557, incorporated herein by reference).
- Natural-sourced osteogenic protein in its mature, native form is a glycosylated dimer typically having an apparent molecular weight of about 30-36 kDa as determined by SDS- PAGE. When reduced, the 30 kDa protein gives rise to two glycosylated peptide subunits having apparent molecular weights of about 16 kDa and 18 kDa.
- the unglycosylated protein which also has osteogenic activity, has an apparent molecular weight of about 27 kDa.
- the 27 kDa protein gives rise to two unglycosylated polypeptides, having molecular weights of about 14 kDa to 16 kDa, capable of inducing endochondral bone formation in a mammal.
- Osteogenic proteins may include forms having varying glycosylation patterns, varying N- termini, and active truncated or mutated forms of native protein.
- particularly useful sequences include those comprising the C-terminal 96 or 102 amino acid sequences of DPP (from Drosophila), VgI (from Xenopus), Vgr-1 (from mouse), the OP-I and OP-2 ⁇ roteins,(see U.S. Pat. No. 5,011,691 and Oppermann et al, incorporated herein by reference), as well as the proteins referred to as BMP-2, BMP-3, BMP-4 (see WO88/00205, U.S. Patent No. 5,013,649 and WO91/18098, incorporated herein by reference), BMP-5 and BMP- 6 (see WO90/11366, PCT/US90/01630, incorporated herein by reference), BMP-8 and BMP-9.
- Preferred osteogenic proteins of this invention comprise at least one polypeptide including, but not limited to OP-I (BMP-7), OP-2, OP-3, COP-I, COP-3, COP-4, COP-5, COP-7, COP-16, BMP-2, BMP-3, BMP-3b, BMP-4,
- the osteogenic protein comprises at least one polypeptide selected from OP-I (BMP- 7), BMP-2, BMP-4, BMP-5, BMP-6, GDF-5, GDF-6, GDF-7, CDMP-I, CDMP-2 or CDMP-3; more preferably, OP-I (BMP-7), BMP-5, BMP-6, GDF-5, GDF-6, GDF-7, CDMP-I, CDMP-2 or CDMP-3; even more preferably, OP-I (BMP-7), BMP-5 or BMP-6; and most preferably, OP-I (BMP-7).
- BMP-7 Publications disclosing these sequences, as well as their chemical and physical properties, include: OP-I and OP-2 (U.S. Patent No.
- GDF-8 (WO94/21681 (PCT/US94/03019); GDF-9 (WO94/15966 (PCTYUS94/00685); GDF-IO (WO95/10539 (PCT/US94/11440); GDF-Il (WO96/01845 (PCT/US95/08543); BMP-15 (WO96/36710 (PCT/US96/06540); MP-121 (WO96/01316 (PCT/EP95/02552); GDF-5 (CDMP-I, MP52) (WO94/15949 (PCT/US94/00657) and WO96/14335 (PCT/US94/12814) and WO93/16099 (PCT/EP93/00350)); GDF-6 (CDMP-2, BMP13) (WO95/01801 (PCT/US94/07762) and WO96/14335 and WO95/10635 (PCT/US94/14030)); GDF-7 (CDMP-3, BMP12
- useful proteins include biologically active biosynthetic constructs, including novel biosynthetic bone morphogenic proteins and chimeric proteins designed using sequences from two or more known bone morphogenic proteins.
- a bone morphogenic protein or osteogenic protein may be prepared synthetically to induce tissue formation. Bone morphogenic proteins prepared synthetically may be native, or may be non-native proteins, i.e., those not otherwise found in nature.
- Non-native osteogenic proteins have been synthesized using a series of consensus DNA sequences (U.S . Patent No. 5,324,819, incorporated herein by reference).
- consensus osteogenic proteins have been expressed as fusion proteins in prokaryotes (see, e.g., U.S. Pat. No. 5,011,691, incorporated herein by reference. These include COP-I, COP-3, COP-4, COP-5, COP-7 and COP- 16, as well as other proteins known in the art.
- Purified fusion proteins may be cleaved, refolded, implanted in an established animal model and shown to have bone- and/or cartilage-inducing activity.
- the currently preferred synthetic osteogenic proteins comprise two synthetic amino acid sequences designated COP-5 (SEQ. ID NO: 2) and COP-7 (SEQ. ID NO: 3).
- COP-5 SEQ. ID NO: 2
- COP-7 SEQ. ID NO: 3
- Oppermann et al U. S. Patent Nos. 5,011,691 and 5,324,819, which are incorporated herein by reference, describe the amino acid sequences of COP-5 and COP-7 as shown below: COP5 LYVDFS-DVGWDDWIVAPPGYQAFYCHGECPFPLAD
- the bone morphogenic protein comprises a pair of subunits disulfide bonded to produce a dimeric species, wherein at least one of the subunits comprises a recombinant peptide belonging to the BMP protein family.
- the bone morphogenic protein comprises a pair of subunits that produce a dimeric species formed through non-covalent interactions, wherein at least one of the subunits comprises a recombinant peptide belonging to the BMP protein family.
- Non-covalent interactions include Van der Waals, hydrogen bond, hydrophobic and electrostatic interactions.
- the dimeric species may be a homodimer or heterodimer and is capable of inducing cell proliferation and/or tissue formation.
- the bone morphogenic protein is a monomer.
- bone morphogenic proteins useful herein include those in which the amino acid sequences comprise a sequence sharing at least 70% amino acid sequence homology or "similarity", and preferably 75%, 80%, 85%, 90%, 95%, or 98% homology or similarity, with a reference bone morphogenic protein selected from the foregoing naturally occurring proteins.
- the reference protein is human OP-I, and the reference sequence thereof is the C-terminal seven cysteine domain present in osteogenically active forms of human OP-I, residues 330-431 of SEQ ID NO: 1.
- a polypeptide suspected of being functionally equivalent to a reference bone morphogenic polypeptide is aligned therewith using the method of Needleman, et al, supra, implemented conveniently by computer programs such as the Align program (DNAstar, Inc.).
- Align program DNAstar, Inc.
- amino acid sequence homology is understood herein to include both amino acid sequence identity and similarity.
- homologous sequences share identical and/or similar amino acid residues, where similar residues are conservation substitutions for, or "allowed point mutations" of, corresponding amino acid residues in an aligned reference sequence.
- a candidate polypeptide sequence that shares 70% amino acid homology with a reference sequence is one in which any 70% of the aligned residues are either identical to, or are conservative substitutions of, the corresponding residues in a reference sequence.
- the reference sequence is OP-I.
- Certain particularly preferred bone morphogenic polypeptides share at least 60% amino acid identity with the preferred reference sequence of human OP-I , still more preferably at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 98% amino acid identity therewith.
- useful osteogenic proteins include those sharing the conserved seven cysteine domain and sharing at least 70% amino acid sequence homology (similarity) within the C-terminal active domain, as defined herein.
- the osteogenic proteins of the invention can be defined as osteogenically active proteins having any one of the generic sequences defined herein, including OPX (SEQ ID NO: 4) and Generic Sequences 7 (SEQ ID NO: 5) and 8 (SEQ ID NO: 6), or Generic Sequences 9 (SEQ ID NO: 7) and 10 (SEQ ID NO: 8).
- the family of bone morphogenic polypeptides useful in the present invention, and members thereof, can be defined by a generic amino acid sequence.
- Generic Sequence 7 (SEQ ID NO: 5) and Generic Sequence 8 (SEQ ID NO: 6) are 96 and 102 amino acid sequences, respectively, and accommodate the homologies shared among preferred protein family members identified to date, including at least OP-I, OP-2, OP-3, CBMP-2A, CBMP-2B, BMP-3, 6OA, DPP, VgI, BMP-5, BMP-6, Vgr-1, and GDF-I.
- the amino acid sequences for these proteins are described herein and/or in the art, as summarized above.
- the generic sequences include both the amino acid identity shared by these sequences in the C- terminal domain, defined by the six and seven cysteine skeletons (Generic Sequences 7 and 8, respectively), as well as alternative residues for the variable positions within the sequence.
- the generic sequences provide an appropriate cysteine skeleton where inter- or intramolecular disulfide bonds can form, and contain certain critical amino acids likely to influence the tertiary structure of the folded proteins.
- the generic sequences allow for an additional cysteine at position 36 (Generic Sequence 7) or position 41 (Generic Sequence 8), thereby encompassing the morphogenically active sequences of OP-2 and OP-3.
- Generic Sequence 8 (SEQ ID NO: 6) includes all of Generic Sequence 7 and in addition includes the following sequence (SEQ ID NO: 9) at its N-terminus:
- each "Xaa” in Generic Sequence 8 is a specified amino acid defined as for Generic Sequence 7, with the distinction that each residue number described for Generic Sequence 7 is shifted by five in Generic Sequence 8.
- Xaa at res.2 (Lys, Arg, Ala or GIn);
- Xaa at res.3 (Lys, Arg or Met);
- Xaa at res.4 (His, Arg or GIn);
- Xaa at res. 5 (GIu, Ser, His, GIy, Arg, Pro, Thr, or Tyr).
- useful osteogenic proteins include those defined by Generic Sequences 9 and 10, defined as follows.
- Generic Sequences 9 and 10 are composite amino acid sequences of the following proteins: human OP-I, human OP-2, human OP-3, human BMP-2, human BMP-3, human BMP-4, human BMP-5, human BMP-6, human BMP-8, human BMP-9, human BMP 10, human BMP-11, Drosophila 6OA, Xenopus Vg-I, sea urchin UNIVIN, human CDMP-I (mouse GDF-5), human CDMP-2 (mouse GDF-6, human BMP- 13), human CDMP-3 (mouse GDF-7, human BMP-12), mouse GDF-3, human GDF-I, mouse GDF-I, chicken DORSALIN, dpp, Drosophila SCREW, mouse NODAL, mouse GDF-8, human GDF-8, mouse GDF-9, mouse GDF-IO, human GDF-11, mouse GDF-11, human BMP-15, and rat BMP3b.
- Generic Sequence 9 is a 96 amino acid sequence that accommodates the C-terminal six cysteine skeleton and, like Generic Sequence 8, Generic Sequence 10 is a 102 amino acid sequence which accommodates the seven cysteine skeleton.
- Generic Sequence 9 Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaaa Xaaa Xaaa Xaaa Xaaa Xaaa Xaaa Xaaa Xaaa
- 63 (Ala, VaI or Thr); Xaa at res.
- 65 (Thr, Ala, GIu, VaI, GIy, Asp or Tyr); Xaa at res.
- 66 (GIn, Lys, GIu, Arg or VaI); Xaa at res.
- 67 (Leu, Met, Thr or Tyr); Xaa at res.
- 68 (Asn, Ser, GIy, Thr, Asp, GIu, Lys or VaI); Xaa at res.
- 69 (Ala, Pro, GIy or Ser); Xaa at res.
- 77 (Asp, Ser, Arg, Asn, GIu, Ala, Lys, GIy or Pro); Xaa at res.
- 78 (Ser, Asn, Asp, Tyr, Ala, GIy, GIn, Met, GIu, Asn or Lys); Xaa at res.
- 79 (Ser, Asn, GIu, Asp, VaI, Lys, GIy, GIn or Arg); Xaa at res.
- 80 (Asn, Lys, Thr, Pro, VaI, He, Arg, Ser or GIn); Xaa at res.
- 81 (VaI, He, Thr or Ala); Xaa at res.
- Generic Sequence 10 includes all of Generic Sequence 9 (SEQ ID NO: 7) and in addition includes the following sequence (SEQ ID NO: 9) at its N-terminus: SEO ID NO: 9
- each "Xaa” in Generic Sequence 10 is a specified amino acid defined as for Generic Sequence 9, with the distinction that each residue number described for Generic Sequence 9 is shifted by five in Generic Sequence 10.
- "Xaa at res. 1 ( Tyr, Phe, His, Arg, Thr, Lys, GIn, VaI or GIu)" in Generic Sequence 9 refers to Xaa at res. 6 in Generic Sequence 10.
- Xaa at res. 2 (Lys, Arg, GIn, Ser, His, GIu, Ala, or Cys); Xaa at res.
- bone morphogenic polypeptide sequences useful in this invention have greater than 60% identity, preferably greater than 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 98% identity, with the amino acid sequence defining the preferred reference sequence of hOP-1.
- useful bone morphogenic proteins include active proteins comprising pairs of polypeptide chains within the generic amino acid sequence herein referred to as "OPX" (SEQ ID NO: 4), which defines the seven cysteine skeleton and accommodates the homologies between several identified variants of OP-I and OP-2. As described therein, each Xaa at a given position independently is selected from the residues occurring at the corresponding position in the C-terminal sequence of mouse or human OP-I or OP-2.
- useful osteogenically active proteins have polypeptide chains with amino acid sequences comprising a sequence encoded by a nucleic acid that hybridizes, under low, medium or high stringency hybridization conditions, to DNA or RNA encoding reference bone morphogenic sequences, e.g., C-terminal sequences defining the conserved seven cysteine domains of OP-I, OP-2, BMP-2, BMP-4, BMP-5, BMP-6, 6OA, GDF-3, GDF-6, GDF-7 and the like.
- reference bone morphogenic sequences e.g., C-terminal sequences defining the conserved seven cysteine domains of OP-I, OP-2, BMP-2, BMP-4, BMP-5, BMP-6, 6OA, GDF-3, GDF-6, GDF-7 and the like.
- high stringent hybridization conditions are defined as hybridization according to known techniques in 40% formamide, 5 X SSPE, 5 X Denhardt's Solution, and 0.1% SDS at 37 0 C overnight, and washing in 0.1 X SSPE, 0.1% SDS at 5O 0 C.
- Standard stringent conditions are well characterized in commercially available, standard molecular cloning texts. See, for example, Molecular Cloning A Laboratory Manual, 2nd Ed., ed. by Sambrook, Fritsch and Maniatis (Cold Spring Harbor Laboratory Press: 1989); DNA Cloning, Volumes I and II (D.N. Glover ed., 1985); Oligonucleotide Synthesis (MJ.
- proteins useful in the present invention generally are dimeric proteins comprising a folded pair of the above polypeptides.
- Such bone morphogenic proteins are inactive when reduced, but are active as oxidized homodimers and when oxidized in combination with others of this invention to produce heterodimers.
- members of a folded pair of bone morphogenic polypeptides in a morphogenically active protein can be selected independently from any of the specific polypeptides mentioned above.
- the bone morphogenic protein is a monomer.
- the bone morphogenic proteins useful in the materials and methods of this invention include proteins comprising any of the polypeptide chains described above, whether isolated from naturally-occurring sources, or produced by recombinant DNA or other synthetic techniques, and includes allelic and phylogenetic counterpart variants of these proteins, as well as muteins thereof, fragments thereof and various truncated and fusion constructs. Deletion or addition mutants also are envisioned to be active, including those which may alter the conserved C-terminal six or seven cysteine domain, provided that the alteration does not functionally disrupt the relationship of these cysteines in the folded structure.
- the proteins may include forms having varying glycosylation patterns, varying N-termini, a family of related proteins having regions of amino acid sequence homology, and active truncated or mutated forms of native or biosynthetic proteins, produced by expression of recombinant DNA in host cells.
- the bone morphogenic proteins contemplated herein can be expressed from intact or truncated cDNA or from synthetic DNAs in prokaryotic or eukaryotic host cells, and purified, cleaved, refolded, and dimerized to form morphogenically active compositions.
- Currently preferred host cells include, without limitation, prokaryotes including E. coli or eukaryotes including yeast, or mammalian cells, such as CHO, COS or BSC cells.
- prokaryotes including E. coli or eukaryotes including yeast
- mammalian cells such as CHO, COS or BSC cells.
- the bone morphogenic protein includes, but is not limited to OP-I, OP-2, OP-3, BMP-2, BMP-3, BMP-4, BMP-5, BMP-6, ,BMP-8, BMP-9, BMP-10, BMP-I l, BMP-12, BMP-13, BMP-15, BMP-16, BMP-17, BMP-18, DPP, VgI, Vgr, 6OA protein, GDF-I, GDF-2, GDF-3, GDF-5, GDF-6, GDF-7, GDF-8, GDF-9, GDF-10, GDF-Il, GDF-12, CDMP-I, CDMP-2, CDMP- 3, NODAL, UNIVIN, SCREW, ADMP, NEURAL, and amino acid sequence variants thereof.
- the bone morphogenic protein comprises an amino acid sequence having at least 70% homology with the C-terminal 102- 106 amino acids, including the conserved seven cysteine domain, of human OP-I, said bone morphogenic protein being capable of inducing repair of bone and/or cartilage defects.
- the bone morphogenic protein is OP-I, BMP- 5, BMP-6, GDF-5, GDF-6 and GDF-7, CDMP-I, CDMP-2 or CDMP-3.
- the bone morphogenic protein is OP-I, BMP-5 or BMP-6.
- the bone morphogenic protein is OP-I.
- transfection refers to any genetic modification of cells and includes both “transfection” and “transduction”.
- transfection of cells refers to the acquisition by a cell of new genetic material by incorporation of added DNA.
- transfection refers to the insertion of nucleic acid (e.g., DNA) into a cell using physical or chemical methods.
- nucleic acid e.g., DNA
- transfection techniques are known to those of ordinary skill in the art including: calcium phosphate DNA co-precipitation (Methods in Molecular Biology, Vol. 7, Gene Transfer and Expression Protocols, Ed. E. J. Murray,
- transduction of cells refers to the process of transferring nucleic acid into a cell using a DNA or RNA virus.
- One or more isolated polynucleotide sequences encoding one or more interferon proteins contained within the virus may be incorporated into the chromosome of the transduced cell.
- a cell is transduced with a virus but the cell will not have the isolated polynucleotide incorporated into its chromosomes but will be capable of expressing interferon extrachromosomally within the cell.
- the cells are transformed (i.e., genetically modified) ex vivo.
- the cells are isolated from a mammal (preferably a human) and transformed (i.e., transduced or transfected in vitro) with a vector containing an isolated bone morphogenic polynucleotide gene operatively linked to one or more expression control sequences for expressing a recombinant protein.
- the cells are then administered to a mammalian recipient for delivery of the bone morphogenic protein in situ.
- the mammalian recipient is a human and the cells to be modified are autologous cells, i.e., the cells are isolated from the mammalian recipient.
- the cells are transformed or otherwise genetically modified in vivo.
- the cells from the mammalian recipient preferably a human
- the isolated polynucleotides encoding the bone morphogenic protein is introduced into the cell ex vivo or in vivo by genetic transfer methods, such as transfection or transduction, to provide a genetically modified cell.
- Various expression vectors i.e., vehicles for facilitating delivery of the isolated polynucleotide into a target cell
- the introduced genetic material includes an isolated polynucleotide such as bone morphogenic protein gene (usually in the form of a cDNA) together with a promoter to control transcription of the new gene.
- the promoter characteristically has a specific nucleotide sequence necessary to initiate transcription.
- the genetic material could include intronic sequences, which will be removed from the mature transcript by RNA splicing.
- a polyadenylation signal should be present at the 3' end of the gene to be expressed.
- the introduced genetic material also may include an appropriate secretion "signal" sequence for secreting the bone morphogenic protein from the cell to the extracellular milieu.
- the isolated genetic material further includes additional sequences (i.e., enhancers) required to obtain the desired gene transcription activity.
- enhancers i.e., an "enhancer” is simply any non- translated DNA sequence which works contiguous with the coding sequence (in cis) to change the basal transcription level dictated by the promoter.
- the isolated genetic material is introduced into the cell genome immediately downstream from the promoter so that the promoter and coding sequence are operatively linked so as to permit transcription of the coding sequence.
- Preferred viral expression vectors includes an exogenous promoter element to control transcription of the inserted bone morphogenic protein gene. Such exogenous promoters include both constitutive and inducible promoters.
- constitutive promoters control the expression of proteins that regulate essential cell functions. As a result, a gene under the control of a constitutive promoter is expressed under all conditions of cell growth.
- exemplary constitutive promoters include the promoters for the following genes which encode certain constitutive or "housekeeping" functions: hypoxanthine phosphoribosyl transferase (HPRT), dihydrofolate reductase (DHFR) (Scharfmann et al., Proc. Natl. Acad. Sci.
- SV40 See Bernoist and Chambon, Nature, 290:304 (1981)
- LTRs long terminal repeats
- Moloney Leukemia Virus and other retroviruses See Weiss et al., RNA Tumor Viruses, Cold Spring Harbor Laboratory, Cold Spring Harbor, N. Y. (1985)
- HSV Herpes Simplex Virus
- IEl cytomegalovirus immediate-early
- any of the above-referenced constitutive promoters can be used to control transcription of a gene insert.
- tissue specific promoters may be used to deliver the gene to a specific tissue.
- tumor specific promoters may be used (e.g., PSA promoter prostate carcinoma).
- Expression vectors compatible with mammalian host cells for use in gene therapy of tumor cells include, for example, plasmids; avian, murine and human retroviral vectors; adenovirus vectors; herpes viral vectors; parvoviruses; and non- replicative pox viruses.
- replication-defective recombinant viruses can be generated in packaging cell lines that produce only replication-defective viruses. See Current Protocols in Molecular Biology: Sections 9.10-9.14 (Ausubel et al., eds.), Greene Publishing Associates, 1989.
- Preferred vectors are DNA viruses that include adenoviruses (preferably Ad-2 or Ad-5 based vectors), herpes viruses (preferably herpes simplex virus based vectors), and parvoviruses (preferably "defective" or non-autonomous parvovirus based vectors, more preferably adeno-associated virus based vectors, most preferably AAV-2 based vectors).
- adenoviruses preferably Ad-2 or Ad-5 based vectors
- herpes viruses preferably herpes simplex virus based vectors
- parvoviruses preferably "defective" or non-autonomous parvovirus based vectors, more preferably adeno-associated virus based vectors, most preferably AAV-2 based vectors.
- the bone morphogenic proteins of this invention may be formulated into compositions having a variety of forms.
- the compositions of this invention will be administered at an effective dose to induce the particular type of tissue at the treatment site selected according to the particular clinical condition addressed. Determination of a preferred pharmaceutical formulation and a pharmaceutically and therapeutically efficient dose regiment for a given application is well within the skill of the art taking into consideration, for example, the administration mode, the condition and weight of the patient, the extent of desired treatment and the tolerance of the patient for the treatment.
- Doses expected to be suitable starting points for optimizing treatment regiments are based on the results of in vitro assays, and ex vivo or in vivo assays. Based on the results of such assays, a range of suitable bone morphogenic protein concentrations can be selected to test at a treatment site in animals and then in humans.
- compositions comprising a bone morphogenic protein this invention may be in a variety of forms. These include, for example, solid, semi-solid and liquid dosage forms such as tablets, pills, powders, liquid solutions or suspensions, suppositories, and injectable and infusible solutions.
- the preferred form depends on the intended mode of administration and therapeutic application and may be selected by one skilled in the art.
- Modes of administration may include systemic such as oral, parenteral (such as subcutaneous, intravenous, intraarterial, intralesional, intraosseous, intramuscular, intradermal, transdermal, transmucosal and inhalational), intraperitoneal, topical or local administration.
- the compositions may be formulated in dosage forms appropriate for each route of administration.
- the bone morphogenic proteins of this invention will be administered into the tumor. In other embodiments, the bone morphogenic proteins of this invention will be administered in the vicinity of the tumor. In other embodiments the bone morphogenic proteins of this invention will be administered locally into the tumor.
- the pharmaceutical compositions comprising the bone morphogenic proteins may, for example, be placed into sterile, isotonic formulations with or without cofactors which stimulate uptake or stability.
- the formulation is preferably liquid, or may be lyophilized powder.
- the bone morphogenic protein may be diluted with a formulation buffer.
- the solution can be lyophilized, stored under refrigeration and reconstituted prior to administration with sterile Water-For-Injection (USP).
- USP Water-For-Injection
- compositions also will preferably include conventional pharmaceutically acceptable carriers well known in the art (see for example Remington's Pharmaceutical Sciences, 16th Edition, 1980, Mac Publishing Company).
- Such pharmaceutically acceptable carriers may include other medicinal agents, carriers, genetic carriers, adjuvants, excipients, etc., such as human serum albumin or plasma preparations.
- the compositions are preferably in the form of a unit dose and will usually be administered as a dose regiment that depends on the particular tissue treatment.
- the carrier is isotonic with the blood or body fluids of the patient. Examples of such carrier vehicles include water, saline, Ringer's solution, a buffered solution, hyaluronan and dextrose solution.
- Non-aqueous vehicles such as fixed oils and ethyl oleate are also useful herein.
- the compositions are preferably in the form of a unit dose and will usually be administered as a dose regimen that depends on the particular tissue treatment.
- the bone morphogenic protein is formulated as a sustained release formulation. There are numerous sustained or slow delivery materials available for preparing the compositions of this invention.
- SABERTM System sucrose acetate isobutyrate (SAIB)
- DUROSTM mini-osmotic pump
- the bone morphogenic proteins of this invention may be dispersed in a biocompatible carrier material that functions as a suitable delivery system for the compounds.
- sustained release carriers include semipermeable polymer matrices.
- Implantable or microcapsular sustained release matrices include polylactides (U.S. Patent No. 3,773,319; EP 58,481), copolymers of L-glutamic acid and gamma-ethyl-L-glutamate (Sidman et al., Biopolymers, 22, pp. 547-56 (1985)); poly(2-hydroxyethyl-methacrylate), ethylene vinyl acetate (Langer et al., J. Biomed. Mater.
- the bone morphogenic protein of this invention may also be administered using, for example, microspheres, liposomes, other microparticulate delivery systems or sustained release formulations placed in, near, or otherwise in communication with affected tissues, the fluids bathing those tissues or bloodstream bathing those tissues.
- Liposomes containing a bone morphogenic protein of this invention can be prepared by well-known methods (See, e.g. DE 3,218,121; Epstein et al., Proc. Natl. Acad. Sci. U.S.A., 82, pp. 3688-92 (1985); Hwang et al., Proc. Natl. Acad. Sci. U.S.A., 77, pp. 4030-34 (1980); U.S. Patent Nos. 4,485,045 and 4,544,545). Ordinarily the liposomes are of the small (about 200-800 Angstroms) unilamellar type in which the lipid content is greater than about 30 mol.% cholesterol.
- the proportion of cholesterol is selected to control the optimal rate of bone morphogenic protein release.
- the bone morphogenic proteins of this invention may also be attached to liposomes containing other biologically active molecules such as immunosuppressive agents, cytokines, etc., to modulate the rate and characteristics of tissue induction. Attachment of bone morphogenic proteins to liposomes may be accomplished by any known cross-linking agent such as heterobifunctional cross-linking agents that have been widely used to couple toxins or chemotherapeutic agents to antibodies for targeted delivery.
- Conjugation to liposomes can also be accomplished using the carbohydrate-directed cross-linking reagent 4-(4-maleimidophenyl) butyric acid hydrazide (MPBH) (Duzgunes et al., J. Cell. Biochem. Abst. Suppl. 16E 77 (1992)).
- MPBH 4-(4-maleimidophenyl) butyric acid hydrazide
- a successful carrier for a bone morphogenic protein should perform several important functions. It should act as a delivery system of the bone morphogenic protein and protect the bone morphogenic protein from non-specific proteolysis.
- the carrier may also take the form of a hydrogel.
- the carrier material comprises a hydrogel, it refers to a three dimensional network of cross- linked hydrophilic polymers in the form of a gel substantially composed of water, preferably but not limited to gels being greater than 90% water.
- Hydrogel can carry a net positive or net negative charge, or may be neutral. A typical net negative charged hydrogel is alginate. Hydrogels carrying a net positive charge may be typified by extracellular matrix components such as collagen and laminin.
- extracellular matrix components examples include MatrigelTM and VitrogenTM.
- An example of a net neutral hydrogel is highly crosslinked polyethylene oxide, or polyvinyalcohol.
- Various growth factors, cytokines, hormones, trophic agents and therapeutic compositions including antibiotics and chemotherapeutic agents, enzymes, enzyme inhibitors and other bioactive agents also may be adsorbed onto or dispersed within the carrier material comprising the bone morphogenic protein, and will also be released over time and slowly absorbed.
- Dosage levels of between about 1 ⁇ g and about 1000 ⁇ g per day, preferably between 3 ⁇ g and 50 ⁇ g per day of the bone morphogenic protein are useful.
- the bone morphogenic protein of this invention may also be dispersed in an implantable biocompatible carrier material that functions as a suitable delivery or support system for the compounds.
- Suitable examples of carriers include semipermeable polymer matrices in the form of shaped articles such as suppositories or capsules.
- Implantable or microcapsular sustained release matrices include polylactides (U.S. Patent No. 3,773,319; EP 58,481), copolymers of L- glutamic acid and ethyl-L-glutamate (Sidman et al., Biopolymers, 22, pp.
- the carriers are sustained release carriers.
- the carrier comprises a biocompatible matrix made up of particles or porous materials. The pores are preferably of a dimension to permit progenitor cell migration and subsequent differentiation and proliferation.
- matrices known in the art can be employed (see, e.g., U. S. Patent Nos.
- the particle size should be within the range of 70 ⁇ m-850 ⁇ m, preferably 70 ⁇ m-420 ⁇ m, most preferably 150 ⁇ m-420 ⁇ m.
- the matrix may be fabricated by close packing particulate material into a shape spanning the particular tissue defect to be treated.
- a material that is biocompatible, and preferably biodegradable in vivo may be structured to serve as a temporary scaffold and substratum for recruitment of migratory progenitor cells, and as a base for their subsequent anchoring and proliferation.
- Useful matrix materials comprise, for example, collagen; homopolymers or copolymers of glycolic acid, lactic acid, and butyric acid, including derivatives thereof; and ceramics, such as hydroxyapatite, tricalcium phosphate and other calcium phosphates. Various combinations of these or other suitable matrix materials also may be useful as determined by the assays set forth herein.
- carriers include particulate, demineralized, guanidine-extracted, species-specific (allogenic) bone, and specially treated particulate, protein-extracted, demineralized xenogenic bone.
- such xenogenic bone powder matrices also may be treated with proteases such as trypsin.
- the xenogenic matrices are treated with one or more fibril modifying agents to increase the intraparticle intrusion volume (porosity) and surface area.
- Useful modifying agents include solvents such as dichloromethane, trichloroacetic acid, acetonitrile and acids such as trifluoroacetic acid and hydrogen fluoride.
- Preferred fibril-modifying agent useful in formulating the matrices of this invention is a heated aqueous medium, preferably an acidic aqueous medium having a pH less than about pH 4.5, most preferably having a pH within the range of about pH 2-pH 4.
- Preferred heated acidic aqueous medium is 0.1% acetic acid which has a pH of about 3.
- Heating demineralized, delipidated, guanidine- extracted bone collagen in an aqueous medium at elevated temperatures e.g., in the range of about 37°C-65°C, preferably in the range of about 45 0 C-OO 0 C
- elevated temperatures e.g., in the range of about 37°C-65°C, preferably in the range of about 45 0 C-OO 0 C
- the heat treatment alters the collagen fibrils, resulting in an increase in the particle surface area.
- Demineralized guanidine-extracted xenogenic bovine bone comprises a mixture of additional materials that may be fractionated further using standard biomolecular purification techniques. For example, chromatographic separation of extract components followed by addition back to active matrix of the various extract fractions corresponding to the cliromatogram peaks may be used to improve matrix properties by fractionating away inhibitors of bone or tissue-inductive activity.
- the matrix may also be substantially depleted in residual heavy metals. Treated as disclosed herein, individual heavy metal concentrations in the matrix can be reduced to less than about 1 ppm.
- One skilled in the art may create a biocompatible matrix of choice having a desired porosity or surface microtexture useful in the methods of this invention, or as a biodegradable sustained release implant.
- synthetically formulated matrices, prepared as disclosed herein, may be used.
- useful matrices may also be formulated synthetically by adding together reagents that have been appropriately modified.
- a matrix is the porous, biocompatible, in vivo biodegradable synthetic matrix disclosed in WO91/18558, the disclosure of which is hereby incorporated by reference.
- the matrix comprises a porous crosslinked structural polymer of biocompatible, biodegradable collagen, most preferably tissue-specific collagen, and appropriate, tissue-specific glycosaminoglycans as tissue-specific cell attachment factors.
- Bone tissue-specific collagen e.g., Type I collagen
- soluble collagen e.g., Type I collagen
- acid-soluble collagen e.g., acid-soluble collagen
- collagen soluble in neutral or basic aqueous solutions e.g., collagen derived from a number of sources
- Type II collagen as found in cartilage, also may be used in combination with Type I collagen.
- GAGs Glycosaminoglycans
- mucopolysaccharides are polysaccharides made up of residues of hexoamines glycosidically bound and alternating in a more-or-less regular manner with either hexouronic acid or hexose moieties.
- GAGs are of animal origin and have a tissue specific distribution (see, e.g., Dodgson et al., in Carbohydrate Metabolism and its Disorders, Dickens et al., eds., Vol. 1, Academic Press (1968)).
- Useful GAGs include those containing sulfate groups, such as hyaluronic acid, heparin, heparin sulfate, chondroitin 6-sulfate, chondroitin 4-sulfate, dermatan sulfate, and keratin sulfate.
- sulfate groups such as hyaluronic acid, heparin, heparin sulfate, chondroitin 6-sulfate, chondroitin 4-sulfate, dermatan sulfate, and keratin sulfate.
- chondroitin 6-sulfate currently is preferred.
- Other GAGs also may be suitable for forming the matrix described herein, and those skilled in the art will either know or be able to ascertain other suitable GAGs using no more than routine experimentation. For a more detailed description of mucopolysaccharides, see Aspinall, Polysaccharides, Pergamon Press, Oxford (1970).
- Collagen can be reacted with a GAG in aqueous acidic solutions, preferably in diluted acetic acid solutions.
- a GAG aqueous acidic solutions
- coprecipitates of tangled collagen fibrils coated with GAG results.
- This tangled mass of fibers then can be homogenized to form a homogeneous dispersion of fine fibers and then filtered and dried.
- Insolubility of the collagen-GAG products can be raised to the desired degree by covalently cross-linking these materials, which also serves to raise the resistance to resorption of these materials.
- any covalent G60 cross- linking method suitable for cross-linking collagen also is suitable for cross-linking these composite materials, although cross-linking by a dehydrothe ⁇ nal process is preferred.
- the cross-linked particles are essentially spherical with diameters of about 500 ⁇ m. Scanning electron microscopy shows pores of about 20 ⁇ m on the surface and 40 ⁇ m on the interior. The interior is made up of both fibrous and sheet-like structures, providing surfaces for cell attachment. The voids interconnect, providing access to the cells throughout the interior of the particle. The material appears to be roughly 99.5% void volume, making the material very efficient in terms of the potential cell mass that can be grown per gram of microcarrier.
- Another useful synthetic matrix is one formulated from biocompatible, in vivo biodegradable synthetic polymers, such as those composed of glycolic acid, lactic acid and/or butyric acid, including copolymers and derivatives thereof.
- polymers composed of polylactic acid (e.g., MW 100 ka), 80% polylactide/20% glycoside or poly 3-hydroxybutyric acid (e.g., MW 30 ka) all may be purchased from PolySciences, Inc.
- the polymer compositions generally are obtained in particulate form and the morphogenic devices preferably fabricated under nonaqueous conditions (e.g., in an ethanol-trifluoroacetic acid solution, EtOH/TFA) to avoid hydrolysis of the polymers.
- EtOH/TFA ethanol-trifluoroacetic acid solution
- one can alter the morphology of the particulate polymer compositions, for example to increase porosity, using any of a number of particular solvent treatments known in the art.
- Example 1 Cell culture and cell morphology study.
- Three human tumor cells lines were used as models: osteosarcoma cell lines SaOS-2 and MG-63 and lung carcinoma cell line A549.
- Cell lines were obtained from American Tissue Culture Collection (ATCC) and were grown and sustained in the appropriate media using standard techniques. Morphology of the cultured cells was monitored with an Olympus CK2 inverted microscope equipped with a CCD camera. Images were captured using phase contrast with 10Ox magnification.
- Example 2 BMP receptor mRNA expression.
- the cDNA probes for ActR-I, BMPR-IA 3 BMPR-IB, and BMPR-II were obtained by digestion of the corresponding plasmids with the appropriate restriction endonucleases as reported previously (Yeh et al., J Cell Physiol 185:87-97 (2000).
- the 580-bp ActR-I insert was obtained by digestion of the parent plasmid containing the ActR-I insert with EcoRI/Aval.
- the 530-bp BMPR-IA insert was obtained by digestion with Hindlll/PvuII.
- the 660-bp BMPR-IB insert was obtained by digestion with Hpal/Sacl.
- the 800-bp BMPR-II insert was obtained by Pstl digestion of hBMPR-II cloned in pCMV5.
- the resultant cDNA fragments were purified by agarose gel electrophoresis and were labeled with [ ⁇ - 32 P]dATP using the Strip-EZ DNA labeling system (Ambion Co, Austin, TX).
- the labeled cDNA probes were purified through a Midi-SELECT G-25 spin column (IBI, New Haven, CT) to remove the un-incorporated nucleotides.
- the 18S rRNA was probed with a 32 P -labeled, 18S-specific oligonucleotide with the following sequence: 5'- GCCGTGCGTACTTAGAC ATGC ATG-3' (SEQ ID NO: 10).
- Northern analyses were conducted to probe for the presence of mRNA for ActR-I, BMPR-IA, BMPR-IB and BMPR-II on osteosarcoma cell lines SaOS-2 and MG-63, lung carcinoma cell line A549, and prostate carcinoma cell line PC-3 as described previously using 20 ⁇ g of total RNAs. Briefly, 20 ⁇ g of total RNAs were denatured and analyzed on 2.2M formaldehyde/ 1% GTG agarose gels.
- RNA standards (0.24-9.5 kb) from Life technologies (Grand Island, NY) were used as size markers. After electrophoresis, the fractionated RNAs were transferred onto a "Nytran Plus" membrane using a Turboblot apparatus (Schleicher & Schuell, Inc., Keene, NH). After cutting the lane containing the standards from the blot, the RNAs were covalently linked to the membrane using the UV Crosslinker
- Example 3 Effects of OP-I on cell proliferation in vitro.
- the amount of radioactivity was determined by scintillation spectrometry in the presence of Econo-Safe cocktail (5 ml). The rate of cellular proliferation of the OP-I -treated samples was optionally defined as a percentage of the solvent-treated control.
- Cell proliferation was also evaluated by a tetrazolium colorimetric assay (CellTiter96AQ Cell Proliferation Assay, Promega, Madison, WI) following the manufacturer's instruction. Briefly, SaOS-2 cells were cultured in 96-well plates and treated in the presence of different concentrations of OP-I for 24 h beginning on the pre-determined day that depended on the doubling time of the specific cell line.
- Total cellular AP activity was measured with p-nitrophenyl phosphate as a substrate in 2-amino-2- methyl-1-propanol buffer, pH 10.3 at 37 0 C using a commercial assay kit (Sigma Chemical Co.). Reactions were terminated by the addition of 0.5N NaOH. Absorbance of the reaction mixture was measured at 405 nm using a MRX microplate reader (Dynex Technologies, Chantilly, VA). Protein was measured according to the method of Bradford using BSA as a standard. AP activity was expressed as nanomoles of p-nitrophenol liberated per ⁇ g of total cellular protein. The total AP activity of the OP-I -treated samples was normalized to the solvent- treated control as 1..
- Example 5 Effects of OP-I on tumor cell growth and differentiation in vivo in a nude mouse xenograft model.
- tumor cell lines were grown to mid-log in complete media. Cells were then treated with 100 ⁇ g/ml of OP-I for 24 h. After the 24h treatment period, cells were collected, washed, resuspended in MEM, and injected subcutaneously (10 6 cells in 0.1 ml HBSS) into the flank of young adult male BALB/C athymic nude mice (treated group). The control group for each tumor cell line tested received a single subcutaneous injection of tumor cells (10 6 cells in 0.1 ml HBSS) with exposure to OP-I .
- mice were monitored daily for general health and the development/progression of tumors via in-life measurement of tumor mass for 49 days after which they were necropised. The size of the tumor mass as a function of time is provided for the different tumor cell lines tested. Masses, when present, were excised, measured, and fixed in 10% neutral buffered formalin. Sections of liver, lung, and skin at injection site were also collected and fixed. Fixed tissue samples were embedded in paraffin, sectioned at 5 ⁇ , stained with hematoxylin and eosin (H&E), and examined microscopically. [0152] No masses were detected at the injection site in mice injected with either control MG-63 (see Figure 14) or SaOS-2 (see Figure 15) cell lines.
- mice injected with OP-I -treated MG-63 osteosarcoma cells tissue masses were detected at the site of injection and increased in size as a function of time (see Figure 14).
- masses were detected at the injection site in mice injected with either control A549 (see Figure 16) or PC-3 (see Figure 17) cell lines.
- tissue masses increased in size as a function of time (see Figures 16 and 17, respectively).
- tissue masses were detected at the site of injection and increased in size as a function of time.
- mice injected with OP-I alone exhibited ectopic bone containing bone marrow at the site of injection in all mice (8 of 8).
- Mice injected with PC-3 cells only showed carcinomas at the site of injection in 8 of 8 mice.
- Mice injected with a mixture of OP-I and PC-3 cells showed subcutaneous masses in 8 of 8 mice.
- Microscopic examination of these masses showed ectopic bone formation with some tumor cell foci in or adjacent to the bone nodule.
- Mice injected with control PC-3 cells exhibited tumor at the site of injection.
- the present study using four diverse human tumor cell lines in a nude mouse xenograft model shows that OP-I does not stimulate tumor cell growth and metastasis. Moreover, at high concentrations, OP-I suppresses tumor cell differentiation and stimulates ectopic bone formation.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Chemical & Material Sciences (AREA)
- Public Health (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Zoology (AREA)
- Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
The present invention provides methods of treating bone cancer, inducing differentiation of bone tumor cells, inhibiting bone tumor growth, inducing bone tumor regression or treating a hyperproliferative cell disorder by administering a pharmaceutically effective amount of a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein.
Description
METHODS FOR TREATING BONE TUMORS
Field of the Invention
[0001] The present invention relates to methods of treating bone cancer. More particularly, it relates to methods of inducing differentiation of tumor cells into bone.
Background of the Invention
[0002] Although bone cancer is not as prevalent as other forms of cancer, it represents 5 percent of all childhood cancers. There are 5000 new cases of primary bone cancer diagnosed each year in the U.S., approximately one fifth of which are osteosarcomas. Bone cancers can affect any bone in the body. There are two types of bone cancers - primary and secondary. Primary bone cancer refers to cancers which start in the bone, whereas secondary bone cancers refers to cancers which start in other parts of the body, such as breasts, lung, and prostate, and later metastasize to bone. [0003] There are several types of bone cancer, including osteosarcomas, chondrosarcomas and osteocarcinomas. Osteosarcomas (also referred to as osteogenic sarcomas or osteochondrosarcomas) are malignant tumors derived from bone cells. Chondrosarcomas are malignant tumors derived from cartilage cells and form in bone. Osteocarcinomas are metastatic carcinomas in bone. [0004] The exact cause of bone cancer is not known, but it is believed to be due to DNA mutations - either inherited or acquired after birth. Other suggested risk factors, include but are not limited to, teenage growth spurts, being tall for a
specific age, previous treatment with radiation for another type of cancer, presence of a benign (non-cancerous) bone disease, presence of certain rare, inherited cancers, such as Li-Fraumeni syndrome and retinoblastoma, lifestyle factors such as high-fat diets, lack of exercise, smoking and alcohol consumption. [0005] Treatment depends on the type of cancer, whether the primary tumor has metastasized, and the size and location of the primary tumor. The main types of therapy used to treat bone cancers include, but are not limited to, surgery, radiotherapy, chemotherapy, amputation (in the case of tumors in limbs) and replacement with bone graft or metal prostheses. [0006] Although there has been considerable progress in developing new regimens for treating bone cancers, such methods still subject patients untoward side effects, such as nausea, vomiting, anemia, hair loss, general malaise, fatigue, lowered resistance to infection, damage to body organs and depression. Therefore, there remains a need for new methods of treating patients suffering from bone cancers.
Summary of the Invention
[0007] Applicants have solved the above problem by discovering that treatment of tumors with a bone morphogenic protein results in differentiation of the tumor cells into bone. Accordingly, in some embodiments, the invention provides a method of treating bone cancer in a mammal comprising the step of administering to the mammal a pharmaceutically effective amount of a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein. [0008] In some embodiments, the invention provides a method of inducing differentiation of bone tumor cells in a mammal comprising the step of administering to the mammal a pharmaceutically effective amount of a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein. In some embodiments, the invention also provides a method or inhibiting bone tumor growth in a mammal comprising the step of administering to the mammal a pharmaceutically effective amount of a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein. In yet other embodiments, the invention provides a method of inducing bone tumor regression in a mammal comprising the step of administering to the mammal a pharmaceutically effective amount of a
bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein.
[0009] In some embodiments, the tumor is a sarcoma or a carcinoma. In a preferred embodiment, the sarcoma is an osteosarcoma. [0010] In some embodiments, the invention provides a method of treating a hyperproliferative cell disorder in a mammal comprising the step of administering to the mammal a pharmaceutically effective amount of a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein. In some embodiments, the hyperproliferative cell is selected from the group consisting of bone, lung and prostate cells.
[0011] In some embodiments, the bone morphogenic protein includes, but is not limited to, OP-I, OP-2, OP-3, BMP-2, BMP-3, BMP-4, BMP-5, BMP-6, BMP-8, BMP-9, BMP-IO, BMP-Il, BMP-12, BMP-13, BMP-15, BMP-16, BMP-17, BMP-18, DPP, VgI, Vgr, 6OA protein, GDF-I, GDF-2, GDF-3, GDF-5, GDF-6, GDF-7, GDF-8, GDF-9, GDF-IO, GDF-11, GDF-12, CDMP-I, CDMP-2, CDMP- 3, NODAL, UNIVIN, SCREW, ADMP, NEURAL, and fragments thereof. In some embodiments, the bone morphogenic protein is selected from the group consisting of OP-I, BMP-5, BMP-6, GDF-5, GDF-6 and GDF-7, CDMP-I, CDMP-2 and CDMP-3. In some embodiments, the bone morphogenic protein is selected from the group consisting of OP-I, BMP-5 and BMP-6. Preferably, the bone morphogenic protein is OP-I.
[0012] In some embodiments, the bone morphogenic protein comprises an amino acid sequence having at least 70% homology with the C-terminal 102-106 amino acids, including the conserved seven cysteine domain, of human OP-I. [0013] In some embodiments, the nucleic acid used in the invention is a viral vector comprising a gene that encodes a bone morphogenic protein, and wherein the viral vector, includes but not limited to, an adenoviral vector, a lentiviral vector, a baculoviral vector, an Epstein Barr viral vector, a papovaviral vector, a vaccinia viral vector and a herpes simplex viral vector. In a preferred embodiment, the viral vector is an adenoviral vector, a baculoviral vector or a lentiviral vector. More preferably, the viral vector is an adenoviral vector.
- A -
[0014] In some embodiments, the invention provides a bone morphogenic protein or nucleic acid formulated as a gel, an aqueous solution, a paste or a putty. In some embodiments, the formulation is a sustained release formulation. In some embodiments, the bone morphogenic protein or nucleic acid encoding it is formulated for local administration.
Brief Description of the Drawings
[0015] Figure 1 shows the effect of OP-I on cell morphology and cell counts (viable and total cell counts) in the osteosarcoma cell line SaOS-2. Cells were treated with either 0.5 μg/ml or 100 μg/ml of OP-I for 24 h. Cell morphology was monitored using an inverted microscope equipped with a CCD camera. Viable and total cell counts (value in parentheses) were determined using the trypan blue exclusion assay.
[0016] Figure 2 shows the effect of OP-I on cell morphology and cell counts (viable and total cell counts) in the osteosarcoma cell line MG-63. Cells were treated with either 0.5 μg/ml or 100 μg/ml of OP-I for 24 h. Cell morphology was monitored using an inverted microscope equipped with a CCD camera. Viable and total cell counts (value in parentheses) were determined using the trypan blue exclusion assay. [0017] Figure 3 shows the effect of OP-I on cell morphology and cell counts (viable and total cell counts) in the lung carcinoma cell line A549. Cells were treated with either 0.5 μg/ml or 100 μg/ml of OP-I for 24 h. Cell morphology was monitored using an inverted microscope equipped with a CCD camera. Viable and total cell counts (value in parentheses) were determined using the trypan blue exclusion assay. [0018] Figure 4 shows the niRNA expression of the BMP receptor ActR-I in the MG-63, A-549, PC-3 and SaOS-2 cell lines. Values were normalized to the 18S rRNA control (=1) and expressed as normalized intensity X 10,000. [0019] Figure 5 shows the mRNA expression of the BMP receptor BMPR-IA in the MG-63, A-549, PC-3 and SaOS-2 cell lines. Values were normalized to the 18S rRNA control (=1) and expressed as normalized intensity X 10,000.
[0020] Figure 6 shows the mRNA expression of the BMP receptor BMPR-IB in the MG-63, A-549, PC-3 and SaOS-2 cell lines. Values were normalized to the 18S rRNA control (=1) and expressed as normalized intensity X 10,000. [0021] Figure 7 shows the mRNA expression of the BMP receptor BMPR-II in the MG-63, A-549, PC-3 and SaOS-2 cell lines. Values were normalized to the 18S rRNA control (=1) and expressed as normalized intensity X 10,000. [0022] Figure 8 shows the effect of OP-I treatment on SaOS-2 cell proliferation. Treatment of SaOS-2 cells with OP-I increased cell proliferation in a dose- dependent manner, as measured by the tetrazolium colorimetric assay (CellTiter96AQ Cell Proliferation Assay) and monitoring color development at 490 nm. Values were normalized to control untreated cells (=1). [0023] Figure 9 shows the effect of OP-I treatment on MG-63 cell proliferation, as measured by thymidine incorporation. Values were normalized to control untreated cells (=1). [0024] Figure 10 shows the effect of OP- 1 treatment on A549 cell proliferation, as measured by thymidine incorporation. Values were normalized to control untreated cells (=1).
[0025] Figure 11 shows the effect of OP-I treatment on PC-3 cell proliferation, as measured by thymidine incorporation. Values were normalized to control untreated cells (=1).
[0026] Figure 12 shows the effect of OP-I treatment on the alkaline phosphatase activity in SaOS-2 cells. Values are normalized to solvent-treated control cells
H)-
[0027] Figure 13 shows the effect of OP-I treatment on the alkaline phosphatase activity in MG-63 cells. Values are normalized to solvent-treated control cells
[0028] Figure 14 shows the in vivo mass growth of MG-63 cells in nude mice injected with control or OP-1-treated cells as a function of post-injection time. Each experiment included n=8 for both the control and OP-1-treated groups. Control mice were also observed for 49 days and no growth/tumors were detected. [0029] Figure 15 shows the in vivo mass growth of SaOS-2 cells in nude mice injected with control or OP-1-treated cells as a function of post-injection time.
Each experiment included n=8 for both the control and OP-1-treated groups.
Control mice were also observed for 49 days and no growth/tumors were detected.
[0030] Figure 16 shows the in vivo mass growth of A549 cells in nude mice injected with control or OP-1-treated cells as a function of post-injection time. Each experiment included n=8 for both the control and OP-1-treated groups.
[0031] Figure 17 shows the in vivo mass growth of PC-3 cells in nude mice injected with control or OP-1-treated cells as a function of post-injection time.
Each experiment included n=8 for both the control and OP-1-treated groups.
[0032] Figure 18 shows the histological appearance of a subcutaneous bone nodule containing bone marrow in a nude mouse injected with MG-63 cells treated with OP-I. The histologic image is represented at a magnification of 200X.
[0033] Figure 19 shows that several tumor cell foci were present within the bone nodule in a nude mouse injected with OP-1-treated MG-63 osteosarcoma cells.
The histologic image is represented at a magnification of 10OX. [0034] Figure 2OA shows the histologic appearance of a subcutaneous mass comprised mainly of bone, bone marrow and focus of tumor cells in a nude mouse injected with OP-1-treated SaOS-02 osteosarcoma cells. The histologic image is represented at a magnification of 10OX.
[0035] Figure 2OB shows a higher magnification of the tumor mass shown in Figure 18 A. There is a distinct tumor cell bone marrow interface. The histologic image is represented at a magnification of 200X.
[0036] Figure 21 shows the histologic appearance of a subcutaneous mass comprised mainly of bone, bone marrow and focus of tumor cells in a nude mouse injected with OP-1-treated SaOS-02 osteosarcoma cells. The histologic image is represented at a magnification of 200X.
Detailed Description Of The Invention
[0037] In order that the invention herein described may be fully understood, the following detailed description is set forth.
[0038] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as those commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the
present invention, suitable methods and materials are described below. The materials, methods and examples are illustrative only, and are not intended to be limiting. AU publications, patents and other documents mentioned herein are incorporated by reference in their entirety. [0039] Throughout this specification, the word "comprise" or variations such as "comprises" or "comprising" will be understood to imply the inclusion of a stated integer or groups of integers but not the exclusion of any other integer or group of integers. [0040] In order to further define the invention, the following terms and definitions are provided herein.
[0041] The term "pharmaceutically effective amount" refers to an amount effective to repair, regenerate, promote, accelerate, prevent degradation, or form bone . A "pharmaceutically effective amount" also means the amount required to improve the clinical symptoms of a patient. The therapeutic methods or methods of treating cancer described herein are not to be interpreted or otherwise limited to "curing" cancer. Rather, the therapeutic methods and methods of treating cancer are intended to mean effecting a beneficial and/or desirable alteration in the general health of a patient suffering from cancer (e.g., bone cancer, lung cancer or prostate cancer). A skilled healthcare practitioner would recognize that such benefits and/or desirable effect include, but are not limited to tumor regression (decrease in tumor size), a decrease in metastasis, improved vital functions of the patient, improved well-being of the patient, decrease in pain, improved appetite, improvement in the patient's weight and any combination thereof. [0042] The term "patient" refers to an animal including a mammal (e.g., a human).
[0043] The term "pharmaceutically acceptable carrier or adjuvant" refers to a non-toxic carrier or adjuvant that may be administered to a patient, together with a morphogenic protein of this invention, and which does not destroy the pharmacological activity thereof. [0044] The term "bone morphogenic protein (BMP)" refers to a protein belonging to the BMP family of the TGF-β superfamily of proteins (BMP family) based on DNA and amino acid sequence homology. A protein belongs to the BMP
family according to this invention when it has at least 50% amino acid sequence identity with at least one known BMP family member within the conserved C- terminal cysteine-rich domain, which characterizes the BMP protein family. Preferably, the protein has at least 70% amino acid sequence identity with at least one known BMP family member within the conserved C-terminal cysteine rich domain. Members of the BMP family may have less than 50% DNA or amino acid sequence identity overall.
[0045] The term "amino acid sequence homology" is understood to include both amino acid sequence identity and similarity. Homologous sequences share identical and/or similar amino acid residues, where similar residues are conservative substitutions for, or "allowed point mutations" of, corresponding amino acid residues in an aligned reference sequence. Thus, a candidate polypeptide sequence that shares 70% amino acid homology with a reference sequence is one in which any 70% of the aligned residues are either identical to, or are conservative substitutions of, the corresponding residues in a reference sequence. Certain particularly preferred morphogenic polypeptides share at least 60%, and preferably 70% amino acid sequence identity with the C-terminal 102- 106 amino acids, defining the conserved seven-cysteine domain of human OP-I and related proteins. [0046] Amino acid sequence homology can be determined by methods well known in the art. For instance, to determine the percent homology of a candidate amino acid sequence to the sequence of the seven-cysteine domain, the two sequences are first aligned. The alignment can be made with, e.g., the dynamic programming algorithm described in Needleman et ah, J. MoI. Biol., 48, pp. 443 (1970), and the Align Program, a commercial software package produced by
DNAstar, Inc. The teachings by both sources are incorporated by reference herein. An initial alignment can be refined by comparison to a multi-sequence alignment of a family of related proteins. Once the alignment is made and refined, a percent homology score is calculated. The aligned amino acid residues of the two sequences are compared sequentially for their similarity to each other. Similarity factors include similar size, shape and electrical charge. One particularly preferred method of determining amino acid similarities is the PAM250 matrix described in
Dayhoff et al, Atlas of Protein Sequence and Structure, 5, pp. 345-352 (1978 & Supp.), which is incorporated herein by reference. A similarity score is first calculated as the sum of the aligned pair wise amino acid similarity scores. Insertions and deletions are ignored for the purposes of percent homology and identity. Accordingly, gap penalties are not used in this calculation. The raw score is then normalized by dividing it by the geometric mean of the scores of the candidate sequence and the seven-cysteine domain. The geometric mean is the square root of the product of these scores. The normalized raw score is the percent homology. [0047] The term "conservative substitutions" refers to residues that are physically or functionally similar to the corresponding reference residues. That is, a conservative substitution and its reference residue have similar size, shape, electric charge, chemical properties including the ability to form covalent or hydrogen bonds, or the like. Preferred conservative substitutions are those fulfilling the criteria defined for an accepted point mutation in Dayhoff et ah, supra. Examples of conservative substitutions are substitutions within the following groups: (a) valine, glycine; (b) glycine, alanine; (c) valine, isoleucine, leucine; (d) aspartic acid, glutamic acid; (e) asparagine, glutamine; (f) serine, threonine; (g) lysine, arginine, methionine; and (h) phenylalanine, tyrosine. The term "conservative variant" or "conservative variation" also includes the use of a substituting amino acid residue in place of an amino acid residue in a given parent amino acid sequence, where antibodies specific for the parent sequence are also specific for, i.e., "cross-react" or "immuno-react" with, the resulting substituted polypeptide sequence. [0048] The term "osteogenic protein (OP)" refers to a morphogenic protein that is capable of inducing a progenitor cell to form cartilage and/or bone. The bone may be intramembranous bone or endochondral bone. Most osteogenic proteins are members of the BMP protein family and are thus also BMPs. As described elsewhere herein, the class of proteins is typified by human osteogenic protein (hOP-1). Other osteogenic proteins useful in the practice of the invention include osteogenically active forms of OP-I, OP-2, OP-3, BMP-2, BMP-3, BMP-4, BMP- 5, BMP-6, BMP-8, BMP-9, BMP-IO, BMP-Il, BMP-12, BMP-13, BMP-15,
BMP-16, BMP-17, BMP-18, DPP, VgI, Vgr-1, 6OA protein, GDF-I, GDF-2, GDF-3, GDF-5, GDF-6, GDF-7, GDF-8, GDF-9, GDF-10, GDF-Il, GDF- 12, CDMP-I, CDMP-2, CDMP-3, UNIVIN, NODAL, SCREW, ADMP or NEURAL, and amino acid sequence variants thereof. Osteogenic proteins suitable for use with applicants' invention can be identified by means of routine experimentation using the art-recognized bioassay described by Reddi and Sampath (Sampath et al, Proc. Natl. Acad. Sci., 84, pp. 7109-13, incorporated herein by reference).
Methods and Compositions For Tumor Differentiation and Inhibition of Tumor Growth [0049] The bone morphogenic proteins and nucleic acids encoding the bone morphogenic proteins of this invention may be used for treating bone cancer. In some embodiments, a method of inducing differentiation of bone tumors using a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein is provided. In some embodiments, the invention also provides a method of inhibiting bone tumor growth in a mammal using a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein. In yet other embodiments, the invention provides a method of inducing bone tumor regression in a mammal using a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein. In some embodiments, the invention provides a method of treating a hyperproliferative cell disorder using a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein. The bone tumors according to this invention may be sarcomas or carcinomas. Preferably, the sarcoma is an osteosarcoma. [0050] In some embodiments, the bone cancer is a primary bone cancer (i.e., cancer which starts in the bone). In other embodiments, the bone cancer is a secondary bone cancer (i.e., the cancer starts in another part of the body and metastasizes to the bone).
Bone Morphogenic Protein Family
[0051] The BMP family, named for its representative bone morphogenic/osteogenic protein family members, belongs to the TGF-β protein superfamily. Of the reported "BMPs" (BMP-I to BMP-18), isolated primarily
based on sequence homology, all but BMP-I remain classified as members of the BMP family of morphogenic proteins (Ozkaynak et al, EMBO J., 9, pp. 2085-93 (1990)).
[0052] The BMP family includes other structurally-related members which are morphogenic proteins, including the drosophila decapentaplegic gene complex (DPP) products, the VgI product of Xenopus laevis and its murine homolog, Vgr-1 (see, e.g., Massague, Annu. Rev. Cell Biol, 6, pp. 597-641 (1990), incorporated herein by reference). [0053] The C-terminal domains of BMP-3, BMP-5, BMP-6, and OP-I (BMP-7) are about 60% identical to that of BMP-2, and the C-terminal domains of BMP-6 and OP-I are 87% identical. BMP-6 is likely the human homolog of the murine Vgr-1 (Lyons et al, Proc. Natl. Acad. Sci. U.S.A., 86, pp. 4554-59 (1989)); the two proteins are 92% identical overall at the amino acid sequence level (U. S. Patent No. 5,459,047, incorporated herein by reference). BMP-6 is 58% identical to the Xenopus Vg-I product.
[0054] The naturally occurring bone morphogenic proteins share substantial amino acid sequence homology in their C-terminal regions (domains). Typically, the naturally occurring osteogenic proteins are translated as a precursor, having an N-terminal signal peptide sequence typically less than about 30 residues, followed by a "pro" domain that is cleaved to yield the mature C-terminal domain of approximately 97-106 amino acids. The signal peptide is cleaved rapidly upon translation, at a cleavage site that can be predicted in a given sequence using the method of Von Heijne Nucleic Acids Research, 14, pp. 4683-4691 (1986). The pro domain typically is about three times larger than the fully processed mature C- terminal domain.
[0055] Another characteristic of the BMP protein family members is their apparent ability to dimerize. Several bone-derived osteogenic proteins (OPs) and BMPs are found as homo- and heterodimers in their active forms. The ability of OPs and BMPs to form heterodimers may confer additional or altered morphogenic inductive capabilities on bone morphogenic proteins. Heterodimers may exhibit qualitatively or quantitatively different binding affinities than homodimers for OP and BMP receptor molecules. Altered binding affinities may in turn lead to
differential activation of receptors that mediate different signaling pathways, which may ultimately lead to different biological activities or outcomes. Altered binding affinities could also be manifested in a tissue or cell type-specific manner, thereby inducing only particular progenitor cell types to undergo proliferation and/or differentiation.
[0056] In preferred embodiments, the pair of osteogenic polypeptides have amino acid sequences each comprising a sequence that shares a defined relationship with an amino acid sequence of a reference bone morphogenic protein. Herein, preferred osteogenic polypeptides share a defined relationship with a sequence present in osteogenically active human OP-I, SEQ ID NO: 1. However, any one or more of the naturally occurring or biosynthetic sequences disclosed herein similarly could be used as a reference sequence. Preferred osteogenic polypeptides share a defined relationship with at least the C-terminal six cysteine domain of human OP-I, residues 335-431 of SEQ ID NO: 1. Preferably, osteogenic polypeptides share a defined relationship with at least the C-terminal seven cysteine domain of human OP-I, residues 330-431 of SEQ ID NO: 1. That is, preferred polypeptides in a dimeric protein with bone morphogenic activity each comprise a sequence that corresponds to a reference sequence or is functionally equivalent thereto. [0057] Functionally equivalent sequences include functionally equivalent arrangements of cysteine residues disposed within the reference sequence, including amino acid insertions or deletions which alter the linear arrangement of these cysteines, but do not materially impair their relationship in the folded structure of the dimeric bone morphogenic protein, including their ability to form such intra- or inter-chain disulfide bonds as may be necessary for morphogenic activity. Functionally equivalent sequences further include those wherein one or more amino acid residues differs from the corresponding residue of a reference sequence, e.g., the C-terminal seven cysteine domain (also referred to herein as the conserved seven cysteine skeleton) of human OP-I, provided that this difference does not destroy bone morphogenic activity. Accordingly, conservative substitutions of corresponding amino acids in the reference sequence are preferred. Amino acid residues that are conservative substitutions for corresponding residues
in a reference sequence are those that are physically or functionally similar to the corresponding reference residues, e.g., that have similar size, shape, electric charge, chemical properties including the ability to form covalent or hydrogen bonds, or the like. Particularly preferred conservative substitutions are those fulfilling the criteria defined for an accepted point mutation in Dayhoff et al. , supra, the teachings of which are incorporated by reference herein. [0058] The osteogenic protein OP-I has been described (see, e.g., Oppermann et al, U. S. Patent No. 5,354,557, incorporated herein by reference). Natural-sourced osteogenic protein in its mature, native form is a glycosylated dimer typically having an apparent molecular weight of about 30-36 kDa as determined by SDS- PAGE. When reduced, the 30 kDa protein gives rise to two glycosylated peptide subunits having apparent molecular weights of about 16 kDa and 18 kDa. In the reduced state, the protein has no detectable osteogenic activity. The unglycosylated protein, which also has osteogenic activity, has an apparent molecular weight of about 27 kDa. When reduced, the 27 kDa protein gives rise to two unglycosylated polypeptides, having molecular weights of about 14 kDa to 16 kDa, capable of inducing endochondral bone formation in a mammal. Osteogenic proteins may include forms having varying glycosylation patterns, varying N- termini, and active truncated or mutated forms of native protein. As described above, particularly useful sequences include those comprising the C-terminal 96 or 102 amino acid sequences of DPP (from Drosophila), VgI (from Xenopus), Vgr-1 (from mouse), the OP-I and OP-2 ρroteins,(see U.S. Pat. No. 5,011,691 and Oppermann et al, incorporated herein by reference), as well as the proteins referred to as BMP-2, BMP-3, BMP-4 (see WO88/00205, U.S. Patent No. 5,013,649 and WO91/18098, incorporated herein by reference), BMP-5 and BMP- 6 (see WO90/11366, PCT/US90/01630, incorporated herein by reference), BMP-8 and BMP-9.
[0059] Preferred osteogenic proteins of this invention comprise at least one polypeptide including, but not limited to OP-I (BMP-7), OP-2, OP-3, COP-I, COP-3, COP-4, COP-5, COP-7, COP-16, BMP-2, BMP-3, BMP-3b, BMP-4,
BMP-5, BMP-6, BMP-9, BMP-IO, BMP-Il, BMP-12, BMP-13, BMP-14, BMP- 15, BMP-16, BMP-17, BMP-18, GDF-I, GDF-2, GDF-3, GDF-5, GDF-6, GDF-7,
GDF-8, GDF-9, GDF-IO, GDF-Il, GDF-12, MP121, CDMP-I, CDMP-2, CDMP- 3, dorsalin-1, DPP, Vg-I, Vgr-1, 6OA protein, NODAL, UNIVIN, SCREW, ADMP, NEURAL, TGF-β, amino acid sequence variants and homologs thereof, including species homologs, thereof and fragments thereof. Preferably, the osteogenic protein comprises at least one polypeptide selected from OP-I (BMP- 7), BMP-2, BMP-4, BMP-5, BMP-6, GDF-5, GDF-6, GDF-7, CDMP-I, CDMP-2 or CDMP-3; more preferably, OP-I (BMP-7), BMP-5, BMP-6, GDF-5, GDF-6, GDF-7, CDMP-I, CDMP-2 or CDMP-3; even more preferably, OP-I (BMP-7), BMP-5 or BMP-6; and most preferably, OP-I (BMP-7). [0060] Publications disclosing these sequences, as well as their chemical and physical properties, include: OP-I and OP-2 (U.S. Patent No. 5,011,691; U.S. Patent No. 5,266,683; Ozkaynak et al, EMBO J., 9, pp. 2085-2093 (1990); OP-3 (WO94/10203 (PCT US93/10520)); BMP-2, BMP-3, BMP-4, (WO88/00205; Wozney et al Science, 242, pp. 1528-1534 (1988)); BMP-5 and BMP-6, (Celeste et al, PNAS, 87, 9843-9847 (1991)); Vgr-1 (Lyons et al, PNAS, 86, pp. 4554- 4558 (1989)); DPP (Padgett et al Nature, 325, pp. 81-84 (1987)); Vg-I (Weeks, Cell, 51, pp. 861-867 (1987)); BMP-9 (WO95/33830 (PCT7US95/07084); BMP-IO (WO94/26893 (PCT/US94/05290); BMP-Il (WO94/26892 (PCT/US94/05288); BMP-12 (WO95/16035 (PCT/US94/14030); BMP-13 (WO95/16035 (PCT/US94/14030); GDF-I (WO92/00382 (PCT/US91/04096) and Lee et al PNAS, 88, pp. 4250-4254 (1991); GDF-8 (WO94/21681 (PCT/US94/03019); GDF-9 (WO94/15966 (PCTYUS94/00685); GDF-IO (WO95/10539 (PCT/US94/11440); GDF-Il (WO96/01845 (PCT/US95/08543); BMP-15 (WO96/36710 (PCT/US96/06540); MP-121 (WO96/01316 (PCT/EP95/02552); GDF-5 (CDMP-I, MP52) (WO94/15949 (PCT/US94/00657) and WO96/14335 (PCT/US94/12814) and WO93/16099 (PCT/EP93/00350)); GDF-6 (CDMP-2, BMP13) (WO95/01801 (PCT/US94/07762) and WO96/14335 and WO95/10635 (PCT/US94/14030)); GDF-7 (CDMP-3, BMP12) (WO95/10802 (PCTVUS94/07799) and WO95/10635 (PCT/US94/14030)); BMP-17 and BMP-18 (U.S. Patent No. 6,027,917). The above publications are incorporated herein by reference.
[0061] In another embodiment, useful proteins include biologically active biosynthetic constructs, including novel biosynthetic bone morphogenic proteins and chimeric proteins designed using sequences from two or more known bone morphogenic proteins. [0062] In another embodiment of this invention, a bone morphogenic protein or osteogenic protein may be prepared synthetically to induce tissue formation. Bone morphogenic proteins prepared synthetically may be native, or may be non-native proteins, i.e., those not otherwise found in nature. [0063] Non-native osteogenic proteins have been synthesized using a series of consensus DNA sequences (U.S . Patent No. 5,324,819, incorporated herein by reference). These consensus sequences were designed based on partial amino acid sequence data obtained from natural osteogenic products and on their observed homologies with other genes reported in the literature having a presumed or demonstrated developmental function. [0064] Several of the biosynthetic consensus sequences (called consensus osteogenic proteins or "COPs") have been expressed as fusion proteins in prokaryotes (see, e.g., U.S. Pat. No. 5,011,691, incorporated herein by reference. These include COP-I, COP-3, COP-4, COP-5, COP-7 and COP- 16, as well as other proteins known in the art. Purified fusion proteins may be cleaved, refolded, implanted in an established animal model and shown to have bone- and/or cartilage-inducing activity. The currently preferred synthetic osteogenic proteins comprise two synthetic amino acid sequences designated COP-5 (SEQ. ID NO: 2) and COP-7 (SEQ. ID NO: 3). [0065] Oppermann et al, U. S. Patent Nos. 5,011,691 and 5,324,819, which are incorporated herein by reference, describe the amino acid sequences of COP-5 and COP-7 as shown below: COP5 LYVDFS-DVGWDDWIVAPPGYQAFYCHGECPFPLAD
COP7 LYVDFS-DVGWNDWΓVAPPGYHAFYCHGECPFPLAD
COP5 HFNSTN--H-AVVQTLVNSVNSKI-PKACCVPTELSA COP7 HLNSTN--H-AVVQTLVNSVNSKI-PKACCVPTELSA
COP5 ISMLYLDENEKVVLKYNQEMVVEGCGCR COP7 ISMLYLDENEKVVLKYNQEMVVEGCGCR [0066] In these amino acid sequences, the dashes (-) are used as fillers only to line up comparable sequences in related proteins. Differences between the aligned amino acid sequences are highlighted.
[0067] The DNA and amino acid sequences of these and other BMP family members are published and may be used by those of skill in the art to determine whether a newly identified protein belongs to the BMP family. New BMP-related gene products are expected by analogy to possess at least one bone morphogenic activity and thus classified as a BMP.
[0068] In one preferred embodiment of this invention, the bone morphogenic protein comprises a pair of subunits disulfide bonded to produce a dimeric species, wherein at least one of the subunits comprises a recombinant peptide belonging to the BMP protein family. In another preferred embodiment of this invention, the bone morphogenic protein comprises a pair of subunits that produce a dimeric species formed through non-covalent interactions, wherein at least one of the subunits comprises a recombinant peptide belonging to the BMP protein family. Non-covalent interactions include Van der Waals, hydrogen bond, hydrophobic and electrostatic interactions. The dimeric species may be a homodimer or heterodimer and is capable of inducing cell proliferation and/or tissue formation. In other preferred embodiments, the bone morphogenic protein is a monomer. [0069] In certain preferred embodiments, bone morphogenic proteins useful herein include those in which the amino acid sequences comprise a sequence sharing at least 70% amino acid sequence homology or "similarity", and preferably 75%, 80%, 85%, 90%, 95%, or 98% homology or similarity, with a reference bone morphogenic protein selected from the foregoing naturally occurring proteins. Preferably, the reference protein is human OP-I, and the reference sequence thereof is the C-terminal seven cysteine domain present in osteogenically active forms of human OP-I, residues 330-431 of SEQ ID NO: 1. In certain embodiments, a polypeptide suspected of being functionally equivalent to a reference bone morphogenic polypeptide is aligned therewith using the method of Needleman, et al, supra, implemented conveniently by computer programs
such as the Align program (DNAstar, Inc.). As noted above, internal gaps and amino acid insertions in the candidate sequence are ignored for purposes of calculating the defined relationship, conventionally expressed as a level of amino acid sequence homology or identity, between the candidate and reference sequences. "Amino acid sequence homology" is understood herein to include both amino acid sequence identity and similarity. Homologous sequences share identical and/or similar amino acid residues, where similar residues are conservation substitutions for, or "allowed point mutations" of, corresponding amino acid residues in an aligned reference sequence. Thus, a candidate polypeptide sequence that shares 70% amino acid homology with a reference sequence is one in which any 70% of the aligned residues are either identical to, or are conservative substitutions of, the corresponding residues in a reference sequence. In a currently preferred embodiment, the reference sequence is OP-I. Bone morphogenic proteins useful herein accordingly include allelic, phylogenetic counterpart and other variants of the preferred reference sequence, whether naturally-occurring or biosynthetically produced (e.g., including "muteins" or "mutant proteins"), as well as novel members of the general morphogenic family of proteins, including those set forth and identified above. Certain particularly preferred bone morphogenic polypeptides share at least 60% amino acid identity with the preferred reference sequence of human OP-I , still more preferably at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 98% amino acid identity therewith. [0070] In another embodiment, useful osteogenic proteins include those sharing the conserved seven cysteine domain and sharing at least 70% amino acid sequence homology (similarity) within the C-terminal active domain, as defined herein. In still another embodiment, the osteogenic proteins of the invention can be defined as osteogenically active proteins having any one of the generic sequences defined herein, including OPX (SEQ ID NO: 4) and Generic Sequences 7 (SEQ ID NO: 5) and 8 (SEQ ID NO: 6), or Generic Sequences 9 (SEQ ID NO: 7) and 10 (SEQ ID NO: 8). [0071] The family of bone morphogenic polypeptides useful in the present invention, and members thereof, can be defined by a generic amino acid sequence. For example, Generic Sequence 7 (SEQ ID NO: 5) and Generic Sequence 8 (SEQ
ID NO: 6) are 96 and 102 amino acid sequences, respectively, and accommodate the homologies shared among preferred protein family members identified to date, including at least OP-I, OP-2, OP-3, CBMP-2A, CBMP-2B, BMP-3, 6OA, DPP, VgI, BMP-5, BMP-6, Vgr-1, and GDF-I. The amino acid sequences for these proteins are described herein and/or in the art, as summarized above. The generic sequences include both the amino acid identity shared by these sequences in the C- terminal domain, defined by the six and seven cysteine skeletons (Generic Sequences 7 and 8, respectively), as well as alternative residues for the variable positions within the sequence. The generic sequences provide an appropriate cysteine skeleton where inter- or intramolecular disulfide bonds can form, and contain certain critical amino acids likely to influence the tertiary structure of the folded proteins. In addition, the generic sequences allow for an additional cysteine at position 36 (Generic Sequence 7) or position 41 (Generic Sequence 8), thereby encompassing the morphogenically active sequences of OP-2 and OP-3. Generic Sequence 7
Leu Xaa Xaa Xaa Phe Xaa Xaa
1 5
Xaa GIy Trp Xaa Xaa Xaa Xaa Xaa Xaa Pro
10 15
Xaa Xaa Xaa Xaa Ala Xaa Tyr Cys Xaa GIy
20 25
Xaa Cys Xaa Xaa Pro Xaa Xaa Xaa Xaa Xaa
30 35
Xaa Xaa Xaa Asn His Ala Xaa Xaa Xaa Xaa
40 45
Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa
50 55
Xaa Xaa Xaa Cys Cys Xaa Pro Xaa Xaa Xaa
60 65
Xaa Xaa Xaa Xaa Xaa Leu Xaa Xaa Xaa Xaa
70 75
Xaa Xaa Xaa VaI Xaa Leu Xaa Xaa Xaa Xaa
80 85
Xaa Met Xaa VaI Xaa Xaa Cys Xaa Cys Xaa
90 95
wherein each Xaa independently is selected from a group of one or more specified amino acids defined as follows: "res." means "residue" and Xaa at res.2 = (Tyr or
Lys); Xaa at res.3 = VaI or He); Xaa at res.4 = (Ser, Asp or GIu); Xaa at res.6 = (Arg, GIn, Ser, Lys or Ala); Xaa at res.7 = (Asp or GIu); Xaa at res.8 = (Leu, VaI or He); Xaa at res. 11 = (GIn, Leu, Asp, His, Asn or Ser); Xaa at res.12 = (Asp, Arg, Asn or GIu); Xaa at res.13 = (Trp or Ser); Xaa at res.14 = (lie or VaI); Xaa at res.15 = (He or VaI); Xaa at res.16 (Ala or Ser); Xaa at res.18 = (GIu, GIn, Leu, Lys, Pro or Arg); Xaa at res.19 = (GIy or Ser); Xaa at res.20 = (Tyr or Phe); Xaa at res.21 = (Ala, Ser, Asp, Met, His, GIn, Leu or GIy); Xaa at res.23 = (Tyr, Asn or Phe); Xaa at res.26 = (GIu, His, Tyr, Asp, GIn, Ala or Ser); Xaa at res.28 = (GIu, Lys, Asp, GIn or Ala); Xaa at res.30 = (Ala, Ser, Pro, GIn, He or Asn); Xaa at res.31 = (Phe, Leu or Tyr); Xaa at res.33 = (Leu, VaI or Met); Xaa at res.34 =
(Asn, Asp, Ala, Thr or Pro); Xaa at res.35 = (Ser, Asp, GIu, Leu, Ala or Lys); Xaa at res.36 = (Tyr, Cys, His, Ser or He); Xaa at res.37 = (Met, Phe, GIy or Leu); Xaa at res.38 = (Asn, Ser or Lys); Xaa at res.39 = (Ala, Ser, GIy or Pro); Xaa at res.40 = (Thr, Leu or Ser); Xaa at res.44 = (He, VaI or Thr); Xaa at res.45 = (VaI, Leu, Met or He); Xaa at res.46 = (GIn or Arg); Xaa at res.47 = (Thr, Ala or Ser); Xaa at res.48 = (Leu or He); Xaa at res.49 = (VaI or Met); Xaa at res.50 = (His, Asn or Arg); Xaa at res.51 = (Phe, Leu, Asn, Ser, Ala or VaI); Xaa at res.52 =(Ile, Met, Asn, Ala, VaI, GIy or Leu); Xaa at res.53 = (Asn, Lys, Ala, GIu, GIy or Phe); Xaa at res.54 = (Pro, Ser or VaI); Xaa at res.55 = (GIu, Asp, Asn, GIy, VaI, Pro or Lys); Xaa at res.56 = (Thr, Ala, VaI, Lys, Asp, Tyr, Ser, GIy, He or His); Xaa at res.57 = (VaI, Ala or He); Xaa at res.58 = (Pro or Asp); Xaa at res.59 = (Lys, Leu or GIu); Xaa at res.60 = (Pro, VaI or Ala); Xaa at res.63 = (Ala or VaI); Xaa at res.65 = (Thr, Ala or GIu); Xaa at res.66 = (GIn, Lys, Arg or GIu); Xaa at res.67 = (Leu, Met or VaI); Xaa at res.68 = (Asn, Ser, Asp or GIy); Xaa at res.69 =(Ala, Pro or Ser); Xaa at res.70 = (He, Thr, VaI or Leu); Xaa at res.71 = (Ser, Ala or Pro); Xaa at res.72 = (VaI, Leu, Met or He); Xaa at res.74 = (Tyr or Phe); Xaa at res.75 = (Phe, Tyr, Leu or His); Xaa at res.76 = (Asp, Asn or Leu); Xaa at res.77 = (Asp, GIu, Asn, Arg or Ser); Xaa at res.78 = (Ser, GIn, Asn, Tyr or Asp); Xaa at res.79 = (Ser, Asn, Asp, GIu or Lys); Xaa at res.80 = (Asn, Thr or Lys); Xaa at res.82 = (He, VaI or Asn); Xaa at res.84 = (Lys or Arg); Xaa at res.85 = (Lys, Asn, GIn,
His, Arg or VaI); Xaa at res.86 = (Tyr, GIu or His); Xaa at res.87 = (Arg, GIn, GIu or Pro); Xaa at res.88 = (Asn, GIu, Trp or Asp); Xaa at res.90 = (VaI, Thr, Ala or
He); Xaa at res.92 = (Arg, Lys, VaI, Asp, GIn or GIu); Xaa at res.93 = (Ala, GIy, GIu or Ser); Xaa at res.95 = (GIy or Ala) and Xaa at res.97 = (His or Arg). [0072] Generic Sequence 8 (SEQ ID NO: 6) includes all of Generic Sequence 7 and in addition includes the following sequence (SEQ ID NO: 9) at its N-terminus:
SEO ID NO: 9
Cys Xaa Xaa Xaa Xaa
1 5
Accordingly, beginning with residue 7, each "Xaa" in Generic Sequence 8 is a specified amino acid defined as for Generic Sequence 7, with the distinction that each residue number described for Generic Sequence 7 is shifted by five in Generic Sequence 8. Thus, "Xaa at res.2 =(Tyr or Lys)" in Generic Sequence 7 refers to Xaa at res. 7 in Generic Sequence 8. In Generic Sequence 8, Xaa at res.2 = (Lys, Arg, Ala or GIn); Xaa at res.3 = (Lys, Arg or Met); Xaa at res.4 = (His, Arg or GIn); and Xaa at res. 5 = (GIu, Ser, His, GIy, Arg, Pro, Thr, or Tyr). [0073] In another embodiment, useful osteogenic proteins include those defined by Generic Sequences 9 and 10, defined as follows.
[0074] Specifically, Generic Sequences 9 and 10 are composite amino acid sequences of the following proteins: human OP-I, human OP-2, human OP-3, human BMP-2, human BMP-3, human BMP-4, human BMP-5, human BMP-6, human BMP-8, human BMP-9, human BMP 10, human BMP-11, Drosophila 6OA, Xenopus Vg-I, sea urchin UNIVIN, human CDMP-I (mouse GDF-5), human CDMP-2 (mouse GDF-6, human BMP- 13), human CDMP-3 (mouse GDF-7, human BMP-12), mouse GDF-3, human GDF-I, mouse GDF-I, chicken DORSALIN, dpp, Drosophila SCREW, mouse NODAL, mouse GDF-8, human GDF-8, mouse GDF-9, mouse GDF-IO, human GDF-11, mouse GDF-11, human BMP-15, and rat BMP3b. Like Generic Sequence 7, Generic Sequence 9 is a 96 amino acid sequence that accommodates the C-terminal six cysteine skeleton and, like Generic Sequence 8, Generic Sequence 10 is a 102 amino acid sequence which accommodates the seven cysteine skeleton. Generic Sequence 9
Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa
1 5 10
Xaa Xaa Xaa Xaa Xaa Xaa Pro Xaa Xaa Xaa
15 20
Xaa Xaa Xaa Xaa Cys Xaa GIy Xaa Cys Xaa
25 30
Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa
35 40
Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa
45 50
Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa
55 60
Xaa Cys Xaa Pro Xaa Xaa Xaa Xaa Xaa Xaa
65 70
Xaa Xaa Leu Xaa Xaa Xaa Xaa Xaa Xaa Xaa
75 80
Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa
85 90
Xaa Xaa Xaa Cys Xaa Cys Xaa
95
wherein each Xaa is independently selected from a group of one or more specified amino acids defined as follows: "res." means "residue" and Xaa at res. 1 = (Phe, Leu or GIu); Xaa at res. 2 = (Tyr, Phe, His, Arg, Thr, Lys, GIn, VaI or GIu); Xaa at res. 3 = (VaI, lie, Leu or Asp); Xaa at res. 4 = (Ser, Asp, GIu, Asn or Phe); Xaa at res. 5 = (Phe or GIu); Xaa at res. 6 = (Arg, GIn, Lys, Ser, GIu, Ala or Asn); Xaa at res. 7 = (Asp, GIu, Leu, Ala or GIn); Xaa at res. 8 = (Leu, VaI, Met, He or Phe); Xaa at res. 9 = (GIy, His or Lys); Xaa at res. 10 = (Trp or Met); Xaa at res. 11 = (GIn, Leu, His, GIu, Asn, Asp, Ser or GIy); Xaa at res. 12 = (Asp, Asn, Ser, Lys, Arg, GIu or His); Xaa at res. 13 = (Trp or Ser); Xaa at res. 14 = (He or VaI); Xaa at res. 15 = (He or VaI); Xaa at res. 16 = (Ala, Ser, Tyr or Trp); Xaa at res. 18 = (GIu, Lys, GIn, Met, Pro, Leu, Arg, His or Lys); Xaa at res. 19 = (GIy, GIu, Asp, Lys, Ser, GIn, Arg or Phe); Xaa at res. 20 = (Tyr or Phe); Xaa at res. 21 = (Ala, Ser, GIy, Met, GIn, His, GIu, Asp, Leu, Asn, Lys or Thr); Xaa at res. 22 = (Ala or Pro); Xaa at res. 23 = (Tyr, Phe, Asn, Ala or Arg); Xaa at res. 24 = (Tyr, His, GIu, Phe or Arg); Xaa at res. 26 = (GIu, Asp, Ala, Ser, Tyr, His, Lys, Arg, GIn or GIy); Xaa at res. 28 = (GIu, Asp, Leu, VaI, Lys, GIy, Thr, Ala or GIn); Xaa at res. 30 = (Ala,
Ser, He, Asn, Pro, GIu, Asp, Phe, GIn or Leu); Xaa at res. 31= (Phe, Tyr, Leu, Asn, GIy or Arg); Xaa at res. 32 = (Pro, Ser, Ala or VaI); Xaa at res. 33 = (Leu, Met, GIu, Phe or VaI); Xaa at res. 34 = (Asn, Asp, Thr, GIy, Ala, Arg, Leu or Pro); Xaa at res. 35 = (Ser, Ala, GIu, Asp, Thr, Leu, Lys, GIn or His); Xaa at res. 36 = (Tyr, His, Cys, He, Arg, Asp, Asn, Lys, Ser, GIu or GIy); Xaa at res. 37 = (Met, Leu,
Phe, VaI, GIy or Tyr); Xaa at res. 38 = (Asn, GIu, Thr, Pro, Lys, His, GIy, Met, VaI or Arg); Xaa at res. 39 = (Ala, Ser, GIy, Pro or Phe); Xaa at res. 40 = (Thr, Ser, Leu, Pro, His or Met); Xaa at res. 41 = (Asn, Lys, VaI, Thr or GIn); Xaa at res. 42 = (His, Tyr or Lys); Xaa at res. 43 = (Ala, Thr, Leu or Tyr); Xaa at res. 44 = (He, Thr, VaI, Phe, Tyr, Met or Pro); Xaa at res. 45 = (VaI, Leu, Met, He or His); Xaa at res. 46 = (GIn, Arg or Thr); Xaa at res. 47 = (Thr, Ser, Ala, Asn or His); Xaa at res. 48 = (Leu, Asn or He); Xaa at res. 49 = (VaI, Met, Leu, Pro or He); Xaa at res. 50 = (His, Asn, Arg, Lys, Tyr or GIn); Xaa at res. 51 = (Phe, Leu, Ser, Asn, Met, Ala, Arg, GIu, GIy or GIn); Xaa at res. 52 = (He, Met, Leu, VaI, Lys, GIn, Ala or Tyr); Xaa at res. 53 = (Asn, Phe, Lys, GIu, Asp, Ala, GIn, GIy, Leu or VaI); Xaa at res. 54 = (Pro, Asn, Ser, VaI or Asp); Xaa at res. 55 = (GIu, Asp, Asn, Lys, Arg, Ser, GIy, Thr, GIn, Pro or His); Xaa at res. 56 = (Thr, His, Tyr, Ala, He, Lys, Asp, Ser, GIy or Arg); Xaa at res. 57 = (VaI, He, Thr, Ala, Leu or Ser); Xaa at res. 58 = (Pro, GIy, Ser, Asp or Ala); Xaa at res. 59 = (Lys, Leu, Pro, Ala, Ser, GIu, Arg or GIy); Xaa at res. 60 = (Pro, Ala, VaI, Thr or Ser); Xaa at res. 61 = (Cys, VaI or Ser); Xaa at res. 63 = (Ala, VaI or Thr); Xaa at res. 65 = (Thr, Ala, GIu, VaI, GIy, Asp or Tyr); Xaa at res. 66 = (GIn, Lys, GIu, Arg or VaI); Xaa at res. 67 = (Leu, Met, Thr or Tyr); Xaa at res. 68 = (Asn, Ser, GIy, Thr, Asp, GIu, Lys or VaI); Xaa at res. 69 = (Ala, Pro, GIy or Ser); Xaa at res. 70 = (He, Thr, Leu or VaI); Xaa at res. 71 = (Ser, Pro, Ala, Thr, Asn or GIy); Xaa at res. 2 = (VaI, He, Leu or Met); Xaa at res. 74 = (Tyr, Phe, Arg, Thr, Tyr or Met); Xaa at res. 75 = (Phe, Tyr, His, Leu, He, Lys, GIn or VaI); Xaa at res. 76 = (Asp, Leu, Asn or GIu); Xaa at res. 77 = (Asp, Ser, Arg, Asn, GIu, Ala, Lys, GIy or Pro); Xaa at res. 78 = (Ser, Asn, Asp, Tyr, Ala, GIy, GIn, Met, GIu, Asn or Lys); Xaa at res. 79 = (Ser, Asn, GIu, Asp, VaI, Lys, GIy, GIn or Arg); Xaa at res. 80 = (Asn, Lys, Thr, Pro, VaI, He, Arg, Ser or GIn); Xaa at res. 81 = (VaI, He, Thr or Ala); Xaa at res. 82 = (He, Asn, VaI, Leu, Tyr, Asp or Ala); Xaa at res. 83 = (Leu, Tyr, Lys or He); Xaa at res. 84 = (Lys,
Arg, Asn, Tyr, Phe, Thr, GIu or GIy); Xaa at res. 85 = (Lys, Arg, His, GIn, Asn, GIu or VaI); Xaa at res. 86 = (Tyr, His, GIu or He); Xaa at res. 87 = (Arg, GIu, GIn, Pro or Lys); Xaa at res. 88 = (Asn, Asp, Ala, GIu, GIy or Lys); Xaa at res. 89 = (Met or Ala); Xaa at res. 90 = (VaI, He, Ala, Thr, Ser or Lys); Xaa at res. 91 = (VaI or Ala); Xaa at res. 92 = (Arg, Lys, GIn, Asp, GIu, VaI, Ala, Ser or Thr); Xaa at res. 93 = (Ala, Ser, GIu, GIy, Arg or Thr); Xaa at res. 95 = (GIy, Ala or Thr); Xaa at res. 97 = (His, Arg, GIy, Leu or Ser). Further, after res. 53 in rBMP3b and niGDF-10 there is an lie; after res. 54 in GDF-I there is a T ; after res. 54 in BMP3 there is a V; after res. 78 in BMP-8 and Dorsalin there is a G; after res. 37 in hGDF- 1 there is Pro, GIy, GIy, Pro.
[0075] Generic Sequence 10 (SEQ ID NO: 8) includes all of Generic Sequence 9 (SEQ ID NO: 7) and in addition includes the following sequence (SEQ ID NO: 9) at its N-terminus: SEO ID NO: 9
Cys Xaa Xaa Xaa Xaa
1 5
Accordingly, beginning with residue 6, each "Xaa" in Generic Sequence 10 is a specified amino acid defined as for Generic Sequence 9, with the distinction that each residue number described for Generic Sequence 9 is shifted by five in Generic Sequence 10. Thus, "Xaa at res. 1 = ( Tyr, Phe, His, Arg, Thr, Lys, GIn, VaI or GIu)" in Generic Sequence 9 refers to Xaa at res. 6 in Generic Sequence 10. In Generic Sequence 10, Xaa at res. 2 = (Lys, Arg, GIn, Ser, His, GIu, Ala, or Cys); Xaa at res. 3 = (Lys, Arg, Met, Lys, Thr, Leu, Tyr, or Ala); Xaa at res. 4 = (His, GIn, Arg, Lys, Thr, Leu, VaI, Pro, or Tyr); and Xaa at res. 5 = (GIn, Thr, His, Arg, Pro, Ser, Ala, GIn, Asn, Tyr, Lys, Asp, or Leu). [0076] As noted above, certain currently preferred bone morphogenic polypeptide sequences useful in this invention have greater than 60% identity, preferably greater than 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 98% identity, with the amino acid sequence defining the preferred reference sequence of hOP-1. These particularly preferred sequences include allelic and phylogenetic counterpart variants of the OP-I and OP-2 proteins, including the Drosophila 6OA protein. Accordingly, in certain particularly preferred embodiments, useful bone
morphogenic proteins include active proteins comprising pairs of polypeptide chains within the generic amino acid sequence herein referred to as "OPX" (SEQ ID NO: 4), which defines the seven cysteine skeleton and accommodates the homologies between several identified variants of OP-I and OP-2. As described therein, each Xaa at a given position independently is selected from the residues occurring at the corresponding position in the C-terminal sequence of mouse or human OP-I or OP-2.
Cys Xaa Xaa His GIu Leu Tyr VaI Ser Phe Xaa Asp Leu GIy Tip Xaa Asp Trp 1 5 10 15
Xaa He Ala Pro Xaa GIy Tyr Xaa Ala Tyr Tyr Cys GIu GIy GIu Cys Xaa Phe Pro
20 25 30 35
Leu Xaa Ser Xaa Met Asn Ala Thr Asn His Ala He Xaa GIn Xaa Leu VaI His Xaa
40 45 50 55 Xaa Xaa Pro Xaa Xaa VaI Pro Lys Xaa Cys Cys Ala Pro Thr Xaa Leu Xaa Ala
60 65 70
Xaa Ser VaI Leu Tyr Xaa Asp Xaa Ser Xaa Asn VaI He Leu Xaa Lys Xaa Arg 75 80 85 90
Asn Met VaI VaI Xaa Ala Cys GIy Cys His 95 100 wherein Xaa at res. 2 = (Lys or Arg); Xaa at res. 3 = (Lys or Arg); Xaa at res. 11 = (Arg or GIn); Xaa at res. 16 = (GIn or Leu); Xaa at res. 19 = (He or VaI); Xaa at res. 23 = (GIu or GIn); Xaa at res. 26 = (Ala or Ser); Xaa at res. 35 = (Ala or Ser); Xaa at res. 39 = (Asn or Asp); Xaa at res. 41 = (Tyr or Cys); Xaa at res. 50 = (VaI
56 = (Phe or Leu); Xaa at res. 57 = (He or Met); Xaa at res. 58 = (Asn or Lys); Xaa at res. 60 = (GIu, Asp or Asn); Xaa at res. 61 = (Thr, Ala or VaI); Xaa at res. 65 = (Pro or Ala); Xaa at res. 71 = (GIn or Lys); Xaa at res. 73 = (Asn or Ser); Xaa at res. 75 = (He or Thr); Xaa at res. 80 = (Phe or Tyr); Xaa at res. 82 = (Asp or Ser); Xaa at res. 84 = (Ser or Asn); Xaa at res. 89 = (Lys or Arg); Xaa at res. 91 = (Tyr or His); and Xaa at res. 97 = (Arg or Lys).
[0077] In still another preferred embodiment, useful osteogenically active proteins have polypeptide chains with amino acid sequences comprising a sequence encoded by a nucleic acid that hybridizes, under low, medium or high stringency hybridization conditions, to DNA or RNA encoding reference bone morphogenic sequences, e.g., C-terminal sequences defining the conserved seven cysteine domains of OP-I, OP-2, BMP-2, BMP-4, BMP-5, BMP-6, 6OA, GDF-3,
GDF-6, GDF-7 and the like. As used herein, high stringent hybridization conditions are defined as hybridization according to known techniques in 40% formamide, 5 X SSPE, 5 X Denhardt's Solution, and 0.1% SDS at 370C overnight, and washing in 0.1 X SSPE, 0.1% SDS at 5O0C. Standard stringent conditions are well characterized in commercially available, standard molecular cloning texts. See, for example, Molecular Cloning A Laboratory Manual, 2nd Ed., ed. by Sambrook, Fritsch and Maniatis (Cold Spring Harbor Laboratory Press: 1989); DNA Cloning, Volumes I and II (D.N. Glover ed., 1985); Oligonucleotide Synthesis (MJ. Gait ed., 1984): Nucleic Acid Hybridization (B. D. Hames & SJ. Higgins eds. 1984); and B. Perbal, A Practical Guide To Molecular Cloning (1984), the disclosures of which are incorporated herein by reference. [0078] As noted above, proteins useful in the present invention generally are dimeric proteins comprising a folded pair of the above polypeptides. Such bone morphogenic proteins are inactive when reduced, but are active as oxidized homodimers and when oxidized in combination with others of this invention to produce heterodimers. Thus, members of a folded pair of bone morphogenic polypeptides in a morphogenically active protein can be selected independently from any of the specific polypeptides mentioned above. In some embodiments, the bone morphogenic protein is a monomer. [0079] The bone morphogenic proteins useful in the materials and methods of this invention include proteins comprising any of the polypeptide chains described above, whether isolated from naturally-occurring sources, or produced by recombinant DNA or other synthetic techniques, and includes allelic and phylogenetic counterpart variants of these proteins, as well as muteins thereof, fragments thereof and various truncated and fusion constructs. Deletion or addition mutants also are envisioned to be active, including those which may alter the conserved C-terminal six or seven cysteine domain, provided that the alteration does not functionally disrupt the relationship of these cysteines in the folded structure. Accordingly, such active forms are considered the equivalent of the specifically described constructs disclosed herein. The proteins may include forms having varying glycosylation patterns, varying N-termini, a family of related proteins having regions of amino acid sequence homology, and active truncated or
mutated forms of native or biosynthetic proteins, produced by expression of recombinant DNA in host cells.
[0080] The bone morphogenic proteins contemplated herein can be expressed from intact or truncated cDNA or from synthetic DNAs in prokaryotic or eukaryotic host cells, and purified, cleaved, refolded, and dimerized to form morphogenically active compositions. Currently preferred host cells include, without limitation, prokaryotes including E. coli or eukaryotes including yeast, or mammalian cells, such as CHO, COS or BSC cells. One of ordinary skill in the art will appreciate that other host cells can be used to advantage. Detailed descriptions of the bone morphogenic proteins useful in the practice of this invention, including how to make, use and test them for osteogenic activity, are disclosed in numerous publications, including U.S. Patent Nos. 5,266,683 and 5,011,691, the disclosures of which are incorporated by reference herein, as well as in any of the publications recited herein, the disclosures of which are incorporated herein by reference .
[0081] Thus, in view of this disclosure and the knowledge available in the art, skilled genetic engineers can isolate genes from cDNA or genomic libraries of various different biological species, which encode appropriate amino acid sequences, or construct DNAs from oligonucleotides, and then can express them in various types of host cells, including both prokaryotes and eukaryotes, to produce large quantities of active proteins capable of stimulating bone and cartilage morphogenesis in a mammal. In addition, the skilled worker can also prepare nucleic acid molecules which express the proteins of this invention in vivo. [0082] In some embodiments, the bone morphogenic protein includes, but is not limited to OP-I, OP-2, OP-3, BMP-2, BMP-3, BMP-4, BMP-5, BMP-6, ,BMP-8, BMP-9, BMP-10, BMP-I l, BMP-12, BMP-13, BMP-15, BMP-16, BMP-17, BMP-18, DPP, VgI, Vgr, 6OA protein, GDF-I, GDF-2, GDF-3, GDF-5, GDF-6, GDF-7, GDF-8, GDF-9, GDF-10, GDF-Il, GDF-12, CDMP-I, CDMP-2, CDMP- 3, NODAL, UNIVIN, SCREW, ADMP, NEURAL, and amino acid sequence variants thereof. In some embodiments, the bone morphogenic protein comprises an amino acid sequence having at least 70% homology with the C-terminal 102- 106 amino acids, including the conserved seven cysteine domain, of human OP-I,
said bone morphogenic protein being capable of inducing repair of bone and/or cartilage defects.
[0083] In a preferred embodiment, the bone morphogenic protein is OP-I, BMP- 5, BMP-6, GDF-5, GDF-6 and GDF-7, CDMP-I, CDMP-2 or CDMP-3. In a more preferred embodiment, the bone morphogenic protein is OP-I, BMP-5 or BMP-6. In a most preferred embodiment, the bone morphogenic protein is OP-I.
Gene Therapy
[0084] As used herein, the term "transformation" or "transform" refers to any genetic modification of cells and includes both "transfection" and "transduction". [0085] As used herein, "transfection of cells" refers to the acquisition by a cell of new genetic material by incorporation of added DNA. Thus, transfection refers to the insertion of nucleic acid (e.g., DNA) into a cell using physical or chemical methods. Several transfection techniques are known to those of ordinary skill in the art including: calcium phosphate DNA co-precipitation (Methods in Molecular Biology, Vol. 7, Gene Transfer and Expression Protocols, Ed. E. J. Murray,
Humana Press (1991)); DEAE-dextran (supra); electroporation (supra); cationic liposome-mediated transfection (supra); and tungsten particle-facilitated microparticle bombardment (Johnston, S. A., Nature 346: 776-777 (1990)); and strontium phosphate DNA co-precipitation (Brash D. E. et al. Molec. Cell. Biol. 7: 2031-2034 (1987). Each of these methods is well represented in the art.
[0086] As used herein, "transduction of cells" refers to the process of transferring nucleic acid into a cell using a DNA or RNA virus. One or more isolated polynucleotide sequences encoding one or more interferon proteins contained within the virus may be incorporated into the chromosome of the transduced cell. Alternatively, a cell is transduced with a virus but the cell will not have the isolated polynucleotide incorporated into its chromosomes but will be capable of expressing interferon extrachromosomally within the cell.
[0087] According to one embodiment of the invention, the cells are transformed (i.e., genetically modified) ex vivo. The cells are isolated from a mammal (preferably a human) and transformed (i.e., transduced or transfected in vitro) with a vector containing an isolated bone morphogenic polynucleotide gene operatively linked to one or more expression control sequences for expressing a recombinant
protein. The cells are then administered to a mammalian recipient for delivery of the bone morphogenic protein in situ. Preferably, the mammalian recipient is a human and the cells to be modified are autologous cells, i.e., the cells are isolated from the mammalian recipient. [0088] According to another embodiment, the cells are transformed or otherwise genetically modified in vivo. The cells from the mammalian recipient (preferably a human), are transformed (i.e., transduced or transfected) in vivo with a vector containing isolated polynucleotide such as a recombinant gene operatively linked to one or more expression control sequences for expressing a bone morphogenic protein and the protein is delivered in situ.
[0089] The isolated polynucleotides encoding the bone morphogenic protein is introduced into the cell ex vivo or in vivo by genetic transfer methods, such as transfection or transduction, to provide a genetically modified cell. Various expression vectors (i.e., vehicles for facilitating delivery of the isolated polynucleotide into a target cell) are known to one of ordinary skill in the art. [0090] Typically, the introduced genetic material includes an isolated polynucleotide such as bone morphogenic protein gene (usually in the form of a cDNA) together with a promoter to control transcription of the new gene. The promoter characteristically has a specific nucleotide sequence necessary to initiate transcription. Optionally, the genetic material could include intronic sequences, which will be removed from the mature transcript by RNA splicing. A polyadenylation signal should be present at the 3' end of the gene to be expressed. The introduced genetic material also may include an appropriate secretion "signal" sequence for secreting the bone morphogenic protein from the cell to the extracellular milieu.
[0091] Optionally, the isolated genetic material further includes additional sequences (i.e., enhancers) required to obtain the desired gene transcription activity. For the purpose of this discussion an "enhancer" is simply any non- translated DNA sequence which works contiguous with the coding sequence (in cis) to change the basal transcription level dictated by the promoter. Preferably, the isolated genetic material is introduced into the cell genome immediately downstream from the promoter so that the promoter and coding sequence are
operatively linked so as to permit transcription of the coding sequence. Preferred viral expression vectors includes an exogenous promoter element to control transcription of the inserted bone morphogenic protein gene. Such exogenous promoters include both constitutive and inducible promoters. [0092] Naturally-occurring constitutive promoters control the expression of proteins that regulate essential cell functions. As a result, a gene under the control of a constitutive promoter is expressed under all conditions of cell growth. Exemplary constitutive promoters include the promoters for the following genes which encode certain constitutive or "housekeeping" functions: hypoxanthine phosphoribosyl transferase (HPRT), dihydrofolate reductase (DHFR) (Scharfmann et al., Proc. Natl. Acad. Sci. USA 88: 4626-4630 (1991)), adenosine deaminase, phosphoglycerol kinase (PGK), pyruvate kinase, phosphoglycerol mutase, the .beta.-actin promoter (Lai et al., Proc. Natl. Acad. Sci. USA 86: 10006-10010 (1989)), and other constitutive promoters known to those of skill in the art. [0093] In addition, many viral promoters function constitutively in eucaryotic cells. These include: the early and late promoters of SV40 (See Bernoist and Chambon, Nature, 290:304 (1981)); the long terminal repeats (LTRs) of Moloney Leukemia Virus and other retroviruses (See Weiss et al., RNA Tumor Viruses, Cold Spring Harbor Laboratory, Cold Spring Harbor, N. Y. (1985)); the thymidine kinase promoter of Herpes Simplex Virus (HSV) (See Wagner et al., Proc. Nat. Acad. Sci. USA, 78: 1441(1981)); the cytomegalovirus immediate-early (IEl) promoter (See Karasuyama et al., J. Exp. Med., 169: 13 (1989); the promoter of the Rous sarcoma virus (RSV) (Yamamoto et al., Cell, 22:787 (1980)); the adenovirus major late promoter (Yamada et al., Proc. Nat. Acad. Sci. USA, 82: 3567 (1985)), among many others. Accordingly, any of the above-referenced constitutive promoters can be used to control transcription of a gene insert. In some embodiments, tissue specific promoters may be used to deliver the gene to a specific tissue. In other embodiments, tumor specific promoters may be used (e.g., PSA promoter prostate carcinoma). [0094] Selection and optimization of these factors for delivery of a pharmaceutically effective amount of a particular bone morphogenic protein is within the scope of one of ordinary skill in the art.
[0095] Any of the methods known in the art for the insertion of polynucleotide sequences into a vector may be used. See, for example, Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N. Y. (1989) and Ausubel et al., Current Protocols in Molecular Biology, J. Wiley & Sons, NY (1992). Conventional vectors consist of appropriate transcriptional/translational control signals operably bone morphogenic protein. [0096] Expression vectors compatible with mammalian host cells for use in gene therapy of tumor cells include, for example, plasmids; avian, murine and human retroviral vectors; adenovirus vectors; herpes viral vectors; parvoviruses; and non- replicative pox viruses. In particular, replication-defective recombinant viruses can be generated in packaging cell lines that produce only replication-defective viruses. See Current Protocols in Molecular Biology: Sections 9.10-9.14 (Ausubel et al., eds.), Greene Publishing Associates, 1989.
[0097] Specific viral vectors for use in gene transfer systems are now well established. See, e.g., Madzak et al., J. Gen. Virol., 73: 1533-36 (1992)
(papovavirus SV40); Berkner et al., Curr. Top. Microbiol. Immunol., 158: 39-61 (1992) (adenovirus); Moss et al., Curr. Top. Microbiol. Immunol., 158: 25-38 (1992) (vaccinia virus); Muzyczka, Curr. Top. Microbiol. Immunol., 158: 97-123 (1992) (adeno-associated virus); Margulskee, Curr. Top. Microbiol. Immunol., 158: 67-93 ( 1992) (herpes simplex virus (HSV) and Epstein-Barr virus (HBV)); Miller, Curr. Top. Microbiol. Immunol, 158: 1-24 (1992) (retrovirus); Brandyopadhyay et al., MoI. Cell. Biol., 4: 749-754 (1984) (retrovirus); Miller et al., Nature, 357: 455-450 (1992) (retrovirus); Anderson, Science, 256: 808-813 (1992) (retrovirus). [0098] Preferred vectors are DNA viruses that include adenoviruses (preferably Ad-2 or Ad-5 based vectors), herpes viruses (preferably herpes simplex virus based vectors), and parvoviruses (preferably "defective" or non-autonomous parvovirus based vectors, more preferably adeno-associated virus based vectors, most preferably AAV-2 based vectors). See, e.g., AIi et al., Gene Therapy 1: 367- 384,1994; U.S. Pat. Nos. 4,797,368 and 5,399,346.
Pharmaceutical Compositions
[0099] The bone morphogenic proteins of this invention may be formulated into compositions having a variety of forms. The compositions of this invention will be administered at an effective dose to induce the particular type of tissue at the treatment site selected according to the particular clinical condition addressed. Determination of a preferred pharmaceutical formulation and a pharmaceutically and therapeutically efficient dose regiment for a given application is well within the skill of the art taking into consideration, for example, the administration mode, the condition and weight of the patient, the extent of desired treatment and the tolerance of the patient for the treatment.
[0100] Doses expected to be suitable starting points for optimizing treatment regiments are based on the results of in vitro assays, and ex vivo or in vivo assays. Based on the results of such assays, a range of suitable bone morphogenic protein concentrations can be selected to test at a treatment site in animals and then in humans.
[0101] The pharmaceutical compositions comprising a bone morphogenic protein this invention may be in a variety of forms. These include, for example, solid, semi-solid and liquid dosage forms such as tablets, pills, powders, liquid solutions or suspensions, suppositories, and injectable and infusible solutions. The preferred form depends on the intended mode of administration and therapeutic application and may be selected by one skilled in the art. Modes of administration may include systemic such as oral, parenteral (such as subcutaneous, intravenous, intraarterial, intralesional, intraosseous, intramuscular, intradermal, transdermal, transmucosal and inhalational), intraperitoneal, topical or local administration. The compositions may be formulated in dosage forms appropriate for each route of administration. In some embodiments, the bone morphogenic proteins of this invention will be administered into the tumor. In other embodiments, the bone morphogenic proteins of this invention will be administered in the vicinity of the tumor. In other embodiments the bone morphogenic proteins of this invention will be administered locally into the tumor.
[0102] The pharmaceutical compositions comprising the bone morphogenic proteins may, for example, be placed into sterile, isotonic formulations with or
without cofactors which stimulate uptake or stability. The formulation is preferably liquid, or may be lyophilized powder. For example, the bone morphogenic protein may be diluted with a formulation buffer. The solution can be lyophilized, stored under refrigeration and reconstituted prior to administration with sterile Water-For-Injection (USP).
[0103] The compositions also will preferably include conventional pharmaceutically acceptable carriers well known in the art (see for example Remington's Pharmaceutical Sciences, 16th Edition, 1980, Mac Publishing Company). Such pharmaceutically acceptable carriers may include other medicinal agents, carriers, genetic carriers, adjuvants, excipients, etc., such as human serum albumin or plasma preparations. The compositions are preferably in the form of a unit dose and will usually be administered as a dose regiment that depends on the particular tissue treatment. [0104] Preferably, the carrier is isotonic with the blood or body fluids of the patient. Examples of such carrier vehicles include water, saline, Ringer's solution, a buffered solution, hyaluronan and dextrose solution. Non-aqueous vehicles such as fixed oils and ethyl oleate are also useful herein. The compositions are preferably in the form of a unit dose and will usually be administered as a dose regimen that depends on the particular tissue treatment. [0105] In some embodiments, the bone morphogenic protein is formulated as a sustained release formulation. There are numerous sustained or slow delivery materials available for preparing the compositions of this invention. They include, but are not limited to, microspheres of polylactic/polyglycolic acid polymers, liposomes, collagen, hyaluronic acid/fibrin matrices, hyaluronic acid, fibrin, chitosan, gelatin, SABER™ System (sucrose acetate isobutyrate (SAIB)),
DURIN™ (biodegradabale polymer for drug loaded implants), MICRODUR™
(biodegradable polymers/microencapsulation) and DUROS™ (mini-osmotic pump).
[0106] The bone morphogenic proteins of this invention may be dispersed in a biocompatible carrier material that functions as a suitable delivery system for the compounds. Suitable examples of sustained release carriers include semipermeable polymer matrices. Implantable or microcapsular sustained release
matrices include polylactides (U.S. Patent No. 3,773,319; EP 58,481), copolymers of L-glutamic acid and gamma-ethyl-L-glutamate (Sidman et al., Biopolymers, 22, pp. 547-56 (1985)); poly(2-hydroxyethyl-methacrylate), ethylene vinyl acetate (Langer et al., J. Biomed. Mater. Res., 15, pp. 167-277 (1981); Langer, Chem. Tech., 12, pp. 98-105 (1982)) or poly-D-(-)-3hydroxybutyric acid (EP 133,988), polylactic acid, poly glycolic acid or polymers of the above. [0107] The bone morphogenic protein of this invention may also be administered using, for example, microspheres, liposomes, other microparticulate delivery systems or sustained release formulations placed in, near, or otherwise in communication with affected tissues, the fluids bathing those tissues or bloodstream bathing those tissues.
[0108] Liposomes containing a bone morphogenic protein of this invention can be prepared by well-known methods (See, e.g. DE 3,218,121; Epstein et al., Proc. Natl. Acad. Sci. U.S.A., 82, pp. 3688-92 (1985); Hwang et al., Proc. Natl. Acad. Sci. U.S.A., 77, pp. 4030-34 (1980); U.S. Patent Nos. 4,485,045 and 4,544,545). Ordinarily the liposomes are of the small (about 200-800 Angstroms) unilamellar type in which the lipid content is greater than about 30 mol.% cholesterol. The proportion of cholesterol is selected to control the optimal rate of bone morphogenic protein release. [0109] The bone morphogenic proteins of this invention may also be attached to liposomes containing other biologically active molecules such as immunosuppressive agents, cytokines, etc., to modulate the rate and characteristics of tissue induction. Attachment of bone morphogenic proteins to liposomes may be accomplished by any known cross-linking agent such as heterobifunctional cross-linking agents that have been widely used to couple toxins or chemotherapeutic agents to antibodies for targeted delivery. Conjugation to liposomes can also be accomplished using the carbohydrate-directed cross-linking reagent 4-(4-maleimidophenyl) butyric acid hydrazide (MPBH) (Duzgunes et al., J. Cell. Biochem. Abst. Suppl. 16E 77 (1992)). [0110] One skilled in the art may create a biocompatible, and or biodegradable formulation of choice for use in the methods of this invention.
[0111] A successful carrier for a bone morphogenic protein should perform several important functions. It should act as a delivery system of the bone morphogenic protein and protect the bone morphogenic protein from non-specific proteolysis. [0112] In addition, selected materials must be biocompatible in vivo and preferably biodegradable. Polylactic acid (PLA), polyglycolic acid (PGA), and various combinations have different dissolution rates in vivo. [0113] The carrier may also take the form of a hydrogel. When the carrier material comprises a hydrogel, it refers to a three dimensional network of cross- linked hydrophilic polymers in the form of a gel substantially composed of water, preferably but not limited to gels being greater than 90% water. Hydrogel can carry a net positive or net negative charge, or may be neutral. A typical net negative charged hydrogel is alginate. Hydrogels carrying a net positive charge may be typified by extracellular matrix components such as collagen and laminin. Examples of commercially available extracellular matrix components include Matrigel™ and Vitrogen™. An example of a net neutral hydrogel is highly crosslinked polyethylene oxide, or polyvinyalcohol. [0114] Various growth factors, cytokines, hormones, trophic agents and therapeutic compositions including antibiotics and chemotherapeutic agents, enzymes, enzyme inhibitors and other bioactive agents also may be adsorbed onto or dispersed within the carrier material comprising the bone morphogenic protein, and will also be released over time and slowly absorbed. [0115] Dosage levels of between about 1 μg and about 1000 μg per day, preferably between 3 μg and 50 μg per day of the bone morphogenic protein are useful. As the skilled artisan will appreciate, lower or higher doses than those recited may be required. Specific dosage and treatment regimens for any particular patient will depend upon a variety of factors, including the activity of the specific bone morphogenic protein employed, the age, body weight, general health status, sex, diet, time of administration, rate of excretion, drug combination, the severity of the tissue damage and the judgment of the treating physician.
[0116] The bone morphogenic protein of this invention may also be dispersed in an implantable biocompatible carrier material that functions as a suitable delivery
or support system for the compounds. Suitable examples of carriers include semipermeable polymer matrices in the form of shaped articles such as suppositories or capsules. Implantable or microcapsular sustained release matrices include polylactides (U.S. Patent No. 3,773,319; EP 58,481), copolymers of L- glutamic acid and ethyl-L-glutamate (Sidman et al., Biopolymers, 22, pp. 547-56 (1985)); poly(2-hydroxyethyl-methacrylate) or ethylene vinyl acetate (Langer et al., J. Biomed. Mater. Res., 15, pp. 167-277 (1981); Langer, Chem. Tech., 12, pp. 98-105 (1982)). In some embodiments, the carriers are sustained release carriers. [0117] In one embodiment of this invention, the carrier comprises a biocompatible matrix made up of particles or porous materials. The pores are preferably of a dimension to permit progenitor cell migration and subsequent differentiation and proliferation. Various matrices known in the art can be employed (see, e.g., U. S. Patent Nos. 4,975,526; 5,162,114; 5,171,574 and WO 91/18558, which are herein incorporated by reference). [0118] The particle size should be within the range of 70 μm-850 μm, preferably 70 μm-420 μm, most preferably 150 μm-420 μm. The matrix may be fabricated by close packing particulate material into a shape spanning the particular tissue defect to be treated. Alternatively, a material that is biocompatible, and preferably biodegradable in vivo may be structured to serve as a temporary scaffold and substratum for recruitment of migratory progenitor cells, and as a base for their subsequent anchoring and proliferation.
[0119] Useful matrix materials comprise, for example, collagen; homopolymers or copolymers of glycolic acid, lactic acid, and butyric acid, including derivatives thereof; and ceramics, such as hydroxyapatite, tricalcium phosphate and other calcium phosphates. Various combinations of these or other suitable matrix materials also may be useful as determined by the assays set forth herein. [0120] In some embodiments, carriers include particulate, demineralized, guanidine-extracted, species-specific (allogenic) bone, and specially treated particulate, protein-extracted, demineralized xenogenic bone. Optionally, such xenogenic bone powder matrices also may be treated with proteases such as trypsin. Preferably, the xenogenic matrices are treated with one or more fibril modifying agents to increase the intraparticle intrusion volume (porosity) and
surface area. Useful modifying agents include solvents such as dichloromethane, trichloroacetic acid, acetonitrile and acids such as trifluoroacetic acid and hydrogen fluoride. Preferred fibril-modifying agent useful in formulating the matrices of this invention is a heated aqueous medium, preferably an acidic aqueous medium having a pH less than about pH 4.5, most preferably having a pH within the range of about pH 2-pH 4. Preferred heated acidic aqueous medium is 0.1% acetic acid which has a pH of about 3. Heating demineralized, delipidated, guanidine- extracted bone collagen in an aqueous medium at elevated temperatures (e.g., in the range of about 37°C-65°C, preferably in the range of about 450C-OO0C) for approximately one hour generally is sufficient to achieve the desired surface morphology. Although the mechanism is not clear, it is hypothesized that the heat treatment alters the collagen fibrils, resulting in an increase in the particle surface area.
[0121] Demineralized guanidine-extracted xenogenic bovine bone comprises a mixture of additional materials that may be fractionated further using standard biomolecular purification techniques. For example, chromatographic separation of extract components followed by addition back to active matrix of the various extract fractions corresponding to the cliromatogram peaks may be used to improve matrix properties by fractionating away inhibitors of bone or tissue-inductive activity.
[0122] The matrix may also be substantially depleted in residual heavy metals. Treated as disclosed herein, individual heavy metal concentrations in the matrix can be reduced to less than about 1 ppm. [0123] One skilled in the art may create a biocompatible matrix of choice having a desired porosity or surface microtexture useful in the methods of this invention, or as a biodegradable sustained release implant. In addition, synthetically formulated matrices, prepared as disclosed herein, may be used.
Other Tissue-Specific Matrices
[0133] In addition to the naturally-derived bone matrices described above, useful matrices may also be formulated synthetically by adding together reagents that have been appropriately modified. One example of such a matrix is the porous,
biocompatible, in vivo biodegradable synthetic matrix disclosed in WO91/18558, the disclosure of which is hereby incorporated by reference. [0134] Briefly, the matrix comprises a porous crosslinked structural polymer of biocompatible, biodegradable collagen, most preferably tissue-specific collagen, and appropriate, tissue-specific glycosaminoglycans as tissue-specific cell attachment factors. Bone tissue-specific collagen (e.g., Type I collagen) derived from a number of sources may be suitable for use in these synthetic matrices, including soluble collagen, acid-soluble collagen, collagen soluble in neutral or basic aqueous solutions, as well as those collagens which are commercially available. In addition, Type II collagen, as found in cartilage, also may be used in combination with Type I collagen.
[0135] Glycosaminoglycans (GAGs) or mucopolysaccharides are polysaccharides made up of residues of hexoamines glycosidically bound and alternating in a more-or-less regular manner with either hexouronic acid or hexose moieties. GAGs are of animal origin and have a tissue specific distribution (see, e.g., Dodgson et al., in Carbohydrate Metabolism and its Disorders, Dickens et al., eds., Vol. 1, Academic Press (1968)). Reaction with the GAGs also provides collagen with another valuable property, i.e., inability to provoke an immune reaction (foreign body reaction) from an animal host. [0136] Useful GAGs include those containing sulfate groups, such as hyaluronic acid, heparin, heparin sulfate, chondroitin 6-sulfate, chondroitin 4-sulfate, dermatan sulfate, and keratin sulfate. For osteogenic devices, chondroitin 6-sulfate currently is preferred. Other GAGs also may be suitable for forming the matrix described herein, and those skilled in the art will either know or be able to ascertain other suitable GAGs using no more than routine experimentation. For a more detailed description of mucopolysaccharides, see Aspinall, Polysaccharides, Pergamon Press, Oxford (1970).
[0137] Collagen can be reacted with a GAG in aqueous acidic solutions, preferably in diluted acetic acid solutions. By adding the GAG dropwise into the aqueous collagen dispersion, coprecipitates of tangled collagen fibrils coated with GAG results. This tangled mass of fibers then can be homogenized to form a homogeneous dispersion of fine fibers and then filtered and dried.
[0138] Insolubility of the collagen-GAG products can be raised to the desired degree by covalently cross-linking these materials, which also serves to raise the resistance to resorption of these materials. In general, any covalent G60 cross- linking method suitable for cross-linking collagen also is suitable for cross-linking these composite materials, although cross-linking by a dehydrotheπnal process is preferred.
[0139] When dry, the cross-linked particles are essentially spherical with diameters of about 500μm. Scanning electron microscopy shows pores of about 20μm on the surface and 40μm on the interior. The interior is made up of both fibrous and sheet-like structures, providing surfaces for cell attachment. The voids interconnect, providing access to the cells throughout the interior of the particle. The material appears to be roughly 99.5% void volume, making the material very efficient in terms of the potential cell mass that can be grown per gram of microcarrier. [0140] Another useful synthetic matrix is one formulated from biocompatible, in vivo biodegradable synthetic polymers, such as those composed of glycolic acid, lactic acid and/or butyric acid, including copolymers and derivatives thereof. These polymers are well described in the art and are available commercially. For example, polymers composed of polylactic acid (e.g., MW 100 ka), 80% polylactide/20% glycoside or poly 3-hydroxybutyric acid (e.g., MW 30 ka) all may be purchased from PolySciences, Inc. The polymer compositions generally are obtained in particulate form and the morphogenic devices preferably fabricated under nonaqueous conditions (e.g., in an ethanol-trifluoroacetic acid solution, EtOH/TFA) to avoid hydrolysis of the polymers. In addition, one can alter the morphology of the particulate polymer compositions, for example to increase porosity, using any of a number of particular solvent treatments known in the art.
Example 1: Cell culture and cell morphology study. [0141] Three human tumor cells lines were used as models: osteosarcoma cell lines SaOS-2 and MG-63 and lung carcinoma cell line A549. Cell lines were obtained from American Tissue Culture Collection (ATCC) and were grown and sustained in the appropriate media using standard techniques. Morphology of the
cultured cells was monitored with an Olympus CK2 inverted microscope equipped with a CCD camera. Images were captured using phase contrast with 10Ox magnification.
[0142] To examine the effects of OP-I on cell morphology and cell counts, cells were treated with different concentrations of OP-I (0.5 μg/ml and 100 μg/ml) for 24 h. The viable and total cell counts following OP-I treatment were measured using the trypan blue exclusion assay. Treatment of SaOS-2 cells with OP-I increased both viable and total cell counts in a dose-dependent manner as compared with untreated control cells (see Figure 1). OP-I treatment of MG-63 cells did not increase viable and total cell counts significantly. Treatment with an OP-I concentration of 100 μg/ml inhibited cell counts (see Figure 2). Similarly, OP-I treatment of A549 cells at a concentration of 0.5 μg/ml did not affect viable and total cell counts as compared with untreated control cells, but at the higher concentration of 100 μg/ml, OP-I significantly reduced cell counts (see Figure 3).
Example 2: BMP receptor mRNA expression.
[0143] Total RNA was isolated using TRI reagent (Molecular Research Center, Inc., Cincinnati, OH) following the manufacturer's recommendation. The cDNA probes for ActR-I, BMPR-IA3 BMPR-IB, and BMPR-II were obtained by digestion of the corresponding plasmids with the appropriate restriction endonucleases as reported previously (Yeh et al., J Cell Physiol 185:87-97 (2000). Specifically, the 580-bp ActR-I insert was obtained by digestion of the parent plasmid containing the ActR-I insert with EcoRI/Aval. The 530-bp BMPR-IA insert was obtained by digestion with Hindlll/PvuII. The 660-bp BMPR-IB insert was obtained by digestion with Hpal/Sacl. The 800-bp BMPR-II insert was obtained by Pstl digestion of hBMPR-II cloned in pCMV5. The resultant cDNA fragments were purified by agarose gel electrophoresis and were labeled with [α-32P]dATP using the Strip-EZ DNA labeling system (Ambion Co, Austin, TX). The labeled cDNA probes were purified through a Midi-SELECT G-25 spin column (IBI, New Haven, CT) to remove the un-incorporated nucleotides. The 18S rRNA was probed with a 32P -labeled, 18S-specific oligonucleotide with the following sequence: 5'- GCCGTGCGTACTTAGAC ATGC ATG-3' (SEQ ID NO: 10).
[0144] Northern analyses were conducted to probe for the presence of mRNA for ActR-I, BMPR-IA, BMPR-IB and BMPR-II on osteosarcoma cell lines SaOS-2 and MG-63, lung carcinoma cell line A549, and prostate carcinoma cell line PC-3 as described previously using 20 μg of total RNAs. Briefly, 20 μg of total RNAs were denatured and analyzed on 2.2M formaldehyde/ 1% GTG agarose gels. RNA standards (0.24-9.5 kb) from Life technologies (Grand Island, NY) were used as size markers. After electrophoresis, the fractionated RNAs were transferred onto a "Nytran Plus" membrane using a Turboblot apparatus (Schleicher & Schuell, Inc., Keene, NH). After cutting the lane containing the standards from the blot, the RNAs were covalently linked to the membrane using the UV Crosslinker
(Stratagene, La Jolla, CA). The membranes were incubated overnight at 420C with a particular cDNA probe containing one of the OP-I receptor sequences. The blots were washed and exposed to a screen for the Phosphorlmager (Molecular Dynamics, Sunnyvale, CA) to detect the hybridized signals. The same blots were washed with Strip-EZ Degradation Buffer (Ambion, Austin, TX) to remove the probe followed by sequential probing with the remaining receptor cDNA probes. Blots were also probed with an 18S rRNA oligonucleotide probe to correct for loading variations. The intensity of the hybridization signal was analyzed and quantified using the ImageQuant software and corrected for the intensity of the rRNA. Each experiment was conducted four times.
[0145] Northern blot analysis revealed that all four cell lines expressed mRNA coding for ActR-IA, BMPR-IA, BMPR-IB, and BMPR-II, though to varying degrees (see Figures 4-7).
Example 3: Effects of OP-I on cell proliferation in vitro.
[0146] To examine the effects of OP-I on cell proliferation, cells were subcultured at a cell density of 2 x 104/ml in a 48-well plate and grown in the appropriate medium with serum until mid-log phase. The specific day at which the culture reached mid-log (the doubling time) varied according to the individual cell line. Cells were then treated with various concentrations of OP-I (0, 0.1, 0.5, 1.0, 5.0, 10, 50, and 100 μg/ml; Stryker Biotech, Hopkinton, MA) in serum free- medium containing 0.1% BSA for 18 h. Cells were pulsed with [3H] thymidine for
6 h after treatment (with the exception of the SaOS-2 cell line in which cell proliferation was evaluated by a tetrazolium colorimetric assay; see discussion below). The extent of incorporation of [3H]thymidine (5 μCi/ml) into DNA and the number of cells were determined as previously described (Yeh et al., Endocrinology 138:4181-4190 (1997)). After removal of the medium containing the unincorporated thymidine, cells were rinsed with cold IX PBS. The radiolabeled DNA was precipitated by cold 10% TCA for 15 min, solubilized in 0.1N NaOH at 370C for 10 min, and neutralized with 0.1N HCl. The amount of radioactivity was determined by scintillation spectrometry in the presence of Econo-Safe cocktail (5 ml). The rate of cellular proliferation of the OP-I -treated samples was optionally defined as a percentage of the solvent-treated control. [0147] Cell proliferation was also evaluated by a tetrazolium colorimetric assay (CellTiter96AQ Cell Proliferation Assay, Promega, Madison, WI) following the manufacturer's instruction. Briefly, SaOS-2 cells were cultured in 96-well plates and treated in the presence of different concentrations of OP-I for 24 h beginning on the pre-determined day that depended on the doubling time of the specific cell line. Media were removed from the cultures and rinsed with sterile PBS followed by the addition to each well of 100 μl of medium containing 1% BSA plus 20 μl of the 96AQ reagent. After 4 h, the color developed was measured at 490 nm using a MRX microplate reader (Dynex Technologies, Chantilly, VA).
[0148] Treatment of SaOS-2 cells with OP-I increased the number of cells in a dose-dependent manner (see Figure 8). OP-I treatment of MG-63 cells did not affect thymidine incorporation or cell number significantly; in fact, high OP-I concentrations inhibited cell proliferation significantly (see Figure 9). OP-I treatment of A549 cells reduced thymidine incorporation and number of cells (see Figure 10). In PC-3 cells, OP-I stimulated thymidine incorporation by a maximum of 40% above the control, but at high protein concentrations, OP-I inhibited thymidine incorporation (see Figure 11). After treatment with high concentrations of OP-I for 24 h, all four cell lines showed abnormal appearance, exhibiting cytopathological changes, indicating cell death compared to control cultures.
Example 4: Alkaline phosphatase activity assay.
[0149] Briefly, cells were grown and treated in 48-well plates with various concentrations of OP-I (0, 0.1, 0.5, 1.0, 5.0, 10, 50, and 100 μg/ml; Stryker Biotech, Hopkinton, MA) for 48 h. After the 48 h treatment period, cells were rinsed with PBS and lysed by sonication in 100 μl/well 0.05% Triton X- 100 in PBS, (250 μl/well for SaOS-2) for 5 min at room temperature. Total cellular AP activity was measured with p-nitrophenyl phosphate as a substrate in 2-amino-2- methyl-1-propanol buffer, pH 10.3 at 370C using a commercial assay kit (Sigma Chemical Co.). Reactions were terminated by the addition of 0.5N NaOH. Absorbance of the reaction mixture was measured at 405 nm using a MRX microplate reader (Dynex Technologies, Chantilly, VA). Protein was measured according to the method of Bradford using BSA as a standard. AP activity was expressed as nanomoles of p-nitrophenol liberated per μg of total cellular protein. The total AP activity of the OP-I -treated samples was normalized to the solvent- treated control as 1..
[0150] Treatment of both osteosarcoma cell lines SaOS-2 and MG-63 down- regulated alkaline phosphatase activity, a biochemical marker of osteoblastic cell differentiation (see Figures 12 and 13).
Example 5: Effects of OP-I on tumor cell growth and differentiation in vivo in a nude mouse xenograft model.
[0151] To examine the effect of OP-I on tumor cell growth and differentiation in vivo, tumor cell lines were grown to mid-log in complete media. Cells were then treated with 100 μg/ml of OP-I for 24 h. After the 24h treatment period, cells were collected, washed, resuspended in MEM, and injected subcutaneously (106 cells in 0.1 ml HBSS) into the flank of young adult male BALB/C athymic nude mice (treated group). The control group for each tumor cell line tested received a single subcutaneous injection of tumor cells (106 cells in 0.1 ml HBSS) with exposure to OP-I . Mice were monitored daily for general health and the development/progression of tumors via in-life measurement of tumor mass for 49 days after which they were necropised. The size of the tumor mass as a function of time is provided for the different tumor cell lines tested. Masses, when present,
were excised, measured, and fixed in 10% neutral buffered formalin. Sections of liver, lung, and skin at injection site were also collected and fixed. Fixed tissue samples were embedded in paraffin, sectioned at 5 μ, stained with hematoxylin and eosin (H&E), and examined microscopically. [0152] No masses were detected at the injection site in mice injected with either control MG-63 (see Figure 14) or SaOS-2 (see Figure 15) cell lines. In mice injected with OP-I -treated MG-63 osteosarcoma cells, tissue masses were detected at the site of injection and increased in size as a function of time (see Figure 14). In the OP-1-treated SaOS-2 osteosarcoma group, mice exhibited masses at the site of injection; however, the mass size decreased as a function of time (see Figure 15). In contrast, masses were detected at the injection site in mice injected with either control A549 (see Figure 16) or PC-3 (see Figure 17) cell lines. Upon injection with OP-1-treated A549 or PC-3 cells, tissue masses increased in size as a function of time (see Figures 16 and 17, respectively). In 8 of 8 mice injected with OP-1-treated MG-63 osteosarcoma cells, tissue masses were detected at the site of injection and increased in size as a function of time.
[0153] Microscopically, these masses consisted of mature bone formation with or without the presence of active bone marrow, as depicted in Figure 18 which shows the histologic appearance of a subcutaneous bone nodule containing bone marrow. In the OP-1-treated MG-63 osteosarcoma cell group, one animal displayed several tumor cell foci within the bone nodule (see Figure 19).
[0154] In the OP-1-treated SaOS-2 group, 5 of 8 mice exhibited masses at site of injection. Histologically, these masses consisted of well differentiated ectopic bone and bone marrow. In some cases, the bone surrounded a small, well- contained focus of tumor cells (see Figures 2OA and 20B). In other cases, the tissue masses consisted of a nodule of ectopic bone that contained a small focus of tumor cells that appeared to be regressing (see Figure 21). [0155] In a separate series of experiments, the effects of co-administration of OP-I and PC-3 cells on the development and progression of tumor formation as compared to either PC-3 cells alone or OP-I alone were examined. Microscopic examination of the masses from mice injected with OP-I alone exhibited ectopic bone containing bone marrow at the site of injection in all mice (8 of 8). Mice
injected with PC-3 cells only showed carcinomas at the site of injection in 8 of 8 mice. Mice injected with a mixture of OP-I and PC-3 cells showed subcutaneous masses in 8 of 8 mice. Microscopic examination of these masses showed ectopic bone formation with some tumor cell foci in or adjacent to the bone nodule. Mice injected with control PC-3 cells exhibited tumor at the site of injection.
In summary, the present study using four diverse human tumor cell lines in a nude mouse xenograft model shows that OP-I does not stimulate tumor cell growth and metastasis. Moreover, at high concentrations, OP-I suppresses tumor cell differentiation and stimulates ectopic bone formation.
Claims
1. A method of treating bone cancer in a mammal comprising the step of administering to the mammal a pharmaceutically effective amount of a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein.
2. A method of inducing differentiation of bone tumor cells in a mammal comprising the step of administering to the mammal a pharmaceutically effective amount of a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein.
3. A method of inhibiting bone tumor growth in a mammal comprising the step of administering to the mammal a pharmaceutically effective amount of a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein.
4. A method of inducing bone tumor regression in a mammal comprising the step of administering to the mammal a pharmaceutically effective amount of a bone morphogenic protein or a nucleic acid encoding the bone morphogenic protein.
5. The method according to any one of claims 1-4, wherein the bone tumor is a sarcoma or a carcinoma.
6. The method according to claim 5, wherein the sarcoma is an osteosarcoma.
7. The method according to any one of claims 1-4, wherein the bone morphogenic protein is selected from the group consisting of OP-I, OP-2, OP-3, BMP-2, BMP-3, BMP-4, BMP-5, BMP-6, BMP-8, BMP-9, BMP-IO, BMP- 11, BMP- 12, BMP- 13, BMP- 15, BMP- 16, BMP- 17, BMP- 18, DPP5 VgI, Vgr, 6OA protein, GDF-I, GDF-2, GDF-3, GDF-5, GDF-6, GDF-7, GDF-8, GDF-9, GDF-IO, GDF-I l, GDF- 12, CDMP-I, CDMP-2, CDMP-3, NODAL, UNIVIN, SCREW, ADMP, NEURAL, and fragments thereof.
8. The method according to claim 7, wherein the bone morphogenic protein is selected from the group consisting of OP-I, BMP-5, BMP- 6, GDF-5, GDF-6, GDF-7, CDMP-I, CDMP-2 and CDMP-3.
9. The method according to claim 8, wherein the bone morphogenic protein is selected from the group consisting of OP-I, BMP-5 and BMP-6.
10. The method according to claim 9 wherein the bone morphogenic protein is OP-I.
11. The method according to claims 1-4, wherein the nucleic acid is a viral vector comprising a gene that encodes the bone morphogenic protein, and wherein the viral vector is selected from the group consisting of an adenoviral vector, a lentiviral vector, a baculoviral vector, an Epstein Barr viral vector, a papovaviral vector, a vaccinia viral vector and a herpes simplex viral vector.
12. The method according to claim 11 , wherein the viral vector is selected from the group consisting of an adenoviral vector, a baculoviral vector and a lentiviral vector.
13. The method according to claim 12, wherein the viral vector is an adenoviral vector.
14. The method according to any one of claims 1-4, wherein the bone morphogenic protein or nucleic acid encoding the bone morphogenic protein is formulated as a gel, an aqueous solution, a paste or a putty.
15. The method according to claim 14, wherein the formulation is a sustained release formulation.
16. The method according to claim 14, wherein the bone morphogenic protein or nucleic acid encoding the bone morphogenic protein is formulated for local administration.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US60919604P | 2004-09-09 | 2004-09-09 | |
| PCT/US2005/032521 WO2006029406A2 (en) | 2004-09-09 | 2005-09-09 | Methods for treating bone tumors using bone morphogenic proteins |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP1802326A2 true EP1802326A2 (en) | 2007-07-04 |
Family
ID=35735379
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP05796502A Withdrawn EP1802326A2 (en) | 2004-09-09 | 2005-09-09 | Methods for treating bone tumors using bone morphogenic proteins |
Country Status (3)
| Country | Link |
|---|---|
| US (2) | US20070249535A1 (en) |
| EP (1) | EP1802326A2 (en) |
| WO (1) | WO2006029406A2 (en) |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB0615129D0 (en) * | 2006-07-29 | 2006-09-06 | Univ Cardiff | Anti-cancer activity of BMP-9 and BMP-10 and their use in cancer therapies |
| CN100450545C (en) * | 2006-08-03 | 2009-01-14 | 中国医学科学院基础医学研究所 | Application of myostatin in the preparation of antitumor drugs |
| US11225512B2 (en) * | 2017-04-27 | 2022-01-18 | University Of New Hampshire | Compositions and methods for ceramide-elevating therapeutic strategies |
| CN118318793A (en) * | 2024-05-22 | 2024-07-12 | 北京大学口腔医学院 | A method for constructing an animal model of tumor intramembranous ossification and bone invasion |
Family Cites Families (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IE52535B1 (en) * | 1981-02-16 | 1987-12-09 | Ici Plc | Continuous release pharmaceutical compositions |
| US4485045A (en) * | 1981-07-06 | 1984-11-27 | Research Corporation | Synthetic phosphatidyl cholines useful in forming liposomes |
| US4544545A (en) * | 1983-06-20 | 1985-10-01 | Trustees University Of Massachusetts | Liposomes containing modified cholesterol for organ targeting |
| US4797368A (en) * | 1985-03-15 | 1989-01-10 | The United States Of America As Represented By The Department Of Health And Human Services | Adeno-associated virus as eukaryotic expression vector |
| US5013649A (en) * | 1986-07-01 | 1991-05-07 | Genetics Institute, Inc. | DNA sequences encoding osteoinductive products |
| US5459047A (en) * | 1986-07-01 | 1995-10-17 | Genetics Institute, Inc. | BMP-6 proteins |
| US5324819A (en) * | 1988-04-08 | 1994-06-28 | Stryker Corporation | Osteogenic proteins |
| US5011691A (en) * | 1988-08-15 | 1991-04-30 | Stryker Corporation | Osteogenic devices |
| US5162114A (en) * | 1989-02-23 | 1992-11-10 | Stryker Corporation | Bone collagen matrix for xenogenic implants |
| US5266683A (en) * | 1988-04-08 | 1993-11-30 | Stryker Corporation | Osteogenic proteins |
| US5354557A (en) * | 1988-04-08 | 1994-10-11 | Stryker Corporation | Osteogenic devices |
| US4975526A (en) * | 1989-02-23 | 1990-12-04 | Creative Biomolecules, Inc. | Bone collagen matrix for zenogenic implants |
| US5399346A (en) * | 1989-06-14 | 1995-03-21 | The United States Of America As Represented By The Department Of Health And Human Services | Gene therapy |
| CA2363965C (en) * | 1991-03-11 | 2010-05-18 | Curis, Inc. | Protein-induced morphogenesis |
| US5942496A (en) * | 1994-02-18 | 1999-08-24 | The Regent Of The University Of Michigan | Methods and compositions for multiple gene transfer into bone cells |
| US5902825A (en) * | 1997-01-07 | 1999-05-11 | Mitreoak, Ltd. | Composition and method for the palliation of pain associated with diseases of the bone and bone joints |
| US6027917A (en) * | 1997-12-10 | 2000-02-22 | Genetics Institute, Inc. | Bone morphogenetic protein (BMP)-17 and BMP-18 compositions |
| US6414006B1 (en) * | 1998-10-15 | 2002-07-02 | Merck Frosst Canada & Co. | Methods for inhibiting bone resorption |
| PT1131087E (en) * | 1998-11-13 | 2004-12-31 | Curis Inc | METHODS OF RELIEF OF CANCER SYMPTOMS |
| EP3489257A1 (en) * | 2004-07-23 | 2019-05-29 | Acceleron Pharma Inc. | Actrii receptor polypeptides, methods and compositions |
-
2005
- 2005-09-09 WO PCT/US2005/032521 patent/WO2006029406A2/en not_active Ceased
- 2005-09-09 EP EP05796502A patent/EP1802326A2/en not_active Withdrawn
-
2007
- 2007-03-06 US US11/715,233 patent/US20070249535A1/en not_active Abandoned
-
2010
- 2010-03-10 US US12/721,244 patent/US20100168029A1/en not_active Abandoned
Non-Patent Citations (1)
| Title |
|---|
| See references of WO2006029406A2 * |
Also Published As
| Publication number | Publication date |
|---|---|
| US20070249535A1 (en) | 2007-10-25 |
| WO2006029406A2 (en) | 2006-03-16 |
| WO2006029406A3 (en) | 2006-06-22 |
| US20100168029A1 (en) | 2010-07-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| KR100253762B1 (en) | Polyethylene Glycol Derivatives of BDNF and NT-3 | |
| US20070191276A1 (en) | Compositions and therapeutic methods using morphogenic proteins, hormones and hormone receptors | |
| JP5550673B2 (en) | Synergistic effect of OP / BMP morphogen and GDNF / NGF neurotrophic factor | |
| JP5346657B2 (en) | Methods for assessing tissue morphogenesis and activity | |
| JP5201987B2 (en) | Use of morphogenic proteins to treat cartilage defects | |
| KR19990063825A (en) | Cleaved Neuroglial Cell Line-Derived Neurotrophic Phosphorus | |
| US7147839B2 (en) | Methods for evaluating tissue morphogenesis and activity | |
| EP1047443A1 (en) | Methods and compositions for enhancing cognitive function using morphogenic proteins | |
| US20100168029A1 (en) | Methods for treating bone tumors | |
| JP4892131B2 (en) | How to relieve cancer symptoms | |
| US20080293654A1 (en) | Therapeutic methods using Smads | |
| AU773990B2 (en) | Compositions and therapeutic methods using morphogenic proteins, hormones and hormone receptors | |
| JP2005533089A (en) | Compositions and methods for ligament growth and repair | |
| US20070122396A1 (en) | Morphogenic proteins and stimulatory factors in gene therapy | |
| WO2000066620A2 (en) | Morphogen-induced enhancement of fertility | |
| AU779278B2 (en) | Matrix-free osteogenic devices, implants and methods of use thereof | |
| AU2434301A (en) | Methods and compositions for identifying morphogenic protein analogs using morphogenic protein responsive inhibitory elements | |
| HK1064055A (en) | Morphogenic proteins for enhancing cognitive function |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20070410 |
|
| AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LI LT LU LV MC NL PL PT RO SE SI SK TR |
|
| DAX | Request for extension of the european patent (deleted) | ||
| RAP1 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: STRYKER CORPORATION |
|
| 17Q | First examination report despatched |
Effective date: 20140611 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20150702 |