EP1658501A2 - A method for the identification of irs protein kinase inhibitors or agonists - Google Patents

A method for the identification of irs protein kinase inhibitors or agonists

Info

Publication number
EP1658501A2
EP1658501A2 EP04763258A EP04763258A EP1658501A2 EP 1658501 A2 EP1658501 A2 EP 1658501A2 EP 04763258 A EP04763258 A EP 04763258A EP 04763258 A EP04763258 A EP 04763258A EP 1658501 A2 EP1658501 A2 EP 1658501A2
Authority
EP
European Patent Office
Prior art keywords
ser
irs
pkc
phosphorylation
peptide
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP04763258A
Other languages
German (de)
French (fr)
Inventor
Norbert Tennagels
Juergen Eckel
Sabine Metzger
Mark Sommerfeld
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Sanofi Aventis Deutschland GmbH
Original Assignee
Sanofi Aventis Deutschland GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Sanofi Aventis Deutschland GmbH filed Critical Sanofi Aventis Deutschland GmbH
Priority to EP04763258A priority Critical patent/EP1658501A2/en
Publication of EP1658501A2 publication Critical patent/EP1658501A2/en
Withdrawn legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/573Immunoassay; Biospecific binding assay; Materials therefor for enzymes or isoenzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/48Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving transferase
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/90Enzymes; Proenzymes
    • G01N2333/91Transferases (2.)
    • G01N2333/912Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
    • G01N2333/91205Phosphotransferases in general
    • G01N2333/9121Phosphotransferases in general with an alcohol group as acceptor (2.7.1), e.g. general tyrosine, serine or threonine kinases

Definitions

  • the present invention relates to a method for the identification of IRS protein kinase inhibitors or agonists as well as to selected IRS peptides comprising phosphorylation sites for PKC- ⁇ and other IRS serine kinases and to the use of these peptides for the identification of a pharmaceutical composition for the treatment of diabetes type 2.
  • Non-insulin dependent diabetes mellitus occurs predominantly in adults and is characterized by a reduced sensitivity of tissues being capable of clearing glucose from the blood.
  • IDDM insulin dependent diabetes mellitus
  • diabetes type II is not characterized by an impaired insulin secretion from the pancreatic beta cells.
  • insulin receptor substrate (IRS) proteins are phosphorylated on multiple tyrosine residues by the activated insulin receptor, the insulin-like-growth factor receptor and JAK1/2 and play a pivotal role in the process of downstream insulin signaling (1 , 2, 3).
  • PI-3 kinase phosphatidylinositol-3 kinase
  • PI-3 kinase is composed of a catalytic 110-kDa subunit (p110) and a regulatory 85-kDa subunit (p85) containing two SH2 domains that bind to tyrosine-phosphorylated pYMXM and pYXXM motifs in IRS proteins and induce PI-3 kinase activation (7).
  • PKB/Akt serine/threonine kinase
  • PKC- ⁇ / ⁇ atypical protein kinase C isoforms- ⁇ and - ⁇ (PKC- ⁇ / ⁇ ) (10, 11) by phosphoinositide- dependent kinase 1.
  • Activation of PKB and PKC- ⁇ / ⁇ and its downstream signals have been shown to play a critical role in mediating the metabolic actions of insulin such as GLUT4 translocation and glucose transport (10, 11 ), GSK3 serine phosphorylation and glycogen synthesis (12), PDE serine phosphorylation and anti-lipolysis (13, 14), and mTOR activation and protein synthesis (15, 16).
  • IRS-1 serine/threonine phosphorylation of IRS-1 occurs constitutively in the cell (21) and it is further promoted by cytokines and metabolites that inhibit signal transduction like tumor necrosis factor (TNF) ⁇ (22), free fatty acids, glucose or ceramide (23). Furthermore, hyperphosphorylation of IRS-1 on serine/threonine residues is a common finding during insulin resistance and type 2 diabetes (24).
  • IRS-1 serine phosphorylation protein kinases
  • JNK c-Jun N-terminal kinase
  • IkappaB kinase- ⁇ 26
  • MAP kinase 27
  • Casein kinase 28
  • glycogensynthase kinase 29
  • phosphoinositol-3-kinase 30
  • protein kinase A 31
  • protein kinase C 32
  • PBB protein kinase B
  • AMPK AMP-activated protein kinase
  • Ser 789 is targeted by AMPK and positively modulates insulin action (34), however, Ser 789 phosphorylation by unidentified kinases was also found to attenuate insulin signaling (37).
  • Ser 612 , Ser 632 , Ser 662 and Ser 731 are located within or near the PI 3-kinase interaction domain, however, the functional implications of these sites has remained elusive (38-40).
  • PKC protein kinase C
  • IRS-1 insulin signal and in the negative feedback control of IRS-1 function (11 , 41-44).
  • PKC- ⁇ was found to colocalize with GLUT4 and to be essential for insulin-regulated GLUT4 translocation and glucose transport in skeletal muscle (41) and adipocytes (11 ). Further, defective activation of PKC- ⁇ may contribute to obesity-dependent development of skeletal muscle insulin resistance (42).
  • IRS-1 represents a novel substrate for PKC- ⁇ and in a parallel study Zick and co- workers (44) found that this process inhibits PI 3-kinase activation, suggesting that PKC- ⁇ represents a key element in the negative feedback control of insulin action.
  • IRS especially IRS-1 interacts with PKC- ⁇
  • PKC- ⁇ the nature of this interaction is not known. Consequently, there are no agents known in the art interacting with IRS-PKC- ⁇ interaction. However, such agents would be highly needed since it is very likely that an inhibition of the interaction of IRS and PKC- ⁇ would result in down-regulation of the inhibition of IRS and, more downstream, PI 3-kinase which in turn would result in an improvement in GLUT4 translokation and glucose transport.
  • the present invention is based on the surprising identification of specific serine phosphorylation sites in the sequence of IRS, which are specifically recognized by PKC- ⁇ . Consequently, in the context of the present invention, the molecular mechanism providing the IRS-PKC- ⁇ interaction were identified. Moreover its likely that other protein kinases like c-Jun N-terminal kinase (JNK), IkappaB kinase- ⁇ , MAP kinase, Casein kinase, glycogensynthase kinase, phosphoinositol-3-kinase, protein kinase A, protein kinase C, protein kinase B 8PKB) and AMP-activated protein kinase (AMPK) might be able to recognize these phosphorylation sites. Therefore the determination of the serine sites, which are phosphorylated by protein kinases, especially PKC- ⁇ .enables the identification of molecules interfering with this interaction, either in an antagonistic or
  • IRS protein kinase inhibitor relates to a substance which interferes with the interaction between IRS and a protein kinase, exemplified by PKC- ⁇ .
  • IRS peptide relates to a peptide comprising a stretch of at least 5, preferably 7, preferably at least 10 amino acids of IRS.
  • IRS peptide includes that the IRS-peptide may comprise, in addition to the stretch of amino acids derived from IRS, further amino acids which are not IRS derived.
  • PKC- ⁇ is commercially available, e.g. from CalBiochem (San Diego, CA, USA). Furthermore, methods for the isolation of PKC- ⁇ are described in the literature cited in the present application.
  • IRS-1 The sequence of IRS, especially IRS-1 and IRS-2 from different species are known in the art.
  • the rat IRS-1 sequence is herein provided as SEQ ID NO: 16.
  • mutated proteins e.g. by exchanging one or more amino acids or by deleting stretches of amino acids, are known in the art (see above). These methods include site directed mutagenesis of the IRS gene and expressing the modified gene in appropriate cells.
  • a reduced phosphorylation of the PKC- ⁇ -Ser- phosphorylation site in comparison to the phosphorylation in the absence of the at least one putative inhibitor is indicative for the inhibitory properties of the putative inhibitor.
  • PKC- ⁇ is of mammalian, preferably, of rodent or human origin, more preferably of rat or human origin.
  • the IRS peptide is derived from an. IRS, preferably IRS-1 , of mammalian, preferably of human or rodent, more preferably of rat origin.
  • the IRS-1 is of rat origin and the at least one PKC- ⁇ -Ser-phosphorylation site is selected from the group consisting of Ser 458, 469, 481 , 498, 522, 526, 530, 536, 538, 539, 542, 560, 570, 577, 599, 600, 612, 620, 632, 635, 662, and 664 wherein the sequence numbers correspond to rat IRS-1 as depicted in SEQ ID NOJ 6.
  • the IRS-1 may be of human origin and the at least one PKC- ⁇ -Ser- phosphorylation site is selected from Ser-residues corresponding to the above Ser- residues of the rat IRS-1 ,
  • the PKC- ⁇ -Ser-phosphorylation site in the context of the present invention may be selected from the group consisting of Ser 498 , Ser 570 and Ser 612 , more preferably Ser 570 .
  • the peptide is rlRS 449 - 664 (SEQ ID NO: 17).
  • the inhibitor is selected from the group consisting of binding peptides, antibodies, and Low molecular weight compounds (LMWs).
  • LMWs Low molecular weight compounds
  • binding protein or "binding peptide” refers to a class of proteins or peptides which bind and inhibit IRS including, without limitation, polyclonal or monoclonal antibodies, antibody fragments and protein scaffolds directed against IRS, e.g. anticalins which are directed against IRS
  • the procedure for preparing an antibody or antibody fragment is effected in accordance with methods which are well known to the skilled person, e.g. by immunizing a mammal, for example a rabbit, with IRS, where appropriate in the presence of, for example, Freund's adjuvant and/or aluminum hydroxide gels (see, for example, Diamond, B.A. et al. (1981 ) The New England Journal of Medicine: 1344- 1349).
  • the polyclonal antibodies which are formed in the animal as a result of an immunological reaction can subsequently be isolated from the blood using well known methods and, for example, purified by means of column chromatography.
  • Monoclonal antibodies can, for example, be prepared in accordance with the known method of Winter & Milstein (Winter, G. & Milstein, C. (1991) Nature, 349, 293-299).
  • antibody or antibody fragment is also understood as meaning antibodies or antigen-binding parts thereof, which have been prepared recombinantly and, where appropriate, modified, such as chimaeric antibodies, humanized antibodies, multifunctional antibodies, bispecific or oligospecific antibodies, single-stranded antibodies and F(ab) or F(ab) 2 fragments (see, for example, EP-B1-0 368 684, US 4,816,567, US 4,816,397, WO 88/01649, WO 93/06213 or WO 98/24884).
  • protein scaffolds against IRS e.g. anticalins which are ' based on lipocalin
  • the natural ligand-binding sites of the lipocalins for example the retinol-binding protein or the bilin-binding protein, can be altered, for example by means of a "combinatorial protein design" approach, in such a way that they bind to selected haptens, here to IRS (Skerra, 2000, Biochim. Biophys. Acta, 1482, 337-50).
  • Other known protein scaffolds are known as being alternatives to antibodies for molecular recognition (Skerra (2000) J. Mol. Recognit, 13, 167-187).
  • LMWs are molecules which are not proteins, peptides antibodies or nucleic acids, and which exhibit a molecular weight of less than 5000 Da, preferably less than 2000 Da, more preferably less than 2000 Da, most preferably less than 500 Da. Such LMWs may be identified in High-Through-Put procedures starting from libraries.
  • the inhibitor can be in the form of a natural product extract, either in crude or in purified form.
  • the extract can be produced according to standard procedures, such as water and/or alcohol and/or organic solvent extraction and/or column chromatography and/or precipitation from an animal, plant or microbial source, like snake poison, leaves or microbial fermentation broths.
  • IRS and PKC- ⁇ are provided e.g. in an assay system and brought directly or indirectly into contact with a test compound, in particular a biochemical or chemical test compound, e.g. in the form of a chemical compound library. Then, the influence of the test compound on the phosphorylation of IRS is measured or detected. Thereafter, suitable inhibitors can be analyzed and/or isolated.
  • the use of high-throughput assays are preferred which are known to the skilled person or which are commercially available.
  • chemical compound library refers to a plurality of chemical compounds that have been assembled from any of multiple sources, including chemically synthesized molecules and natural products, or that have been generated by combinatorial chemistry techniques.
  • the influence of the test compound on the interaction is measured or detected by determining the degree of phosphorylation of the IRS peptide. This can be done by using phosphor-specific antibodies. Such antibodies are known in the art and available e.g: from Clonetech, Santa Cruz and Cellsignal.
  • the degree of phosphorylation may be measured by using radio labeled ATP in the assay.
  • the ATP can be labeled with 32-P or 33-P, and the amount of radioactive phosphate incorporated into the IRS can be measured by methods known in the art (see Example 2, 9.).
  • the intensity of a signal measured by auto radiography may be indicative for the degree of phosphorylation.
  • the method of the present invention is carried out in a robotics system e.g. including robotic plating and a robotic liquid transfer system, e.g. using micro fluidics, i.e. channeled structured.
  • the method is carried out in form of a high-through put screening system.
  • the screening method is automated and miniaturized, in particular it uses miniaturized wells and micro fluidics controlled by a roboter.
  • the invention further relates to a method for the identification of an IRS agonist, comprising the steps of a) bringing into contact PKC- ⁇ with at least one IRS peptide comprising at least one PKC- ⁇ -Ser-phosphorylation site in the presence of at least one putative agonist comprising at least one PKC- ⁇ -Ser-phosphorylation site, and b) measuring the phosphorylation of the PKC- ⁇ -Ser-phosphorylation site of the putative agonist.
  • the agonist is a peptide.
  • Peptide libraries which could be used in the context of the present invention are known in the art.
  • an increased phosphorylation of the PKC- ⁇ -Ser-phosphorylation site of the agonist in comparison to the phosphorylation of the PKC- ⁇ -Ser-phosphorylation site of the IRS peptide is indicative for the agonistic properties of the putative agonist.
  • the invention further relates to a method for the determination of PKC- ⁇ activity, comprising the steps of a) bringing into contact PKC- ⁇ with at least one IRS peptide comprising at least one PKC- ⁇ -Ser-phosphorylation site in the presence of at least one putative inhibitor, and b) measuring the phosphorylation of the PKC- ⁇ -Ser-phosphorylation site. Consequently, the present invention provides a method to measure the activity of PKC- ⁇ . Such a method is especially useful when the activity of PKC- ⁇ from different patients has to measured in order to gain more information about the signal transduction system in patients, especially diabetic patients.
  • PKC- ⁇ is preferably of mammalian, more preferably of human origin.
  • the invention further relates to an IRS-1 peptide comprising Ser 570 , preferably IRS- ,
  • this peptide of the invention is especially useful for the identification of IRS analogues or inhibitors.
  • the invention further provides a kit comprising a) at least one IRS peptide, b) a PKC- ⁇ preparation, and c) at least one putative IRS protein kinase inhibitor or agonist.
  • the present invention provides an IRS-1 peptide, wherein Ser 570 and/or Ser 612 are mutated, preferably to alanine.
  • a peptide is useful for blocking PKC- ⁇ activity in vitro or in vivo.
  • the invention further relates to the use of an IRS peptide as defined above for the production of antibodies, preferably against a PKC- ⁇ -Ser-phosphorylation site, preferably against Ser 498 , Ser 570 and Ser 612 , more preferably against Ser 570 . Consequently, with the help of the IRS peptides as defined in the present invention, it is possible to produce IRS specific antibodies, especially antibodies which are directed against PKC- ⁇ phosphorylation sites. Such antibodies can serve both in in vitro diagnostics as well as in pharmaceutical compositions.
  • the present invention relates to the use of an IRS peptide as defined above or of an IRS-1 peptide with mutated Ser-sites as defined above for the preparation of a pharmaceutical composition for the treatment of diabetes type 2.
  • Such peptides may inhibit the interaction between IRS and PKC- ⁇ and may, therefore, serve as antagonists of IRS phosphorylation.
  • the IRS protein kinase inhibitors or agonists as identified in the present invention or the peptides of the present invention are usually formulated with one or more pharmaceutically acceptable additives or auxiliary substances, such as physiological buffer solution, e.g. sodium chloride solution, demineralized water, stabilizers, such as protease or nuclease inhibitors, preferably aprotinin, ⁇ -aminocaproic acid or pepstatin A or sequestering agents such as EDTA, gel formulations, such as white vaseline, low-viscosity paraffin and/or yellow wax, etc. depending on the kind of administration.
  • physiological buffer solution e.g. sodium chloride solution
  • demineralized water demineralized water
  • stabilizers such as protease or nuclease inhibitors, preferably aprotinin, ⁇ -aminocaproic acid or pepstatin A or sequestering agents such as EDTA
  • gel formulations such as white vaseline, low-visco
  • Suitable further additives are, for example, detergents, such as, for example, Triton X-100 or sodium deoxycholate, but also polyols, such as, for example, polyethylene glycol or glycerol, sugars, such as, for example, sucrose or glucose, zwitterionic compounds, such as, for example, amino acids such as glycine or in particular taurine or betaine and/or a protein, such as, for example, bovine or human serum albumin. Detergents, polyols and/or zwitterionic compounds are preferred.
  • the physiological buffer solution preferably has a pH of approx. 6.0-8.0, expecially a pH of approx. 6.8-7.8, in particular a pH of approx. 7.4, and/or an osmolarity of approx. 200-400 milliosmol/liter, preferably of approx. 290-310 milliosmol/liter.
  • the pH of the pharmaceutical composition is in general adjusted using a suitable organic or inorganic buffer, such as, for example, preferably using a phosphate buffer, tris buffer (tris(hydroxymethyl)aminomethane), HEPES buffer ([4-(2-hydroxyethyl)piperazino]ethanesulphonic acid) or MOPS buffer (3-morpholino- 1-propanesulphonic acid).
  • a suitable organic or inorganic buffer such as, for example, preferably using a phosphate buffer, tris buffer (tris(hydroxymethyl)aminomethane), HEPES buffer ([4-(2-hydroxyethyl)piperazino
  • the pharmaceutical composition can be administered in a conventional manner, e.g. by means of oral dosage forms, such as, for example, tablets or capsules, by means of the mucous membranes, for example the nose or the oral cavity, in the form of depositories implanted under the skin, by means of injections, infusions or gels which contain the pharmaceutical compositions according to the invention. It is further . possible to administer the pharmaceutical composition topically and locally, if appropriate, in the form of liposome complexes. Furthermore, the treatment can be carried out by means of a transdermal therapeutic system (TTS), which makes possible a temporally controlled release of the pharmaceutical compositions.
  • TTS transdermal therapeutic system
  • TTS are known for example, from EP 0 944 398 A1 , EP 0 916 336 A1 , EP 0 889 723 A1 or EP 0 852 493 A1.
  • Injection solutions are in general used if only relatively small amounts of a solution or suspension, for example about 1 to about 20 ml, are to be administered to the body.
  • Infusion solutions are in general used if a larger amount of a solution or suspension, for example one or more liters, are to be administered. Since, in contrast to the infusion solution, only a few milliliters are administered in the case of injection solutions, small differences from the pH and from the osmotic pressure of the blood or the tissue fluid in the injection do not make themselves noticeable or only make themselves noticeable to an insignificant extent with respect to pain sensation. Dilution of the formulation according to the invention before use is therefore in general not necessary.
  • the formulation according to the invention should be diluted briefly before administration to such an extent that an at least approximately isotonic solution is obtained.
  • An example of an isotonic solution is a 0.9% strength sodium chloride solution.
  • the dilution can be carried out, for example, using sterile water while the administration can be carried out, for example, via a so-called bypass.
  • the invention further relates to a method for the preparation of a pharmaceutical composition, comprising the steps: a) identifying an IRS protein kinase inhibitor or agonist as defined above, b) providing adequate amounts of the IRS protein kinase inhibitor, and c) formulating the IRS protein kinase inhibitor into a pharmaceutical composition, optionally in combination with a pharmaceutical acceptable carrier.
  • Example 1 MATERIALS Oligonucleotide primers were obtained from MWG-Biotech (Ebersberg, Germany). BL21 Codon Plus and QuikChangeTM Site-Directed Mutagenesis Kit were purchased from Stratagene (La Jolla, CA, USA). One Shot TOP 10 Competent Cells were from Invitrogen (Karlsruhe, Germany). A plasmid miniprep kit was obtained from Qiagen (Hilden, Germany). A polyclonal anti-IRS-1 antiserum was a gift from Dr. J. A. Maassen (Leiden, The Netherlands). Anti-phosphotyrosine antibody (RC20) coupled to horseradish peroxidase and anti-p85 antibody were obtained from Transduction Laboratories, Inc.
  • RC20 Anti-phosphotyrosine antibody
  • Alpha Thrombin was purchased from Upstate Biotechnology Inc. (Lake Placid, NY, USA). Enzymes for molecular biology, Complete protease inhibitor cocktail, and modified trypsin sequencing grade were obtained from Roche (Mannheim, Germany). Okadaic acid, phosphatidylserine, and wheat germ agglutinin (Triticum vulgaris) were purchased from SIGMA (M ⁇ nchen, Germany). IRS-1 peptides were synthesized by Dr. Hoffmann (BMFZ, University of Dusseldorf, Dusseldorf, Germany).
  • Example 2 METHODS 1.) Construction and Expression of Fusion Proteins
  • the regulatory p85 ⁇ subunit of bovine PI 3-kinase cloned into the expression vector pGEX-2T was a kind gift of Dr. P. Shepherd (London, UK).
  • a glutathione S-transferase (GST) fusion protein containing the amino acids 449-664 of rat IRS-1 (rlRS-1 449"664 , M w of 51.2 kDa) was prepared based on the method described by Smith and Johnson (40) using the pGEX-5X-3 vector.
  • Corresponding rat cDNA was generated from RNA r isolated from rat heart by reverse transcription using avian myeloblastosis virus reverse transcriptase and subsequent amplification by polymerase chain reaction using Pwo.DNA Polymerase and the following oligonucleotide primers: 5 ' -primer, ATATTGTCGACCAC-ACCCCACCAGCCAGG, 3 ' -primer, ATGTACTACTACAGAGGGTC-ACGCCGGCGTAAGAATA (SEQ ID NO: 1 and 2). The PCR products were isolated, digested with appropriate restriction enzymes and subcloned into pGEX-5X-3.
  • rat IRS-1 clone was verified by restriction endonuclease analysis and nucleotide sequencing.
  • This vector and the p85 ⁇ -pGEX-2T construct were used to transform Escherichia coli BL21.
  • Transformed cells were grown to an A 6 oo nm of 0.6 - 0.8 in 2x YTA medium (16 g/l tryptone, 10 g/l yeast, NaCl 5 g/l) supplemented with 0.1 mg/ml ampicillin and induced for 2 h with 0.1 mM isopropyl- ⁇ -D- thiogalactoside (IPTG).
  • IPTG isopropyl- ⁇ -D- thiogalactoside
  • Fusion proteins were purified by affinity chromatography on glutathione-sepharose columns and eluted by 10 mM glutathione in 50 mM Tris-HCI (pH 8.0).
  • the GST part of the p85 GST-fusion protein was proteolytically removed using bovine thrombin in PBS.
  • the protease was added to the fusion protein bound to the glutathione sepharose column, incubated for 2 h at room temperature and then the eluate was collected. Protein was determined using a modification of the Bio-Rad protein assay. All GST fusion proteins had the expected molecular weight when analyzed by sodium dodecyl sulphate (SDS) polyacrylamide gel electrophoresis (PAGE).
  • SDS sodium dodecyl sulphate
  • PAGE polyacrylamide gel electrophoresis
  • the supernatant was then applied to an agarose-bound wheat germ agglutinin (WGA) column.
  • WGA wheat germ agglutinin
  • the column was washed with 50 mM Hepes (pH 7.4), 0.1% Triton X-100, and bound glycoproteins were eluted from the WGA column with this buffer containing 0.3 M N-acetylglucoseamine.
  • rlRS-1 449"664 phosphorylation by insulin receptor 5 ⁇ g of the WGA-purified glycoprotein fraction was preincubated for 30 min at 30°C with 100 nM of insulin in a phosphorylation buffer containing 20 mM Hepes (pH 7.4), 1 mM DTT, 10 mM MgC ⁇ , 100 ⁇ g/ml bovine serum albumin, 0.2 mM Na 3 V0 , 1.7 mM CaCI 2 , 0.6 mg/ml phosphatidylserine, and 0.5 ⁇ g/ml okadaic acid. Autophosphorylation was initiated by the addition of ATP at a concentration of 50 ⁇ M and continued for 10 min at 30 °C.
  • Substrate phosphorylations were initiated by addition of equal volumes of rlRS-1 449"669 (1 ⁇ g) with or without pre-treatment (30 min) by the PKC isoforms in the same buffer in the presence of 50 ⁇ M ATP and was allowed to proceed for 10 min at 30°C in a final volume of 50 ⁇ l.
  • the reaction was terminated by the addition of 6x sample buffer (0.35 M Tris-HCI (pH 6.8), 10.28 % (w/v) SDS, 36 % (v/v) glycerol; 0.6 M DTT, 0.012 % (w/v) bromphenol blue) and boiling for 5 min.
  • Proteins were separated by SDS-PAGE and analyzed by immunodetection with an anti-phosphotyrosine antibody after transfer to nitrocellulose. Serine/threonine phosphorylation of rlRS-1 449"664 by different PKC isoforms was assessed by incubating 1 ⁇ g rlRS-1 449"664 with 0.5 ⁇ g PKC-rb or PKC- ⁇ in phosphorylation buffer for 30 min at 30°C in the presence of 50 ⁇ M ATP plus 2 ⁇ Ci [ ⁇ - 32 P]ATP in a volume of 20 ⁇ l. Proteins were resolved by SDS-PAGE and the stained and dried gels were subjected to autoradiography.
  • Proteins were separated by SDS-PAGE using 8-18 % gradient gels followed by transfer to nitrocellulose in a semi-dry blotting apparatus. The membrane was then blocked 60 min in Tris-buffered saline containing 0.05% Tween 20 and 1 % BSA or 5% non fat dry milk and probed with appropriate antibodies (anti-IRS-1 , anti-pTyr, anti- p85 ⁇ ). After extensive washing, the membranes were incubated with horseradish
  • the HPLC flow rate was 0.5 ml/min. After injection of sample, the peptides were eluted beginning at 100% buffer A (20 mM NH 4 CH 3 COOH, pH 7.0) and 0% of buffer B (1 M KH 2 P0 4 , pH 4.0). The amount of buffer B was increased to 10% within 40 min and from 10 to 50% during the following 75 min. Fractions of 0.5 ml were collected, and radioactivity was measured by Cerenkov counting. Radioactive fractions were subjected to reversed phase HPLC.
  • Mass spectra were recorded on an electrospray quadrupole time-of-flight mass spectrometer (QSTAR Pulsar I, Applied Biosystems, Foster City, CA, USA) using a nanospray source (Protana, Odense, Denmark). Selected peptides were analyzed in tandem mass spectrometry mode and the sequence and posttranslational modifications were retrieved by manual interpretation.
  • the serine 570 to alanine and serine 612 to alanine mutants of rlRS-1 449"664 were generated by site-directed mutagenesis using the QuikChangeTM Site-Directed Mutagenesis Kit according to the manufacturer's instructions using pGEX-5X-3/rlRS- 1 449"664 as a template.
  • the following primers were used: S570A, 5 ' -CCCGGCTACCGGCATGCCGCCTTCGTGCCCACC (SEQ ID NO:3) and 3 ' -GGGCCGATGGCCGTACGGCGGAAGCACGGGTGG (SEQ ID NO:4); S612A, 5 ' -GGCTACATGCCCATGGCTCCCGGAGTGGCTCC (SEQ ID NO:5) and 3 ' -CCGATGTACGGGTACCGAGGGCCTCACCGAGG (SEQ ID NO:6). Presence of the desired mutations was confirmed by sequencing the recombinant molecules by Qiagen Sequencing Services (Hilden, Germany).
  • the mixture was adjusted with water to an end volume of 20 ⁇ l minus the necessary ATP volume. Then the phosphorylation reaction was started by addition of ATP from a stock solution to an end concentration of 50 ⁇ M ATP plus 2 ⁇ Ci [ ⁇ - 32 P]ATP and incubated for 30 min at 30°C. The reaction was stopped by addition of 4 ⁇ l 6x sample buffer (0.35 M Tris-HCI (pH 6.8), 10.28% (w/v) SDS, 36% (v/v) glycerol; 0.6 M 30 DTT, 0.012% (w/v) bromphenol blue) and boiling for 5 min. The proteins were then resolved by SDS-Page and the stained and dried gels were subjected for analysis to autoradiography.
  • Example 3 An IRS-1 domain is phosphorylated by the insulin receptor and interacts with PI 3- kinase
  • a selected part of the rat IRS-1 protein was cloned, expressed as a GST-fusion protein and purified from E. coli.
  • This GST-fusion protein (rlRS-1 449"664 ) covers a domain of 216 amino acids (449-664) of the rat IRS-1 protein
  • rlRS-1 449"664 incubated with the same amount of PKC in the presence of PKC inhibitors exhibited no significant incorporation of phosphate (Fig. 3 A).
  • a dose-response curve with increasing amounts of PKC was then determined to establish conditions of max. phosphorylation, which was observed with 0.5 ⁇ g PKC rat brain or PKC- ⁇ (data not shown).
  • rlRS-1 449"664 was treated with or without PKC and then incubated with WGA-purified IR.
  • p85 ⁇ association was subsequently determined by coupling rlRS-1 449"664 to glutathione sepharose beads via its GST part and incubation with 0.5 ⁇ g p85 ⁇ , as outlined in Figure 2 A.
  • Samples were analyzed by SDS-PAGE and immunoblotting with antibodies against phosphotyrosine (pTyr), p85 ⁇ , and IRS-1.
  • pTyr phosphotyrosine
  • IRS-1 IRS-1
  • rlRS-1 449"664 was incubated with PKC- ⁇ and separated by SDS-PAGE.
  • Phosphorylated rlRS-1 449"664 was digested with trypsin and extracted from the gel.
  • the peptides generated by digestion were resolved by two dimensional HPLC and the content of radioactivity in the fractions was monitored by Cerenkov counting.
  • the HPLC profile of the first separation using an anion exchange column showed 6 reproducible major peaks (Fig. 7 A).
  • Phosphoserine 358 was identified by ESI-MS/MS.
  • the fragment ion with a mass difference of 97.9 Da to the parent ion indicates a phosphopeptide (Fig. 8 A).
  • a mass difference 97.9 Da correlates to the loss of phosphoric acid.
  • the site of phosphorylation was identified by the loss of the phosphate group (HPO 3 ) and phosphoric acid (H 3 P0 ) from the fragment ions bg and b-io. This dephosphorylation of the fragment ions indicates that the phosphorylation could only take place by the Y355 or S358.
  • S358 is the phosphoaminoacid, because there was no dephosphorylation detected from the b 4 ion, indicating a phosphorylation at Y355 (data not shown).
  • Phosphoserine 612 could not be detected by mass spectrometry despite being detected by a phosphosite specific antibody (Fig. 6 A), but a peptide including this site was found in peak 2 together with three additional peptides. Peak 1 and peak 3 contained only one peptide covering 13% and 21% of the radioactivity, respectively (THSAGTSPTISHQK and TPSQSSVVSIEEY-TEMMPAAYPPGGGSGGR). (SEQ ID NO:10 and 11 ) To further confirm that the phosphorylation sites found were serine 570 and 612, two additional GST fusion proteins with mutation of serine to alanine were generated.
  • the abbreviations used are: GST, glutathione S-transferase; HPLC, high performance liquid chromatography; IR, insulin receptor; IRS, insulin receptor substrate; ESI-MS, electrospray ionization mass spectrometry; p85, regulatory subunit of phosphatidylinositol (PI)-3 kinase; PAGE, polyacrylamide gel electrophoresis; PI 3- kinase, phosphatidylinositol-3-kinase; RP, reversed phase; PKC, protein kinase C; PKB, protein kinase B; RTKs, receptor tyrosine kinases; SH2, src-homology domain 2; WGA, wheat germ agglutinine; SDS, sodium dodecyl sulphate; ECL, enhanced chemiluminescence.
  • PI phosphatidylinositol
  • FIG. 1 Schematic overview of IRS-1 with known interaction partners and known serine/threonine phosphorylation sites.
  • Upper panel The relative positions of the pleckstrin homology (PH) and phosphotyrosine-binding (PTB) domain are indicated followed by a C-terminal tail that contains numerous tyrosine phosphorylation sites. Potential binding partners including PI 3-kinase, Grb2 and SHP-2 are also shown.
  • Middle panel Known (S307, 612, 632, 789) and potential serine phosphorylation sites are highlighted.
  • Bottom panel Construction of a GST-fusion protein containing aa 449-664 of rat IRS-1 including the major binding site of the PI 3-kinase.
  • FIG. 2 Tyrosine phosphorylation of rlRS-1 449"664 and interaction with p85 ⁇ subunit of . PI 3-kinase.
  • A Schematic diagram of the experimental procedure. 5 ⁇ g IR was autophosphorylated for 10 min at 30°C in phosphorylation buffer after a 30 min preincubation with 100 nM insulin. Substrate phosphorylation was subsequently initiated by addition of autophosphorylated IR to aliquots of 1 ⁇ g rlRS-1 449"664 . The reaction proceeded for 10 min and then glutathione sepharose beads were added and samples were incubated at 4 °C on a rotator for 1 h.
  • FIG. 3 Effect of PKC from rat brain on tyrosine phosphorylation of rlRS-1 449"664 and interaction with p85 .
  • A 1 ⁇ g of rlRS-1 449 - 664 was incubated with 0.5 ⁇ g PKC from rat brain (PKC-rb) or 0.5 ⁇ g PKC- ⁇ in the presence of 2 ⁇ Ci ( 32 P)-ATP (final cone. 50 ⁇ M), as detailed in Methods. The reaction was inhibited by bisindolylmaleimide I (BIM) or pseudosubstrate peptide for PKC-rb or PKC- ⁇ , respectively. Proteins were resolved by SDS-PAGE and subjected to autoradiography.
  • BIM bisindolylmaleimide I
  • BIM pseudosubstrate peptide for PKC-rb or PKC- ⁇
  • FIG. 4 Effect of PKC isoforms on IR autophosphorylation.
  • A Autophosphorylation of IR was conducted as outlined in Fig. 2. Either PKC-rb or PKC- ⁇ was added after 10 min of autophosphorylation and incubation was continued for another 10 min. Tyrosine phosphorylation of IR ⁇ -subunit was then analyzed by immunoblotting.
  • Figure 5 Effect of PKC- ⁇ on tyrosine phosphorylation of rlRS-1 449"664 and interaction with p85 ⁇ .
  • rlRS-1 449"664 was preincubated with PKC- ⁇ (0.5 ⁇ g) for 30 min. Tyrosine phosphorylation by IR and interaction with p85 ⁇ was determined by immunoblotting, as detailed in Fig. 2.
  • FIG. 6 Identification of IRS-1 serine 612 as a target of PKC and interaction analysis with p85 ⁇ using surface plasmon resonance.
  • Figure 7 HPLC analysis of tryptic phosphopeptides derived from rlRS-1 449"664 phosphorylated by PKC- ⁇ .
  • Fig. 8 ESI-MS/MS spectra from the phosphopeptid 352-378.
  • Fig. 9 HPLC analysis of tryptic phosphopeptides of rlRS-1 449"664 and mutants S570A and S612A.
  • FIG. 10 Functional analysis of serine 570 and serine 612.
  • riRS-1 449"664 and the indicated mutants were preincubated with PKC- ⁇ and subjected to tyrosine phosphorylation by IR and interaction with p85 ⁇ , as outlined in Fig. 5. Representative Western, blots are shown.
  • NAHTPPARGEEELSNYICMGGK SEQ TD 233-254 4 & 2 NOJ2
  • GASTLTAPNGHYILSR SEQ LO NOJ3
  • 225555--227700 2 20.7
  • YTPGATMGTSPALTGDEAAGAADLDNR 277-303 S286 5 & 6 10.6 (SEQ ID NO:9)
  • THSAGTSPTISHQK (SEQ ID NO: 10) 308-321 1 12.9 TPSQSSVNSffiEYTEMMPAAYPPGGGSGGR 322-351 3 21.2 (SEQ LD ⁇ OJ1)
  • NDPNGYMMMSPSAAAS (SEQ LD NO:15) 441-456 2 20.7 a Tryptic peptides of rIRS-1 " were analyzed after anion exchange HPLC and reversed phase _-_ _ H

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Wood Science & Technology (AREA)
  • Medicinal Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Diabetes (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • General Engineering & Computer Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Cell Biology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Emergency Medicine (AREA)
  • Obesity (AREA)
  • Endocrinology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The present invention relates to a method for the identification of an IRS protein kinase inhibitor, comprising the steps of a) bringing into contact PKC-ζ with at least one IRS peptide comprising at least one PKC-ζ-Ser-phosphorylation site in the presence of at least one putative inhibitor, and b) measuring the phosphorylation of the PKC-ζ-Ser-phosphorylation site.

Description

A method for the identification of IRS protein kinase inhibitors or agonists
Description
The present invention relates to a method for the identification of IRS protein kinase inhibitors or agonists as well as to selected IRS peptides comprising phosphorylation sites for PKC-ζ and other IRS serine kinases and to the use of these peptides for the identification of a pharmaceutical composition for the treatment of diabetes type 2.
Non-insulin dependent diabetes mellitus (NIDDM) occurs predominantly in adults and is characterized by a reduced sensitivity of tissues being capable of clearing glucose from the blood. In contrast to insulin dependent diabetes mellitus (IDDM, diabetes type I) diabetes type II is not characterized by an impaired insulin secretion from the pancreatic beta cells.
The molecular mechanism leading to decreased insulin sensitivity or even insulin resistance are not yet known, despite of intensive efforts carried out by researchers both in Universities as well as in pharmaceutical industry. Recent studies have elucidated that in diabetes type ll. the second messenger pathways connecting the activated insulin receptor with GLUT4 translocation and glucose transport are disturbed. Specifically, insulin receptor substrate (IRS) proteins are phosphorylated on multiple tyrosine residues by the activated insulin receptor, the insulin-like-growth factor receptor and JAK1/2 and play a pivotal role in the process of downstream insulin signaling (1 , 2, 3). The phosphotyrosine motifs, specifically within IRS-1 and IRS-2, serve as docking sites for a series of adaptor proteins that possess Src homology 2 (SH2) domains including Grb2, the intracellular PTPase SHP-2, Nek, Crk, and phosphatidylinositol-3 kinase (PI-3 kinase) (4-6). PI-3 kinase is composed of a catalytic 110-kDa subunit (p110) and a regulatory 85-kDa subunit (p85) containing two SH2 domains that bind to tyrosine-phosphorylated pYMXM and pYXXM motifs in IRS proteins and induce PI-3 kinase activation (7). This leads to stimulation of additional downstream kinases including the serine/threonine kinase PKB/Akt (8,9) and the atypical protein kinase C isoforms-ζ and -λ (PKC-ζ/λ) (10, 11) by phosphoinositide- dependent kinase 1. Activation of PKB and PKC-ζ/λ and its downstream signals have been shown to play a critical role in mediating the metabolic actions of insulin such as GLUT4 translocation and glucose transport (10, 11 ), GSK3 serine phosphorylation and glycogen synthesis (12), PDE serine phosphorylation and anti-lipolysis (13, 14), and mTOR activation and protein synthesis (15, 16).
Dysregulation of the insulin-signaling system is a multifactorial process leading to insulin resistance and type 2 diabetes with the IRS proteins potentially representing a major target (17). Thus, serine/threonine phosphorylation of IRS proteins has been proposed to play a key role both in feedback inhibition of the insulin signal and the development of cellular insulin resistance (for review, see 17-19). Covalent modification of IRS-1 on serine/threonine was shown to impair its insulin-induced tyrosine phosphorylation, the activation of PI 3-kinase and the stimulation of glucose transport (20). In the unstimulated state serine/threonine phosphorylation of IRS-1 occurs constitutively in the cell (21) and it is further promoted by cytokines and metabolites that inhibit signal transduction like tumor necrosis factor (TNF)α (22), free fatty acids, glucose or ceramide (23). Furthermore, hyperphosphorylation of IRS-1 on serine/threonine residues is a common finding during insulin resistance and type 2 diabetes (24).
Despite a key role for the development of insulin resistance, the serine phosphorylation of IRS-1 has remained incompletely understood, mainly because IRS-1 contains more than 100 potential serine phosphorylation sites and because it was shown to represent a substrate for many, protein kinases including c-Jun N-terminal kinase (JNK) (25), IkappaB kinase-β (26), MAP kinase (27), Casein kinase (28), glycogensynthase kinase (29), phosphoinositol-3-kinase (30), protein kinase A (31 ), protein kinase C (32), protein kinase B (PKB) (33) and AMP-activated protein kinase (AMPK) (34). Interestingly, both PKB and AMPK were found to operate as a positive regulator of IRS-1 function supporting the notion that serine/threonine phosphorylation of IRS-1 has a dual role, either to enhance or to terminate insulin signaling (35). Identification of residues within different domains of IRS-1 undergoing serine phosphorylation in response to different stimuli has improved our understanding of this highly complex regulatory step in insulin action. Thus, Ser307 which is located near the phosphotyrosine-binding (PTB) domain has been identified as a target for stress- activated kinases including JNK (25) and may also play a role as a negative feedback regulator of insulin action (36). Ser789 is targeted by AMPK and positively modulates insulin action (34), however, Ser789 phosphorylation by unidentified kinases was also found to attenuate insulin signaling (37). Ser612, Ser632, Ser662 and Ser731 are located within or near the PI 3-kinase interaction domain, however, the functional implications of these sites has remained elusive (38-40).
In contrast to the protein kinases mentioned above, protein kinase C (PKC)-ζ, which is an atypical member of the PKC family of serine/threonine kinases, appears to participate both in the downstream transduction of the insulin signal and in the negative feedback control of IRS-1 function (11 , 41-44). Thus, PKC-ζ was found to colocalize with GLUT4 and to be essential for insulin-regulated GLUT4 translocation and glucose transport in skeletal muscle (41) and adipocytes (11 ). Further, defective activation of PKC-ζ may contribute to obesity-dependent development of skeletal muscle insulin resistance (42). Recent data by Quon and co-workers (43) have shown that IRS-1 represents a novel substrate for PKC-ζ and in a parallel study Zick and co- workers (44) found that this process inhibits PI 3-kinase activation, suggesting that PKC-ζ represents a key element in the negative feedback control of insulin action.
In summary, although it is known in the art that IRS, especially IRS-1 interacts with PKC-ζ, the nature of this interaction is not known. Consequently, there are no agents known in the art interacting with IRS-PKC-ζ interaction. However, such agents would be highly needed since it is very likely that an inhibition of the interaction of IRS and PKC-ζ would result in down-regulation of the inhibition of IRS and, more downstream, PI 3-kinase which in turn would result in an improvement in GLUT4 translokation and glucose transport.
Consequently, it is the object of the present invention to provide a method for the identification of IRS protein kinase inhibitors or agonists. According to the present invention, this object is met by a method for the identification of an IRS protein kinase inhibitor, comprising the steps of
a) bringing into contact PKC-ζ with at least one IRS peptide comprising at least one PKC-ζ-Ser-phosphorylation site in the presence of at least one putative inhibitor, and
b) measuring the phosphorylation of the PKC-ζ-Ser-phosphorylation site.
The present invention is based on the surprising identification of specific serine phosphorylation sites in the sequence of IRS, which are specifically recognized by PKC-ζ. Consequently, in the context of the present invention, the molecular mechanism providing the IRS-PKC-ζ interaction were identified. Moreover its likely that other protein kinases like c-Jun N-terminal kinase (JNK), IkappaB kinase-β, MAP kinase, Casein kinase, glycogensynthase kinase, phosphoinositol-3-kinase, protein kinase A, protein kinase C, protein kinase B 8PKB) and AMP-activated protein kinase (AMPK) might be able to recognize these phosphorylation sites. Therefore the determination of the serine sites, which are phosphorylated by protein kinases, especially PKC-ζ .enables the identification of molecules interfering with this interaction, either in an antagonistic or agonistic way.
In the context of the present invention, the term "IRS protein kinase inhibitor" relates to a substance which interferes with the interaction between IRS and a protein kinase, exemplified by PKC-ζ.
In the context of the present invention, the term "IRS peptide" relates to a peptide comprising a stretch of at least 5, preferably 7, preferably at least 10 amino acids of IRS. The term "IRS peptide" includes that the IRS-peptide may comprise, in addition to the stretch of amino acids derived from IRS, further amino acids which are not IRS derived.
All methods of the invention are preferably carried out in vitro. PKC-ζ is commercially available, e.g. from CalBiochem (San Diego, CA, USA). Furthermore, methods for the isolation of PKC-ζ are described in the literature cited in the present application.
The sequence of IRS, especially IRS-1 and IRS-2 from different species are known in the art. The rat IRS-1 sequence is herein provided as SEQ ID NO: 16.
Methods for the production of proteins and consequently of IRS are known in the art and enclude e.g. the expression of the protein in appropriate cells starting from a cDNA or the production by subsequent addition of amino acids to a starting amino acid (see Current Protocols, John Wiley & Sons, Inc., New York)
Furthermore, methods for the production of protein fragments are known in the art (see above) and include the cleavage of the protein with appropriate proteases or the generation of nucleic acid fragments encoding the protein fragments and subsequent expression of the fragments in appropriate cells.
Methods for the production of mutated proteins, e.g. by exchanging one or more amino acids or by deleting stretches of amino acids, are known in the art (see above). These methods include site directed mutagenesis of the IRS gene and expressing the modified gene in appropriate cells.
According to a preferred embodiment, a reduced phosphorylation of the PKC-ζ-Ser- phosphorylation site in comparison to the phosphorylation in the absence of the at least one putative inhibitor is indicative for the inhibitory properties of the putative inhibitor.
Preferably, PKC-ζ is of mammalian, preferably, of rodent or human origin, more preferably of rat or human origin. According to a preferred embodiment of the present invention, the IRS peptide is derived from an. IRS, preferably IRS-1 , of mammalian, preferably of human or rodent, more preferably of rat origin.
Preferably, the IRS-1 is of rat origin and the at least one PKC-ζ-Ser-phosphorylation site is selected from the group consisting of Ser 458, 469, 481 , 498, 522, 526, 530, 536, 538, 539, 542, 560, 570, 577, 599, 600, 612, 620, 632, 635, 662, and 664 wherein the sequence numbers correspond to rat IRS-1 as depicted in SEQ ID NOJ 6. Furthermore, the IRS-1 may be of human origin and the at least one PKC-ζ-Ser- phosphorylation site is selected from Ser-residues corresponding to the above Ser- residues of the rat IRS-1 ,
Preferably, the PKC-ζ-Ser-phosphorylation site in the context of the present invention may be selected from the group consisting of Ser498, Ser570 and Ser612, more preferably Ser570.
According to a most preferred embodiment of the present invention, the peptide is rlRS449-664 (SEQ ID NO: 17).
Preferably, the inhibitor is selected from the group consisting of binding peptides, antibodies, and Low molecular weight compounds (LMWs).
The term "binding protein" or "binding peptide" refers to a class of proteins or peptides which bind and inhibit IRS including, without limitation, polyclonal or monoclonal antibodies, antibody fragments and protein scaffolds directed against IRS, e.g. anticalins which are directed against IRS
The procedure for preparing an antibody or antibody fragment is effected in accordance with methods which are well known to the skilled person, e.g. by immunizing a mammal, for example a rabbit, with IRS, where appropriate in the presence of, for example, Freund's adjuvant and/or aluminum hydroxide gels (see, for example, Diamond, B.A. et al. (1981 ) The New England Journal of Medicine: 1344- 1349). The polyclonal antibodies which are formed in the animal as a result of an immunological reaction can subsequently be isolated from the blood using well known methods and, for example, purified by means of column chromatography. Monoclonal antibodies can, for example, be prepared in accordance with the known method of Winter & Milstein (Winter, G. & Milstein, C. (1991) Nature, 349, 293-299).
According to the present invention the term antibody or antibody fragment is also understood as meaning antibodies or antigen-binding parts thereof, which have been prepared recombinantly and, where appropriate, modified, such as chimaeric antibodies, humanized antibodies, multifunctional antibodies, bispecific or oligospecific antibodies, single-stranded antibodies and F(ab) or F(ab)2 fragments (see, for example, EP-B1-0 368 684, US 4,816,567, US 4,816,397, WO 88/01649, WO 93/06213 or WO 98/24884).
As an alternative to the classical antibodies it is also possible, for example, to use protein scaffolds against IRS, e.g. anticalins which are'based on lipocalin (Beste et al. (1999) Proc. Natl. Acad. Sci. USA, 96, 1898-1903). The natural ligand-binding sites of the lipocalins, for example the retinol-binding protein or the bilin-binding protein, can be altered, for example by means of a "combinatorial protein design" approach, in such a way that they bind to selected haptens, here to IRS (Skerra, 2000, Biochim. Biophys. Acta, 1482, 337-50). Other known protein scaffolds are known as being alternatives to antibodies for molecular recognition (Skerra (2000) J. Mol. Recognit, 13, 167-187).
LMWs are molecules which are not proteins, peptides antibodies or nucleic acids, and which exhibit a molecular weight of less than 5000 Da, preferably less than 2000 Da, more preferably less than 2000 Da, most preferably less than 500 Da. Such LMWs may be identified in High-Through-Put procedures starting from libraries.
The inhibitor can be in the form of a natural product extract, either in crude or in purified form. The extract can be produced according to standard procedures, such as water and/or alcohol and/or organic solvent extraction and/or column chromatography and/or precipitation from an animal, plant or microbial source, like snake poison, leaves or microbial fermentation broths. In the context of the present invention, IRS and PKC-ζ are provided e.g. in an assay system and brought directly or indirectly into contact with a test compound, in particular a biochemical or chemical test compound, e.g. in the form of a chemical compound library. Then, the influence of the test compound on the phosphorylation of IRS is measured or detected. Thereafter, suitable inhibitors can be analyzed and/or isolated. For the screening of chemical compound libraries, the use of high-throughput assays are preferred which are known to the skilled person or which are commercially available.
According to the present invention the term "chemical compound library" refers to a plurality of chemical compounds that have been assembled from any of multiple sources, including chemically synthesized molecules and natural products, or that have been generated by combinatorial chemistry techniques.
In general, the influence of the test compound on the interaction is measured or detected by determining the degree of phosphorylation of the IRS peptide. This can be done by using phosphor-specific antibodies. Such antibodies are known in the art and available e.g: from Clonetech, Santa Cruz and Cellsignal.
Alternatively, the degree of phosphorylation may be measured by using radio labeled ATP in the assay. The ATP can be labeled with 32-P or 33-P, and the amount of radioactive phosphate incorporated into the IRS can be measured by methods known in the art (see Example 2, 9.). For example, the intensity of a signal measured by auto radiography may be indicative for the degree of phosphorylation.
Advantageously the method of the present invention is carried out in a robotics system e.g. including robotic plating and a robotic liquid transfer system, e.g. using micro fluidics, i.e. channeled structured.
In another embodiment of the present invention, the method is carried out in form of a high-through put screening system. In such a system advantageously the screening method is automated and miniaturized, in particular it uses miniaturized wells and micro fluidics controlled by a roboter.
The invention further relates to a method for the identification of an IRS agonist, comprising the steps of a) bringing into contact PKC-ζ with at least one IRS peptide comprising at least one PKC-ζ-Ser-phosphorylation site in the presence of at least one putative agonist comprising at least one PKC-ζ-Ser-phosphorylation site, and b) measuring the phosphorylation of the PKC-ζ-Ser-phosphorylation site of the putative agonist.
For this method of the invention, with respect to PKC-ζ and IRS, the same embodiments as for the above disclosed method apply.
In preferred embodiment, the agonist is a peptide. Peptide libraries which could be used in the context of the present invention are known in the art.
According to a preferred embodiment of this method of the invention, an increased phosphorylation of the PKC-ζ-Ser-phosphorylation site of the agonist in comparison to the phosphorylation of the PKC-ζ-Ser-phosphorylation site of the IRS peptide is indicative for the agonistic properties of the putative agonist.
The invention further relates to a method for the determination of PKC-ζ activity, comprising the steps of a) bringing into contact PKC-ζ with at least one IRS peptide comprising at least one PKC-ζ-Ser-phosphorylation site in the presence of at least one putative inhibitor, and b) measuring the phosphorylation of the PKC-ζ-Ser-phosphorylation site. Consequently, the present invention provides a method to measure the activity of PKC-ζ. Such a method is especially useful when the activity of PKC-ζ from different patients has to measured in order to gain more information about the signal transduction system in patients, especially diabetic patients.
Within this method of the invention, PKC-ζ is preferably of mammalian, more preferably of human origin.
With respect to this method of the invention and to the IRS used therein, the same applies as for the other method of the invention as disclosed above.
The invention further relates to an IRS-1 peptide comprising Ser570, preferably IRS- ,| 449-664 as snown jn SEQ ID NO: 17 or to its human homologue.
Within the present invention, it has turned out that this peptide of the invention is especially useful for the identification of IRS analogues or inhibitors.
The invention further provides a kit comprising a) at least one IRS peptide, b) a PKC-ζ preparation, and c) at least one putative IRS protein kinase inhibitor or agonist.
As already discussed above, such a kit is extremely useful for the identification of, IRS protein kinase inhibitors. Its individual components have already been discussed above.
In a further aspect, the present invention provides an IRS-1 peptide, wherein Ser570 and/or Ser612 are mutated, preferably to alanine. Such a peptide is useful for blocking PKC-ζ activity in vitro or in vivo. The invention further relates to the use of an IRS peptide as defined above for the production of antibodies, preferably against a PKC-ζ-Ser-phosphorylation site, preferably against Ser498, Ser570 and Ser612, more preferably against Ser570. Consequently, with the help of the IRS peptides as defined in the present invention, it is possible to produce IRS specific antibodies, especially antibodies which are directed against PKC-ζ phosphorylation sites. Such antibodies can serve both in in vitro diagnostics as well as in pharmaceutical compositions.
In a further aspect, the present invention relates to the use of an IRS peptide as defined above or of an IRS-1 peptide with mutated Ser-sites as defined above for the preparation of a pharmaceutical composition for the treatment of diabetes type 2. Such peptides may inhibit the interaction between IRS and PKC-ζ and may, therefore, serve as antagonists of IRS phosphorylation.
For the production of the pharmaceutical composition the IRS protein kinase inhibitors or agonists as identified in the present invention or the peptides of the present invention are usually formulated with one or more pharmaceutically acceptable additives or auxiliary substances, such as physiological buffer solution, e.g. sodium chloride solution, demineralized water, stabilizers, such as protease or nuclease inhibitors, preferably aprotinin, ε-aminocaproic acid or pepstatin A or sequestering agents such as EDTA, gel formulations, such as white vaseline, low-viscosity paraffin and/or yellow wax, etc. depending on the kind of administration.
Suitable further additives are, for example, detergents, such as, for example, Triton X-100 or sodium deoxycholate, but also polyols, such as, for example, polyethylene glycol or glycerol, sugars, such as, for example, sucrose or glucose, zwitterionic compounds, such as, for example, amino acids such as glycine or in particular taurine or betaine and/or a protein, such as, for example, bovine or human serum albumin. Detergents, polyols and/or zwitterionic compounds are preferred.
The physiological buffer solution preferably has a pH of approx. 6.0-8.0, expecially a pH of approx. 6.8-7.8, in particular a pH of approx. 7.4, and/or an osmolarity of approx. 200-400 milliosmol/liter, preferably of approx. 290-310 milliosmol/liter. The pH of the pharmaceutical composition is in general adjusted using a suitable organic or inorganic buffer, such as, for example, preferably using a phosphate buffer, tris buffer (tris(hydroxymethyl)aminomethane), HEPES buffer ([4-(2-hydroxyethyl)piperazino]ethanesulphonic acid) or MOPS buffer (3-morpholino- 1-propanesulphonic acid). The choice of the respective buffer in general depends on the desired buffer molarity. Phosphate buffer is suitable, for example, for injection and infusion solutions.
The pharmaceutical composition can be administered in a conventional manner, e.g. by means of oral dosage forms, such as, for example, tablets or capsules, by means of the mucous membranes, for example the nose or the oral cavity, in the form of depositories implanted under the skin, by means of injections, infusions or gels which contain the pharmaceutical compositions according to the invention. It is further . possible to administer the pharmaceutical composition topically and locally, if appropriate, in the form of liposome complexes. Furthermore, the treatment can be carried out by means of a transdermal therapeutic system (TTS), which makes possible a temporally controlled release of the pharmaceutical compositions. TTS are known for example, from EP 0 944 398 A1 , EP 0 916 336 A1 , EP 0 889 723 A1 or EP 0 852 493 A1.
Injection solutions are in general used if only relatively small amounts of a solution or suspension, for example about 1 to about 20 ml, are to be administered to the body. Infusion solutions are in general used if a larger amount of a solution or suspension, for example one or more liters, are to be administered. Since, in contrast to the infusion solution, only a few milliliters are administered in the case of injection solutions, small differences from the pH and from the osmotic pressure of the blood or the tissue fluid in the injection do not make themselves noticeable or only make themselves noticeable to an insignificant extent with respect to pain sensation. Dilution of the formulation according to the invention before use is therefore in general not necessary. In the case of the administration of relatively large amounts, however, the formulation according to the invention should be diluted briefly before administration to such an extent that an at least approximately isotonic solution is obtained. An example of an isotonic solution is a 0.9% strength sodium chloride solution. In the case of infusion, the dilution can be carried out, for example, using sterile water while the administration can be carried out, for example, via a so-called bypass.
The invention further relates to a method for the preparation of a pharmaceutical composition, comprising the steps: a) identifying an IRS protein kinase inhibitor or agonist as defined above, b) providing adequate amounts of the IRS protein kinase inhibitor, and c) formulating the IRS protein kinase inhibitor into a pharmaceutical composition, optionally in combination with a pharmaceutical acceptable carrier.
The invention is further described by the following examples and figures, which are not intended to limit the scope of the present invention.
EXAMPLES
Example 1 MATERIALS Oligonucleotide primers were obtained from MWG-Biotech (Ebersberg, Germany). BL21 Codon Plus and QuikChange™ Site-Directed Mutagenesis Kit were purchased from Stratagene (La Jolla, CA, USA). One Shot TOP 10 Competent Cells were from Invitrogen (Karlsruhe, Germany). A plasmid miniprep kit was obtained from Qiagen (Hilden, Germany). A polyclonal anti-IRS-1 antiserum was a gift from Dr. J. A. Maassen (Leiden, The Netherlands). Anti-phosphotyrosine antibody (RC20) coupled to horseradish peroxidase and anti-p85 antibody were obtained from Transduction Laboratories, Inc. (Lexington, KY, USA). Monoclonal anti-IRβ antibody was supplied from Oncogene (Cambridge, MA, USA). Anti-IRS-1 pS616 antibody was from Biosource (Camarillo, CA, USA). HRP-conjugated anti-rabbit and anti-mouse IgG antibody as secondary antibody for enhanced chemiluminescence (ECL) detection was from Promega Corp. (Mannheim, Germany). Protein kinase C from rat brain (PKC-rb), recombinant human protein kinase C-ζ, bisindolylmaleim.de I (BIM), and PKC-ζ pseudosubstrate inhibitor were obtained from Calbiochem (San Diego, CA, USA). Alpha Thrombin was purchased from Upstate Biotechnology Inc. (Lake Placid, NY, USA). Enzymes for molecular biology, Complete protease inhibitor cocktail, and modified trypsin sequencing grade were obtained from Roche (Mannheim, Germany). Okadaic acid, phosphatidylserine, and wheat germ agglutinin (Triticum vulgaris) were purchased from SIGMA (Mϋnchen, Germany). IRS-1 peptides were synthesized by Dr. Hoffmann (BMFZ, University of Dusseldorf, Dusseldorf, Germany). Chemicals for SDS- PAGE, GST gβne fusion vector pGEX-5X-3, Glutathione Sepharose® 4B and [γ- 32P]ATP were supplied by Amersham Biosciences (Freiburg, Germany). GelCode Blue Stain reagent, Restore™ Western Blot stripping buffer and SuperSignal Substrate was obtained from Pierce (Rockford, USA). Biacore X and sensor chip CM5 are products of Biacore (Freiburg, Germany). All other chemicals were of the highest grade commercially available. Example 2 METHODS 1.) Construction and Expression of Fusion Proteins The regulatory p85α subunit of bovine PI 3-kinase cloned into the expression vector pGEX-2T was a kind gift of Dr. P. Shepherd (London, UK). A glutathione S-transferase (GST) fusion protein containing the amino acids 449-664 of rat IRS-1 (rlRS-1449"664, Mw of 51.2 kDa) was prepared based on the method described by Smith and Johnson (40) using the pGEX-5X-3 vector. Corresponding rat cDNA was generated from RNA r isolated from rat heart by reverse transcription using avian myeloblastosis virus reverse transcriptase and subsequent amplification by polymerase chain reaction using Pwo.DNA Polymerase and the following oligonucleotide primers: 5'-primer, ATATTGTCGACCAC-ACCCCACCAGCCAGG, 3'-primer, ATGTACTACTACAGAGGGTC-ACGCCGGCGTAAGAATA (SEQ ID NO: 1 and 2). The PCR products were isolated, digested with appropriate restriction enzymes and subcloned into pGEX-5X-3. Identity of the rat IRS-1 clone was verified by restriction endonuclease analysis and nucleotide sequencing. This vector and the p85α-pGEX-2T construct were used to transform Escherichia coli BL21. Transformed cells were grown to an A6oo nm of 0.6 - 0.8 in 2x YTA medium (16 g/l tryptone, 10 g/l yeast, NaCl 5 g/l) supplemented with 0.1 mg/ml ampicillin and induced for 2 h with 0.1 mM isopropyl-β-D- thiogalactoside (IPTG). Fusion proteins were purified by affinity chromatography on glutathione-sepharose columns and eluted by 10 mM glutathione in 50 mM Tris-HCI (pH 8.0). The GST part of the p85 GST-fusion protein was proteolytically removed using bovine thrombin in PBS. The protease was added to the fusion protein bound to the glutathione sepharose column, incubated for 2 h at room temperature and then the eluate was collected. Protein was determined using a modification of the Bio-Rad protein assay. All GST fusion proteins had the expected molecular weight when analyzed by sodium dodecyl sulphate (SDS) polyacrylamide gel electrophoresis (PAGE). 0 2.) Insulin Receptor Kinase Preparation Rat liver was rapidly removed, immediately frozen in liquid nitrogen and processed as described (41 ). Briefly, 3.5 vol/wt of an ice-cold buffer consisting of 50 mM Hepes (pH 7.4), 1% Triton X-100 and 2x Complete Protease Inhibitors was added and the liver was homogenized using an Ultraturrax and a Potter-Elvehjem homogenizer, followed by centrifugation at 10,000 x g for 10 min at 4°C. The resultant supernatant was slowly stirred at room temperature for 60 min, then again centrifuged at 100,000 x g for 90 min at 4°C. The supernatant was then applied to an agarose-bound wheat germ agglutinin (WGA) column. The column was washed with 50 mM Hepes (pH 7.4), 0.1% Triton X-100, and bound glycoproteins were eluted from the WGA column with this buffer containing 0.3 M N-acetylglucoseamine.
3.) In vitro Phosphorylation Assay
For rlRS-1449"664 phosphorylation by insulin receptor, 5 μg of the WGA-purified glycoprotein fraction was preincubated for 30 min at 30°C with 100 nM of insulin in a phosphorylation buffer containing 20 mM Hepes (pH 7.4), 1 mM DTT, 10 mM MgC^, 100 μg/ml bovine serum albumin, 0.2 mM Na3V0 , 1.7 mM CaCI2, 0.6 mg/ml phosphatidylserine, and 0.5 μg/ml okadaic acid. Autophosphorylation was initiated by the addition of ATP at a concentration of 50 μM and continued for 10 min at 30 °C. Substrate phosphorylations were initiated by addition of equal volumes of rlRS-1449"669 (1 μg) with or without pre-treatment (30 min) by the PKC isoforms in the same buffer in the presence of 50 μM ATP and was allowed to proceed for 10 min at 30°C in a final volume of 50 μl. The reaction was terminated by the addition of 6x sample buffer (0.35 M Tris-HCI (pH 6.8), 10.28 % (w/v) SDS, 36 % (v/v) glycerol; 0.6 M DTT, 0.012 % (w/v) bromphenol blue) and boiling for 5 min. Proteins were separated by SDS-PAGE and analyzed by immunodetection with an anti-phosphotyrosine antibody after transfer to nitrocellulose. Serine/threonine phosphorylation of rlRS-1449"664 by different PKC isoforms was assessed by incubating 1 μg rlRS-1449"664 with 0.5 μg PKC-rb or PKC-ζ in phosphorylation buffer for 30 min at 30°C in the presence of 50 μM ATP plus 2 μCi [γ- 32P]ATP in a volume of 20 μl. Proteins were resolved by SDS-PAGE and the stained and dried gels were subjected to autoradiography. The extent of phosphate incorporation was determined by Cerenkov counting of excised fragments. 4.) GST Pull Down Assay In vitro phosphorylated rlRS-1449"664 was incubated with glutathione sepharose beads on a rotator for 1 h at 4°C. Pellets were washed three times with binding buffer (50 mM Tris (pH 7.4), 150 mM NaCl, 1 % (v/v) Nonidet P-40, 1 mM EDTA, 1 mM NaF, 1 mM 5 Na3V0 ). Then 0.5 μg recombinant p85α was added and incubation was continued for 2 h at 4°C. After three times washing, the bound proteins were eluted with 20 μl of 2x sample buffer and separated by SDS-PAGE.
5.) Immunoblotting
10 Proteins were separated by SDS-PAGE using 8-18 % gradient gels followed by transfer to nitrocellulose in a semi-dry blotting apparatus. The membrane was then blocked 60 min in Tris-buffered saline containing 0.05% Tween 20 and 1 % BSA or 5% non fat dry milk and probed with appropriate antibodies (anti-IRS-1 , anti-pTyr, anti- p85α). After extensive washing, the membranes were incubated with horseradish
15 peroxidase-conjugated secondary antibodies, again washed and then the protein bands were visualized by the enhanced chemiluminescence (ECL) method on a Lumilmager workstation (Boehringer, Mannheim, Germany). All blots were quantified using the Lumilmager software. Significance of reported differences was evaluated by using the null hypothesis and t statistics for unpaired data. A p value less than 0.05
20 was considered to be statistically significant.
6.) Phosphopeptide mapping by High Performance Liquid Chromatography (HPLC) and Electrospray lonisation Mass Spectrometry (ESI-MS) Using 50 U (40 μg) of PKC-ζ, 5 nmol of rlRS-1449"664 protein was phosphorylated with
25 50 μM ATP plus 0.25 mCi/ml [γ-32P]ATP for 60 min under conditions described above. Proteins were separated by SDS-PAGE and phosphorylated rlRS-1449"664 was digested with 100 μg trypsin in the excised gel pieces overnight at 30°C. Peptides were eluted with 50 mM NH HCθ3, 50% acetonitrile and separated on an anion exchange column (Nucleogel SAX 1000-8/46, 50 x 4.6 mm, Macherey & Nagel, Dϋren, Germany) using
30 Beckman gold solvent delivery system. The HPLC flow rate was 0.5 ml/min. After injection of sample, the peptides were eluted beginning at 100% buffer A (20 mM NH4CH3COOH, pH 7.0) and 0% of buffer B (1 M KH2P04, pH 4.0). The amount of buffer B was increased to 10% within 40 min and from 10 to 50% during the following 75 min. Fractions of 0.5 ml were collected, and radioactivity was measured by Cerenkov counting. Radioactive fractions were subjected to reversed phase HPLC. Peptides were separated on a C18-reversed phase column (Nucleosil 300-5 C18, 250 mm x 2 mm, 5 μm particle size, 300 A pore size, Macherey & Nagel, Dϋren, Germany). The HPLC flow rate was adjusted to 0.33 ml/min. After application of the sample, elution started with 100% of solution A (0.1% TFA) and 0% of solution B (acetonitrile/TFA (84/OJ ; v/v)). The content of solution B was raised to 100% in 120 min. Again the radioactivity of the collected fractions was measured. Fractions containing radiolabeled peptides were subjected to ESI-TOF mass spectrometry. Mass spectra were recorded on an electrospray quadrupole time-of-flight mass spectrometer (QSTAR Pulsar I, Applied Biosystems, Foster City, CA, USA) using a nanospray source (Protana, Odense, Denmark). Selected peptides were analyzed in tandem mass spectrometry mode and the sequence and posttranslational modifications were retrieved by manual interpretation.
7.) Site-Directed Mutagenesis.
The serine 570 to alanine and serine 612 to alanine mutants of rlRS-1449"664 were generated by site-directed mutagenesis using the QuikChange™ Site-Directed Mutagenesis Kit according to the manufacturer's instructions using pGEX-5X-3/rlRS- 1449"664 as a template. The following primers were used: S570A, 5'-CCCGGCTACCGGCATGCCGCCTTCGTGCCCACC (SEQ ID NO:3) and 3'-GGGCCGATGGCCGTACGGCGGAAGCACGGGTGG (SEQ ID NO:4); S612A, 5'-GGCTACATGCCCATGGCTCCCGGAGTGGCTCC (SEQ ID NO:5) and 3'-CCGATGTACGGGTACCGAGGGCCTCACCGAGG (SEQ ID NO:6). Presence of the desired mutations was confirmed by sequencing the recombinant molecules by Qiagen Sequencing Services (Hilden, Germany).
8.) Interaction studies by surface plasmon resonance technology The principle of operation of the BIAcore™ biosensor (Biacore, Freiburg, Germany) has been described previously (42). To avoid the interfering dimerization of the GST part of the fusion protein, it was cleaved with thrombin during the purification. Because of the known extremely fast association rates of SH2-domains to phosphopeptides the relative affinities were assessed by competition assay (43). Therefore, a constant concentration of p85α (100 nM) was incubated in running buffer (0.01 M Hepes pH 7.4, 0.15 M NaCl, 3 mM EDTA, 0.005% Surfactant P20 (HBS-EP)) with a variable 5 concentration of the competitor peptide (50 nM - 10 μM), which was identical to that bound on the CM5 sensor chip surface. After a 1 h preincubation at room temperature the various mixtures were then injected sequentially at a flow rate of 5 μl/min at 25°C in HBS-EP buffer. The used peptides DDGYMPMSPGV (SEQ ID NO: 7), DDGpYMPMSPGV, DDGYMPMpSPGV and DDGpYMPMpSPGV, representing the
10 amino acids 605 to 615 of rat IRS-1 , were synthesized on an Applied Biosystems model 433 peptide synthesizer. All peptides were immobilized with a concentration of 5 mg/ml in 100 mM H3B0 (NaOH pH 8.5) at 1 μl/min by standard amine coupling procedure as described by the manufacturer. Regeneration after each binding experiment was performed by injection of 6 M guanidine hydrochloride for 2 min. The
15 kinetic analysis of the p85α with pY608 and pY606-pS612 interaction has been performed using the BIAevaluation 3J software (Biacore, Freiburg, Germany) and GraphPad Prism 3.0 (San Diego, CA, USA).
9.) Measurement of Serine/threonine phosphorylation of rlRS-1449"664 by PKC 20 Serine/threonine phosphorylation of rlRS-1449"664 by different PKC isoforms was assessed by pipetting appropriate volumes of 1 μg rlRS-1449"664 and 0J - 1.0 μg PKC- ζ or PKC-rat brain into μl 2x phosphorylation buffer (20 mM Hepes (pH 7.4), 1 mM DTT, 10 mM MgCI2, 100 μg/ml bovine serum albumin, 0,2 mM Na3N0 , 1.7 mM CaCI2, 0.6 mg/ml phosphatidylserine, and 0.5 μg/ml okadaic acid, 50 μM ATP + 2 μCi [γ- 25 32P]ATP). The mixture was adjusted with water to an end volume of 20 μl minus the necessary ATP volume. Then the phosphorylation reaction was started by addition of ATP from a stock solution to an end concentration of 50 μM ATP plus 2 μCi [γ-32P]ATP and incubated for 30 min at 30°C. The reaction was stopped by addition of 4 μl 6x sample buffer (0.35 M Tris-HCI (pH 6.8), 10.28% (w/v) SDS, 36% (v/v) glycerol; 0.6 M 30 DTT, 0.012% (w/v) bromphenol blue) and boiling for 5 min. The proteins were then resolved by SDS-Page and the stained and dried gels were subjected for analysis to autoradiography. Example 3 An IRS-1 domain is phosphorylated by the insulin receptor and interacts with PI 3- kinase In order to determine the effects of serine/threonine phosphorylation on the interaction 5 of IRS-1 with the insulin receptor and PI3-kinase, we developed an in vitro phosphorylation and PI 3-kinase interaction assay using recombinant p85α and a GST-pulldown approach. A selected part of the rat IRS-1 protein was cloned, expressed as a GST-fusion protein and purified from E. coli. This GST-fusion protein (rlRS-1449"664) covers a domain of 216 amino acids (449-664) of the rat IRS-1 protein
10 containing potential tyrosine phosphorylation sites within YMXM or YXXM consensus motifs, including the major PI3-kinase binding sites Tyr608 and Tyr628 (39) (see Fig. 1 ). Based on the structure of the coded fusion protein a molecular mass of 51.2 kDa was calculated, an apparent weight of 55 kDa was determined by SDS-PAGE. The experimental procedure of the in vitro phosphorylation and p85α interaction assay is
15 presented in Fig. 2 A. Exposing the fusion protein to WGA-purified insulin receptor induced to a prominent insulin-stimulated tyrosine phosphorylation of rlRS-1449"664 (Fig. 2 B, upper panel). Quantification showed an 8.8 ± 1.1 fold stimulation over basal (n = 10, Fig. 2 C). The GST-pulldown assay revealed a significant increase in the interaction of the p85α
20 regulatory subunit of PI3-kinase with the tyrosine phosphorylated rlRS-1449"664 (Fig. 2B, middle panel).
Example 4 Different PKC isoforms inhibit insulin-stimulated tyrosine phosphorylation of rlRS-1449"
25 664 and subsequent association to p85α. In order to assess if protein kinase C is capable of phosphorylating rlRS-1449"664 in vitro, we first incubated the fusion protein with PKC rat brain and PKC-ζ in the presence of [32P]ATP. rlRS-1449"664 was then analyzed by SDS-PAGE and autoradiography (Fig. 3 A) and a prominent phosphorylation of rlRS-1449"664 by PKC
30 became detectable. rlRS-1449"664 incubated with the same amount of PKC in the presence of PKC inhibitors exhibited no significant incorporation of phosphate (Fig. 3 A). A dose-response curve with increasing amounts of PKC was then determined to establish conditions of max. phosphorylation, which was observed with 0.5 μg PKC rat brain or PKC-ζ (data not shown). Using this condition we then investigated the influence of the serine phosphorylation of rlRS-1449"664 on the subsequent activation by the autophosphorylated IR. Therefore, rlRS-1449"664 was treated with or without PKC and then incubated with WGA-purified IR. p85α association was subsequently determined by coupling rlRS-1449"664 to glutathione sepharose beads via its GST part and incubation with 0.5 μg p85α, as outlined in Figure 2 A. Samples were analyzed by SDS-PAGE and immunoblotting with antibodies against phosphotyrosine (pTyr), p85α, and IRS-1. As shown in Figure 3 B, pretreatment of rlRS-1449"664 with PKC rat brain caused a decrease in the insulin-stimulated tyrosine phosphorylation and the interaction with p85α. Tyr-phosphorylation of rlRS-1449"664 was reduced by 27 + 4% (n = 9) with a more prominent inhibition of the association of p85α (49 ± 8%) (Fig..3 C). Inhibition of PKC-rb after phosphorylation of rlRS-1449"664 by addition of bisindolylmaleimide (BIM) did not modify this result (Fig. 3 C). To further exclude effects of PKC at the level of IR, the autophosphorylation of the β- subunit was examined. No significant alteration of IR autophosphorylation became detectable when the autoactivated receptor was incubated for 10 min at 30°C in the presence of PKC-rb or PKC-ζ when compared to controls (Fig. 4). The experimental approach described in Fig. 3 B was then repeated for PKC-ζ. When compared to PKC-rb, an even more prominent reduction in the tyrosine phosphorylation of rlRS-1449"664 and interaction with p85α was observed (Fig. 5 A). Quantification of the data showed an inhibition of tyrosine phosphorylation by 46 + 5% (n = 3) and a concomitant inhibition of p85α binding to IRS-1 by 81 ± 1% (Fig. 5 B).
Example 5
Identification and functional analysis of IRS-1 serine phosphorylation sites targeted by
PKC
Prior studies have indicated that negative regulation of insulin signaling by protein kinase C involves the mitogen-activated protein kinase and phosphorylation of serine 612 in IRS-1 (26). Serine 612 is localized in direct neighborhood to a major YMXM motif at Y608 which is described to be one of the main interaction sites for PI 3-kinase
(39). We assessed modification of this site by PKC using a specific IRS-1 phosphoserine 612 antibody (αpS612). After incubation with PKC from rat brain and PKC-ζ for 30 min at 30°C, rlRS-1449"664 was strongly immunoblotted with αpS612 (Figure 6A); inhibition of PKC with BIM clearly prevented the phosphorylation of this serine.
To characterize the influence of phosphoserine 612 of IRS-1 on the interaction with PI 3-kinase the technique of surface plasmon resonance (SPR) was used. For this purpose peptides were synthesized with the sequence DDGYMPMSPGV (SEQ ID NO:7) representing amino acids 605 to 615 of rat IRS-1 and immobilized on a chip surface by standard amine coupling. It has been reported that fusion of SH2 domains to GST may affect their binding to phosphopeptides leading to an overestimation of the binding affinity (44). Therefore, the GST part of the recombinant p85α fusion protein was cleaved. Binding of p85α to the peptides was studied by applying various concentrations of the purified p85α to a biosensor chip to which the peptides were coupled in different phosphorylation forms. These experiments showed that p85α only binds to the tyrosine phosphorylated form of the peptide (Fig. 6 B and C), consistent with the literature (45).
We then determined the relative binding affinity of this reaction by monitoring the binding of 100 nM p85α to the peptides pY608 (DDGpYMPMSPGV) and pY608-pS612 (DDGpYMPMpSPGV) in the presence of competing soluble peptides (Fig. 6 D, E, F). Half-maximum inhibitory concentrations (IC50) were obtained by plotting the SPR response 440 s after injection at equilibrium versus the log peptide concentration. Both peptides displayed a measurable binding activity (Fig. 6 D versus 6 E). Solubilized peptides inhibited binding of p85α to the immobilized peptides at micromolar concentrations. Complete inhibition was achieved at a peptide concentration of -10 μM. Fitting of the determined readings with an equation for two site competition resulted in an IC50 for pY608 of 0.26 μmol/l and 16.56 μmol/l (^=0.9983), and for pY608-pS612 of 0J5 μmol/l, 2.88 μmol/l (^=0.9989). From this data it is clear that the peptide pY608-pS612 inhibited the binding of p85 with a better efficiency, indicating that the presence of a phosphoserine residue at position +4 of the phosphotyrosine even increases the affinity of the p85α SH2-domain for the IRS-1 phosphopeptide. In order to identify additional PKC-ζ phosphorylation sites on rlRS-1449"664 that might promote the inhibition of insulin-stimulated tyrosine phosphorylation in the in vitro system, rlRS-1449"664 was incubated with PKC-ζ and separated by SDS-PAGE. Phosphorylated rlRS-1449"664 was digested with trypsin and extracted from the gel. The peptides generated by digestion were resolved by two dimensional HPLC and the content of radioactivity in the fractions was monitored by Cerenkov counting. The HPLC profile of the first separation using an anion exchange column showed 6 reproducible major peaks (Fig. 7 A). To separate comigrating peptides, radioactive fractions of each peak were pooled according to the elution profile and subjected to reversed phase (RP)-HPLC (Fig. 7 B). This resulted in 1.0 distinct radiolabeled RP- HPLC fractions that were subsequently subjected to electrospray ionization mass spectrometry (ESI-MS). The results obtained by MS analysis are summarized in Table 1. Eight peptides could be identified, covering 37% of the rlRS-1449"664 sequence. Two phosphoserines were found, serine 358 (serine 570 in full length IRS-1 ) (LPGYRHpSAFVPTHSYPEEGLEMHHLER (SEQ ID NO:8)) in peak 4 of anion exchange HPLC, and serine 286 (serine 498)
(YIPGATMGTpSPALTGDEAAGAADLDNR (SEQ ID NO:9)) in peak 5 and 6. The phosphopeptide with serine 358/570 corresponded to about 19% of the incorporated radioactivity. The peptide with phosphoserine 286/498 accounted for 11 % of the overall measured radioactivity.
Phosphoserine 358 was identified by ESI-MS/MS. The fragment ion with a mass difference of 97.9 Da to the parent ion indicates a phosphopeptide (Fig. 8 A). A mass difference 97.9 Da correlates to the loss of phosphoric acid. The site of phosphorylation was identified by the loss of the phosphate group (HPO3) and phosphoric acid (H3P0 ) from the fragment ions bg and b-io. This dephosphorylation of the fragment ions indicates that the phosphorylation could only take place by the Y355 or S358. S358 is the phosphoaminoacid, because there was no dephosphorylation detected from the b4 ion, indicating a phosphorylation at Y355 (data not shown).
Phosphoserine 612 could not be detected by mass spectrometry despite being detected by a phosphosite specific antibody (Fig. 6 A), but a peptide including this site was found in peak 2 together with three additional peptides. Peak 1 and peak 3 contained only one peptide covering 13% and 21% of the radioactivity, respectively (THSAGTSPTISHQK and TPSQSSVVSIEEY-TEMMPAAYPPGGGSGGR). (SEQ ID NO:10 and 11 ) To further confirm that the phosphorylation sites found were serine 570 and 612, two additional GST fusion proteins with mutation of serine to alanine were generated. These GST fusion proteins were exposed to PKC-ζ and were phosphorylated by the enzyme at a level comparable to the wild type (data not shown). On the other hand, converting serine 358/570 to alanine largely reduced peak 4 in anion exchange HPLC (Fig. 9 B) demonstrating that serine 570 of IRS-1 is a novel phosphorylation site targeted by PKC-ζ. The serine 400/612 to alanine mutation leads to a decrease of peak 2 (Fig. 9 C), confirming the data obtained with the phosphospecific antiserum.
Example 6
Functional relevance of serine residues 570 and 612 in rlRS-1449"664 To determine the functional relevance of the identified phosphosites the rlRS-1449"664 serine 358/570 to alanine and serine 400/612 mutants were tested in the in vitro phosphorylation and p85α interaction assay (Fig. 10 A). Comparing the results of tyrosine phosphorylation by IR after PKC-ζ pretreatment showed a comparable reduction (30-40%) for wild type rlRS-1449-664 and the two mutants (Fig. 10 B, left panel). However, a significant difference became apparent when comparing the interaction of the two mutants with p85α. Thus, p85α binding to S570A was reduced to 43 ± 4% (n = 3) of control by PKC-ζ treatment, with a reduction to 28 ± 3% for the S612A mutant of rlRS-1449"664 (Fig. 10 B, right panel).
The abbreviations used are: GST, glutathione S-transferase; HPLC, high performance liquid chromatography; IR, insulin receptor; IRS, insulin receptor substrate; ESI-MS, electrospray ionization mass spectrometry; p85, regulatory subunit of phosphatidylinositol (PI)-3 kinase; PAGE, polyacrylamide gel electrophoresis; PI 3- kinase, phosphatidylinositol-3-kinase; RP, reversed phase; PKC, protein kinase C; PKB, protein kinase B; RTKs, receptor tyrosine kinases; SH2, src-homology domain 2; WGA, wheat germ agglutinine; SDS, sodium dodecyl sulphate; ECL, enhanced chemiluminescence.
REFERENCES
I . White, M. F. (1998) Mol. Cell. Biochem. 182, 3-11
5 2. Thirone AC, Carvalho CR, Saad MJ. (1999) Endocrinology 140, 55-62
3. Cheatham, B., and Kahn, C. R. (1995) Endocr. Rev. 16, 117-142
4. Backer, J. M., Myers, M. G. Jr., Shoelson, S. E., Chin, D. J., Sun, X. J., Miralpeix,
10 M., Hu, P., Margolis, B., Skolnik, E. Y., and Schlessinger, J. (1992) EMBO J. 11 , 3469- 3479
5. Skolnik, E. Y., Lee, C. H., Batzer, A., Vicentini, L M., Zhou, M., Daly, R., Myers, M. J. Jr., Backer, J. M., Ullrich, A., and White, M. F. (1993) EMBO J. 12, 1929-1936
15 6. Sun, X. J., Crimmins, D. L., Myers, M. G. Jr., Miralpeix, M., and White, M.F. (1993) Mol. Cell. Biol. 13, 7418-7428
7. Shepherd, P. R., Withers, D. J., and Siddle, K. (1998) Biochem. J. 333, 471-490 20. 8. Alessi, D. R., and Cohen, P. (1998) Curr. Opin. Genet. Dev. 8, 55-62
9. Lawlor, M. A., and Alessi, D. R. (2001) J. Cell. Sci. 114, 2903-2910
25 10. Bandyopadhyay, G., Sajan, M. P., Kanoh, Y., Standaert, M. L, Quon, M. J., Reed, B. C, Dikic, I., and Farese, R. V. (2001 ) J. Biol. Chem. 276, 35537-35545
I I . Bandyopadhyay, G., Sajan, M. P., Kanoh, Y., Standaert, M. L., Quon. M. J., Lea- Currie, R., Sen, A., and Farese, R. V. (2002) J. Clin. Endocrinol. Metab. 87, 716-723
30 12. Summers, S. A., Kao, A. W., Kohn, A. D., Backus, G. S., Roth, R. A., Pessin, J. E., and Bimbaum, M. J. (1999) J. Biol. Chem. 274, 17934-17940 13. Kitamura, T., Kitamura, Y., Kuroda, S., Hino, Y., Ando, M., Kotani, K., Konishi, H., Matsuzaki, H., Kikkawa, U., Ogawa, W., and Kasuga, M. (1999) Mol. Cell. Biol. 19, 6286-6296. 14. Eriksson, H., Ridderstrale, M., Degerman, E., Ekholm, D., Smith, C. J., 5 Manganiello, V. C, Belfrage, P., and Tomqvist, H. (1995) Biochim. Biophys. Acta. 1266, 101-107
15. Nave, B. T., Ouwens, M., Withers, D. J., Alessi, D. R., and Shepherd, P. R. (1999) Biochem. J. 344, 427-431
10 16. Scott, P. H., Brunn, G. J., Kohn, A. D., Roth, R. A., and Lawrence, J. C. Jr. (1998) Proc. Natl. Acad. Sci. 95, 7772-7777
17. White, M. F. (2002) Am. J. Physiol. Endocrinol. Metab. 283, E413-422 15 18. Birnbaum, M. J. (2001 ) J. Clin. invest. 108, 655-659
19. Zick, Y. (2001 ) Trends Cell. Biol. 11 , 437-441
20 20. Tanti, J. F., Gremeaux, T., van Obberghen, E., and Le Marchand-Brustel, Y. (1994) J. Biol. Chem. 269, 6051-6057
21. Sun, X. J., Rothenberg, P., Kahn, C. R., Backer, J. M., Araki, E., Wilden, P. A., Cahill, D. A., Goldstein, B. J., and White, M.F. (1991 ) Nature 352, 73-77
25 22. Hotamisligil, G. S., Peraldi, P., Budavarϊ, A., Ellis, R., White, M. F., and Spiegelman, B. M. (1996) Science 271 , 665-668
23. Shulman, G. I. (2000) J. Clin. Invest. 106, 171-176 30 24. Virkamaki, A., Ueki, K„ and Kahn, C. R. (1999) J. Clin. Invest. 103, 931-943 25. Aguirre, V., Werner, E. D., Giraud, J., Lee, Y. H., Shoelson, S. E., and White, M. F. (2002) J. Biol. Chem. 277, 1531 -1537
26. Gao, Z., Hwang, D., Bataille, F., Lefevre, M., York, D., Quon, M. J., and Ye, J. 5 (2002) J. Biol. Chem. 277, 48115-48121
27. De Fea, K., and Roth, R. A. (1997) J. Biol. Chem. 272, 31400-31406
28. Tanasijevic MJ, Myers MG Jr, Thoma RS, Crimmins DL, White. MF, Sacks DB. 10 (1993) J. Biol. Chem. 268, 18157-18166
29. Eldar-Finkelman H, Krebs EG. (1997) Proc. Natl. Acad. Sci. U S A 94, 9660-9664
30. Freund GG, Wittig JG, Mooney RA. (1995) Biochem Biophys Res Commun 206, 15 272-278
31. Sun XJ, Rothenberg P, Kahn CR, Backer JM, Araki E, Wilden PA, Cahill DA, Goldstein BJ, White MF. (1991 ) Nature 352, 73-77
20 32. Schmitz-Peiffer C, Craig DL, Biden TJ. (2002) Ann. N. Y. Acad. Sci. 967, 146-157
33. Paz, K., Liu, Y. F., Shorer, H., Hemi, R., LeRoith, D., Quan, M., Kanety, H., Seger, R., and Zick, Y. (1999) J. Biol. Chem. 274, 28816-28822
25 34. Jakobsen, S. N., Hardie, D. G., Morrice, N., and Tomqvist, H. E. (2001 ) J. Biol. Chem. 276, 46912-46916
35. Greene, M. W., and Garofalo, R. S. (2002) Biochemistry 41 , 7082-7091
30 36. Lee, Y. H., Giraud, J., Davis, R. J., and White, M. F. (2003) J. Biol. Chem. 278, 2896-2902 37. Qiao, L. Y., Zhande, R., Jetton, T. L, Zhou, G., and Sun, X. J. (2002) J. Biol. Chem. 277, 26530-26539
38. Mothe, I., and Van Obberghen, E. (1996) J. Biol. Chem. 271 , 11222-11227 5 39. DeFea, K., and Roth, R. A. (1997) Biochemistry 36, 12939-12947 .
40. Li, J., DeFea, K., and Roth, R. A. (1999) J. Biol. Chem. 274, 9351-9356
10 41. Braiman, L., Alt, A., Kuroki, T., Ohba, M., Bak, A., Tennenbaum, T., and Sampson, S. R. (2001) Mol. Cell. Biol. 21 , 7852-7861
42. Standaert, M. L., Ortmeyer, H. K., Sajan, M. P., Kanoh, Y., Bandyopadhyay, G., Hansen, B. C, and Farese, R. V. (2002) Diabetes 51 , 2936-2943
15 43. Ravichandran, L. V., Esposito, D. L., Chen, J., and Quon, M. J. (2001 ) J. Biol. Chem. 276, 3543-3549
44. Liu, Y. F., Paz, K., Herschkovitz, A., Alt, A., Tennenbaum, T., Sampson, S. R.,
20 Ohba, M., Kuroki, T., LeRoith, D., and Zick, Y. (2001 ) J. Biol. Chem. 276, 14459-14465
39. Esposito, D. L., Li, Y., Cama, A., and Quon, M. J. (2001 ) Endocrinology 142, 2833- 2840
25 40. Smith, D. B., and Johnson, K. S. (1988) Gene 67, 31-40
41. Burant, C. F., Treutelaar, M. K., Landreth, G. E., and Buse, M. G. (1984) Diabetes 33, 704-708
30 42. Malmqvist, M., and Karlsson, R. (1997) Curr. Opin. Chem. Biol. 1 , 378-383
43. Vely, F., Trautmann, A., and Vivier, E. (2000) Methods Mol. Biol. 121 , 313-21 44. Ladbury, J. E., Lemmon, M. A., Zhou, M., Green, J., Botfield, M. C, and Schlessinger, J. (1995) Proc. Natl. Acad. Sci. U.S.A. 92, 3199-203
45. Felder, S., Zhou, M., Hu, P., Urena, J., Ullrich, A., Chaudhuri, M., White, M., Shoelson, S. E., and Schlessinger, J. (1993) Mol. Cell. Biol. 13, 1449-55
BRIEF DESCRIPTION OF THE FIGURES
Figure 1 : Schematic overview of IRS-1 with known interaction partners and known serine/threonine phosphorylation sites. Upper panel: The relative positions of the pleckstrin homology (PH) and phosphotyrosine-binding (PTB) domain are indicated followed by a C-terminal tail that contains numerous tyrosine phosphorylation sites. Potential binding partners including PI 3-kinase, Grb2 and SHP-2 are also shown. Middle panel: Known (S307, 612, 632, 789) and potential serine phosphorylation sites are highlighted. Bottom panel: Construction of a GST-fusion protein containing aa 449-664 of rat IRS-1 including the major binding site of the PI 3-kinase.
Figure 2: Tyrosine phosphorylation of rlRS-1449"664 and interaction with p85α subunit of . PI 3-kinase. (A) Schematic diagram of the experimental procedure. 5 μg IR was autophosphorylated for 10 min at 30°C in phosphorylation buffer after a 30 min preincubation with 100 nM insulin. Substrate phosphorylation was subsequently initiated by addition of autophosphorylated IR to aliquots of 1 μg rlRS-1449"664. The reaction proceeded for 10 min and then glutathione sepharose beads were added and samples were incubated at 4 °C on a rotator for 1 h. Pellets were washed three times with binding buffer, 0.5 μg recombinant p85α was added and incubation was continued for 2 h. After washing, bound proteins were eluted by addition of 2x sample buffer followed by boiling for 5 min. (B) Eluted proteins were resolved by SDS-PAGE and were analyzed by immunoblotting using antibodies against phosphotyrosine, p85 and IRS-1 , as detailed in the Methods section. Representative blots out of six separate - experiments are shown. (C) Quantification of rlRS-1449"664 tyrosine phosphorylation was obtained using Lumi Imager software. Data are mean values ± SEM (n = 10).
- Figure 3: Effect of PKC from rat brain on tyrosine phosphorylation of rlRS-1449"664 and interaction with p85 . (A) 1 μg of rlRS-1449-664 was incubated with 0.5 μg PKC from rat brain (PKC-rb) or 0.5 μg PKC-ζ in the presence of 2 μCi (32P)-ATP (final cone. 50 μM), as detailed in Methods. The reaction was inhibited by bisindolylmaleimide I (BIM) or pseudosubstrate peptide for PKC-rb or PKC-ζ, respectively. Proteins were resolved by SDS-PAGE and subjected to autoradiography. (B) Tyrosine phosphorylation of rlRS-1449"664 by IR and interaction with p85α was determined as described in Fig. 2. rlRS-1449"664 was preincubated with 0.5 μg PKC-rb for 30 min. Representative blots are shown. (C) Quantification of the inhibitory effect of PKC-rb on insulin stimulated tyrosine phosphorylation and p85 interaction with the insulin-stimulated value set as 100%. When present, BIM was added for 10 min before starting substrate phosphorylation by IR (see Fig. 2). Data are mean values ± SEM (n = 6-9).
Figure 4: Effect of PKC isoforms on IR autophosphorylation. (A) Autophosphorylation of IR was conducted as outlined in Fig. 2. Either PKC-rb or PKC-ζ was added after 10 min of autophosphorylation and incubation was continued for another 10 min. Tyrosine phosphorylation of IR β-subunit was then analyzed by immunoblotting. (B) Quantification of blots was obtained using Lumi I mager software. Data are mean values ± SEM (n = 4-6).
Figure 5: Effect of PKC-ζ on tyrosine phosphorylation of rlRS-1449"664 and interaction with p85α. (A) rlRS-1449"664 was preincubated with PKC-ζ (0.5 μg) for 30 min. Tyrosine phosphorylation by IR and interaction with p85α was determined by immunoblotting, as detailed in Fig. 2.(B) Quantification of the inhibitory effect of PKC-ζ was performed as described in Fig. 3. Data are mean values ± SEM (n = 3).
Figure 6: Identification of IRS-1 serine 612 as a target of PKC and interaction analysis with p85α using surface plasmon resonance.
(A) 0.5 μg of rlRS-144W364 was incubated with 0.5 μg of the different PKCs for 30 min at 30°C and immunoblotted with an antibody against phosphoserine 612. A representative experiment is shown. (B) Binding of p85 to immobilized peptides corresponding to the IRS-1 amino acids 605 to 615 with phosphotyrosine 608 or (C) without phosphotyrosine using surface plasmon resonance (pY608 - DDGpYMPMSPGV and Y608 - DDGYMPMSPGV). Protein concentrations of p85α used were (from bottom to top): 1 , 5, 10, 25, 50, 100, 250, 500 nM. (D) Inhibition of p85 binding by competition with soluble peptides pY608 - DDGpYMPMSPGV or (E) pY608-pS612 - DDGpYMPMpSPGV. The soluble peptides were also immobilized on the chip. (F) Half-maximum inhibitory concentrations (IC50) were obtained by plotting the SPR response at equilibrium (440 s after injection) versus the log peptide concentration. IC50 for pY608: 0.26 μmol/l, 16.56 μmol/l and for pY608-pS612: 0.15 μmol/l, 2.88 μmol/l.
Figure 7: HPLC analysis of tryptic phosphopeptides derived from rlRS-1449"664 phosphorylated by PKC-ζ.
Five nanomoles of rlRS-1449"664 were phosphorylated for 60 min using 0.5 nmol of
PKC-ζ. Proteins were separated by SDS-PAGE and the excised rlRS-1449"664 was digested with trypsin. The recovered 32P-radiolabeled peptide mixture was separated by ion exchange (A) and C18 reversed phase HPLC (B). The radioactivity of the collected fractions was determined by Cerenkov counting. After reversed phase HPLC radioactive fractions were analyzed by mass spectrometry.
Fig. 8: ESI-MS/MS spectra from the phosphopeptid 352-378.
(A) Loss of phosphoric acid from the parent ion [M+4H] + = 818.11 , indicating the phosphorylation. (B) Dephosphorylation of the fragment ion b9 and b-ι0, indicating the phosphorylation site.
Fig. 9: HPLC analysis of tryptic phosphopeptides of rlRS-1449"664 and mutants S570A and S612A.
HPLC analysis of tryptic peptides generated from wildtype rlRS-1449"664 (A,) rlRS-1449"
664 S570A (B), and rlRS-1449'664 S612A (C) phosphorylated with recombinant PKC-ζ is shown. Representative HPLC profiles are presented.
Figure 10: Functional analysis of serine 570 and serine 612. (A) riRS-1449"664 and the indicated mutants were preincubated with PKC-ζ and subjected to tyrosine phosphorylation by IR and interaction with p85α, as outlined in Fig. 5. Representative Western, blots are shown. (B) Blots were quantified using Lumi Imager software and data are expressed relative to the insulin-stimulated control value set as 100%. Results are mean values ± SEM (n = 3).
SEQUENCE LISTING
Table 1 : Sequence Analysis Results of rlRS1 49~5b'4 Phosphopeptides Amino acid sequence of the aa in Phosphorylated Part identified phosphopeptide rlRS1449- residue peak0 of 664 b 32p
(%) d
NAHTPPARGEEELSNYICMGGK (SEQ TD 233-254 4 & 2 NOJ2) GASTLTAPNGHYILSR (SEQ LO NOJ3) 225555--227700 2 20.7 YTPGATMGTSPALTGDEAAGAADLDNR 277-303 S286 5 & 6 10.6 (SEQ ID NO:9)
THSAGTSPTISHQK (SEQ ID NO: 10) 308-321 1 12.9 TPSQSSVNSffiEYTEMMPAAYPPGGGSGGR 322-351 3 21.2 (SEQ LD ΝOJ1)
LPGYRHSAFVPTHSYPEEGLEMHHLER 352-378 S358 4 18.8 (SEQ LO NO: 8)
GGHHRPDSSNLHTDDGYMPMSPGNAPVPSNR 380-410 2 20.7
(SEQ ID NO: 14)
NDPNGYMMMSPSAAAS (SEQ LD NO:15) 441-456 2 20.7 a Tryptic peptides of rIRS-1 " were analyzed after anion exchange HPLC and reversed phase _-_ _ H
HPLC by mass spectrometry. Phosphorylated serine residues are marked in bold letters. Numbering according to a composed sequence of glutathione S-transferase plus IRS-1 amino acids 449-664. c Peaks from anion exchange chromatography HPLC (numbers) (see figure 7 A). d Total amount of radioactivity incorporated into the identified phosphopeptides was set as 100% and the percentage given represents the integrated peak area.

Claims

Claims
1. A method for the identification of an IRS protein kinase inhibitor, comprising the steps of a) bringing into contact PKC-ζ with at least one IRS peptide comprising at least one PKC-ζ-Ser-phosphorylation site in the presence of at least one putative inhibitor, and b) measuring the phosphorylation of the PKC-ζ-Ser-phosphorylation site.
2. The method of claim 1 , wherein a reduced phosphorylation of the PKC-ζ-Ser- phosphorylation site in comparison to the phosphorylation in the absence of the at least one putative inhibitor is indicative for the inhibitory properties of the putative inhibitor.
3. The method of any of claims 1 or 2, wherein PKC-ζ is of mammalian, preferably of human or rodent, more preferably of rat or human origin.
4. The method of any of claims 1 to 3, wherein the IRS peptide is derived from an IRS, preferably IRS-1 , of mammalian, preferably of human or rodent, more preferably of rat origin.
5. The method of claim 4, wherein the IRS-1 is of rat origin and wherein the at least one PKC-ζ-Ser-phosphorylation site is selected from the group consisting of Ser 458, 469, 481 , 498, 522, 526, 530, 536, 538, 539, 542, 560, 570, 577, 599, 600, 612, 620, 632, 635, 662, and 664, wherein the sequence numbers correspond to rat IRS-1 as depicted in SEQ ID NOJ 6.
6. The method of claim 5, wherein the PKC-ζ-Ser-phosphorylation site is selected from the group consisting of Ser498, Ser570 and Ser612, preferably Ser570.
7. The method of claim 6, wherein the peptide is rlRS-1449:664 (SEQ ID NO: 17).
8. The method of any of claims 1 to 7, wherein the inhibitor is selected from the group consisting of antibodies, binding peptides, Low molecular weight compounds (LMWs).
9. A method for the identification of an IRS agonist, comprising the steps of a) bringing into contact PKC-ζ with at least one IRS peptide comprising at least one PKC-ζ-Ser-phosphorylation site in the presence of at least one putative agonist comprising at least one PKC-ζ-Ser-phosphorylation site, and b) measuring the phosphorylation of the PKC-ζ-Ser-phosphorylation site of the putative agonist.
10. The method of claim 9, wherein an increased phosphorylation of the PKC-ζ-Ser- phosphorylation site of the agonist in comparison to the phosphorylation of the PKC-ζ-Ser-phosphorylation site of the IRS peptide is indicative for the agonistic properties of the putative agonist.
11. The method of any of claims 9 or 10, whereinPKC-ζ is of mammalian, preferably of human or rodent, more preferably of rat origin.
12. The method of any of claims 9 to 11 , wherein the IRS peptide is derived from an IRS, preferably IRS-1 , of mammalian, preferably of human or rodent, more preferably of rat origin.
13. The method of claim 12, wherein the IRS is of rat origin and wherein the at least one PKC-ζ-Ser-phosphorylation site is selected from the group consisting of Ser 458, 469, 481 , 498, 522, 526, 530, 536, 538, 539, 542, 560, 570, 577, 599, 600, 612, 620, 632, 635, 662, and 664, wherein the sequence numbers correspond to rat IRS as depicted in SEQ ID NO:16.
14. The method of claim 13, wherein the PKC-ζ-Ser-phosphorylation site is selected from the group consisting of Ser498, Ser570 and Ser612, preferably Ser570.
15. The method of claim 14, wherein the peptide is rlRS-1449"664 (SEQ ID NO: 17). 5 "
16. A method for the determination of PKC-ζ activity, comprising the steps of a) bringing into contact PKC-ζ with at least one IRS peptide comprising at least one PKC-ζ-Ser-phosphorylation site in the presence of at least one putative inhibitor, and 10 b) measuring the phosphorylation of the PKC-ζ-Ser-phosphorylation site.
17. The method of claim 16, whereinPKC-ζ is of mammalian, preferably of human or rodent, more preferably of rat origin.
15 18. The method of any of claims 16 or 17, wherein the IRS peptide is derived from an IRS, preferably IRS-1 , of mammalian, preferably of human or rodent, more preferably of rat origin.
19. The method of claim.18, wherein the IRS is of rat origin and wherein the at least 20 one PKC-ζ-Ser-phosphorylation site is selected from the group consisting of Ser 458, 469, 481 , 498, 522, 526, 530, 536, 538, 539, 542, 560, 570, 577, 599, 600, 612, 620, 632, 635, 662, and 664, wherein the sequence numbers correspond to rat IRS as depicted in SEQ ID NO: 16.
25 20. The method of claim 19, wherein the PKC-ζ-Ser-phosphorylation site is selected from the group consisting of Ser498, Ser570 and Ser612, preferably Ser570.
21. The method of claim 20, wherein the peptide is rlRS-1449'664 (SEQ ID NO: 17).
30 22. An IRS-1 peptide comprising Ser570, preferably IRS-1449-664.
23. A kit comprising a) at least one IRS peptide, 5 b) a PKC-ζ preparation, and c) optionally at least one putative IRS protein kinase inhibitor or agonist.
24. The kit of claim 23, whereinPKC-ζ is of mammalian, preferably of human or 10 rodent, more preferably of rat origin.
25. The kit of any of claims 23 to 24, wherein the IRS peptide is derived from an IRS, preferably IRS-1 , of mammalian, preferably of human or rodent, more preferably of rat origin.
15 26. The kit of claim 25, wherein the IRS is of rat origin and wherein the at least one PKC-ζ-Ser-phosphorylation site is selected from the group consisting of Ser 458, 469, 481 , 498, 522, 526, 530, 536, 538, 539, 542, 560, 570, 577, 599, 600, 612, 620, 632, 635, 662, and 664, wherein the sequence numbers correspond
20 to rat IRS as depicted in SEQ ID NOJ 6.
27. The kit of claim 26, wherein the PKC-ζ-Ser-phosphorylation site is selected from the group consisting of Ser498, Ser570 and Ser612, preferably Ser570.
25 28. The kit of claim 27, wherein the peptide is rlRS-1449"664 (SEQ ID NO: 17).
29. An IRS-1 peptide, wherein Ser570 and/or Ser612 are mutated, preferably to alanine.
30 30. Use of an IRS peptide as defined in claims 3 to 7 for the production of antibodies, prferably against a PKC-ζ-Ser-phosphorylation site, preferabyl against Ser498, Ser570 and Ser612, more preferably against Ser570.
31. Use of an IRS peptide as defined in claims 3 to 7 or of an IRS-1 peptide of claim 29 for the preparation of a pharmaceutical composition for the treatment of diabetis type II.
32. A method for the preparation of a pharmaceutical composition, comprising the steps of: d) identifying an IRS protein kinase inhibitor or agonist according to claims 1 to 15, e) providing adequate amounts of the IRS protein kinase inhibitor, and
f) fomulating the IRS protein kinase inhibitor into a pharmaceutical composition, optionally in combination with a pharmaceutical acceptable carrier.
EP04763258A 2003-08-16 2004-07-16 A method for the identification of irs protein kinase inhibitors or agonists Withdrawn EP1658501A2 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
EP04763258A EP1658501A2 (en) 2003-08-16 2004-07-16 A method for the identification of irs protein kinase inhibitors or agonists

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
EP03018517A EP1508806A1 (en) 2003-08-16 2003-08-16 A method for the identification of IRS protein kinase inhibitors or agonists
PCT/EP2004/007900 WO2005017196A2 (en) 2003-08-16 2004-07-16 A method for the identification of irs protein kinase inhibitors or agonists
EP04763258A EP1658501A2 (en) 2003-08-16 2004-07-16 A method for the identification of irs protein kinase inhibitors or agonists

Publications (1)

Publication Number Publication Date
EP1658501A2 true EP1658501A2 (en) 2006-05-24

Family

ID=34042847

Family Applications (2)

Application Number Title Priority Date Filing Date
EP03018517A Withdrawn EP1508806A1 (en) 2003-08-16 2003-08-16 A method for the identification of IRS protein kinase inhibitors or agonists
EP04763258A Withdrawn EP1658501A2 (en) 2003-08-16 2004-07-16 A method for the identification of irs protein kinase inhibitors or agonists

Family Applications Before (1)

Application Number Title Priority Date Filing Date
EP03018517A Withdrawn EP1508806A1 (en) 2003-08-16 2003-08-16 A method for the identification of IRS protein kinase inhibitors or agonists

Country Status (13)

Country Link
EP (2) EP1508806A1 (en)
JP (1) JP4796490B2 (en)
KR (1) KR20060065695A (en)
CN (1) CN1836164A (en)
AU (1) AU2004265390B2 (en)
BR (1) BRPI0413610A (en)
CA (1) CA2535649A1 (en)
IL (1) IL173545A (en)
MX (1) MXPA06001618A (en)
NO (1) NO20061215L (en)
RU (1) RU2340898C2 (en)
WO (1) WO2005017196A2 (en)
ZA (1) ZA200600587B (en)

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100239586A1 (en) * 2009-03-21 2010-09-23 The Regents Of The University Of California Procalin polypeptides, antigens, and methods of use
RU2694964C2 (en) * 2017-12-19 2019-07-19 ФЕДЕРАЛЬНОЕ АГЕНТСТВО ПО ТЕХНИЧЕСКОМУ РЕГУЛИРОВАНИЮ И МЕТРОЛОГИИ (Росстандарт) Method of measuring catalytic activity (catalytic concentration) of enzymes using methods of mass spectrometry and spectrophotometry with preliminary identification of target analyte and determination of purity of substances

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5260200A (en) * 1991-01-18 1993-11-09 Joslin Diabetes Center, Inc. Isolated DNA encoding an insulin receptor substrate
US6511811B1 (en) * 1995-06-07 2003-01-28 The Regents Of The University Of California Protein kinase C antagonist related to insulin receptor
JPWO2002083730A1 (en) * 2001-04-10 2004-08-05 大正製薬株式会社 Novel protein IRSAL and gene irsal encoding the protein

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO2005017196A2 *

Also Published As

Publication number Publication date
CA2535649A1 (en) 2005-02-24
KR20060065695A (en) 2006-06-14
WO2005017196A2 (en) 2005-02-24
IL173545A (en) 2011-10-31
ZA200600587B (en) 2009-06-24
JP4796490B2 (en) 2011-10-19
MXPA06001618A (en) 2006-05-12
AU2004265390A1 (en) 2005-02-24
EP1508806A1 (en) 2005-02-23
BRPI0413610A (en) 2006-10-17
WO2005017196A3 (en) 2005-09-01
CN1836164A (en) 2006-09-20
RU2340898C2 (en) 2008-12-10
IL173545A0 (en) 2006-07-05
AU2004265390B2 (en) 2010-07-08
JP2007502604A (en) 2007-02-15
NO20061215L (en) 2006-05-15
RU2006108110A (en) 2006-07-27

Similar Documents

Publication Publication Date Title
Fonseca et al. PRAS40 is a target for mammalian target of rapamycin complex 1 and is required for signaling downstream of this complex
Browne et al. Stimulation of the AMP-activated protein kinase leads to activation of eukaryotic elongation factor 2 kinase and to its phosphorylation at a novel site, serine 398
Sun et al. MKP-1 (3CH134), an immediate early gene product, is a dual specificity phosphatase that dephosphorylates MAP kinase in vivo
Osherov et al. Epidermal‐growth‐factor‐dependent activation of the src‐family kinases
Deng et al. Phosphorylation of the myosin phosphatase inhibitors, CPI-17 and PHI-1, by integrin-linked kinase
Tao et al. Protein kinase A regulates AKAP250 (gravin) scaffold binding to the β2‐adrenergic receptor
Sumandea et al. Tyrosine phosphorylation modifies protein kinase C δ-dependent phosphorylation of cardiac troponin I
Sommerfeld et al. In vitro phosphorylation of insulin receptor substrate 1 by protein kinase C-ζ: functional analysis and identification of novel phosphorylation sites
Shen et al. The fall in creatine levels and creatine kinase isozyme changes in the failing heart are reversible: complex post-transcriptional regulation of the components of the CK system
BROWNE et al. The level of the glycogen targetting regulatory subunit R5 of protein phosphatase 1 is decreased in the livers of insulin-dependent diabetic rats and starved rats
US7803571B2 (en) Method for identifying IRS inhibitors or agonists
AU2004265390B2 (en) A method for the identification of IRS protein kinase inhibitors or agonists
Bridges et al. Identification and characterization of D-AKAP1 as a major adipocyte PKA and PP1 binding protein
Yang et al. Increased expression of Gαq protein in the heart of streptozotocin-induced diabetic rats
Hinchliffe et al. Regulation of type II PIP kinase by PKD phosphorylation
WEN et al. Evidence that 12-lipoxygenase product 12-hydroxyeicosatetraenoic acid activates p21-activated kinase
Yanagihori et al. Protein phosphatase regulation by PRIP, a PLC-related catalytically inactive protein—implications in the phospho-modulation of the GABAA receptor
Surdo et al. Structural and biochemical evaluation of the interaction of the phosphatidylinositol 3-kinase p85α Src homology 2 domains with phosphoinositides and inositol polyphosphates
Cohen et al. The molecular mechanism by which insulin activates glycogen synthase in mammalian skeletal muscle
Galán-Caridad et al. Identification of casein kinase 1, casein kinase 2, and cAMP-dependent protein kinase-like activities in Trypanosoma evansi
KR20200144786A (en) Method of screening a material regulating autophagy targeting O-GlcNACylation of ULK1 protein
Klein et al. O-GlcNAc modification of insulin receptor substrate-1 (IRS-1) occurs in close proximity to multiple SH2 domain binding motifs
WO2005095976A1 (en) Diagnostics and therapeutics for diseases associated with p21 (cdkn1a)-activated kinase 3 (pak3)
US20070134752A1 (en) Smooth muscle myosin phosphatase associated kinase
Giles Molecular signal processing by eukaryotic elongation factor 2 kinase (eEF-2K)

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20060316

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LI LU MC NL PL PT RO SE SI SK TR

DAX Request for extension of the european patent (deleted)
17Q First examination report despatched

Effective date: 20080822

RTI1 Title (correction)

Free format text: A METHOD FOR THE IDENTIFICATION OF IRS PROTEIN KINASE INHIBITORS AND IRS-1 AGONISTS

GRAP Despatch of communication of intention to grant a patent

Free format text: ORIGINAL CODE: EPIDOSNIGR1

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION HAS BEEN WITHDRAWN

18W Application withdrawn

Effective date: 20111220