EP1626696A2 - Novel fibroblast growth factors and methods of use thereof - Google Patents

Novel fibroblast growth factors and methods of use thereof

Info

Publication number
EP1626696A2
EP1626696A2 EP04751821A EP04751821A EP1626696A2 EP 1626696 A2 EP1626696 A2 EP 1626696A2 EP 04751821 A EP04751821 A EP 04751821A EP 04751821 A EP04751821 A EP 04751821A EP 1626696 A2 EP1626696 A2 EP 1626696A2
Authority
EP
European Patent Office
Prior art keywords
fgf
polypeptide
cartilage
seq
protein
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP04751821A
Other languages
German (de)
French (fr)
Inventor
Jeffrey Peterson
Paul Sciore
Peter Mezes
Henri Lichtenstein
Michael Jeffers
William Larochelle
Marie Ruiz-Martinez
Galina Chernaya
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
CuraGen Corp
Original Assignee
CuraGen Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by CuraGen Corp filed Critical CuraGen Corp
Publication of EP1626696A2 publication Critical patent/EP1626696A2/en
Withdrawn legal-status Critical Current

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18—Growth factors; Growth regulators
    • A61K38/1825—Fibroblast growth factor [FGF]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00—Drugs for skeletal disorders
    • A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00—Drugs for skeletal disorders
    • A61P19/04—Drugs for skeletal disorders for non-specific disorders of the connective tissue
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00—Drugs for disorders of the muscular or neuromuscular system
    • A61P21/02—Muscle relaxants, e.g. for tetanus or cramps
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16—Anti-Parkinson drugs
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P39/00—General protective or antinoxious agents
    • A61P39/02—Antidotes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00—Drugs for disorders of the cardiovascular system
    • A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis

Definitions

  • the present invention relates to compositions and methods of treatment of various conditions, including but are not limited to, stroke, wound healing, and joint diseases (e.g., osteoarthritis and rheumatoid arthritis). More particularly, the present invention relates to compositions comprising a member of the fibroblast growth factor family, FGF-CX (also known as CG53135-05 or FGF-20), its related polypeptides, nucleic acids encoding such polypeptides, and their uses for treating a condition, such as but is not limited to, stroke, would healing, and joint diseases (e.g., osteoarthritis and rheumatoid arthritis).
  • FGF-CX also known as CG53135-05 or FGF-20
  • FGF-1 basic FGF
  • FGF-2 basic FGF
  • FGFR-1 FGF receptor-1
  • FGFs and their receptors in brains of perinatal and adult mice has been examined. Messenger RNA of all FGF genes, with the exception of FGF-4, is detected in these tissues.
  • FGF-3, FGF-6, FGF-7 and FGF-8 genes demonstrate higher expression in the late embryonic stages than in postnatal stages, suggesting that these members are involved in the late stages of brain development.
  • FGF-1 and FGF-5 increased after birth.
  • FGF-6 expression in perinatal mice has been reported to be restricted to the central nervous system and skeletal muscles, with intense signals in the developing cerebrum in embryos but in cerebellum in 5 -day-old neonates.
  • FGF-receptor (FGFR)-4 a cognate receptor for FGF-6, demonstrates similar spatiotemporal expression, suggesting that FGF-6 and FGFR-4 play significant roles in the maturation of nervous system as a Ugand-receptor system.
  • these results strongly suggest that the various FGFs and their receptors are involved in the regulation of a variety of developmental processes of brain, such as proliferation and migration of neuronal progenitor cells, neuronal and glial differentiation, neurite extensions, and synapse formation. See, e.g., Ozawa et ah, Brain Res. Mol. Brain Res. 199641(l-2):279-88.
  • FGF polypeptide family include the FGF receptor tyrosine kinase (FGFRTK) family and the FGF receptor heparan sulfate proteoglycan (FGFRHS) family. These members interact to regulate active and specific FGFR signal transduction complexes. These regulatory activities are diversified throughout a broad range of organs and tissues, and in both normal and tumor tissues, in mammals. Regulated alternative messenger RNA (mRNA) splicing and combination of variant subdomains give rise to diversity of FGFRTK monomers.
  • mRNA alternative messenger RNA
  • Divalent cations cooperate with the FGFRHS to conformationally restrict FGFRTK trans-phosphorylation, which causes depression of kinase activity and facilitates appropriate activation of the FGFR complex by FGF.
  • FGFRTK trans-phosphorylation
  • different point mutations in the FGFRTK commonly cause craniofacial and skeletal abnormalities of graded severity by graded increases in FGF-independent activity of total FGFR complexes.
  • Other processes in which FGF family exerts important effects are liver growth and function, and prostate tumor progression.
  • GAF Glia-activating factor
  • GAF is a heparin- binding growth factor that was purified from the culture supernatant of a human glioma cell line. See, Miyamoto etah, 1993, Mol. Cell Biol. 13(7): 4251-4259. GAF shows a spectrum of activity slightly different from those of other known growth factors, and is designated as FGF-9.
  • the human FGF-9 cDNA encodes a polypeptide of 208 amino acids. Sequence similarity to other members of the FGF family was estimated to be around 30%. Two cysteine residues and other consensus sequences found in other family members were also well conserved in the FGF-9 sequence.
  • FGF-9 was found to have no typical signal sequence in its N-terminus like those in acidic FGF and basic FGF. Acidic FGF and basic FGF are known not to be secreted from cells in a conventional manner. However, FGF-9 was found to be secreted efficiently from cDNA-transfected COS cells despite its lack of a typical signal sequence. It could be detected exclusively in the culture medium of cells. The secreted protein lacked no amino acid residues at the N-terminus with respect to those predicted by the cDNA sequence, except the initiation methionine. The rat FGF-9 cDNA was also cloned, and the structural analysis indicated that the FGF-9 gene is highly conserved. [007] FGFs have been shown to induce neuronal sprouting. See Proc. Natl. Acad.
  • Osteoarthritis is a degenerative joint disease and a frequent cause of joint pain that affects a large and growing population. OA is estimated to be the most common cause of disability in adults. The disease typically manifests itself in the 2nd to 3rd decades, with most people over forty years exhibiting some pathologic change in weight bearing joints, although the change may be asymptomatic. A systematic review of incidence and prevalence of OA of the knee in people older than 55 years in the United Kingdom reported an incidence of 25 percent per year, a prevalence of disability of 10 percent, and severe disability in about two to three percent.
  • OA results from a complex interplay of multiple factors, including joint integrity, genetics, local inflammation, mechanical forces, and cellular and biochemical processes. Characteristic features of the disease are degradation of articular cartilage, hypertrophy of bone at the margins, and changes in the synovial membrane, typically accompanied by pain and stiffness of the joint. For the majority of patients, OA is linked to one or more factors, such as aging, occupation, trauma, and repetitive and small insults over time. The pathophysiologic process of OA is almost always progressive.
  • CG53135-05 and their variants belong to the FGF family that regulates proliferation (see U.S. Application Serial No. 10/174,394, which is incorporated herein by its entirety).
  • the identification of a polymorphism (CG53135-12) in the gene encoding an FGF20-like protein, CG53135-01, in humans, and a method for identifying individuals who are carriers of the genetic risk-altering factor for OA have been described in U.S. Application Serial No. 10/702,126 (“the '126 application”), which is incorporated herein by its entirety.
  • the '126 application describes a DNA-based diagnostic test for identifying individuals with increased risk for OA and resultant musculoskeletal complications.
  • Non-pharmaceutical interventions include behaviour modification, weight loss, exercise, walking aids, avoidance of aggravating activities, as well as joint irrigation, and arthroscopic and surgical interventions.
  • Current pharmaceutical interventions include nonsteroidal antiinflammatory drugs, intraarticular corticosteroids, and colchicine.
  • FGF- 18 has been shown to repair damaged cartilage in a rat meniscal tear model for OA (See Paper #0199, 50th Annual Meeting of the Orthopaedic Research Society, San Francisco CA, 2004).
  • the present invention provides methods of preventing or treating a disease
  • FGF-CX polypeptide which has homology to Fibroblast Growth Factor (FGF) protein.
  • FGF Fibroblast Growth Factor
  • present invention also encompasses FGF-CX polynucleotide sequences and the FGF-CX polypeptides encoded by these nucleic acid sequences, and fragments, homologs, analogs, and derivatives thereof.
  • the diseases to be prevented or treated include, but are not limited to, joint diseases (non-limiting examples being arthritis, osteoarthritis, joint pathology, ligament and tendon injuries, and meniscal injuries), ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning, and neurodegenerative diseases (non-hmiting examples being Alzheimer's, Parkinson's Disease, Amyotrophic Lateral Sclerosis, Huntington's Disease).
  • the invention encompasses an isolated FGF-CX nucleic acid
  • the nucleic acid can include, but not limited to, nucleic acid sequence encoding a polypeptide at least 85% identical to a polypeptide comprising the amino acid sequence of Table A (SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36).
  • the invention also encompasses the polypeptides resulting from the proteolytic cleavage, of CG53135-05 (SEQ ID NO: 2) that includes SEQ ID Nos: 37, 38, 39, 40.
  • the nucleic acid can be, but is not limited to, a genomic DNA fragment, and a cDNA molecule.
  • the present invention also encompasses a vector containing one or more of the nucleic acids described herein, and a cell containing the vectors or nucleic acids described herein.
  • the present invention further encompasses host cells transformed with a recombinant expression vector comprising any of the nucleic acid molecules described above.
  • the invention provides a pharmaceutical composition that comprises a FGF-CX nucleic acid and a pharmaceutically acceptable carrier.
  • the invention provides a substantially purified FGF-CX polypeptide, e.g., any of the FGF-CX polypeptides encoded by a FGF-CX nucleic acid, and fragments, homologs, analogs, and derivatives thereof.
  • the invention also provides a pharmaceutical composition that comprises a FGF-CX polypeptide and a pharmaceutically acceptable carrier.
  • the invention provides an antibody that binds specifically to a FGF-CX polypeptide.
  • the antibody can be, but is not limited to, a monoclonal or polyclonal antibody, and fragments, homologs, analogs, and derivatives thereof.
  • the invention also provides a pharmaceutical composition including FGF-CX antibody and a pharmaceutically acceptable carrier.
  • the present invention also emcompasses isolated antibodies that bind to an epitope on a polypeptide encoded by any of the nucleic acid molecules described above.
  • kits comprising antibodies that bind to a polypeptide encoded by any of the nucleic acid molecules described above and a negative control antibody.
  • the invention encompasses a method for producing a FGF-CX polypeptide.
  • the method includes providing a cell containing a FGF-CX nucleic acid, e.g., a vector that includes a FGF-CX nucleic acid, and culturing the cell under conditions sufficient to express the FGF-CX polypeptide encoded by the nucleic acid.
  • the expressed FGF-CX polypeptide is then recovered from the cell.
  • the cell produces little or no endogenous FGF-CX polypeptide.
  • the cell can be, e.g., a prokaryotic cell or eukaryotic cell.
  • the present invention provides a method of inducing an immune response in a subject against a polypeptide encoded by any of the nucleic acid molecules disclosed above by administering to the mammal an amount of the polypeptide sufficient to induce the immune response.
  • the present invention also provides methods of identifying a compound that binds to FGF-CX polypeptide by contacting the FGF-CX polypeptide with a compound and determining whether the compound binds to the FGF-CX polypeptide.
  • the invention provides a prophylactic treatment with FGF-CX polypeptide wherein an injury that predisposes the subject to osteoarthritis has occurred but the cartilage is intact.
  • the invention also provides a therapeutic treatment with FGF-CX polypeptide wherein intrinsic or extrinsic factors (e.g. genetic predisposition or meniscal injury, respectively) has led to osteoarthritic changes and cartilage damage.
  • intrinsic or extrinsic factors e.g. genetic predisposition or meniscal injury, respectively
  • Figure 1 shows Liquid Chromatography and Mass Spectrometry analysis of
  • CG53135-05 was injected onto the phenyl-hexyl column in an aqueous mobile phase containing 95% water, 5% acetonitrile, and 0.1% triftuoroacetic acid. The protein was then eluted by using a non-linear gradient with an organic mobile phase containing 95% acetonitrile, 5% water, and 0.085% triftuoroacetic acid. Each of the 4 peaks was characterized using LC/ESI/MS, MALDI-TOF MS, and N-terminal amino acid sequencing.
  • Figure 2A and 2B depict Peptide Map of CG53135-05.
  • the upper tracing in each panel represents that of CG53135-05 and the lower tracing in each panel represents an identical sample treated similarly but without CG53135-05.
  • Figure 2A Detection at 214 nm to monitor CG53135 peptides.
  • Figure 2B Detection at 295 nm to monitor tryptophan- containing peptides.
  • Figure 3 shows Receptor Binding Specificity of CG53135.
  • Figure 4 shows the results of Forelimb Placing Test.
  • the mean and standard error of the score for groups receiving vehicle are represented over time.
  • Asterisks indicate significant difference from vehicle control as assessed by one-way ANOVA.
  • Figure 5 shows the results of Hindlimb Placing Test.
  • the mean and standard error of the score for groups receiving vehicle are represented over time.
  • Asterisks indicate significant difference from vehicle control as assessed by one-way ANOVA.
  • Figure 6 shows the results of Body Swing Test.
  • the mean and standard error of the score for groups receiving vehicle (diamonds), 1.0 ⁇ g/injection CG53135-05 (square), and 2.5 ⁇ g/injection CG53135-05 (triangles) are represented over time.
  • a score range of -50% swings to the right indicates no impairment, whereas 0% swings to the right swing indicates maximal impairment.
  • Asterisks indicate significant difference from vehicle control as assessed by one-way ANOVA.
  • Figure 7 shows the results of Cylinder Test. The mean and standard error of the score for groups receiving vehicle (diamonds), 1.0 ⁇ g injection CG53135-05 (square), and 2.5 ⁇ g/injection CG53135-05 (triangles) are represented over time.
  • Figure 8 shows the results of Body Weight. The mean and standard errors of the weights for groups receiving vehicle (diamonds), 1.0 ⁇ g/injection CG53135-05 (square), and 2.5 ⁇ g/injection CG53135-05 (triangles) is represented over time.
  • Figure 9 shows the effect of CG53135-05 on Pro-MMP production in
  • Figure 10 shows the effect of CG53135-05 on Pro-MMP production in
  • Figure 11 shows the effect of CG53135-05 on T P production in SW1353 cells.
  • Figure 12 shows the effect of intra-articular injection of CG53135-05 in the
  • Figure 13 shows results of intra-articular injection of CG53135-05 in the
  • Figure 15 shows results of intra-articular injection CG53135-05 in the
  • Figure 16 shows results of intra-articular injection of CG53135-05 in the
  • Figure 17 shows results of intra-articular injection of CG53135-05 in
  • the present invention provides methods of preventing or treating a joint disease (e.g., osteoarthritis, other related joint pathologies, such as but are not limited to, ligament and tendon injuries within the ligament and tendon itself, or within their respective insertion sites, meniscal tears, other joint disorders where matrix deposition occurs, joint disorders where remodeling and repair are required, and cartilage and joint pathology occurred as a result of an inflammatory disease (e.g., rheumatoid arthritis)) in a subject comprising administering to the subject a composition comprising an FGF-CX polypeptide.
  • a joint disease e.g., osteoarthritis, other related joint pathologies, such as but are not limited to, ligament and tendon injuries within the ligament and tendon itself, or within their respective insertion sites, meniscal tears, other joint disorders where matrix deposition occurs, joint disorders where remodeling and repair are required, and cartilage and joint pathology occurred as a result of an inflammatory disease (e.g., rheumatoid arthritis))
  • the present invention also encompasses methods of using FGF-CX to improve functional recovery following middle cerebral artery (MCA) occlusion in rats.
  • MCA middle cerebral artery
  • the present invention evaluates the efficacy and safety of FGF-CX in a model that assesses these parameters.
  • administering FGF-CX will be beneficial in the treatment of pathological conditions including, but are not limited to, ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning, and neurodegenerative diseases (such as Alzheimer's, Parkinson's Disease, Amyotrophic Lateral Sclerosis, Huntington's Disease).
  • FGF-CX polypeptides FGF-CX polypeptides, nucleic acids encoding the polypeptides, and methods of making such polypeptides are described in U.S. Application Serial Nos. 09/494,585 and
  • FGF-CX is used interchangeably with the term “CG53135,” “CG53135-05,” and "FGF-20.”
  • FGF-CX nucleic acids include isolated nucleic acids that encode FGF-CX polypeptide or a portion thereof, FGF-CX polypeptides, vectors containing these nucleic acids, host cells transformed with the FGF-CX nucleic acids, anti- FGF-CX antibodies, and pharmaceutical compositions.
  • methods of making FGF-CX polypeptides as well as methods of screening, diagnosing, treating conditions using these compounds, and methods of screening compounds that modulate FGF- CX polypeptide activity.
  • Table A provides a summary of the FGF-CX nucleic acids and their encoded polypeptides.
  • the terms “subject” and “subjects” refer to an animal, preferably a mammal, including a non-primate (e.g., a cow, pig, horse, cat, dog, rat, and mouse) and a primate (e.g., a monkey, such as a cynomolgous monkey, chimpanzee, and a human), and more preferably a human.
  • a non-primate e.g., a cow, pig, horse, cat, dog, rat, and mouse
  • a primate e.g., a monkey, such as a cynomolgous monkey, chimpanzee, and a human
  • the subject is a mammal, preferably a human, who is suffering from a joint disease (e.g., osteoarthritis, other osteoarthritis-related disorders), ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning, or neurodegenerative diseases (non-limiting examples being Alzheimer's, Parkinson's Disease, Amyotrophic Lateral Sclerosis, Huntington's Disease).
  • the subject is a mammal, preferably a human, who are at risk for a joint disease, ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning, or neurodegenerative diseases.
  • the subject is a mammal, preferably a human, who is suffering from a joint disease, but who is not suffering from stroke or a neurodegenerative disease.
  • the term "subject" is used interchangeably with "patient” in the present invention.
  • the term "therapeuticaHy effective amount” refers to the amount of a therapy (e.g., FGF-CX polypeptide), which is sufficient to reduce the severity of a disease (e.g., a joint disease, ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning, or neurodegenerative diseases), reduce the duration of a disease, prevent the advancement of a disease, cause regression of a disease, ameliorate one or more symptoms associated with a disease, or enhance or improve the therapeutic effect(s) of another therapy.
  • a therapy e.g., FGF-CX polypeptide
  • compositions comprising FGF-CX can also be administered in combination with one or more other therapies to prevent, treat, or ameliorate a disease (e.g., a joint disease, ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning, or neurodegenerative diseases) or one or more symptoms thereof.
  • a disease e.g., a joint disease, ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning, or neurodegenerative diseases
  • a disease e.g., a joint disease, ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning, or neurodegenerative diseases
  • a disease e.g., a joint disease, ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning, or neurodegenerative diseases
  • FGF-CX polypeptide and/or another therapy are administered in a sub-optimal amount, e.g., an amount that does not manifest detectable therapeutic benefits when administered alone, as determined by methods known in the art.
  • a sub-optimal amount e.g., an amount that does not manifest detectable therapeutic benefits when administered alone, as determined by methods known in the art.
  • co-administration of FGF-CX polypeptide and another therapy results in an overall improvement in effectiveness of treatment.
  • FGF-CX polypeptide and one or more other therapies are administered within the same patient visit.
  • FGF-CX polypeptide is administered prior to the administration of one or more other therapies.
  • the FGF-CX polypeptide is administered subsequent to the administration of one or more other therapies.
  • FGF-CX polypeptide and one or more other therapies are cyclically administered to a subject. Cycling therapy involves the administration of FGF-CX polypeptide for a period of time, followed by the administration of one or more other therapies for a period of time and repeating this sequential administration. Cycling therapy can reduce the development of resistance to one or more of the therapies, avoid or reduce the side effects of one of the therapies, and/or improve the efficacy of the treatment.
  • Toxicity and therapeutic efficacy of a composition of the invention e.g. , FGF-
  • CX polypeptide can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% of the population) and the ED 50 (the dose therapeutically effective in 50% of the population).
  • the dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio of LD 5 0/ED 50 .
  • Compositions that exhibit large therapeutic indices are preferred. While compositions that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such composition to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects.
  • the data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for use in humans.
  • the dosage of complexes lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity.
  • the dosage may vary within this range depending upon the dosage form employed, the route of administration utilized, the severity of the disease, age and weight of the subject, and other factors normally considered by a medical professional (e.g., a physician).
  • the therapeutically effective dose can be estimated initially from cell culture assays.
  • a dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the test compound that achieves a half-maximal inhibition of symptoms) as determined in cell cultures. Such information can be used to more accurately determine useful doses in humans. Levels in plasma may be measured, for example, by high performance liquid chromatography. [INSERT PRFERRED DOSAGE RANGES HERE]
  • Various delivery systems are known and can be used to administer a composition of the invention.
  • Such delivery systems include, but are not limited to, encapsulation in liposomes, microparticles, microcapsules, expression by recombinant cells, receptor-mediated endocytosis, construction of the nucleic acids of the invention as part of a retroviral or other vectors, etc.
  • Methods of introduction include, but are not limited to, intradermal, intramuscular, intraperitoneal, intrathecal, intracerebroventricular, epidural, intravenous, subcutaneous, intranasal, intratumoral, transdermal, rectal, and oral routes.
  • compositions of the invention may be administered by any convenient route, for example, by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, virginal mucosa, rectal and intestinal mucosa, etc.), and may be administered together with other biologically active agents. Administration can be systemic or local.
  • epithelial or mucocutaneous linings e.g., oral mucosa, virginal mucosa, rectal and intestinal mucosa, etc.
  • Administration can be systemic or local.
  • compositions of the invention may be desirable to administer locally to the area in need of treatment. This may be achieved by, for example, local infusion during surgery, or topical apphcation, e.g., in conjunction with a wound dressing after surgery, by injection, by means of a catheter, by means of a suppository, or by means of an implant (said implant being of a porous, non-porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers).
  • administration can be by direct injection at the site (or former site) of rapidly proliferating tissues which are most sensitive to an insult such radiation, chemotherapy, or chemical warfare agent.
  • the nucleic acid can be administered in vivo to promote expression of their encoded proteins (e.g., FGF-CX polypeptide), by constructing the nucleic acid as part of an appropriate nucleic acid expression vector and administering it so that it becomes intracellular, e.g., by use of a retro viral vector, or by direct injection, or by use of microparticle bombardment (e.g., a gene gun), or coating with lipids or cell-surface receptors or transfecting agents, or by administering it in linkage to a homeobox- like peptide which is known to enter the nucleus, etc.
  • a nucleic acid of the invention can be introduced intracellularly and incorporated within host cell DNA for expression, by homologous recombination.
  • compositions of the invention include bulk drug compositions useful in the manufacture of pharmaceutical compositions that can be used in the preparation of unit dosage forms.
  • a composition of the invention is a pharmaceutical composition.
  • Such compositions comprise a prophylactically or therapeutically effective amount of one or more compositions (e.g., FGF-CX polypeptide) of the invention, and a pharmaceutically acceptable carrier.
  • the pharmaceutical compositions are formulated to be suitable for the route of administration to a subject.
  • the term "pharmaceutically acceptable” means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans.
  • carrier refers to a diluent, adjuvant (e.g., Freund's adjuvant (complete and incomplete)), excipient, or vehicle with which the prophylactic or therapeutic agent is administered.
  • Such pharmaceutical carriers can be sterile liquids, such as water and oils (e.g., oils of petroleum, animal, vegetable or synthetic origins, such as peanut oil, soybean oil, mineral oil, sesame oil and the like), or solid carriers, such as one or more substances which may also act as diluents, flavoring agents, solubilizers, lubricants, suspending agents, binders, tablet disintegrating agents, or encapsulating material.
  • Water is a preferred carrier when the pharmaceutical composition is administered intravenously.
  • Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
  • Suitable pharmaceutical excipients include, but are not limited to, starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol, or a combination thereof.
  • the composition if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
  • compositions of the present invention may be formulated into any of many possible dosage forms such as, but not limited to, liquid syrups, tablets, capsules, gel capsules, soft gels, pills, powders, enemas, sustained-release formulations and the like.
  • the compositions of the present invention may also be formulated as suspensions in aqueous, non-aqueous or mixed media.
  • Aqueous suspensions may further contain substances that increase the viscosity of the suspension including, for example, sodium carboxymethylcellulose, sorbitol and/or dextran.
  • the suspension may also contain stabilizers.
  • the composition can also be formulated as a suppository, with traditional binders and carriers such as triglycerides.
  • Oral formulation can include standard carriers, such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc.
  • compositions of the present invention may be formulated and used as foams.
  • Pharmaceutical foams include formulations such as, but not limited to, emulsions, microemulsions, creams, jellies and liposomes. While basically similar in nature, these formulations vary in the components and the consistency of the final product.
  • the preparation of such compositions and formulations is generally known to those skilled in the pharmaceutical and formulation arts and may be applied to the formulation of the compositions of the present invention.
  • a pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration.
  • the composition is formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous, subcutaneous, intramuscular, oral, intranasal, intratumoral or topical administration to human beings.
  • compositions for intravenous administration are solutions in sterile isotonic aqueous buffer.
  • the composition may also include a solubilizing agent and a local anesthetic such as lidocaine to ease pain at the site of the injection.
  • compositions of the invention are to be administered topically, the compositions can be formulated in the form of transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders.
  • Conventional pharmaceutical carriers, aqueous, powder or oily bases, thickeners and the like may be necessary or desirable.
  • Coated condoms, gloves and the like may also be useful.
  • Preferred topical formulations include those in which the polypeptides of the invention are in admixture with a topical delivery agent, such as but not limited to, lipids, liposomes, fatty acids, fatty acid esters, steroids, chelating agents and surfactants.
  • Preferred lipids and liposomes include, but are not limited to, neutral (e.g. dioleoylphosphatidyl DOPE ethanolamine, dimyristoyiphosphatidyl choline DMPC, distearolyphosphatidyl choline), negative (e.g. dimyristoyiphosphatidyl glycerol DMPG), and cationic (e.g. dioleoyltetramethylaminopropyl DOTAP and dioleoylphosphatidyl ethanolamine DOTMA).
  • the polypeptides of the invention may be encapsulated within liposomes or may form complexes thereto, in particular to cationic liposomes.
  • the polypeptides may be complexed to lipids, in particular to cationic lipids.
  • Preferred fatty acids and esters include, but are not limited to, arachidonic acid, oleic acid, eicosanoic acid, lauric acid, caprylic acid, capric acid, myristic acid, palmitic acid, stearic acid, linoleic acid, linolenic acid, dicaprate, tricaprate, monoolein, dilaurin, glyceryl 1-monocaprate, l-dodecylazacycloheptan-2-one, an acylcarnitine, an acylcholine, or a Cl-10 alkyl ester (e.g.
  • isopropylmyristate IPM monoglyceride, diglyceride, or pharmaceutically acceptable salt thereof.
  • viscous to semi-solid or solid forms comprising a carrier or one or more excipients compatible with topical application and having a dynamic viscosity preferably greater than water are typically employed.
  • suitable topical dosage forms include sprayable aerosol preparations wherein the active ingredient, preferably in combination with a solid or liquid inert carrier, is packaged in a mixture with a pressurized volatile (e.g., a gaseous propellant, such as freon) or in a squeeze bottle.
  • a pressurized volatile e.g., a gaseous propellant, such as freon
  • Moisturizers or humectants can also be added to pharmaceutical compositions and dosage forms if desired. Examples of such additional ingredients are well- known in the art.
  • the composition can be formulated in an aerosol form, spray, mist or in the form of drops.
  • prophylactic or therapeutic agents for use according to the present invention can be conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebuliser, with the use of a suitable propellant (e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas).
  • a suitable propellant e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
  • the dosage unit may be determined by providing a valve to deliver a metered amount.
  • Capsules and cartridges for use in an inhaler or insufflator may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.
  • compositions can be formulated in the form of powders, granules, microparticulates, nanoparticulates, suspensions or solutions in water or non-aqueous media, capsules, gel capsules, sachets, tablets or minitablets. Thickeners, flavoring agents, diluents, emulsifiers, dispersing aids or binders may be desirable.
  • Tablets or capsules can be prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (e.g., pregelatinised maize starch, polyvinylpyrrolidone, or hydroxypropyl methylcellulose); fillers (e.g., lactose, microcrystalline cellulose, or calcium hydrogen phosphate); lubricants (e.g., magnesium stearate, talc, or silica); disintegrants (e.g., potato starch or sodium starch glycolate); or wetting agents (e.g., sodium lauryl sulphate).
  • binding agents e.g., pregelatinised maize starch, polyvinylpyrrolidone, or hydroxypropyl methylcellulose
  • fillers e.g., lactose, microcrystalline cellulose, or calcium hydrogen phosphate
  • lubricants e.g., magnesium stearate, talc, or silica
  • disintegrants e.g., potato starch or sodium starch
  • Liquid preparations for oral administration may be prepared by conventional means with pharmaceutically acceptable additives such as suspending agents (e.g., sorbitol syrup, cellulose derivatives, or hydrogenated edible fats); emulsifying agents (e.g., lecithin or acacia); non-aqueous vehicles (e.g., almond oil, oily esters, ethyl alcohol, or fractionated vegetable oils); and preservatives (e.g., methyl or propyl-p-hydroxybenzoates or sorbic acid).
  • the preparations may also contain buffer salts, flavoring, coloring, and sweetening agents as appropriate.
  • Preparations for oral administration may be suitably formulated for slow release, controlled release, or sustained release of a prophylactic or, therapeutic agent(s).
  • compositions of the invention are orally administered in conjunction with one or more penetration enhancers, e.g., surfactants and chelators.
  • Preferred surfactants include, but are not limited to, fatty acids and esters or salts thereof, bile acids and salts thereof.
  • combinations of penetration enhancers are used, e.g., fatty acids/salts in combination with bile acids/salts.
  • sodium salt of lauric acid, capric acid is used in combination with UDCA.
  • Further penetration enhancers include, but are not limited to, polyoxyethylene-9-lauryl ether, polyoxyethylene-20-cetyl ether.
  • Compositions of the invention may be delivered orally in granular form including, but is not limited to, sprayed dried particles, or complexed to form micro or nanoparticles.
  • Complexing agents that can be used for complexing with the peptide of the invention include, but are not limited to, poly-amino acids, polyimines, polyacrylates, polyalkylacrylates, polyoxethanes, polyalkylcyanoacrylates, cationized gelatins, albumins, acrylates, polyethyleneglycols (PEG), polyalkylcyanoacrylates, DEAE-derivatized polyimines, pollulans, celluloses, and starches.
  • Particularly preferred complexing agents include, but are not limited to, chitosan, N-trimethylchitosan, poly-L- lysine, polyhistidine, polyornithine, polyspermines, protamine, polyvinylpyridine, polythiodiethylamino-methylethylene P(TDAE), polyaminostyrene (e.g.
  • PEG polyethyleneglycol
  • the method of the invention may comprise pulmonary administration, e.g. , by use of an inhaler or nebulizer, of a composition formulated with an aerosolizing agent.
  • the method of the invention may comprise administration of a composition formulated for parenteral administration by injection (e.g., by bolus injection or continuous infusion).
  • Formulations for injection may be presented in unit dosage form (e.g., in ampoules or in multi-dose containers) with an added preservative.
  • the compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
  • the active ingredient may be in powder form for constitution with a suitable vehicle (e.g., sterile pyrogen-free water) before use.
  • the composition is formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous administration to human beings.
  • compositions for intravenous administration are solutions in sterile isotonic aqueous buffer.
  • the composition may also include a solubilizing agent and a local anesthetic such as lignocaine to ease pain at the site of the injection.
  • the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container, such as an ampoule or sachette, indicating the quantity of active agent.
  • compositions of the invention can be formulated as neutral or salt forms.
  • Pharmaceutically acceptable salts include, but are not limited to, those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2- ethylamino ethanol, histidine, procaine, etc.
  • Non-limiting examples of pharmaceutically acceptable salts are acetate, benzenesulfonate, benzoate, bicarbonate, bitartrate, bromide, calcium acetate, camsylate, carbonate, chloride, citrate, dihydrochloride, edetate, edisylate, estolate, esylate, fumarate, glucaptate, gluconate, glutamate, glycollylarsanilate, hexylresorcinate, hydrabamine, hydrobromide, hydrochloride, hydroxynaphthoate, iodide, isethionate, lactate, lactobionate, malate, maleate, mandelate mesylate, methylbromide, methylnitrate, methylsulfate, mucate, napsylate, nitrate, pamoate (embonate), pantothenate, phosphateldiphosphate, polygalacturonate, salicylate, ste
  • compositions may also be formulated as a depot preparation. Such long acting formulations may be administered by implantation (for example, subcutaneously or intramuscularly) or by intramuscular injection.
  • the compositions may be formulated with suitable polymeric or hydrophobic materials (for example, as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
  • suitable polymeric or hydrophobic materials for example, as an emulsion in an acceptable oil
  • ion exchange resins for example, as sparingly soluble derivatives, for example, as a sparingly soluble salt.
  • liposomes and emulsions are well known examples of delivery vehicles or carriers for hydrophilic drugs.
  • ingredients of the compositions of the invention e.g., a, a, a, a, a, a, a, a, a, a, a, a, a, a,
  • FGF-CX are derived from a subject that is the same species origin or species reactivity as recipient of such compositions.
  • kits for carrying out the therapeutic regimens of the invention comprise in one or more containers prophylactically or therapeutically effective amounts of the composition of the invention (e.g., FGF-CX polypeptide) in pharmaceutically acceptable form.
  • the composition in a vial of a kit of the invention may be in the form of a pharmaceutically acceptable solution, e.g., in combination with sterile saline, dextrose solution, or buffered solution, or other pharmaceutically acceptable sterile fluid.
  • the composition may be lyophilized or desiccated; in this instance, the kit optionally ' further comprises in a container a pharmaceutically acceptable solution (e.g., saline, dextrose solution, etc.), preferably sterile, to reconstitute the composition to form a solution for injection purposes.
  • a pharmaceutically acceptable solution e.g., saline, dextrose solution, etc.
  • kits of the invention further comprises a needle or syringe, preferably packaged in sterile form, for injecting the formulation, and or a packaged alcohol pad. Instructions are optionally included for administration of the formulations of the invention by a clinician or by the patient.
  • kits comprising a plurality of containers each comprising a pharmaceutical formulation or composition comprising a dose of the composition of the invention (e.g., FGF-CX polypeptide) sufficient for a single administration.
  • a pharmaceutical formulation or composition comprising a dose of the composition of the invention (e.g., FGF-CX polypeptide) sufficient for a single administration.
  • compositions of the invention are stored in containers with biocompatible detergents, including but not limited to, lecithin, taurocholic acid, and cholesterol; or with other proteins, including but not limited to, gamma globulins and serum albumins.
  • the products of the invention include instructions for use or other informational material that advise the physician, technician, or patient on how to appropriately prevent or treat the disease or disorder in question.
  • FGF-CXld 250059596 SEQ ID NO: 8 185 aa MW at 20762.3kD Protein Sequence
  • FGF-CXlj CG53135-02 iSEQ ID NO: 20 158 aa MW at l8254.6kD Protein Sequence iMAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGM NDKGELYGSEKLT SEC I FR ⁇ QFEENWY TYS SNI YKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTH FLPRPVDPERVP ⁇ LYKDLLMYT
  • FGF-CX11, CG53135-06 ISEQ ID NO: 24 179 aa !MW at 20146.7kD Protein Sequence
  • FGF-CXlm CG53135-07 SEQ JD NO: 25 54 bp DNA Sequence ORF Start: ATG at 1
  • FGF -CXIa MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHL FGF -CXlb MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHL FGF -CXlc FGF -CXld FGF -CXle FGF -CXlf -TRSILRRRQLYCRTGFHLQILPDGSVQGT FGF -CXlg FGF -CXlh FGF -CXli FGF -CXlj MAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGT FGF -CXl MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAA ⁇ RSARGGPGAAQLAHL FGF -CX11 MAPLAEVGGFLGGLEGLGQPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSV
  • FGF-CXld (SEQ ID NO 8)
  • FGF-CXle (SEQ ID NO 10)
  • FGF-CXlh (SEQ ID NO 16)
  • FGF-CXli (SEQ ID NO 18)
  • PSG a new signal peptide prediction method
  • N-region length 6; pos.chg 0; neg.chg 1 H-region: length 8; peak value 0.00 PSG score: -4.40
  • GvH von Heijne's method for signal seq. recognition
  • GvH score (threshold: -2.1): -5.49 possible cleavage site: between 16 and 17
  • membrane topology type lb (cytoplasmic tail 94 to 211)
  • Gavel prediction of cleavage sites for mitochondrial preseq cleavage site motif not found
  • NUCDISC discrimination of nuclear localization signals pat4 : none pat7 : none bipartite: none content of basic residues: 12.3%
  • KDEL ER retention motif in the C-terminus: none
  • SKL peroxisomal targeting signal in the C-terminus: none
  • VAC possible vacuolar targeting motif
  • Actinin-type actin-binding motif type 1 : none type 2 : none
  • NMYR N-myristoylation pattern : none
  • Prenylation motif none memYQRL: transport motif from cell surface to Golgi: none
  • NNCN Reinhardt's method for Cytoplasmic/Nuclear discrimination Prediction: cytoplasmic Reliability: 89
  • COIL Lupas's algorithm to detect coiled-coil regions total : 0 residues
  • CG53135-05 resulted in variants that have high activity in the proliferation assays.
  • these variants detailed in this section are expected to have same utility as that of CG53135- 05.
  • fractions were collected using an automated fraction-collector (Agilent 1100) and the fractions characterized by liquid chromatography electrospray ionization ion trap mass spectrometry (LC/ESI/MS), matrix-assisted laser desorption ionization time of flight mass spectrometry (MALDI-TOF-MS), and N-terminal amino acid sequencing.
  • LC/ESI/MS liquid chromatography electrospray ionization ion trap mass spectrometry
  • MALDI-TOF-MS matrix-assisted laser desorption ionization time of flight mass spectrometry
  • N-terminal amino acid sequencing N-terminal amino acid sequencing.
  • Peak 0 is not a protein, is not product-related, and is not a residual process impurity (i.e., it is not DNA, endotoxin, kanamycin, or IPTG).
  • the CG53135-05-related species (Peaks 1, 2, 3, and 4) eluted in mobile phase of 36% acetonitrile, 63% water, and 0.1% trifluoroacetic acid. Similar fractions were then pooled and the samples concentrated using an Amicon 10,000 dalton cut-off filter (Millipore, Bedford, MA) in a 4°C centrifuge.
  • the samples were diluted 16-fold in 200 mM arginine, 40 mM sodium acetate, and 3% glycerol and then concentrated to a volume of approximately 500 ⁇ l.
  • the concentration of the pooled fractions was determined using amino acid analysis.
  • the XP DECA was set to acquire a full MS scan between 400 and 1400 m/z followed by full MS/MS scans between 400 and 2000 m/z of the top 3 ions from the preceding MS scan.
  • Data were processed using TurboSequest (Thermofinngan).
  • Database searching and protein identification was performed using MASCOT (Matrix Sciences, Manchester, UK).
  • MASCOT reports a probability-based MOWSE score and percent coverage for the identified protein based on molecular mass of the peptides, MS/MS sequence information, mass accuracy, and number of peptides detected.
  • Table 2 contains the peak number for the CG53135-05-related species, confidence score provide by MASCOT, and percent coverage obtained from MS/MS spectra.
  • NA . data not available, not a protein, not product-related
  • the molecular weight determined by MALDI-TOF and N-terminus sequencing can identify the 4 species. For peak 1, 4 different species were detected via N- terminal sequencing, 2 of which were also detected by MALDI-TOF. These results are also in agreement with the coverage obtained using LC/MS.
  • the polypeptide sequences of each species derived by N-terminal sequencing are given in Table 4.
  • CG53135-05 were hydrolyzed for 16 h at 115°C in 100 mL of 6 N HC1, 0.2% phenol containing 2 nmol norleucine as an internal standard. Samples were dried in a Speed Vac Concentrator and dissolved in 100 mL sample buffer containing 2 nmol homoserine as an internal standard. The amino acids in each sample were separated on a Beckman Model 7300 ion-exchange instrument. The amino acid composition of CG53135-05 was consistent with the theoretical amino acid composition.
  • the chromatogram in Figure 2A is consistent with the 20 peptides expected from the digestion of CG53135-05 with trypsin, and the chromatogram in Figure 2B reveals a single peak as expected for the single tryptophan residue in CG53135-05.
  • CG53135-05 related species collected from the 4 peaks identified by LC and MS was measured by treatment of serum-starved cultured NIH 3T3 murine embryonic fibroblast cells with various doses of the isolated CG53135-05 related species and measurement of incorporation of bromodeoxyuridine (BrdU) during DNA synthesis.
  • BrdU bromodeoxyuridine
  • cells were cultured in Dulbecco' s modified Eagle's medium supplemented with 10% fetal bovine serum. Cells were grown in 96- well plates to confluence at 37°C in 10% CO 2 /air and then starved in Dulbecco's modified Eagle's medium for 24 - 72 h.
  • CG53135-05-related species were added and incubated for 18 h at 37°C in 10% CO 2 /air.
  • BrdU (10 mM final concentration) was added and incubated with the cells for 2 h 37°C in 10% CO /air. Incorporation of BrdU was measured by enzyme-linked immunosorbent assay according to the manufacturer's specifications (Roche Molecular Biochemicals, Indianapolis, IN).
  • FGF family members transduce signals intracellularly via high affinity interactions with cell surface immunoglobulin (Ig) domain-containing tyrosine kinase FGF receptors (FGFRs).
  • Ig immunoglobulin domain-containing tyrosine kinase FGF receptors
  • Four distinct human genes encode FGFRs (Powers et ah, Endocr Relat Cancer 2000, 7:165-97; Klint and Claesson-Welsh, Front Biosci 1999, 4:D165-77; Xu et ah, Cell Tissue Res 1999, 296:33-43).
  • a related fifth human sequence lacking a kinase domain has recently been identified and named FGFR-5 (Kim et ah, Biochim Biophys Acta 2001, 1518:152-6).
  • FGFs also bind, albeit with low affinity, to heparin sulfate proteoglycans (HSPGs) present on most cell surfaces and extracellular matrices (ECM). Interactions between FGFs and HSPGs serve to stabilize FGF/FGFR interactions and to sequester FGF and protect it from degradation (Powers et al, Endocr Relat Cancer 2000, 7:165-97; Szebenyi and Fallon, Lit Rev Cytol 1999,185:45-106).
  • HSPGs heparin sulfate proteoglycans
  • FGF receptor-1 (FGFR-1), which shows the broadest expression pattern of the four FGF receptors, contains at least seven tyrosine phosphorylation sites. A number of signal transduction molecules are affected by binding with different affinities to these phosphorylation sites.
  • FGFR-1, FGFR-2 and FGFR-3 each recognize FGF-1, FGF-2, FGF-4 and
  • FGF-8 In addition, FGFR-1 & FGFR-2 bind FGF-3, FGF-5, FGF-6, FGF-10 and FGF-17 (Powers et ah, Endocr Relat Cancer 2000, 7:165-97). Binding of various FGF ligands varies with each receptor splice form, thus allowing a wide repertoire of FGF-mediated signaling events through a limited number of receptor coding genes. Tissue-specific alternate splicing permits cells expressing a single FGFR gene to significantly diversify their biological response by generating distinct receptor isoforms that may exhibit different ligand specificity and function.
  • FGFR-4 binds FGF-1, FGF-2, FGF-4, FGF-6, FGF-8 and FGF-9 but not FGF- 3, FGF-5 or FGF-7.
  • FGF-7, or keratinocyte growth factor- 1 (KGF-1) is only recognized by FGFR-2, whereas FGF-9 binds to FGFR-2, FGFR-3 and FGFR-4.
  • Receptor specificity of FGFs-11 to -19 is not well understood (Powers et ah, Endocr Relat Cancer 2000, 7:165-97; Ornitz et al, J Biol Chem 1996, 271:15292-7).
  • FGFR-1, FGFR-2 and FGFR-3 are widely expressed, suggesting an important functional role in tissue homeostasis. Protein expression patterns for tissue-specific isoforms have not yet been determined.
  • FGFR-4 has a more limited expression pattern being notably absent from lung, oviduct, placenta, testis, prostate, thyroid, parathyroid, and sympathetic ganglia, tissues where all three other receptors are predominantly expressed (Hughes, J Histochem Cytochem 1997, 45:1005-19).
  • the nickel column was washed with PBS/0.5M NaCl + 1M L-arginine and bound proteins were eluted with a linear gradient of imidazole (0-0.5 M). Fractions containing CG53135 (100-150 mM imidazole) were pooled and dialyzed against 1 X 10 6 volumes of PBS pH 8.0 containing 1M L-arginine. The protein sample was stored at -80°C.
  • recombinant CG53135-01, aFGF, or PDGF-BB final concentrations of 10, 5 and 3 ng/mL, respectively
  • soluble receptors final concentrations of 0.2, 1 and 5 ug/mL
  • Factor concentrations represent the amount of hgand needed to generate a half maximal BrdU response in NIH 3T3 cells.
  • Soluble FGFRs were Fc chimeras of the following receptor forms (FGFRl ⁇ (IIIc); FGFR2 ⁇ (IIIb); FGFR2 ⁇ (IIIb); FGFR2QC(IIIC); FGFR3 ⁇ (IIIc); FGFR4) and were obtained from R&D Systems (Minneapolis, MN).
  • the BrdU assay was performed according to the manufacturer's specifications (Roche Molecular Biochemicals, Indianapolis, IN) using a 4 h BrdU incorporation time.
  • Example 4 Treatment of Stroke [00103] Thirty male Sprague Dawley rats were allocated to treatment groups as indicated in the study design Table 8 below.
  • MCA Middle cerebral artery
  • Rats were given CG53135-05 or vehicle [40mM acetate, 200 mM mannitol (pH 5.3)] by percutaneous injection into the cisterna magna, once at 1 day, (approximately 24 hours) and once at 3 days, (approximately 72 hours) after MCA. Animals were given test article (2 dose groups) or vehicle treatment according to the study design. Clinical Observations/Signs
  • Body Weight Animals were weighed on Days 1, 3, 7, 14 and 21.
  • Forelimb Placing Test Assessment Score The forelimb placing test measures sensorimotor function in each forelimb as the animal places the limb on a table top in response to visual, tactile, and proprioceptive stimuh.
  • Hie forelimb placing test consists of the following evaluations and scoring, where the combined total score for the forelimb placing test reflects a range from 0 (no impairment) to 10 (maximal impairment): visual placing (forward, sideways):, 0 - 4 tactile placing (dorsal,lateral): 0 - 4 proprioceptive placing: 0 - 2 Total score for all forelimb tests: 0 - 10
  • Hindlimb Placing Test Assessment Score Similarly, the hindlimb placing test measures sensorimotor function of the hindlimb as the animal places it on a tabletop in response to tactile and proprioceptive stimuli.
  • the hindhmb placing test consists of the following evaluations and scoring, where the combined total score for the hindlimb placing test reflects a range from 0 (no impairment) to 6 (maximal impairment): tactile placing (dorsal,lateral): 0 - 4 proprioceptive placing: 0 - 2
  • Body Swing Test the body swing test was carried out on all animals on Day
  • the cylinder test measures spontaneous motor activity of the forelimbs. Animals are placed in a narrow glass cylinder (16.5 x 25 cm) and videotaped for 5 min on the day before stroke surgery and at weekly intervals thereafter. Videotapes are then scored independently by one experienced observer and up to 50 spontaneous movements will be counted ( ⁇ 5 min per rat per day). Spontaneous movements include those made by each forelimb to initiate rearing, to land on or to move laterally along the wall of the cylinder, or to land on the floor after rearing.
  • the area of cerebral infarcts on each of seven slices (+4.7, +2.7, +0.7, -1.3, -3.3, -5.3, and -7.3 mm compared with Bregma) was determined using a computer interface imaging system using the indirect method (area of the intact contralateral hemisphere - area of the intact ipsilateral hemisphere) to correct for brain shrinkage during processing. Jnfarct volume was then expressed as a percentage of the intact contralateral hemispheric volume. Volumes of the infarction in the cortex and striatum were also determined separately using these same methods. H&E stained section was examined for histological changes such as hemorrhage, abscess or tumor formation.
  • Forelimb Placing Test on days -1, 1, 3, 7, 14, and 21 relative to MCA occlusion, animals were examined by using a limb placing test to assess sensorimotor function in the forelimb in response to visual, tactile and proprioceptive stimuli (Kawamata, T., Dietrich, W. D., Schallert, T., Gotts, E., Cocke, R. R., Benowitz, L. I. & Finklestein, S. P. (1997) Proc. Natl. Acad. Sci. USA 94, 8179-8184; De Ryck, M., Van Reempts, J., Duytschaever, H., Van Deuren, B. & Clincke, G. (1992) Brain Res.
  • Visual placing (scored 0-4), tactile placing (scored 0-4), and proprioceptive placing (scored 0-2) were summed to generate a range of potential total scores from 0 to 12, with 12 representing maximal impairment (Figure 4).
  • Hindlimb Placing on days -1, 1, 3, 7, 14, and 21 relative to MCA occlusion, animals were examined by using a limb placing test to assess sensorimotor function in the hindlimb in response to tactile and proprioceptive stimuli [Kawamata, T., Dietrich, W. D., Schallert, T., Gotts, E., Cocke, R. R., Benowitz, L. I. & Finklestein, S. P. (1997) Proc. Natl. Acad. Sci. USA 94, 8179-8184; De Ryck, M., Van Reempts, J., Duytschaever, H., Van Deuren, B. & Clincke, G. (1992) Brain Res. 573, 44-60]. Tactile placing (scored 0-4), and proprioceptive placing (scored 0-2) were summed to generate a range of potential total scores from 0 to 6, with 6 representing maximal impairment (Figure 5).
  • Body Swing Test On days -1, 1, 3, 7, 14, and 21 relative to MCA occlusion, animals were examined by using a body swing test to assess side preference as the animal is held approximately one inch above the surface of the table, and swings to the right or the left side.
  • a body swing test to assess side preference as the animal is held approximately one inch above the surface of the table, and swings to the right or the left side.
  • Cylinder Test On days -1, 1, 3, 7, 14, and 21 relative to MCA occlusion, animals were examined by cylinder test to assess spontaneous motor activity of the forelimbs (Kawamata, T., Dietrich, W. D., Schallert, T., Gotts, E., Cocke, R. R., Benowitz, L. I. & Finklestein, S. P. (1997) Proc. Natl. Acad. Sci. USA 94, 8179-8184; De Ryck, M., Van Reempts, J., Duytschaever, H., Van Deuren, B. & Clincke, G. (1992) Brain Res.
  • CG53135-05 administration will be useful in the treatment of pathological conditions including ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning and neurodegenerative diseases (such as Alzheimer's, Parkinson's Disease, Amyotrophic Lateral Sclerosis, Huntington's Disease).
  • pathological conditions including ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning and neurodegenerative diseases (such as Alzheimer's, Parkinson's Disease, Amyotrophic Lateral Sclerosis, Huntington's Disease).
  • MMPs matrix metalloproteinases
  • OA Osteoarthritis
  • RA Rheumatoid Arthritis
  • MMP matrix metalloproteinase
  • SW1353 chondrosarcoma cell line ATCC HTB-94. This cell line is a well-established chondrocytic cellular model for matrix metalloproteinases (MMP) production.
  • SW1353 cells were plated in a 24-well plate at 1 xlO 5 cells/ml (1 ml) in DMEM medium- 10 % FBS. Following overnight incubation, the medium was replaced with DMEM + 0.2 % Lactabulmin serum.
  • CG53135-05 was added to the wells at doses ranging from 10 to 5000 ng/ml, in the absence or presence of JL-1 beta (0.1 to 1 ng/ml, R&D systems Minneapolis, MN), TNF-alpha (10 ng/ml, R&D systems) or vehicle control to a final volume of 0.5 ml.
  • TL-1 beta and TNF-alpha are both potent stimulators of MMP activity. All treatments were done in triplicate wells. After 24 h, the supernatants were collected and Pro- MMP-1, and -13, as well as TJMP-1 (tissue inhibitor of matrix metalloproteinase), a natural inhibitor of MMP activity, was measured by ELIS A (R&D systems). The measurements were normalized to the number of cells by an MTS assay.
  • CG53135-05 significantly decreased MMP-13 production in the presence of either IL-1 beta or TNF-alpha as demonstrated in Figure 14 and Figurel5 respectively.
  • JL-1 beta and TNF-alpha are both potent stimulators of MMP activity.
  • MMP-13 affinity for type It collagen, the main collagen that is degraded in OA is ten times higher that of MMP- 1. Since MMP-13 expression increases in OA and RA, the decrease of MMP-13 observed with addition of CG53135-05 indicates that the protein can be used as an OA and RA therapeutic ( Figure 10).
  • CG53135-05 up-regulated the production of TJMP-1, a natural inhibitor of MMP activity (Figure 11).
  • CG53135-05 This enhancement of TJMP-1 production by CG53135-05 is beneficial in reducing the matrix breakdown by MMP-1 and -13 observed in OA and RA.
  • CG53135-05 had no effect on MMP-3 production constitutively or after JL-1 induction (data not shown.).
  • CG53135-05 FGF-20 showed increase in basal expression of MMP-1 in SW1353 cells (data not shown).
  • the rats were injected intra-articularly three times per week for 2 weeks with vehicle solution (8mM acetate, 40 mM arginine, and 0.6% glycerol (pH 5.3) in approximately 1% hyaluronic acid), 10 ⁇ g CG 53135-05 or 100 ⁇ g CG 53135-05.
  • vehicle solution 8mM acetate, 40 mM arginine, and 0.6% glycerol (pH 5.3) in approximately 1% hyaluronic acid
  • the rats were divided into three treatment groups with three animals in each group: two groups received CG53135 and one received only the vehicle control.
  • the rats were anesthetized with Isoflurane and injected through the patellar tendon into the area of the cruciate attachments of both knees.
  • CG53135 was injected at doses of 0.1 mg/ml (0.01 mg/joint) or 1.0 mg/ml (0.1 mg/joint).
  • Controls were injected with the vehicle solution as described above. Injections were done Monday, Wednesday and Friday for 2 weeks. The animals were terminated on day 15 at which time they were injected ip with BRDU (100 mg kg) in order to pulse label proliferating cells.
  • Morphologic Pathology Vehicle injected rats had minimal to mild synovial hyperplasia, inflammation and fibroplasia with none to minimal matrix deposition in fibrotic synovium.
  • Articular cartilage had no proteoglycan loss or fibrillation.
  • the central area of the joint where the cruciates attach and in which the intra-articular injections are made had none to minimal fibroplasia and cartilage/bone damage. No marginal zone chondrogenesis was present.
  • Knees injected with 10 ⁇ g CG 53135-05 had mild to moderate synovial hyperplasia, inflammation and fibroplasia with minimal to moderate matrix deposition in fibrotic synovium.
  • Articular cartilage had no proteoglycan loss or fibrillation.
  • the central area of the joint where the cmciates attach and in which the intra-articular injections are made had none to minimal fibroplasia and cartilage/bone damage.
  • One knee had minimal marginal zone chondrogenesis.
  • Knees injected with 100 ⁇ g CG 53135-05 had moderate to marked synovial hyperplasia, inflammation and fibroplasia with moderate matrix deposition in fibrotic synovium.
  • Articular cartilage had none to minimal proteoglycan loss or fibrillation.
  • the central area of the joint where the cruciates attach and in which the intra-articular injections are made had minimal to marked fibroplasia and cartilage/bone damage. All knees had mild to moderate marginal zone chondrogenesis.
  • One animal had chondrogenesis in areas associated with articular cartilage.
  • Example 7 Intra-articular injection of CG53135-05 in Meniscal Tear model of Rat Osteoarthritis: Prophylactic and Therapeutic Dosing
  • Example 6 utilized CG53135-05 administration into the joints of normal rats to identify effects on relevant cell populations by histomorphometric analysis.
  • CG53135-05 induced significant marginal zone chondrogenesis similar to that seen with other growth factors such as TGF-beta, suggesting an effect on pluripotent stem cells within the marginal zone.
  • TGF-beta growth factors
  • the potentially adverse effects of observed synovial fibroplasia and bone resorption could have been due to either FGF-20 activity or endotoxin levels within the non-clinical grade hyaluronic acid used to formulate the protein.
  • Prophylactic Dosing intra-articular dosing (CG53135-05) of the right knee joint was initiated on the day of surgery and is continued for 2 weeks post-surgery with intra- articular injections given Thursday, Saturday, and Monday (day 0, 2, 4, 7, 9, and 11) with rats under Isoflurane anesthesia.
  • Indomethacin a nonsteroidal anti-inflammatory drug, was dosed (lmg/kg/day) daily by the oral route starting on the day of surgery to reduce any potential inflammation due to the injection.
  • Body weights were recorded on days 0, 7 and 14. After animal termination on day 14 post-surgery, both knees were collected for histopathologic evaluation. The study design is shown in Table 10.
  • intra-articular dosing CG53135-05
  • intra-articular injections given Friday, Sunday, and Tuesday (day 22, 25, 27, 29, 32, and 34) with rats under Isoflurane anesthesia.
  • Indomethacin is dosed daily by the oral route starting on the day of surgery.
  • Body weights are recorded on days 0, 7, 14, 21, 28, and 35.
  • both knees are collected for histopathologic evaluation.
  • Table 11 The study design is shown in Table 11.
  • Results of prophylactic dosing study include the standards followed for this model. Multiple sections (3 levels) of right knee were analyzed microscopically and scored according to the following methods. In scoring the 3 sections, the worst case scenario for the 2 halves on each of the 3 slides representing 3 levels was determined for cartilage degeneration and osteophyte formation. This value for each parameter for each slide was then averaged to determine overall subjective cartilage degeneration scores for tibia and femur and osteophyte scores for tibia.
  • Cartilage degeneration was scored none to severe (numerical values 0-5) for depth and area (surface divided into thirds) using the following criteria:
  • l minimum degeneration, chondrocyte and proteoglycan loss with or without fibrillation involving the superficial zone
  • Total Tibial Cartilage Degeneration Width ⁇ m a micrometer measurement of total extent of tibial plateau affected by any severity of degeneration (Total Tibial Cartilage Degeneration Width ⁇ m) extended from the origination of the osteophyte or marginal zone if no osteophyte was present with adjacent cartilage degeneration (outside 1/3) across the surface to the point where tangential layer and underlying cartilage appeared histologically normal.
  • a micrometer depth of any type of lesion (cell/proteoglycan loss, change in metachromasia, but may have good retention of collagenous matrix and no fibrillation) expressed as a ratio of depth of changed area vs. depth to tidemark was included and taken over 4 equally spaced points on the tibial surface. These measurements were taken (1st) matrix adjacent to osteophyte (2nd) 1/4 of the distance across the tibial plateau (3rd) 1/2 of the distance across the tibial plateau (4th) 3/4 of the distance across the tibial plateau. This measurement was the most critical analysis of any type of microscopic change present. The depth to tidemark measurement (denominator) also gives an indication of cartilage thickness across the tibial plateau and therefore allows comparisons across groups when trying to determine if hypertrophy or hyperplasia has occurred.
  • Results of the prophylactic dosing study indicate that intra-articular injection of 100 ⁇ g of CG53135-05 in knee joints of rats with medial meniscal tear results in chondroprotective effects as a result of both inhibition of cartilage degeneration and stimulation of cartilage repair. Some joints had layering of proliferated new cartilage over existing normal appearing or damaged cartilage. This observation is particularly exciting as it demonstrates the potential for resurfacing to occur.
  • CG53135-05 in osteoarthritis include:
  • Results of the therapeutic dosing study The data described demonstrated the potential chondroproliferative activities of CG53135-05 administered intra-articularly. However, protein injected joints had markedly increased inflammation, fibroplasia and connective tissue resorptive process.
  • Indomethacin treatment was not effective in reducing the inflammatory changes and it had no beneficial effects on inhibiting the resorptive processes occurring in bone.
  • following modification to the therapeutic dosing study can be attempted: Increasing the dosing interval to once or twice weekly and/or increasing the study duration to allow time for the prohferative tissue to fill the large cartilage defects induced by this disease process.
  • Another possibility is to investigate the effects of CG53135-05 in a larger species such as the dog as dogs have less of a tendency to proliferate connective tissue and resorb bone in response to various stimuli than rodents.
  • Such alterations and changes may include, but not limited to, different compositions for the administration of the polypeptides according to the present invention to a subject; different amounts of the polypeptide; different times and means of administration; different materials contained in the administration dose including, for example, combinations of different peptides, or combinations of peptides with different biologically active compounds.
  • Such changes and alterations also are intended to include modifications in the amino acid sequence of the specific polypeptides described herein in which such changes alter the sequence in a manner as not to change the functionality of the polypeptide, but as to change solubility of the peptide in the composition to be administered to a subject, absorption of the peptide by the body, protection of the polypeptide for either shelf life or within the body until such time as the biological action of the peptide is able to bring about the desired effect, and such similar modifications. Accordingly, such changes and alterations are properly intended to be within the full range of equivalents of the present invention.

Landscapes

  • Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Organic Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Pain & Pain Management (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Immunology (AREA)
  • Rheumatology (AREA)
  • Psychology (AREA)
  • Urology & Nephrology (AREA)
  • Vascular Medicine (AREA)
  • Hospice & Palliative Care (AREA)
  • Psychiatry (AREA)
  • Dermatology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Epidemiology (AREA)
  • Cardiology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The present invention relates to compositions and methods of treatment of various conditions, including but are not limited to, stroke, wound healing, and joint diseases (e.g., osteoarthritis and rheumatoid arthritis). More particularly, the present invention relates to compositions comprising a member of the fibroblast growth factor family, FGF-CX (also known as CG53135-05 or FGF-20), its related polypeptides, nucleic acids encoding such polypeptides, and their uses for treating a condition, such as but is not limited to, stroke, wound healing, and joint diseases (e.g., osteoarthritis and rheumatoid arthritis).

Description

NOVEL FIBROBLAST GROWTH FACTORS AND METHODS OF USE THEREOF
[001] This application claims the benefit of U.S. Provisional Application Serial No.
60/469,353, filed May 9, 2003, which is incorporated herein by reference in its entirety.
1. FIELD OF INVENTION [002] The present invention relates to compositions and methods of treatment of various conditions, including but are not limited to, stroke, wound healing, and joint diseases (e.g., osteoarthritis and rheumatoid arthritis). More particularly, the present invention relates to compositions comprising a member of the fibroblast growth factor family, FGF-CX (also known as CG53135-05 or FGF-20), its related polypeptides, nucleic acids encoding such polypeptides, and their uses for treating a condition, such as but is not limited to, stroke, would healing, and joint diseases (e.g., osteoarthritis and rheumatoid arthritis).
2. BACKGROUND OF THE INVENTION [003] The FGF family of proteins, whose prototypic members include acidic FGF
(FGF-1) and basic FGF (FGF-2), bind to four related receptor tyrosine kinases. These FGF receptors are expressed on most types of cells in tissue culture. Dimerization of FGF receptor monomers upon ligand binding has been reported to be a requisite for activation of the kinase domains, leading to receptor trans phosphorylation. FGF receptor-1 (FGFR-1), which shows the broadest expression pattern of the four FGF receptors, contains at least seven tyrosine phosphorylation sites. A number of signal transduction molecules are affected by binding with different affinities to these phosphorylation sites.
[004] Expression of FGFs and their receptors in brains of perinatal and adult mice has been examined. Messenger RNA of all FGF genes, with the exception of FGF-4, is detected in these tissues. FGF-3, FGF-6, FGF-7 and FGF-8 genes demonstrate higher expression in the late embryonic stages than in postnatal stages, suggesting that these members are involved in the late stages of brain development. In contrast, expression of FGF-1 and FGF-5 increased after birth. In particular, FGF-6 expression in perinatal mice has been reported to be restricted to the central nervous system and skeletal muscles, with intense signals in the developing cerebrum in embryos but in cerebellum in 5 -day-old neonates. FGF-receptor (FGFR)-4, a cognate receptor for FGF-6, demonstrates similar spatiotemporal expression, suggesting that FGF-6 and FGFR-4 play significant roles in the maturation of nervous system as a Ugand-receptor system. According to Ozawa et ah, these results strongly suggest that the various FGFs and their receptors are involved in the regulation of a variety of developmental processes of brain, such as proliferation and migration of neuronal progenitor cells, neuronal and glial differentiation, neurite extensions, and synapse formation. See, e.g., Ozawa et ah, Brain Res. Mol. Brain Res. 199641(l-2):279-88.
[005] Other members of the FGF polypeptide family include the FGF receptor tyrosine kinase (FGFRTK) family and the FGF receptor heparan sulfate proteoglycan (FGFRHS) family. These members interact to regulate active and specific FGFR signal transduction complexes. These regulatory activities are diversified throughout a broad range of organs and tissues, and in both normal and tumor tissues, in mammals. Regulated alternative messenger RNA (mRNA) splicing and combination of variant subdomains give rise to diversity of FGFRTK monomers. Divalent cations cooperate with the FGFRHS to conformationally restrict FGFRTK trans-phosphorylation, which causes depression of kinase activity and facilitates appropriate activation of the FGFR complex by FGF. For example, it is known that different point mutations in the FGFRTK commonly cause craniofacial and skeletal abnormalities of graded severity by graded increases in FGF-independent activity of total FGFR complexes. Other processes in which FGF family exerts important effects are liver growth and function, and prostate tumor progression.
[006] Glia-activating factor (GAF), another FGF family member, is a heparin- binding growth factor that was purified from the culture supernatant of a human glioma cell line. See, Miyamoto etah, 1993, Mol. Cell Biol. 13(7): 4251-4259. GAF shows a spectrum of activity slightly different from those of other known growth factors, and is designated as FGF-9. The human FGF-9 cDNA encodes a polypeptide of 208 amino acids. Sequence similarity to other members of the FGF family was estimated to be around 30%. Two cysteine residues and other consensus sequences found in other family members were also well conserved in the FGF-9 sequence. FGF-9 was found to have no typical signal sequence in its N-terminus like those in acidic FGF and basic FGF. Acidic FGF and basic FGF are known not to be secreted from cells in a conventional manner. However, FGF-9 was found to be secreted efficiently from cDNA-transfected COS cells despite its lack of a typical signal sequence. It could be detected exclusively in the culture medium of cells. The secreted protein lacked no amino acid residues at the N-terminus with respect to those predicted by the cDNA sequence, except the initiation methionine. The rat FGF-9 cDNA was also cloned, and the structural analysis indicated that the FGF-9 gene is highly conserved. [007] FGFs have been shown to induce neuronal sprouting. See Proc. Natl. Acad.
Sci. U.S.A. 1997 94 (15): 8179-84. Kawamata et al. (Journal of Cerebral Blood Flow and Metabohsm, 16:542-547, 1996) proposed that basic FGF, an 18 kDa and 154 amino acid long polypeptide, supports the survival and outgrowth of a wide variety of brain neurons. US Patent Application US 2002/0151496 Al suggests that FGF-20 is a neurotrophic factor and stimulate survival of cells of neuronal origin.
2.1. Inflammation: Osteoarthritis and Rheumatoid Arthritis [008] Osteoarthritis ("OA") is a degenerative joint disease and a frequent cause of joint pain that affects a large and growing population. OA is estimated to be the most common cause of disability in adults. The disease typically manifests itself in the 2nd to 3rd decades, with most people over forty years exhibiting some pathologic change in weight bearing joints, although the change may be asymptomatic. A systematic review of incidence and prevalence of OA of the knee in people older than 55 years in the United Kingdom reported an incidence of 25 percent per year, a prevalence of disability of 10 percent, and severe disability in about two to three percent. The National Health and Nutrition Examination Survey (Center for Health Statistics, Centers for Disease Control and Prevention) found the prevalence of this disease to be over 80 percent in people over age 55, compared to less than 0.1 percent in those aged 25 to 34 years old. OA results from a complex interplay of multiple factors, including joint integrity, genetics, local inflammation, mechanical forces, and cellular and biochemical processes. Characteristic features of the disease are degradation of articular cartilage, hypertrophy of bone at the margins, and changes in the synovial membrane, typically accompanied by pain and stiffness of the joint. For the majority of patients, OA is linked to one or more factors, such as aging, occupation, trauma, and repetitive and small insults over time. The pathophysiologic process of OA is almost always progressive.
[009] CG53135-05 and their variants belong to the FGF family that regulates proliferation (see U.S. Application Serial No. 10/174,394, which is incorporated herein by its entirety). The identification of a polymorphism (CG53135-12) in the gene encoding an FGF20-like protein, CG53135-01, in humans, and a method for identifying individuals who are carriers of the genetic risk-altering factor for OA have been described in U.S. Application Serial No. 10/702,126 ("the '126 application"), which is incorporated herein by its entirety. The '126 application describes a DNA-based diagnostic test for identifying individuals with increased risk for OA and resultant musculoskeletal complications. [0010] There are several well-established treatment modes for OA, ranging from non- pharmaceutical to pharmaceutical intervention. Non-pharmaceutical interventions include behaviour modification, weight loss, exercise, walking aids, avoidance of aggravating activities, as well as joint irrigation, and arthroscopic and surgical interventions. Current pharmaceutical interventions include nonsteroidal antiinflammatory drugs, intraarticular corticosteroids, and colchicine. In addition, FGF- 18 has been shown to repair damaged cartilage in a rat meniscal tear model for OA (See Paper #0199, 50th Annual Meeting of the Orthopaedic Research Society, San Francisco CA, 2004).
[0011] However, satisfactory treatment of OA is an unmet medical need, as existing therapeutics have not been successful in curtailing the incidence or the severity of the disease. Consequently, a therapeutic that can successfully treat osteoarthritis has the beneficial effects of decreasing morbidity, while potentially saving the healthcare system millions of dollars in costs associated with invasive surgical procedures, disability and ancillary support services.
[0012] Citation or discussion of a reference herein shall not be construed as an admission that such is prior art to the present invention.
3. SUMMARY OF THE INVENTION [0013] The present invention provides methods of preventing or treating a disease
(e.g., stroke, joint diseases, and trauma) comprising administering to a subject in need thereof a FGF-CX polypeptide, which has homology to Fibroblast Growth Factor (FGF) protein. The present invention also encompasses FGF-CX polynucleotide sequences and the FGF-CX polypeptides encoded by these nucleic acid sequences, and fragments, homologs, analogs, and derivatives thereof.
[0014] In accordance with the present invention, the diseases to be prevented or treated include, but are not limited to, joint diseases (non-limiting examples being arthritis, osteoarthritis, joint pathology, ligament and tendon injuries, and meniscal injuries), ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning, and neurodegenerative diseases (non-hmiting examples being Alzheimer's, Parkinson's Disease, Amyotrophic Lateral Sclerosis, Huntington's Disease).
[0015] In one aspect, the invention encompasses an isolated FGF-CX nucleic acid
(SEQ ID NOs:l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, as shown in Table A), that encodes a FGF-CX polypeptide, or a fragment, homolog, analog or derivative thereof. The nucleic acid can include, but not limited to, nucleic acid sequence encoding a polypeptide at least 85% identical to a polypeptide comprising the amino acid sequence of Table A (SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36). The invention also encompasses the polypeptides resulting from the proteolytic cleavage, of CG53135-05 (SEQ ID NO: 2) that includes SEQ ID Nos: 37, 38, 39, 40. The nucleic acid can be, but is not limited to, a genomic DNA fragment, and a cDNA molecule.
[0016] The present invention also encompasses a vector containing one or more of the nucleic acids described herein, and a cell containing the vectors or nucleic acids described herein.
[0017] The present invention further encompasses host cells transformed with a recombinant expression vector comprising any of the nucleic acid molecules described above.
[0018] In one embodiment, the invention provides a pharmaceutical composition that comprises a FGF-CX nucleic acid and a pharmaceutically acceptable carrier. In another embodiment, the invention provides a substantially purified FGF-CX polypeptide, e.g., any of the FGF-CX polypeptides encoded by a FGF-CX nucleic acid, and fragments, homologs, analogs, and derivatives thereof. The invention also provides a pharmaceutical composition that comprises a FGF-CX polypeptide and a pharmaceutically acceptable carrier.
[0019] In another embodiment, the invention provides an antibody that binds specifically to a FGF-CX polypeptide. The antibody can be, but is not limited to, a monoclonal or polyclonal antibody, and fragments, homologs, analogs, and derivatives thereof. The invention also provides a pharmaceutical composition including FGF-CX antibody and a pharmaceutically acceptable carrier. The present invention also emcompasses isolated antibodies that bind to an epitope on a polypeptide encoded by any of the nucleic acid molecules described above.
[0020] The present invention further provides kits comprising antibodies that bind to a polypeptide encoded by any of the nucleic acid molecules described above and a negative control antibody.
[0021] The invention encompasses a method for producing a FGF-CX polypeptide.
The method includes providing a cell containing a FGF-CX nucleic acid, e.g., a vector that includes a FGF-CX nucleic acid, and culturing the cell under conditions sufficient to express the FGF-CX polypeptide encoded by the nucleic acid. The expressed FGF-CX polypeptide is then recovered from the cell. Preferably, the cell produces little or no endogenous FGF-CX polypeptide. The cell can be, e.g., a prokaryotic cell or eukaryotic cell.
[0022] The present invention provides a method of inducing an immune response in a subject against a polypeptide encoded by any of the nucleic acid molecules disclosed above by administering to the mammal an amount of the polypeptide sufficient to induce the immune response.
[0023] The present invention also provides methods of identifying a compound that binds to FGF-CX polypeptide by contacting the FGF-CX polypeptide with a compound and determining whether the compound binds to the FGF-CX polypeptide.
[0024] The invention provides a prophylactic treatment with FGF-CX polypeptide wherein an injury that predisposes the subject to osteoarthritis has occurred but the cartilage is intact.
[0025] The invention also provides a therapeutic treatment with FGF-CX polypeptide wherein intrinsic or extrinsic factors (e.g. genetic predisposition or meniscal injury, respectively) has led to osteoarthritic changes and cartilage damage.
4. BRIEF DESCRIPTION OF THE FIGURES [0026] Figure 1 shows Liquid Chromatography and Mass Spectrometry analysis of
CG53135-05. CG53135-05 was injected onto the phenyl-hexyl column in an aqueous mobile phase containing 95% water, 5% acetonitrile, and 0.1% triftuoroacetic acid. The protein was then eluted by using a non-linear gradient with an organic mobile phase containing 95% acetonitrile, 5% water, and 0.085% triftuoroacetic acid. Each of the 4 peaks was characterized using LC/ESI/MS, MALDI-TOF MS, and N-terminal amino acid sequencing.
[0027] Figure 2A and 2B depict Peptide Map of CG53135-05. The upper tracing in each panel represents that of CG53135-05 and the lower tracing in each panel represents an identical sample treated similarly but without CG53135-05. Figure 2A: Detection at 214 nm to monitor CG53135 peptides. Figure 2B: Detection at 295 nm to monitor tryptophan- containing peptides.
[0028] Figure 3 shows Receptor Binding Specificity of CG53135. NIH 3T3 cells were serum-starved, incubated with the indicated factor (green squares=platelet derived growth factor; blue triangle=FGF-l ; red circle=CG53135) either alone or together with the indicated soluble FGFR, and DNA synthesis in response to CG53135 was measured in a BrdU incorporation assay. Data points represent the average obtained from triplicate wells, and are represented as the percent BrdU incorporation relative to cells receiving factor alone.
[0029] Figure 4 shows the results of Forelimb Placing Test. The mean and standard error of the score for groups receiving vehicle (diamonds), 1.0 μg/injection CG53135-05 (square), and 2.5 μg/injection CG53135-05 (triangles) are represented over time. Asterisks indicate significant difference from vehicle control as assessed by one-way ANOVA.
[0030] Figure 5 shows the results of Hindlimb Placing Test. The mean and standard error of the score for groups receiving vehicle (diamonds), 1.0 μg/injection CG53135-05 (square), and 2.5 μg/injection CG53135-05 (triangles) are represented over time. Asterisks indicate significant difference from vehicle control as assessed by one-way ANOVA.
[0031] Figure 6 shows the results of Body Swing Test. The mean and standard error of the score for groups receiving vehicle (diamonds), 1.0 μg/injection CG53135-05 (square), and 2.5 μg/injection CG53135-05 (triangles) are represented over time. A score range of -50% swings to the right indicates no impairment, whereas 0% swings to the right swing indicates maximal impairment. Asterisks indicate significant difference from vehicle control as assessed by one-way ANOVA.
[0032] Figure 7 shows the results of Cylinder Test. The mean and standard error of the score for groups receiving vehicle (diamonds), 1.0 μg injection CG53135-05 (square), and 2.5 μg/injection CG53135-05 (triangles) are represented over time.
[0033] Figure 8 shows the results of Body Weight. The mean and standard errors of the weights for groups receiving vehicle (diamonds), 1.0 μg/injection CG53135-05 (square), and 2.5 μg/injection CG53135-05 (triangles) is represented over time.
[0034] Figure 9 shows the effect of CG53135-05 on Pro-MMP production in
SW1353 cells in the presence of IL-1 beta.
[0035] Figure 10 shows the effect of CG53135-05 on Pro-MMP production in
SW1353 cells in the presence of TNF-alpha.
[0036] Figure 11 shows the effect of CG53135-05 on T P production in SW1353 cells.
[0037] Figure 12 shows the effect of intra-articular injection of CG53135-05 in the
Meniscal Tear Model of Rat Osteoarthritis (Prophylactic Dosing): Mean Tibial Cartilage Degeneration.
[0038] Figure 13 shows results of intra-articular injection of CG53135-05 in the
Meniscal Tear Model of Rat Osteoarthritis: (Prophylactic Dosing): Total Cartilage Degeneration Width. [0039] Figure 14 shows results of intra-articular injection of CG53135-05 in the
Meniscal Tear Model of Rat Osteoarthritis: (Prophylactic Dosing): Significant Tibial Cartilage Degeneration Width.
[0040] Figure 15 shows results of intra-articular injection CG53135-05 in the
Meniscal Tear Model of Rat Osteoarthritis (Therapeutic Dosing): Mean Tibial Degeneration.
[0041] Figure 16 shows results of intra-articular injection of CG53135-05 in the
Meniscal Tear Model of Rat Osteoarthritis (Therapeutic Dosing): Total Cartilage Degeneration Width.
[0042] Figure 17 shows results of intra-articular injection of CG53135-05 in
Meniscal Tear Model of Rat Osteoarthritis (Therapeutic Dosing): Significant Tibial Cartilage Degeneration Width.
5. DETAILED DESCRIPTION OF THE INVENTION [0043] The present invention provides methods of preventing or treating a joint disease (e.g., osteoarthritis, other related joint pathologies, such as but are not limited to, ligament and tendon injuries within the ligament and tendon itself, or within their respective insertion sites, meniscal tears, other joint disorders where matrix deposition occurs, joint disorders where remodeling and repair are required, and cartilage and joint pathology occurred as a result of an inflammatory disease (e.g., rheumatoid arthritis)) in a subject comprising administering to the subject a composition comprising an FGF-CX polypeptide.
[0044] The present invention also encompasses methods of using FGF-CX to improve functional recovery following middle cerebral artery (MCA) occlusion in rats. As stroke may result in disturbances of motor strength and coordination, sensory discrimination, visual function, speech, memory or other intellectual abilities, the present invention evaluates the efficacy and safety of FGF-CX in a model that assesses these parameters. In accordance with the present invention, administering FGF-CX will be beneficial in the treatment of pathological conditions including, but are not limited to, ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning, and neurodegenerative diseases (such as Alzheimer's, Parkinson's Disease, Amyotrophic Lateral Sclerosis, Huntington's Disease).
[0045] FGF-CX polypeptides, nucleic acids encoding the polypeptides, and methods of making such polypeptides are described in U.S. Application Serial Nos. 09/494,585 and
10/174,394, both of which are incorporated herein by reference in their entireties. FGF-CX is used interchangeably with the term "CG53135," "CG53135-05," and "FGF-20." [0046] Included within the invention are FGF-CX nucleic acids, isolated nucleic acids that encode FGF-CX polypeptide or a portion thereof, FGF-CX polypeptides, vectors containing these nucleic acids, host cells transformed with the FGF-CX nucleic acids, anti- FGF-CX antibodies, and pharmaceutical compositions. Also disclosed are methods of making FGF-CX polypeptides, as well as methods of screening, diagnosing, treating conditions using these compounds, and methods of screening compounds that modulate FGF- CX polypeptide activity. Table A provides a summary of the FGF-CX nucleic acids and their encoded polypeptides.
Table A
[0047] As used herein, the terms "subject" and "subjects" refer to an animal, preferably a mammal, including a non-primate (e.g., a cow, pig, horse, cat, dog, rat, and mouse) and a primate (e.g., a monkey, such as a cynomolgous monkey, chimpanzee, and a human), and more preferably a human. In a certain embodiment, the subject is a mammal, preferably a human, who is suffering from a joint disease (e.g., osteoarthritis, other osteoarthritis-related disorders), ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning, or neurodegenerative diseases (non-limiting examples being Alzheimer's, Parkinson's Disease, Amyotrophic Lateral Sclerosis, Huntington's Disease). In another embodiment, the subject is a mammal, preferably a human, who are at risk for a joint disease, ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning, or neurodegenerative diseases. In one embodiment, the subject is a mammal, preferably a human, who is suffering from a joint disease, but who is not suffering from stroke or a neurodegenerative disease. The term "subject" is used interchangeably with "patient" in the present invention.
[0048] As used herein, the term "therapeuticaHy effective amount" refers to the amount of a therapy (e.g., FGF-CX polypeptide), which is sufficient to reduce the severity of a disease (e.g., a joint disease, ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning, or neurodegenerative diseases), reduce the duration of a disease, prevent the advancement of a disease, cause regression of a disease, ameliorate one or more symptoms associated with a disease, or enhance or improve the therapeutic effect(s) of another therapy.
[0049] Compositions comprising FGF-CX can also be administered in combination with one or more other therapies to prevent, treat, or ameliorate a disease (e.g., a joint disease, ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning, or neurodegenerative diseases) or one or more symptoms thereof. In a preferred embodiment, compositions comprising FGF-CX is administered in combination with one or more other therapies known to be used in preventing, treating, or ameliorating a disease such as a joint disease, ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning, or neurodegenerative diseases, or one or more symptoms thereof.
[0050] In one embodiment, during a combination therapy, FGF-CX polypeptide and/or another therapy are administered in a sub-optimal amount, e.g., an amount that does not manifest detectable therapeutic benefits when administered alone, as determined by methods known in the art. In such methods, co-administration of FGF-CX polypeptide and another therapy results in an overall improvement in effectiveness of treatment.
[0051] In one embodiment, FGF-CX polypeptide and one or more other therapies are administered within the same patient visit. In another embodiment, FGF-CX polypeptide is administered prior to the administration of one or more other therapies. Jn yet another embodiment, the FGF-CX polypeptide is administered subsequent to the administration of one or more other therapies. In a specific embodiment, FGF-CX polypeptide and one or more other therapies are cyclically administered to a subject. Cycling therapy involves the administration of FGF-CX polypeptide for a period of time, followed by the administration of one or more other therapies for a period of time and repeating this sequential administration. Cycling therapy can reduce the development of resistance to one or more of the therapies, avoid or reduce the side effects of one of the therapies, and/or improve the efficacy of the treatment.
[0052] Toxicity and therapeutic efficacy of a composition of the invention (e.g. , FGF-
CX polypeptide) can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio of LD50/ED50. Compositions that exhibit large therapeutic indices are preferred. While compositions that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such composition to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects.
[0053] In one embodiment, the data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for use in humans. The dosage of complexes lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed, the route of administration utilized, the severity of the disease, age and weight of the subject, and other factors normally considered by a medical professional (e.g., a physician). For any composition used in the method of the invention, the therapeutically effective dose can be estimated initially from cell culture assays. A dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the test compound that achieves a half-maximal inhibition of symptoms) as determined in cell cultures. Such information can be used to more accurately determine useful doses in humans. Levels in plasma may be measured, for example, by high performance liquid chromatography. [INSERT PRFERRED DOSAGE RANGES HERE]
[0054] The appropriate and recommended dosages, formulation and routes of administration for treatment modalities such as chemotherapeutic agents, radiation therapy and biological/immunotherapeutic agents such as cytokines are known in the art and described in such literature as the Physician's Desk Reference (58th ed., 2004).
[0055] Various delivery systems are known and can be used to administer a composition of the invention. Such delivery systems include, but are not limited to, encapsulation in liposomes, microparticles, microcapsules, expression by recombinant cells, receptor-mediated endocytosis, construction of the nucleic acids of the invention as part of a retroviral or other vectors, etc. Methods of introduction include, but are not limited to, intradermal, intramuscular, intraperitoneal, intrathecal, intracerebroventricular, epidural, intravenous, subcutaneous, intranasal, intratumoral, transdermal, rectal, and oral routes. The compositions of the invention may be administered by any convenient route, for example, by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, virginal mucosa, rectal and intestinal mucosa, etc.), and may be administered together with other biologically active agents. Administration can be systemic or local.
[0056] In some embodiments, it may be desirable to administer the pharmaceutical compositions of the invention locally to the area in need of treatment. This may be achieved by, for example, local infusion during surgery, or topical apphcation, e.g., in conjunction with a wound dressing after surgery, by injection, by means of a catheter, by means of a suppository, or by means of an implant (said implant being of a porous, non-porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers). In one embodiment, administration can be by direct injection at the site (or former site) of rapidly proliferating tissues which are most sensitive to an insult such radiation, chemotherapy, or chemical warfare agent.
[0057] In some embodiments, where the composition of the invention is a nucleic acid encoding a prophylactic or therapeutic agent, the nucleic acid can be administered in vivo to promote expression of their encoded proteins (e.g., FGF-CX polypeptide), by constructing the nucleic acid as part of an appropriate nucleic acid expression vector and administering it so that it becomes intracellular, e.g., by use of a retro viral vector, or by direct injection, or by use of microparticle bombardment (e.g., a gene gun), or coating with lipids or cell-surface receptors or transfecting agents, or by administering it in linkage to a homeobox- like peptide which is known to enter the nucleus, etc. Alternatively, a nucleic acid of the invention can be introduced intracellularly and incorporated within host cell DNA for expression, by homologous recombination.
[0058] The compositions of the invention include bulk drug compositions useful in the manufacture of pharmaceutical compositions that can be used in the preparation of unit dosage forms. In a preferred embodiment, a composition of the invention is a pharmaceutical composition. Such compositions comprise a prophylactically or therapeutically effective amount of one or more compositions (e.g., FGF-CX polypeptide) of the invention, and a pharmaceutically acceptable carrier. Preferably, the pharmaceutical compositions are formulated to be suitable for the route of administration to a subject.
[0059] In one embodiment, the term "pharmaceutically acceptable" means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans. The term "carrier" refers to a diluent, adjuvant (e.g., Freund's adjuvant (complete and incomplete)), excipient, or vehicle with which the prophylactic or therapeutic agent is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils (e.g., oils of petroleum, animal, vegetable or synthetic origins, such as peanut oil, soybean oil, mineral oil, sesame oil and the like), or solid carriers, such as one or more substances which may also act as diluents, flavoring agents, solubilizers, lubricants, suspending agents, binders, tablet disintegrating agents, or encapsulating material. Water is a preferred carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical excipients include, but are not limited to, starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol, or a combination thereof. The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
[0060] The compositions of the present invention may be formulated into any of many possible dosage forms such as, but not limited to, liquid syrups, tablets, capsules, gel capsules, soft gels, pills, powders, enemas, sustained-release formulations and the like. The compositions of the present invention may also be formulated as suspensions in aqueous, non-aqueous or mixed media. Aqueous suspensions may further contain substances that increase the viscosity of the suspension including, for example, sodium carboxymethylcellulose, sorbitol and/or dextran. The suspension may also contain stabilizers. The composition can also be formulated as a suppository, with traditional binders and carriers such as triglycerides. Oral formulation can include standard carriers, such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc.
[0061] In some embodiments, the compositions of the present invention may be formulated and used as foams. Pharmaceutical foams include formulations such as, but not limited to, emulsions, microemulsions, creams, jellies and liposomes. While basically similar in nature, these formulations vary in the components and the consistency of the final product. The preparation of such compositions and formulations is generally known to those skilled in the pharmaceutical and formulation arts and may be applied to the formulation of the compositions of the present invention.
[0062] A pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration. In a specific embodiment, the composition is formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous, subcutaneous, intramuscular, oral, intranasal, intratumoral or topical administration to human beings. Typically, compositions for intravenous administration are solutions in sterile isotonic aqueous buffer. Where necessary, the composition may also include a solubilizing agent and a local anesthetic such as lidocaine to ease pain at the site of the injection. [0063] If the compositions of the invention are to be administered topically, the compositions can be formulated in the form of transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders. Conventional pharmaceutical carriers, aqueous, powder or oily bases, thickeners and the like may be necessary or desirable. Coated condoms, gloves and the like may also be useful. Preferred topical formulations include those in which the polypeptides of the invention are in admixture with a topical delivery agent, such as but not limited to, lipids, liposomes, fatty acids, fatty acid esters, steroids, chelating agents and surfactants. Preferred lipids and liposomes include, but are not limited to, neutral (e.g. dioleoylphosphatidyl DOPE ethanolamine, dimyristoyiphosphatidyl choline DMPC, distearolyphosphatidyl choline), negative (e.g. dimyristoyiphosphatidyl glycerol DMPG), and cationic (e.g. dioleoyltetramethylaminopropyl DOTAP and dioleoylphosphatidyl ethanolamine DOTMA). The polypeptides of the invention may be encapsulated within liposomes or may form complexes thereto, in particular to cationic liposomes. Alternatively, the polypeptides may be complexed to lipids, in particular to cationic lipids. Preferred fatty acids and esters include, but are not limited to, arachidonic acid, oleic acid, eicosanoic acid, lauric acid, caprylic acid, capric acid, myristic acid, palmitic acid, stearic acid, linoleic acid, linolenic acid, dicaprate, tricaprate, monoolein, dilaurin, glyceryl 1-monocaprate, l-dodecylazacycloheptan-2-one, an acylcarnitine, an acylcholine, or a Cl-10 alkyl ester (e.g. isopropylmyristate IPM), monoglyceride, diglyceride, or pharmaceutically acceptable salt thereof. For non-sprayable topical dosage forms, viscous to semi-solid or solid forms comprising a carrier or one or more excipients compatible with topical application and having a dynamic viscosity preferably greater than water are typically employed. Other suitable topical dosage forms include sprayable aerosol preparations wherein the active ingredient, preferably in combination with a solid or liquid inert carrier, is packaged in a mixture with a pressurized volatile (e.g., a gaseous propellant, such as freon) or in a squeeze bottle. Moisturizers or humectants can also be added to pharmaceutical compositions and dosage forms if desired. Examples of such additional ingredients are well- known in the art.
[0064] If the method of the invention comprises intranasal administration of a composition, the composition can be formulated in an aerosol form, spray, mist or in the form of drops. In particular, prophylactic or therapeutic agents for use according to the present invention can be conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebuliser, with the use of a suitable propellant (e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas). In the case of a pressurized aerosol the dosage unit may be determined by providing a valve to deliver a metered amount. Capsules and cartridges (composed of, e.g., gelatin) for use in an inhaler or insufflator may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.
[0065] If the method of the invention comprises oral administration, compositions can be formulated in the form of powders, granules, microparticulates, nanoparticulates, suspensions or solutions in water or non-aqueous media, capsules, gel capsules, sachets, tablets or minitablets. Thickeners, flavoring agents, diluents, emulsifiers, dispersing aids or binders may be desirable. Tablets or capsules can be prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (e.g., pregelatinised maize starch, polyvinylpyrrolidone, or hydroxypropyl methylcellulose); fillers (e.g., lactose, microcrystalline cellulose, or calcium hydrogen phosphate); lubricants (e.g., magnesium stearate, talc, or silica); disintegrants (e.g., potato starch or sodium starch glycolate); or wetting agents (e.g., sodium lauryl sulphate). The tablets may be coated by methods well- known in the art. Liquid preparations for oral administration may be prepared by conventional means with pharmaceutically acceptable additives such as suspending agents (e.g., sorbitol syrup, cellulose derivatives, or hydrogenated edible fats); emulsifying agents (e.g., lecithin or acacia); non-aqueous vehicles (e.g., almond oil, oily esters, ethyl alcohol, or fractionated vegetable oils); and preservatives (e.g., methyl or propyl-p-hydroxybenzoates or sorbic acid). The preparations may also contain buffer salts, flavoring, coloring, and sweetening agents as appropriate. Preparations for oral administration may be suitably formulated for slow release, controlled release, or sustained release of a prophylactic or, therapeutic agent(s).
[0066] In one embodiment, the compositions of the invention are orally administered in conjunction with one or more penetration enhancers, e.g., surfactants and chelators. Preferred surfactants include, but are not limited to, fatty acids and esters or salts thereof, bile acids and salts thereof. In some embodiments, combinations of penetration enhancers are used, e.g., fatty acids/salts in combination with bile acids/salts. In a specific embodiment, sodium salt of lauric acid, capric acid is used in combination with UDCA. Further penetration enhancers include, but are not limited to, polyoxyethylene-9-lauryl ether, polyoxyethylene-20-cetyl ether. Compositions of the invention may be delivered orally in granular form including, but is not limited to, sprayed dried particles, or complexed to form micro or nanoparticles. Complexing agents that can be used for complexing with the peptide of the invention (e.g., FGF-CX polypeptide) include, but are not limited to, poly-amino acids, polyimines, polyacrylates, polyalkylacrylates, polyoxethanes, polyalkylcyanoacrylates, cationized gelatins, albumins, acrylates, polyethyleneglycols (PEG), polyalkylcyanoacrylates, DEAE-derivatized polyimines, pollulans, celluloses, and starches. Particularly preferred complexing agents include, but are not limited to, chitosan, N-trimethylchitosan, poly-L- lysine, polyhistidine, polyornithine, polyspermines, protamine, polyvinylpyridine, polythiodiethylamino-methylethylene P(TDAE), polyaminostyrene (e.g. p-amino), poly(methylcyanoacrylate), poly(ethylcyanoacrylate), poly(butylcyanoacrylate), poly(isobutylcyanoacrylate), poly(isohexylcynaoacrylate), DEAE-methacrylate, DEAE- hexylacrylate, DEAE-acrylamide, DEAE-albumin and DEAE-dextran, polymethylacrylate, polyhexylacrylate, poly(D,L-lactic acid), poly(DL-lactic-co-glycolic acid (PLGA), alginate, and polyethyleneglycol (PEG).
[0067] The method of the invention may comprise pulmonary administration, e.g. , by use of an inhaler or nebulizer, of a composition formulated with an aerosolizing agent.
[0068] The method of the invention may comprise administration of a composition formulated for parenteral administration by injection (e.g., by bolus injection or continuous infusion). Formulations for injection may be presented in unit dosage form (e.g., in ampoules or in multi-dose containers) with an added preservative. The compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents. Alternatively, the active ingredient may be in powder form for constitution with a suitable vehicle (e.g., sterile pyrogen-free water) before use.
[0069] In a preferred embodiment, the composition is formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous administration to human beings. Typically, compositions for intravenous administration are solutions in sterile isotonic aqueous buffer. Where necessary, the composition may also include a solubilizing agent and a local anesthetic such as lignocaine to ease pain at the site of the injection. Generally, the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container, such as an ampoule or sachette, indicating the quantity of active agent. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration. [0070] The compositions of the invention can be formulated as neutral or salt forms.
Pharmaceutically acceptable salts include, but are not limited to, those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2- ethylamino ethanol, histidine, procaine, etc. Non-limiting examples of pharmaceutically acceptable salts are acetate, benzenesulfonate, benzoate, bicarbonate, bitartrate, bromide, calcium acetate, camsylate, carbonate, chloride, citrate, dihydrochloride, edetate, edisylate, estolate, esylate, fumarate, glucaptate, gluconate, glutamate, glycollylarsanilate, hexylresorcinate, hydrabamine, hydrobromide, hydrochloride, hydroxynaphthoate, iodide, isethionate, lactate, lactobionate, malate, maleate, mandelate mesylate, methylbromide, methylnitrate, methylsulfate, mucate, napsylate, nitrate, pamoate (embonate), pantothenate, phosphateldiphosphate, polygalacturonate, salicylate, stearate, subacetate, succinate, sulfate, tannate, tartrate, teoclate, triethiodide, benzathine, chloroprocaine, choline, diethanolamine, ethylenediamine, meglumine, procaine, aluminium, calcium, lithium, magnesium, potassium, sodium, and zinc.
[0071] In addition to the formulations described previously, the compositions may also be formulated as a depot preparation. Such long acting formulations may be administered by implantation (for example, subcutaneously or intramuscularly) or by intramuscular injection. Thus, for example, the compositions may be formulated with suitable polymeric or hydrophobic materials (for example, as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt. Liposomes and emulsions are well known examples of delivery vehicles or carriers for hydrophilic drugs.
[0072] In one embodiment, the ingredients of the compositions of the invention (e.g.,
FGF-CX) are derived from a subject that is the same species origin or species reactivity as recipient of such compositions.
[0073] The invention also provides kits for carrying out the therapeutic regimens of the invention. Such kits comprise in one or more containers prophylactically or therapeutically effective amounts of the composition of the invention (e.g., FGF-CX polypeptide) in pharmaceutically acceptable form. The composition in a vial of a kit of the invention may be in the form of a pharmaceutically acceptable solution, e.g., in combination with sterile saline, dextrose solution, or buffered solution, or other pharmaceutically acceptable sterile fluid. Alternatively, the composition may be lyophilized or desiccated; in this instance, the kit optionally' further comprises in a container a pharmaceutically acceptable solution (e.g., saline, dextrose solution, etc.), preferably sterile, to reconstitute the composition to form a solution for injection purposes.
[0074] In another embodiment, a kit of the invention further comprises a needle or syringe, preferably packaged in sterile form, for injecting the formulation, and or a packaged alcohol pad. Instructions are optionally included for administration of the formulations of the invention by a clinician or by the patient.
[0075] In some embodiments, the present invention provides kits comprising a plurality of containers each comprising a pharmaceutical formulation or composition comprising a dose of the composition of the invention (e.g., FGF-CX polypeptide) sufficient for a single administration.
[0076] As with any pharmaceutical product, the packaging material and container are designed to protect the stability of the product during storage and shipment. In one embodiment, compositions of the invention are stored in containers with biocompatible detergents, including but not limited to, lecithin, taurocholic acid, and cholesterol; or with other proteins, including but not limited to, gamma globulins and serum albumins. Further, the products of the invention include instructions for use or other informational material that advise the physician, technician, or patient on how to appropriately prevent or treat the disease or disorder in question.
[0077] The present invention is further illustrated by the following Examples.
5.1. Example 1 : Sequence Analysis
[0078] Details of the sequence relatedness and domain analysis for each FGF-CX are presented in Table 1A. The FGF-CX 1 clone was analyzed, and the nucleotide and encoded polypeptide sequences are shown in Table 1A.
Protein Sequence
MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQ LYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGΞLYGSEKLTSE CIFRΞQFEENWY TYSSNIYKHGDTGRRYFVANKDGTPRDGARSKRHQKFTHFLPRPλ/DPERVPELY KDLLMYT
FGF-CXlb, CG53135-01 SEQ ID NO: 3 633 bp DNA Sequence ORF Start: ATG at 1 ORF Stop:
ATGGCTCCCTTAGCCGAAGTCGGGGGCTTTCTGGGCGGCCTGGAGGGCTTGGGCCAGCAGGTGGGTTC GCATTTCCTGTTGCCTCCTGCCGGGGAGCGGCCGCCGCTGCTGGGCGAGCGCAGGAGCGCGGCGGAGC GGAGCGCGCGCGGCGGGCCGGGGGCTGCGCAGCTGGCGCACCTGCACGGCATCCTGCGCCGCCGGCAG CTCTATTGCCGCACCGGCTTCCACCTGCAGATCCTGCCCGACGGCAGCGTGCAGGGCACCCGGCAGGA CCACAGCCTCTTCGGTATCTTGGAATTCATCAGTGTGGCAGTGGGACTGGTCAGTATTAGAGGTGTGG ACAGTGGTCTCTATCTTGGAATGAATGACAAAGGAGAACTCTATGGATCAGAGAAACTTACTTCCGAA TGCATCTTTAGGGAGCAGTTTGAAGAGAACTGGTATAACACCTATTCATCTAACATATATAAACATGG AGACACTGGCCGCAGGTATTTTGTGGCACTTAACAAAGACGGAACTCCAAGAGATGGCGCCAGGTCCA AGAGGCATCAGAAATTTACACATTTCTTACCTAGACCAGTGGATCCAGAAAGAGTTCCAGAATTGTAC AAGGACCTACTGATGTACACT
|FGF-CXlb, CG53135-01 SEQ ED NO: 4 211 aa MW at 23498.4kD Protein Sequence
MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGΞRRSAAERSARGGPGAAQLAHLHGILRRRQ LYCRTGFHLQI PDGSVQGTRQDHS FGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEK TSE; CIFREQFEENWYNTYSSNIYKHGDTGRRYFVANKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELY: KDLLMYT
FGF-CXlc, CG53135-04 SEQ JD NO: 5 540 bp DNA Sequence ORF Start: ATG at 1 ORF Stop: end of sequence
ATGGCTCCCTTAGCCGAAGTCGGGGGCTTTCTGGGCGGCCTGGAGGGCTTGGGCCAGCCGGGGGCAGC GCAGCTGGCGCACCTGCACGGCATCCTGCGCCGCCGGCAGCTCTATTGCCGCACCGGCTTCCACCTGC AGATCCTGCCCGACGGCAGCGCGCAGGGCACCCGGCAGGACCACAGCCTCTTCGGTATCTTGGAATTC ATCAGTGTGGCAGTGGGACTGGTCAGTATTAGAGGTGTGGACAGTGGTCTCTATCTTGGAATGAATGA CAAAGGAGAACTCTATGGATCAGAGAAACTTACTTCCGAATGCATCTTTAGGGAGCAGTTTGAAGAGA ACTGGTATAACACCTATTCATCTAACATATATAAACATGGAGACACTGGCCGCAGGTATTTTGTGGCA CTTAACAAAGACGGAACTCCAAGAGATGGCGCCAGGTCCAAGAGGCATCAGAAATTTACACATTTCTT ACCTAGACCAGTGGATCCAGAAAGAGTTCCAGAATTGTACAAGGACCTACTGATGTACACTTAG
FGF-CXlc, CG53135-04 SEQ ID NO: 6 179 aa MW at 20118.6kD Protein Sequence
MAPLAEVGGFLGGLEGLGQPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSAQGTRQDHSLFGILEF ISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEEN Y TYSSNIYKHGDTGRRYFVA LNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT
FGF-CXld, 250059596 !SEQ ID NO: 7 556 bp DNA Sequence IORF Start: ORF Stop:
CACCAGATCTATGGCTCCCTTAGCCGAAGTCGGGGGCTTTCTGGGCGGCCTGGAGGGCTTGGGCCAGC CGGGGGCAGCGCAGCTGGCGCACCTGCACGGCATCCTGCGCCGCCGGCAGCTCTATTGCCGCACCGGC TTCCACCTGCAGATCCTGCCCGACGGCAGCGTGCAGGGCACCCGGCAGGACCACAGCCTCTTCGGTAT CTTGGAATTCATCAGTGTGGCAGTGGGACTGGTCAGTATTAGAGGTGTGGACAGTGGTCTCTATCTTG GAATGAATGACAAAGGAGAACTCTATGGATCAGAGAAACTTACTTCCGAATGCATCTTTAGGGAGCAG TTTGAAGAGAACTGGTATAACACCTATTCATCTAACATATATAAACATGGAGACACTGGCCGCAGGTA TTTTGTGGCACTTAACAAAGACGGAACTCCAAGAGATGGCGCCAGGTCCAAGAGGCATCAGAAATTTA CACATTTCTTACCTAGACCAGTGGATCCAGAAAGAGTTCCAGAATTGTACAAGGACCTACTGATGTAC ACTGTCGACGGC
FGF-CXld, 250059596 SEQ ID NO: 8 185 aa MW at 20762.3kD Protein Sequence
TRSMAPLAEVGGFLGGLEGLGQPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGI LEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEE YNTYSSNIYKHGDTGRRY FVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPΞLYKDLLMYTVDG
FGF-CXle, 250059629 SEQ ID NO: 9 415 bp DNA Sequence ORF Start: ORF Stop:
CACCAGATCTATCCTGCGCCGCCGGCAGCTCTATTGCCGCACCGGCTTCCACCTGCAGATCCTGCCCG ACGGCAGCGTGCAGGGCACCCGGCAGGACCACAGCCTCTTCGGTATCTTGGAATTCATCAGTGTGGCAl GTGGGACTGGTCAGTATTAGAGGTGTGGACAGTGGTCTCTATCTTGGAATGAATGACAAAGGAGAACT CTATGGATCAGAGAAACTTACTTCCGAATGCATCTTTAGGGAGCAGTTTGAAGAGAACTGGTATAACA CCTATTCATCTAACATATATAAACATGGAGACACTGGCCGCAGGTATTTTGTGGCACTTAACAAAGAC GGAACTCCAAGAGATGGCGCCAGGTCCAAGAGGCATCAGAAATTTACACATTTCTTACCTAGACCAGT CGACGGC
FGF-CXle, 250059629 SEQ JJD NO: 10 138 aa !MW at 15847.7kD Protein Sequence
TRSILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGΞL YGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPV DG
FGF-CXlf, 250059669 SEQ ID NO: 11 466 bp DNA Sequence ORF Start: ORF Stop:
CACCAGATCTATCCTGCGCCGCCGGCAGCTCTATTGCCGCACCGGCTTCCACCTGCAGATCCTGCCCG ACGGCAGCGTGCAGGGCACCCGGCAGGACCACAGCCTCTTCGGTATCTTGGAATTCATCAGTGTGGCA GTGGGACTGGTCAGTATTAGAGGTGTGGACAGTGGTCTCTATCTTGGAATGAATGACAAAGGAGAACT CTATGGATCAGAGAAACTTACTTCCGAATGCATCTTTAGGGAGCAGTTTGAAGAGAACTGGTATAACA CCTATTCATCTAACATATATAAACATGGAGACACTGGCCGCAGGTATTTTGTGGCACTTAACAAAGAC GGAACTCCAAGAGATGGCGCCAGGTCCAAGAGGCATCAGAAATTTACACATTTCTTACCTAGACCAGT GGATCCAGAAAGAGTTCCAGAATTGTACAAGGACCTACTGATGTACACTGTCGACGGC
FGF-CXlf, 250059669 SEQ ID NO: 12 155 aa MW at l7911.1kD Protein Sequence
TRSILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVBSGLYLGMNDKGEL YGSEKLTSECIFREQFEENWY TYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPV DPERVPELYKDLLMYTVDG
FGF-CXlg, 316351224 SEQ ID NO: 13 549 bp DNA Sequence ORF Start: ORF Stop:
AGATCTATGGCTCCCTTAGCCGAAGTCGGGGGCTTTCTGGGCGGCCTGGAGGGCTTGGGCCAGCCGGG GGCAGCGCAGCTGGCGCACCTGCACGGCATCCTGCGCCGCCGGCAGCTCTATTGCCGCACCGGCTTCC ACCTGCAGATCCTGCCCGACGGCAGCGTGCAGGGCACCCGGCAGGACCACAGCCTCTTCGGTATCTTG GAATTCATCAGTGTGGCAGTGGGACTGGTCAGTATTAGAGGTGTGGACAGTGGTCTCTATCTTGGAAT GAATGACAAAGGAGAACTCTATGGATCAGAGAAACTTACTTCCGAATGCATCTTTAGGGAGCAGTTTG AAGAGAACTGGTATAACACCTATTCATCTAACATATATAAACATGGAGACACTGGCCGCAGGTATTTT GTGGCACTTAACAAAGACGGAACTCCAAGAGATGGCGCCAGGTCCAAGAGGCATCAGAAATTTACACA TTTCTTACCTAGACCAGTGGATCCAGAAAGAGTTCCAGAATTGTACAAGGACCTACTGATGTACACTC TCGAG
FGF-CXlg, 316351224 SEQ JO NO: 14 183 aa MW at 20632.2kD Protein Sequence
RSMAPLAEVGGFLGGLEGLGQPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGIL ΞFISVAVGLVSIRGVDSGLYLGM DKGELYGSEKLTSECIFREQFEEN YNTYSSNIYKHGDTGRRYF VALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYTLE
FGF-CXlh, 317459553 SEQ ID NO: 15 408 bp DNA Sequence ORF Start: ORF Stop:
AGATCTATCCTGCGCCGCCGGCAGCTCTATTGCCGCACCGGCTTCCACCTGCAGATCCTGCCCGACGG CAGCGTGCAGGGCACCCGGCAGGACCACAGCCTCTTCGGTATCTTGGAATTCATCAGTGTGGCAGTGG GACTGGTCAGTATTAGAGGTGTGGACAGTGGTCTCTATCTTGGAATGAATGACAAAGGAGAACTCTAT GGATCAGAGAAACTTACTTCCGAATGCATCTTTAGGGAGCAGTTTGAAGAGAACTGGTATAACACCTA TTCATCTAACATATATAAACATGAAGACACTGGCCGCAGGTATTTTGTGGCACTTAACAAAGACGGAA CTCCAAGAGATGGCGCCAGGTCCAAGAGGCATCAGAAATTTACACATTTCTTACCTAGACCACTCGAG
FGF-CXlh, 317459553 SEQ ID NO: 16 !l36 aa MW at 15789.6kD Protein Sequence
RSILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELY GSEKLTSECIFREQFEENWY TYSSNIYKHEDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPLE iFGF-CXli, 317459571 SEQ ID NO: 17 408 bp DNA Sequence ORF Start: 1 ORF Stop:
AGATCTATCCTGCGCCGCCGGCAGCTCTATTGCCGCACCGGCTTCCACCTGCAGATCCTGCCCGACGG CAGCGTGCAGGGCACCCGGCAGGACCACAGCCTCTTCGGTATCTTGGAATTCATCAGTGTGGCAGTGG GACTGGTCAGTATTAGAGGTGTGGACAGTGGTCTCTATCTTGGAATGAATGACAAAGGAGAACTCTAT GGATCAGAGAAACTTACTTCCGAATGCATCTTTAGGGAGCAGTTTGAAGAGAACTGGTATAACACCTA TTCATCTAACATATATAAACATGGAGACACTGGCCGCAGGTATTTTGTGGCACTTAACAAAGACGGAA CTCCAAGAGATGGCGCCAGGTCCAAGAGGCATCAGAAATTTACACATTTCTTACCTAGACCACTCGAG
FGF-CXli, 317459571 SEQ ID NO: 18 136 aa MW at l5717.6kD Protein Sequence
RSILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELY GSEKLTSECIFREQFΞENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPLE
FGF-CXlj, CG53135-02 SEQ ID NO: 19 477 bp DNA Sequence IORF Start: ATG at 1 ORF Stop: end of sequence
ATGGCTCAGCTGGCTCACCTGCATGGTATCCTGCGTCGCCGTCAGCTGTACTGCCGTACTGGTTTCCA CCTGCAGATCCTGCCGGATGGTTCTGTTCAGGGTACCCGTCAGGACCACTCTCTGTTCGGTATCCTGG AATTCATCTCTGTTGCTGTTGGTCTGGTTTCTATCCGTGGTGTTGACTCTGGCCTGTACCTGGGTATG AACGACAAAGGCGAACTGTACGGTTCTGAAAAACTGACCTCTGAATGCATCTTCCGTGAACAGTTTGA AGAGAACTGGTACAACACCTACTCTTCCAACATCTACAAACATGGTGACACCGGCCGTCGCTACTTCG TTGCTCTGAACAAAGACGGTACCCCGCGTGATGGTGCTCGTTCTAAACGTCACCAGAAATTCACCCAC TTCCTGCCGCGCCCAGTTGACCCGGAGCGTGTTCCAGAACTGTATAAAGACCTGCTGATGTACACCTA
FGF-CXlj, CG53135-02 iSEQ ID NO: 20 158 aa MW at l8254.6kD Protein Sequence iMAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGM NDKGELYGSEKLT SEC I FRΞQFEENWY TYS SNI YKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTH FLPRPVDPERVPΞLYKDLLMYT
FGF-CXlk, CG53135-03 SEQ JD NO: 21 636 bp DNA Sequence ORF Start: ATG at 1 ORF Stop: end of sequence
ATGGCTCCCTTAGCCGAAGTCGGGGGCTTTCTGGGCGGCCTGGAGGGCTTGGGCCAGCAGGTGGGTTC GCATTTCCTGTTGCCTCCTGCCGGGGAGCGGCCGCCGCTGCTGGGCGAGCGCAGGAGCGCGGCGGAGC GGAGCGCGCGCGGCGGGCCGGGGGCTGCGCAGCTGGCGCACCTGCACGGCATCCTGCGCCGCCGGCAG CTCTATTGCCGCACCGGCTTCCACCTGCAGATCCTGCCCGACGGCAGCGTGCAGGGCACCCGGCAGGA CCACAGCCTCTTCGGTATCTTGGAATTCATCAGTGTGGCAGTGGGACTGGTCAGTATTAGAGGTGTGG ACAGTGGTCTCTATCTTGGAATGAATGACAAAGGAGAACTCTATGGATCAGAGAAACTTACTTCCGAA TGCATCTTTAGGGAGCAGTTTGAAGAGAACTGGTATAACACCTATTCATCTAACATATATAAACATGG AGACACTGGCCGCAGGTATTTTGTGGCACTTAACAAAGACGGAACTCCAAGAGATGGCGCCAGGTCCA AGAGGCATCAGAAATTTACACATTTCTTACCTAGACCAGTGGATCCAGAAAGAGTTCCAGAATTGTAC AAGGACCTACTGATGTACACTTGA
FGF-CXlk, CG53135-03 SEQ ID NO: 22 211 aa MW at 23498.4kD Protein Sequence
MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGΞRPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQ LYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGΞLYGSEKLTSE CIFREQFΞENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELY KDLLMYT
FGF-CX11, CG53135-06 SEQ JD NO: 23 540 bp DNA Sequence ORF Start: ATG at 1 ORF Stop: end of sequence
ATGGCTCCCTTAGCCGAAGTCGGGGGCTTTCTGGGCGGCCTGGAGGGCTTGGGCCAGCCGGGGGCAGC GCAGCTGGCGCACCTGCACGGCATCCTGCGCCGCCGGCAGCTCTATTGCCGCACCGGCTTCCACCTGC AGATCCTGCCCGACGGCAGCGTGCAGGGCACCCGGCAGGACCACAGCCTCTTCGGTATCTTGGAATTC ATCAGTGTGGGAGTGGGACTGGTCAGTATTAGAGGTGTGGACAGTGGTCTCTATCTTGGAATGAATGA CAAAGGAGAACTCTATGGATCAGAGAAACTTACTTCCGAATGCATCTTTAGGGAGCAGTTTGAAGAGA ACTGGTATAACACCTATTCATCTAACATATATAAACATGGAGACACTGGCCGCAGGTATTTTGTGGCA CTTAACAAAGACGGAACTCCAAGAGATGGCGCCAGGTCCAAGAGGCATCAGAAATTTACACATTTCTT ACCTAGACCAGTGGATCCAGAAAGAGTTCCAGAATTGTACAAGGACCTACTGATGTACACTTAG
FGF-CX11, CG53135-06 ISEQ ID NO: 24 179 aa !MW at 20146.7kD Protein Sequence
MAPLAΞVGGFLGGLEGLGQPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEF ISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEE WY TYSSNIYKHGDTGRRYFVA LNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPΞLYKDLLMYT
FGF-CXlm, CG53135-07 SEQ JD NO: 25 54 bp DNA Sequence ORF Start: ATG at 1 |ORF Stop iATGGCTCCCTTAGCCGAAGTCGGGGGCTTTCTGGGCGGCCTGGAGGGCTTGGGC
FGF-CXlm, CG53135-07 SEQ JD NO: 26 18 aa MW t l688.0kD Protein Sequence
IMAPLAEVGGFLGGLEGLG
FGF-CXln, CG53135-08 SEQ JD NO: 27 63 bp DNA Sequence ORF Start: ORF Stop:
GAGCGGCCGCCGCTGCTGGGCGAGCGCAGGAGCGCGGCGGAGCGGAGCGCGCGCGGCGGGCCG
FGF-CXln, CG53135-08 SEQ JD NO: 28 21 aa MW at 2262.5kD! Protein Sequence
ERPPLLGERRSAAERSARGGP
FGF-CXlo, CG53135-09 3SEQ ID NO: 29 63 bp DNA Sequence ORF Start: ORF Stop:
CGCAGGTATTTTGTGGCACTTAACAAAGACGGAACTCCAAGAGATGGCGCCAGGTCCAAGAGG!
FGF-CXlo, CG53135-09 SEQ JD NO: 30 21 aa MW at 2463.8kD Protein Sequence
RRYFVALNKDGTPRDGARSKR
FGF-CXlp, CG53135-10 SEQ JD NO: 31 60 bp DNA Sequence ORF Start: ORF Stop:
CCTAGACCAGTGGATCCAGAAAGAGTTCCAGAATTGTACAAGGACCTACTGATGTACACT
FGF-CXlp, CG53135-10 SEQ JD NO: 32 20 aa MW at 2431.8kD Protein Sequence
PRPVDPERVPELYKDLLMYT
FGF-CXlq, CG53135-11 SEQ JD NO: 33 51 bp DNA Sequence ORF Start: ATG at 1 ORF Stop:
ATGAACGACAAGGGCGAGCTGTACGGCAGCGAGAAGCTGACCAGCGAGTGC
FGF-CXlq, CG53135-11 SEQ JD NO: 34 17 aa MW at l904.1kD Protein Sequence
MNDKGELYGSEKLTSEC
FGF-CXlr, CG53135-12 SEQ JD NO: 35 633 bp DNA Sequence ORF Start: ATG at 1 ORF Stop:
ATGGCTCCCTTAGCCGAAGTCGGGGGCTTTCTGGGCGGCCTGGAGGGCTTGGGCCAGCAGGTGGGTTC GCATTTCCTGTTGCCTCCTGCCGGGGAGCGGCCGCCGCTGCTGGGCGAGCGCAGGAGCGCGGCGGAGC GGAGCGCGCGCGGCGGGCCGGGGGCTGCGCAGCTGGCGCACCTGCACGGCATCCTGCGCCGCCGGCAG CTCTATTGCCGCACCGGCTTCCACCTGCAGATCCTGCCCGACGGCAGCGTGCAGGGCACCCGGCAGGA CCACAGCCTCTTCGGTATCTTGGAATTCATCAGTGTGGCAGTGGGACTGGTCAGTATTAGAGGTGTGG ACAGTGGTCTCTATCTTGGAATGAATGACAAAGGAGAACTCTATGGATCAGAGAAACTTACTTCCGAA TGCATCTTTAGGGAGCAGTTTGAAGAGAACTGGTATAACACCTATTCATCTAACATATATAAACATGG AGACACTGGCCGCAGGTATTTTGTGGCACTTAACAAAGACGGAACTCCAAGAGATGGCGCCAGGTCCA AGAGGCATCAGAAATTTACACATTTCTTACCTAGACCAGTGGATCCAGAAAGAGTTCCAGAATTGTAC AAGAACCTACTGATGTACACT
FGF-CXlr, CG53135-12 SEQ JD NO: 36 211 aa MW at 23497.4kD Protein Sequence
MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGΞRRSAAERSARGGPGAAQLAHLHGILRRRQ LYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSE CIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELY KNLLMYT
[0079] A ClustalW comparison of the above protein sequences yields the following sequence alignment shown in Table IB. Table IB. Comparison of the FGF-CX1 protein sequences.
FGF -CXIa MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHL FGF -CXlb MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHL FGF -CXlc FGF -CXld FGF -CXle FGF -CXlf -TRSILRRRQLYCRTGFHLQILPDGSVQGT FGF -CXlg FGF -CXlh FGF -CXli FGF -CXlj MAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGT FGF -CXl MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAΞRSARGGPGAAQLAHL FGF -CX11 MAPLAEVGGFLGGLEGLGQPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGT FGF -CXlm FGF -CXln FGF -CXlo FGF -CXlp FGF -CXlq FGF -CXlr MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHL
FGF -CXIa HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG FGF -CXlb HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILΞFISVAVGLVSIRGVDSGLYLG FGF -CXlc FGF -CXld FGF -CXle RSILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG FGF -CXlf RQDHSLFGILEFISVAVGLVSIRGVDSGLYLGM DKGELYGSEKLTSECIFREQFEEN Y FGF -CXlg FGF -CXl RSILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG FGF -CXli RSILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG FGF -CXlj RQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFRΞQFΞENWY FGF -CXlk HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILΞFISVAVGLVSIRGVDSGLYLG FGF -CXli RQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMKDKGELYGSΞKLTSECIFREQFEENWY FGF -CXlm FGF -CXln FGF -CXlo FGF -CXlp FGF -CXlg FGF -CXlr HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
FGF -CXla MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR FGF -CXlb MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR FGF -CXlc MAPLAEVGGFLGGLΞ FGF -CXld TRSMAPLAΞVGGFLGGLE FGF -CXle MNDKGELYGSEKLTSECIFREQFEΞNWY TYSSNIYKHGDTGRRYFVALNKDGTPRDGAR FGF -CXlf NTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLL FGF -CXlg RSMAPLAEVGGFLGGLE FGF -CXlh M DKGELYGSEKLTSECIFREQFEEN YNTYSSNIYKHEDTGRRYFVALNKDGTPRDGAR FGF -CXli MNDKGELYGSEKLTSECIFREQFEE YNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR FGF -CXlj NTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPΞLYKDLL FGF -CXlk MNDKGELYGSΞKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR FGF -CXli NTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPΞRVPELYKDLL FGF -CXlm MAPLAΞVGGFLGGLE FGF -CXln ERPPLLGERRSAAERSAR FGF -CXlo RRYFVALNKDGTPRDGAR FGF -CXlp PRPVDPΞRVPELYKDLL FGF -CXlq M DKGELYGSEK FGF -CXlr MNDKGELYGSEKLTSECIFREQFEEWWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR
FGF-CXla SKRHQKFTHFLPRPVDPERVPELYKDLLMYT FGF-CXlb SKRHQKFTHFLPRPVDPΞRVPELYKDLLMYT FGF-CXlc GLGQPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSAQGTRQDHSLFGILEFISVAVGL FGF-CXld GLGQPGAA LAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGL
FGF-CXle SKRHQKFTHFLPRPVDG
FGF-CXlf MYTVDG
FGF-CXlg GLGQPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGL
FGF-CXlh SKRHQKFTHFLPRPLΞ
FGF-CXli SKRHQKFTHFLPRPLE
FGF-CXlj MYT
FGF-CXlk SKRHQKFTHFLPRPVDPERVPELYKDLLMYT
FGF-CX11 MYT
FGF-CXlm GLG
FGF-CXln GGP
FGF-CXlo SKR
FGF-CXlp MYT
FGF-CXlq LTSEC
FGF-CXlr SKRHQKFTHFLPRPVDPΞRVPELYKNLLMYT
FGF-CXla
FGF-CXlb
FGF-CXlc VSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFV
FGF-CXld VSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWY TYSSNIYKHGDTGRRYFV
FGF-CXle
FGF-CXlf
FGF-CXlg VSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFV
FGF-CXlh
FGF-CXli
FGF-CXlj
FGF-CXlk
FGF-CXli
FGF-CXlm
FGF-CXln
FGF-CXlo
FGF-CXlp
FGF-CXlq
FGF-CXlr
FGF-CXla
FGF-CXlb
FGF-CXlc ALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT
FGF-CXld ALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYTVDG
FGF-CXle
FGF-CXlf
FGF-CXlg ALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYTLΞ-
FGF-CXlh
FGF-CXli
FGF-CXlj
FGF-CXlk
FGF-CXli
FGF-CXlm ■
FGF-CXln
FGF-CXlo
FGF-CXlp
FGF-CXlq
FGF-CXlr
FGF-CXla (SEQ ID NO 2)
FGF-CXlb (SEQ ID NO 4)
FGF-CXlc (SEQ ID NO 6)
FGF-CXld (SEQ ID NO 8)
FGF-CXle (SEQ ID NO 10)
FGF-CXlf (SEQ ID NO 12)
FGF-CXlg (SEQ ID NO 14)
FGF-CXlh (SEQ ID NO 16) FGF-CXli (SEQ ID NO 18)
FGF-CXlj (SEQ ID NO 20)
FGF-CXlk (SEQ ID NO 22)
FGF-CXli (SEQ ID NO 24)
FGF-CXlm (SEQ ID NO 26)
FGF-CXln (SEQ ID NO 28)
FGF-CXlo (SEQ ID NO 30)
FGF-CXlp (SEQ ID NO 32)
FGF-CXlq (SEQ ID NO 34)
FGF-CXlr (SEQ ID NO 36)
[0080] Further analysis of the FGF-CXla protein yielded the following properties shown in Table IC.
Table IC. Protein Sequence Properties FGF-CXla
SignalP analysis: No Known Signal Sequence Predicted
PSORT π analysis:
PSG: a new signal peptide prediction method
N-region: length 6; pos.chg 0; neg.chg 1 H-region: length 8; peak value 0.00 PSG score: -4.40
GvH: von Heijne's method for signal seq. recognition GvH score (threshold: -2.1): -5.49 possible cleavage site: between 16 and 17
>» Seems to have no N-terminal signal peptide
ALOM: Klein et al ' s method for TM region allocation Init position for calculation: 1
Tentative number of TMS(s) for the threshold 0.5: 1 Number of TMS(s) for threshold 0.5: 1
INTEGRAL Likelihood = -6.42 Transmembrane 94 - 110 PERIPHERAL Likelihood = 5.20 (at 1) ALOM score: -6.42 (number of TMSs : 1)
MTOP: Prediction of membrane topology (Hartmann et al . ) Center position for calculation: 101 Charge difference: 0.5 C( 0.0) - N(-0.5) C > N: C-terminal side will be inside
>» membrane topology: type lb (cytoplasmic tail 94 to 211)
MITDISC: discrimination of mitochondrial targeting seq R content: 0 Hyd Moment (75) : 3.24 Hyd Moment (95): 6.56 G content: 4 D/E content: 2 S/T content: 0 Score: -9.30
Gavel: prediction of cleavage sites for mitochondrial preseq cleavage site motif not found
NUCDISC: discrimination of nuclear localization signals pat4 : none pat7 : none bipartite: none content of basic residues: 12.3% NLS Score: -0.47 KDEL: ER retention motif in the C-terminus: none
ER Membrane Retention Signals: none
SKL: peroxisomal targeting signal in the C-terminus: none
PTS2 : 2nd peroxisomal targeting signal : none
VAC: possible vacuolar targeting motif: none
RNA-binding motif: none
Actinin-type actin-binding motif: type 1 : none type 2 : none
NMYR: N-myristoylation pattern : none
Prenylation motif: none memYQRL: transport motif from cell surface to Golgi: none
Tyrosines in the tail: too long tail
Dileucine motif in the tail: found LL at 207 checking 63 PROSITE DNA binding motifs: none checking 71 PROSITE ribosomal protein motifs: none checking 33 PROSITE prokaryotic DNA binding motifs: none
NNCN: Reinhardt's method for Cytoplasmic/Nuclear discrimination Prediction: cytoplasmic Reliability: 89
COIL: Lupas's algorithm to detect coiled-coil regions total : 0 residues
Final Results (k = 9/23):
34.8 %: nuclear
21.7 %: mitochondrial
21.7 %: cytoplasmic
8.7 %: vesicles of secretory system
4.3 % : vacuolar
4.3 %: peroxisomal
4.3 %: endoplasmic reticulum
» prediction for CG53135-05 is nuc (k=23)
[0081] A search of the FGF-CX1 a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publication, yielded several homologous proteins shown in Table ID.
[0082] In a BLAST search of public sequence databases, the FGF-CXla protein was found to have homology to the proteins shown in the BLASTP data in Table IE.
[0083] PFam analysis predicts that the FGF-CX1 a protein contains the domains shown in the Table IF.
5.2. Example 2: Proteolvtic Cleavage Products of CG53135-05 CFGF-20^
[0084] Liquid Chromatography, Mass spectrometry and N-terminal sequencing of
CG53135-05 resulted in variants that have high activity in the proliferation assays. Thus these variants detailed in this section are expected to have same utility as that of CG53135- 05.
Liquid Chromatography (LC) and Mass Spectrometry (MS) analysis of CG53135-05
[0085] Purified CG53135-05 was injected onto a phenyl-hexyl column (Luna 5 mm,
250 mm X 3 mm, Phenomenex) using a standard HPLC system (Agilent 1100, Agilent) in a mobile phase containing acetonitrile, water and trifluoroacetic acid. The resulting analysis revealed detectable levels of micro-heterogeneity, showing 1 major peak (#3) and 3 minor peaks (#1, 2, 4, and 5) related to CG53135-05 (Figure 1). In order to characterize these species, fractions were collected using an automated fraction-collector (Agilent 1100) and the fractions characterized by liquid chromatography electrospray ionization ion trap mass spectrometry (LC/ESI/MS), matrix-assisted laser desorption ionization time of flight mass spectrometry (MALDI-TOF-MS), and N-terminal amino acid sequencing.
[0086] Peak 0 is not a protein, is not product-related, and is not a residual process impurity (i.e., it is not DNA, endotoxin, kanamycin, or IPTG). The CG53135-05-related species (Peaks 1, 2, 3, and 4) eluted in mobile phase of 36% acetonitrile, 63% water, and 0.1% trifluoroacetic acid. Similar fractions were then pooled and the samples concentrated using an Amicon 10,000 dalton cut-off filter (Millipore, Bedford, MA) in a 4°C centrifuge. The samples were diluted 16-fold in 200 mM arginine, 40 mM sodium acetate, and 3% glycerol and then concentrated to a volume of approximately 500 μl. The concentration of the pooled fractions was determined using amino acid analysis.
[0087] All four CG53135-05-related species (Peaks 1 , 2, 3 , and 4) were proteolytically digested using trypsin and the peptides analyzed using liquid chromatography with mass spectrometry detection. Mass Spectrometry was performed using a XP DECA nanospray/ion trap instrument (ThermoFinnigan, San Jose, CA) interfaced with an Ultimate Nanoflow Chromatography System (LC Packings, Amsterdam, Netherlands). Data were collected via Xcalibur Software (Thermofinngan) using automated MS to MS/MS switching. In the Instrument Method files, the XP DECA was set to acquire a full MS scan between 400 and 1400 m/z followed by full MS/MS scans between 400 and 2000 m/z of the top 3 ions from the preceding MS scan. Data were processed using TurboSequest (Thermofinngan). Database searching and protein identification was performed using MASCOT (Matrix Sciences, Manchester, UK). MASCOT reports a probability-based MOWSE score and percent coverage for the identified protein based on molecular mass of the peptides, MS/MS sequence information, mass accuracy, and number of peptides detected. Table 2 contains the peak number for the CG53135-05-related species, confidence score provide by MASCOT, and percent coverage obtained from MS/MS spectra.
Table 2: Characterization of CG53135-05 (DEV10) by MASCOT
NA = data not available
[0088] The fractions collected were analyzed by MALDI-TOF and N-terminal sequencing to determine the identity of CG53135-05-related species. N-terminal amino acid sequence of purified CG53135-05 was determined qualitatively. CG53135-05 protein was resolved by SDS-PAGE and electrophoretically transferred to a polyvinylidenefluoride membrane; the Coomassie-stained ~23 kDa major band was excised from the membrane and analyzed by an automated Edman sequencer (Procise, Applied Biosystems, Foster City, CA). Table 3 presents the molecular weight obtained for each species and variant determined by N- terminus sequencing (where N = full-length CG53135): Table 3: Characterization of CG53135-05 (DEV10) by MALDI-TOF and Sequence Analysis
NA =. data not available, not a protein, not product-related
[0089] The molecular weight determined by MALDI-TOF and N-terminus sequencing can identify the 4 species. For peak 1, 4 different species were detected via N- terminal sequencing, 2 of which were also detected by MALDI-TOF. These results are also in agreement with the coverage obtained using LC/MS. The polypeptide sequences of each species derived by N-terminal sequencing are given in Table 4.
Table 4: Polypeptide Sequences of the proteol tic cleavage products
N-8:
GFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLλHL
HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
Ml^KGELYGSEKLTSECIFREQFEENWWTYSSMYKHGDTGRRYFVALNKDGTPRDGAR
SKRHQKFTHFLPRPVDPERVPELYKDLLMYT (SEQ JD NO: 37)
N-ll:
GGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHL
HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEHSVAVGLVSIRGVDSGLYLG
MN KGELYGSEKLTSECIFREQFEENWΥNTYSSMYKHGDTGRRYFVALN DGTPRDGAR
SKRHQKFTHFLPRPVDPERVPELYKDLLMYT (SEQ ID NO: 38)
N-14:
EGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHL
HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
MNDKGELYGSEKLTSECIFREQIΕEN YNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR
SKRHQKFTHFLPRPVDPERVPELYKDLLMYT (SEQ JD NO: 39)
N-23:
HFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHL
HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEHSVAVGLVSIRGVDSGLYLG
MNDKGELYGSEKLTSECIEREQFEENWYNTYSSNIY HGDTGRRYFVALNKDGTPRDGAR
SKRHQKFTHFLPRPVDPERVPELYKDLLMYT (SEQ ID NO: 40) Table 5: Clustal analysis of CG53135-05 (SEQ ID NO: 2) versus the novel proteolytic cleavage products
Multiple Alignment:
CG53135-05 181 aaaim:«a»:ιa»aaatioaaa!iaa» Mn» a>'liιι 211
N-ll 170 200
N-14 167 197
N-8 173 203
N-23 158 bM tø U MM iiύ M ύlMtΛΛmm 188
Total Amino Acid Analysis
[0090] The amino acid composition of CG53135-05 was determined. Samples of
CG53135-05 were hydrolyzed for 16 h at 115°C in 100 mL of 6 N HC1, 0.2% phenol containing 2 nmol norleucine as an internal standard. Samples were dried in a Speed Vac Concentrator and dissolved in 100 mL sample buffer containing 2 nmol homoserine as an internal standard. The amino acids in each sample were separated on a Beckman Model 7300 ion-exchange instrument. The amino acid composition of CG53135-05 was consistent with the theoretical amino acid composition.
[0091] The experimental amino acid composition was used to derive the extinction coeffeicient used in estimation of concentration via UV absorbance (protein estimation using the Bradford method). The extinction coefficient at λ ax is 0.97 mL/mg-cm. Table 6: Amino Acid Analysis of CG53135-05 (DEV10)
A Not determined because of excess arg in the formulation;
Not determined because cys is destroyed in the acid hydrolysis during analysis;
Not determined because trp is destroyed in the acid hydrolysis during analysi; D During acid hydrolysis asn will be converted to asp and gin to glu acid. Therefore, asx represents the sum of asn and asp while glx represents the sum of gin and glu.
Peptide Mapping
[0092] Purified CG53135-05 (25 mg) was denatured and reduced in urea and dithiothreitol at 50°C and then alkylated with iodoacetate. After lowering the concentration of urea, the samples were treated with trypsin for 40 h at 20°C. The resulting peptide fragments were separated by RP-HPLC (using a C-18 column with an acetonitrile gradient in trifluoroacetate) to obtain a peptide map (Figure 2A and 2B). The chromatogram in Figure 2A is consistent with the 20 peptides expected from the digestion of CG53135-05 with trypsin, and the chromatogram in Figure 2B reveals a single peak as expected for the single tryptophan residue in CG53135-05.
Bioassay
[0093] The biological activity of CG53135-05 related species collected from the 4 peaks identified by LC and MS was measured by treatment of serum-starved cultured NIH 3T3 murine embryonic fibroblast cells with various doses of the isolated CG53135-05 related species and measurement of incorporation of bromodeoxyuridine (BrdU) during DNA synthesis. For this assay, cells were cultured in Dulbecco' s modified Eagle's medium supplemented with 10% fetal bovine serum. Cells were grown in 96- well plates to confluence at 37°C in 10% CO2/air and then starved in Dulbecco's modified Eagle's medium for 24 - 72 h. CG53135-05-related species were added and incubated for 18 h at 37°C in 10% CO2/air. BrdU (10 mM final concentration) was added and incubated with the cells for 2 h 37°C in 10% CO /air. Incorporation of BrdU was measured by enzyme-linked immunosorbent assay according to the manufacturer's specifications (Roche Molecular Biochemicals, Indianapolis, IN).
[0094] Peak 4 was not included in this assay since insufficient material was collected
(Peak 4 is less than 3% of the total peak area for CG53135-05). CG53135-05 and material collected from all 3 remaining fractions (i.e., Peak 1, 2, and 3) induced DNA synthesis in NJΗ 3T3 mouse fibroblasts in a dose-dependent manner (Table 7). The PI20o was defined as the concentration of protein that resulted in incorporation of BrdU at 2 times the background. CG53135-05 and CG53135-05 related species recovered from all 3 measurable peaks demonstrated similar biological activity with a PI 00 of 0.7 - 11 ng/mL (Table 9).
Table 7: Biological Activity of CG53135-05 (DEV10): Induction of DNA Synthesis
5.3. Example 3: Receptor Binding Specificity of CG53135 fStudv L-l 16.01)
[0095] FGF family members transduce signals intracellularly via high affinity interactions with cell surface immunoglobulin (Ig) domain-containing tyrosine kinase FGF receptors (FGFRs). Four distinct human genes encode FGFRs (Powers et ah, Endocr Relat Cancer 2000, 7:165-97; Klint and Claesson-Welsh, Front Biosci 1999, 4:D165-77; Xu et ah, Cell Tissue Res 1999, 296:33-43). A related fifth human sequence lacking a kinase domain has recently been identified and named FGFR-5 (Kim et ah, Biochim Biophys Acta 2001, 1518:152-6). These receptors can each bind several different members of this family (Kim et ah, Biochim Biophys Acta 2001, 1518:152-6; Ornitz et ah, J Biol Chem 1996, 271:15292-7). FGFs also bind, albeit with low affinity, to heparin sulfate proteoglycans (HSPGs) present on most cell surfaces and extracellular matrices (ECM). Interactions between FGFs and HSPGs serve to stabilize FGF/FGFR interactions and to sequester FGF and protect it from degradation (Powers et al, Endocr Relat Cancer 2000, 7:165-97; Szebenyi and Fallon, Lit Rev Cytol 1999,185:45-106). Dimerization of FGF receptor monomers upon ligand binding is reported to be a requisite for activation of the kinase domains, leading to receptor trans- phosphorylation. FGF receptor-1 (FGFR-1), which shows the broadest expression pattern of the four FGF receptors, contains at least seven tyrosine phosphorylation sites. A number of signal transduction molecules are affected by binding with different affinities to these phosphorylation sites.
[0096] FGFR-1, FGFR-2 and FGFR-3 each recognize FGF-1, FGF-2, FGF-4 and
FGF-8. In addition, FGFR-1 & FGFR-2 bind FGF-3, FGF-5, FGF-6, FGF-10 and FGF-17 (Powers et ah, Endocr Relat Cancer 2000, 7:165-97). Binding of various FGF ligands varies with each receptor splice form, thus allowing a wide repertoire of FGF-mediated signaling events through a limited number of receptor coding genes. Tissue-specific alternate splicing permits cells expressing a single FGFR gene to significantly diversify their biological response by generating distinct receptor isoforms that may exhibit different ligand specificity and function. FGFR-4, binds FGF-1, FGF-2, FGF-4, FGF-6, FGF-8 and FGF-9 but not FGF- 3, FGF-5 or FGF-7. FGF-7, or keratinocyte growth factor- 1 (KGF-1) is only recognized by FGFR-2, whereas FGF-9 binds to FGFR-2, FGFR-3 and FGFR-4. Receptor specificity of FGFs-11 to -19 is not well understood (Powers et ah, Endocr Relat Cancer 2000, 7:165-97; Ornitz et al, J Biol Chem 1996, 271:15292-7).
[0097] Immunohistochemistry studies (Hughes, J Histochem Cytochem 1997,
45:1005-19)in normal human adult tissues from the major organ systems indicated that FGFR-1, FGFR-2 and FGFR-3 are widely expressed, suggesting an important functional role in tissue homeostasis. Protein expression patterns for tissue-specific isoforms have not yet been determined. FGFR-4 has a more limited expression pattern being notably absent from lung, oviduct, placenta, testis, prostate, thyroid, parathyroid, and sympathetic ganglia, tissues where all three other receptors are predominantly expressed (Hughes, J Histochem Cytochem 1997, 45:1005-19).
[0098] To determine the receptor binding specificity of CG53135, we examined the effect of soluble FGFRs on the induction of DNA synthesis in NIH 3T3 cells by recombinant CG53135-01 produced in E. coli.
Materials and Methods
[0099] Protein Purification from Escherichia coli: For production in E. coli, plasmid pEIMY-hFGF20X was transformed into the E. coli expression host BL21 (Novagen, Madison, Wl) and the induction of protein CG53135 expression was carried out according to the manufacturer's instructions. ρETMYhFGF20X/BL21 E. coli bacteria were grown in LB medium at 37°C. At an OD of 0.6, bacteriophage lambda (CE6) was added to a final multiplicity of infection of 5. The infected culture was further incubated at 27 °C for 3 hours. After induction, total cells were harvested, and proteins were analyzed by Western blotting using anti-HisGly antibody (Invitrogen). Cells were harvested by low-speed centrifugation (5000 rpm in a GS-3 rotor for 15 minutes at 4°C), suspended in phosphate-buffered saline (PBS) containing 0.5M NaCl and 1M arginine, and disrupted with two passes through a microfluidizer. Cell debris was removed by low-speed centrifugation and the soluble protein fraction (supernatant) was clarified by filtration through a 0.2 micron low-protein binding membrane. The protein sample was then loaded onto a metal chelation column (pre-charged with nickel sulfate). The nickel column was washed with PBS/0.5M NaCl + 1M L-arginine and bound proteins were eluted with a linear gradient of imidazole (0-0.5 M). Fractions containing CG53135 (100-150 mM imidazole) were pooled and dialyzed against 1 X 106 volumes of PBS pH 8.0 containing 1M L-arginine. The protein sample was stored at -80°C.
[00100] Receptor Specificity: NJH 3T3 cells were cultured in 96-well plates to approximately.100% confluence, washed and fed with DMEM without supplements (Life Technologies), and incubated for 24 h. Recombinant CG53135-01 or control protein was then added to the cells for 18 h. Control proteins used were aFGF (positive control) and platelet derived growth factor-BB (PDGFBB) (negative control). To analyze the effect of soluble FGFRs on CG53135 activity, recombinant CG53135-01, aFGF, or PDGF-BB (final concentrations of 10, 5 and 3 ng/mL, respectively), were mixed with soluble receptors (final concentrations of 0.2, 1 and 5 ug/mL), and incubated for 30 rnin at 37°C prior to addition to serum-starved NJH 3T3 cells. Factor concentrations represent the amount of hgand needed to generate a half maximal BrdU response in NIH 3T3 cells. Soluble FGFRs were Fc chimeras of the following receptor forms (FGFRlβ(IIIc); FGFR2β(IIIb); FGFR2α(IIIb); FGFR2QC(IIIC); FGFR3α(IIIc); FGFR4) and were obtained from R&D Systems (Minneapolis, MN). The BrdU assay was performed according to the manufacturer's specifications (Roche Molecular Biochemicals, Indianapolis, IN) using a 4 h BrdU incorporation time.
Results and Conclusions
[00101] To determine the receptor binding specificity of CG53135, we examined the effect of soluble FGFRs on the induction of DNA synthesis in NIH 3T3 cells by recombinant CG53135-01 produced in E. coli. Soluble receptors for FGFRlβ(IIIc), FGFR2β (Tub), FGFR2α(IIIb), FGFR2 (IIIc), FGFR3α(IIIc), and FGFR4 were utilized. We found that soluble forms of each of these FGFRs were able to specifically inhibit the biological activity of CG53135 (Figure 3).
[00102] Complete or nearly complete inhibition was obtained with soluble
FGFR2α(IIIb), FGFR2β(IIIb), FGFR2α (IIIc), and FGFR3α (JJJc), whereas partial inhibition was achieved with soluble FGFRlβ (JJIc) and FGFR4. None of the soluble receptor reagents interfered with the induction of DNA synthesis by PDGF-BB (Figure 2), thereby demonstrating their specificity. The integrity of each soluble receptor reagent was demonstrated by showing their ability to inhibit the induction of DNA synthesis by aFGF, a factor known to interact with all of the FGFR's under analysis (Figure 3).
5.4. Example 4: Treatment of Stroke [00103] Thirty male Sprague Dawley rats were allocated to treatment groups as indicated in the study design Table 8 below.
Table 8: Experimental Design
*Administered dose and volume is based on an average bodyweight of 330 g. Experimental Procedures
[00104] Middle cerebral artery (MCA) Surgery and Intracisternal Injections:
Animals were handled for 7 days prior to surgery. Cefazolin sodium (40 mg/kg, i.p) was administered on the day before surgery and just after surgery. At the time of surgery, the rats were anesthetized with 2% halothane in a 2:1 N O :O2 mixture. Body temperature was maintained at 37 ± 0.50°C. The proximal right MCA was electrocoagulated from just proximal to the olfactory tract to the inferior cerebral vein and was then transected. For intracisternal injections, animals were re-anesthetized as above and placed in a stereotaxic frame. Rats were given CG53135-05 or vehicle [40mM acetate, 200 mM mannitol (pH 5.3)] by percutaneous injection into the cisterna magna, once at 1 day, (approximately 24 hours) and once at 3 days, (approximately 72 hours) after MCA. Animals were given test article (2 dose groups) or vehicle treatment according to the study design. Clinical Observations/Signs
[00105] Animals were observed immediately over a 1 hour period following injections for signs of seizure (indicated by tremor and violent motion about the cage), pain (indicated by loud vocalization), and lethargy. Animals were also observed daily for mortality and moribundity.
[00106] Body Weight: Animals were weighed on Days 1, 3, 7, 14 and 21.
[00107] Limb Placing Test: limb placing tests were carried out on all animals on Day
-1 (pre-operation), Day 1 (just prior to injection), Day 3 and then every 7 days thereafter (Days 7, 14, 21).
[00108] Forelimb Placing Test Assessment Score: The forelimb placing test measures sensorimotor function in each forelimb as the animal places the limb on a table top in response to visual, tactile, and proprioceptive stimuh. Hie forelimb placing test consists of the following evaluations and scoring, where the combined total score for the forelimb placing test reflects a range from 0 (no impairment) to 10 (maximal impairment): visual placing (forward, sideways):, 0 - 4 tactile placing (dorsal,lateral): 0 - 4 proprioceptive placing: 0 - 2 Total score for all forelimb tests: 0 - 10
[00109] Hindlimb Placing Test Assessment Score: Similarly, the hindlimb placing test measures sensorimotor function of the hindlimb as the animal places it on a tabletop in response to tactile and proprioceptive stimuli. The hindhmb placing test consists of the following evaluations and scoring, where the combined total score for the hindlimb placing test reflects a range from 0 (no impairment) to 6 (maximal impairment): tactile placing (dorsal,lateral): 0 - 4 proprioceptive placing: 0 - 2
Total score for all hindlimb tests: 0 - 6
[00110] Body Swing Test: the body swing test was carried out on all animals on Day
-1 (pre-operation), Day 1 (just prior to injection), Day 3 and then every 7 days thereafter (Days 7, 14, 21).
[00111] The body swing test examines side preference as the animal is held approximately one inch above the surface of the table, and swings to the right or the left side. Thirty swings are counted, and the score is then calculated based on the percentage of swings to the right, (score range = -50% right swing (no impairment) - 0% right swing (maximal impairment))
[00112] Cylinder Test: the cylinder test was carried out on all animals on Day -1
(pre-operation) and 7 days thereafter (Days 7, 14, 21). The cylinder test measures spontaneous motor activity of the forelimbs. Animals are placed in a narrow glass cylinder (16.5 x 25 cm) and videotaped for 5 min on the day before stroke surgery and at weekly intervals thereafter. Videotapes are then scored independently by one experienced observer and up to 50 spontaneous movements will be counted (~ 5 min per rat per day). Spontaneous movements include those made by each forelimb to initiate rearing, to land on or to move laterally along the wall of the cylinder, or to land on the floor after rearing.
[00113] Macroscopic and Histomorphology: on the day of scheduled termination
(Day 3), animals were euthanized by an intraperitoneal injection of Chloral hydrate (500mg/Kg). Brains were examined grossly and removed, postfixed in formalin, dehydrated and embedded in paraffin. Coronal sections (5 mm) will be cut on a microtome mounted on to glass slides, and stained with hematoxylin/eosin (H&E). The area of cerebral infarcts on each of seven slices (+4.7, +2.7, +0.7, -1.3, -3.3, -5.3, and -7.3 mm compared with Bregma) was determined using a computer interface imaging system using the indirect method (area of the intact contralateral hemisphere - area of the intact ipsilateral hemisphere) to correct for brain shrinkage during processing. Jnfarct volume was then expressed as a percentage of the intact contralateral hemispheric volume. Volumes of the infarction in the cortex and striatum were also determined separately using these same methods. H&E stained section was examined for histological changes such as hemorrhage, abscess or tumor formation.
[00114] Statistical Analysis: all intracisternal injections, behavioral testing, and subsequent histological analyses were done by investigators blinded to the treatment assignment of each animal. Data are then expressed as means +/- SEM, and will be analyzed by one or two way (ANOVA) followed by appropriate pairwise post hoc tests with correction for multiple comparisons.
Results
[00115] Forelimb Placing Test: on days -1, 1, 3, 7, 14, and 21 relative to MCA occlusion, animals were examined by using a limb placing test to assess sensorimotor function in the forelimb in response to visual, tactile and proprioceptive stimuli (Kawamata, T., Dietrich, W. D., Schallert, T., Gotts, E., Cocke, R. R., Benowitz, L. I. & Finklestein, S. P. (1997) Proc. Natl. Acad. Sci. USA 94, 8179-8184; De Ryck, M., Van Reempts, J., Duytschaever, H., Van Deuren, B. & Clincke, G. (1992) Brain Res. 573, 44-60.) Visual placing (scored 0-4), tactile placing (scored 0-4), and proprioceptive placing (scored 0-2) were summed to generate a range of potential total scores from 0 to 12, with 12 representing maximal impairment (Figure 4).
[00116] Hindlimb Placing: on days -1, 1, 3, 7, 14, and 21 relative to MCA occlusion, animals were examined by using a limb placing test to assess sensorimotor function in the hindlimb in response to tactile and proprioceptive stimuli [Kawamata, T., Dietrich, W. D., Schallert, T., Gotts, E., Cocke, R. R., Benowitz, L. I. & Finklestein, S. P. (1997) Proc. Natl. Acad. Sci. USA 94, 8179-8184; De Ryck, M., Van Reempts, J., Duytschaever, H., Van Deuren, B. & Clincke, G. (1992) Brain Res. 573, 44-60]. Tactile placing (scored 0-4), and proprioceptive placing (scored 0-2) were summed to generate a range of potential total scores from 0 to 6, with 6 representing maximal impairment (Figure 5).
[00117] Body Swing Test: On days -1, 1, 3, 7, 14, and 21 relative to MCA occlusion, animals were examined by using a body swing test to assess side preference as the animal is held approximately one inch above the surface of the table, and swings to the right or the left side. (Kawamata, T., Dietrich, W. D., Schallert, T., Gotts, E., Cocke, R. R., Benowitz, L. I. & Finklestein, S. P. (1997) Proc. Natl. Acad. Sci. USA 94, 8179-8184; De Ryck, M., Van Reempts, J., Duytschaever, H., Van Deuren, B. & Clincke, G. (1992) Brain Res. 573, 44- 60.) Thirty swings were counted, and the score calculated based on the percentage of swings to the right (Figure 6).
[00118] Cylinder Test: On days -1, 1, 3, 7, 14, and 21 relative to MCA occlusion, animals were examined by cylinder test to assess spontaneous motor activity of the forelimbs (Kawamata, T., Dietrich, W. D., Schallert, T., Gotts, E., Cocke, R. R., Benowitz, L. I. & Finklestein, S. P. (1997) Proc. Natl. Acad. Sci. USA 94, 8179-8184; De Ryck, M., Van Reempts, J., Duytschaever, H., Van Deuren, B. & Clincke, G. (1992) Brain Res. 573, 44- 60.) Briefly, animals are placed in a narrow glass cylinder (16.5 x 25 cm) and videotaped for 5 min on the day before stroke surgery and at weekly intervals thereafter. Videotapes are then scored independently by one experienced observer and up to 50 spontaneous movements will be counted (~ 5 min per rat per day). Spontaneous movements include those made by each forelimb to initiate rearing, to land on or to move laterally along the wall of the cylinder, or to land on the floor after rearing (Figure 7). [00119] Body Weight: animals were weighed on days -1, 1, 3, 7, 14, and 21 relative to MCA occlusion and the results indicate no significant difference between the vehicle and CG53135-05 treatment (Figure 8).
Conclusion
[00120] Administering CG53135-05 following MCA occlusion suggested that both the low and high doses produced a significant enhancement of recovery on forelimb (Figure 4) and hindlimb placing tests (Figure 5) for the contralateral (affected) limbs, and improvement on the body swing test (Figure 6). This pattern of activity with other therapeutics in this model has generally been shown to reflect improvement in cerebrocortical and subcortical (striatal) function, respectively (Dijkhuizen RM, Ren J, Mandeville JB, Wu O, Ozdag FM, Moskowitz MA, Rosen BR, Finklestein SP. 2001, Proc Natl Acad Sci U S A 98(22):12766- 71). No apparent differences were seen on the cylinder test (Figure 7) of spontaneous limb use or on animal body weight (Figure 8).
[00121] Therefore, CG53135-05 administration will be useful in the treatment of pathological conditions including ischemic stroke, hemorrhagic stroke, trauma, spinal cord damage, heavy metal or toxin poisoning and neurodegenerative diseases (such as Alzheimer's, Parkinson's Disease, Amyotrophic Lateral Sclerosis, Huntington's Disease).
5.5. Example 5: Matrix Metalloproteinase Production Assay
[00122] The matrix metalloproteinases (MMPs) are a family of related enzymes that degrade the extracellular matrix in bone and cartilage. These enzymes operate during normal development in tissues differentiation and remodeling. In arthritic diseases, such as Osteoarthritis (OA) and Rheumatoid Arthritis (RA), elevated expression of these enzymes contribute to irreversible matrix degradation. Thus, effect of CG53135-05 on MMP production was assayed.
[00123] The activity of CG53135 on matrix metalloproteinase (MMP) production was assessed using the SW1353 chondrosarcoma cell line (ATCC HTB-94). This cell line is a well-established chondrocytic cellular model for matrix metalloproteinases (MMP) production. SW1353 cells were plated in a 24-well plate at 1 xlO5 cells/ml (1 ml) in DMEM medium- 10 % FBS. Following overnight incubation, the medium was replaced with DMEM + 0.2 % Lactabulmin serum. CG53135-05 was added to the wells at doses ranging from 10 to 5000 ng/ml, in the absence or presence of JL-1 beta (0.1 to 1 ng/ml, R&D systems Minneapolis, MN), TNF-alpha (10 ng/ml, R&D systems) or vehicle control to a final volume of 0.5 ml. TL-1 beta and TNF-alpha are both potent stimulators of MMP activity. All treatments were done in triplicate wells. After 24 h, the supernatants were collected and Pro- MMP-1, and -13, as well as TJMP-1 (tissue inhibitor of matrix metalloproteinase), a natural inhibitor of MMP activity, was measured by ELIS A (R&D systems). The measurements were normalized to the number of cells by an MTS assay.
Results
[00124] CG53135-05 significantly decreased MMP-13 production in the presence of either IL-1 beta or TNF-alpha as demonstrated in Figure 14 and Figurel5 respectively. JL-1 beta and TNF-alpha are both potent stimulators of MMP activity. MMP-13 affinity for type It collagen, the main collagen that is degraded in OA, is ten times higher that of MMP- 1. Since MMP-13 expression increases in OA and RA, the decrease of MMP-13 observed with addition of CG53135-05 indicates that the protein can be used as an OA and RA therapeutic (Figure 10). Furthermore, CG53135-05 up-regulated the production of TJMP-1, a natural inhibitor of MMP activity (Figure 11). This enhancement of TJMP-1 production by CG53135-05 is beneficial in reducing the matrix breakdown by MMP-1 and -13 observed in OA and RA. In addition, CG53135-05 had no effect on MMP-3 production constitutively or after JL-1 induction (data not shown.). Similarly, CG53135-05 (FGF-20) showed increase in basal expression of MMP-1 in SW1353 cells (data not shown).
5.6. Example 6: Effect of CG53135-05 on Normal Rats: Proof of Principle to the Meniscal
Tear Model
[00125] The effect of CG53135-05 on the normal rats was studied as a proof of principle to drive further studies in disease model (ex: meniscal tear model of osteoarthritis in rats). The effect of CG53135-05 on synovium and cartilage was assessed by injecting the protein into normal male Lewis rats.
Effects of Intra-articular injection of CG53135-05 in Normal Rats
[00126] The rats were injected intra-articularly three times per week for 2 weeks with vehicle solution (8mM acetate, 40 mM arginine, and 0.6% glycerol (pH 5.3) in approximately 1% hyaluronic acid), 10 μg CG 53135-05 or 100 μg CG 53135-05.
[00127] Study Design: Male Lewis rats weighing 293-325 grams on day 0 were obtained from Harlan Sprague Dawley (Indianapolis, Indiana) and acclimated for 8 days.
The rats were divided into three treatment groups with three animals in each group: two groups received CG53135 and one received only the vehicle control. The rats were anesthetized with Isoflurane and injected through the patellar tendon into the area of the cruciate attachments of both knees. CG53135 was injected at doses of 0.1 mg/ml (0.01 mg/joint) or 1.0 mg/ml (0.1 mg/joint). Controls were injected with the vehicle solution as described above. Injections were done Monday, Wednesday and Friday for 2 weeks. The animals were terminated on day 15 at which time they were injected ip with BRDU (100 mg kg) in order to pulse label proliferating cells.
Observations and Analysis of Markers of Pathology
[00128] Gross observations Rats were observed daily for abnormal swelling or gait alterations and were weighed weekly.
[00129] Histopathology Preserved and decalcified (5% formic acid) knees were trimmed into 2 approximately equal longitudinal (ankles) or frontal (knees) halves, processed through graded alcohols and a clearing agent, infiltrated and embedded in paraffin, sectioned, and stained with toluidine blue (knees). Multiple sections (3 levels) of right knee were analyzed microscopically with attention to the parameters of interest listed below. Each parameter was graded as normal, minimal, mild, moderate, marked or severe. Evaluation of the cartilage was done using descriptive parameters rather than the scoring criteria generally used in the osteoarthritis model because of the type of alterations generated by the repetitive injection of the protein. Although animals were injected with BRDU prior to termination, the proliferative changes were readily observed in toluidine blue stained sections.
RESULTS
Table 9: Microscopically Monitored Parameters
[00130] Live Phase Parameters Body weights were similar in vehicle and protein injected animals throughout the study (Table 12). Knees injected with 100 μg of protein had some evidence of fibrosis clinically during the injection process beginning with the 3rd injection.
[00131] Morphologic Pathology Vehicle injected rats had minimal to mild synovial hyperplasia, inflammation and fibroplasia with none to minimal matrix deposition in fibrotic synovium. Articular cartilage had no proteoglycan loss or fibrillation. The central area of the joint where the cruciates attach and in which the intra-articular injections are made had none to minimal fibroplasia and cartilage/bone damage. No marginal zone chondrogenesis was present.
[00132] Knees injected with 10 μg CG 53135-05 had mild to moderate synovial hyperplasia, inflammation and fibroplasia with minimal to moderate matrix deposition in fibrotic synovium. Articular cartilage had no proteoglycan loss or fibrillation. The central area of the joint where the cmciates attach and in which the intra-articular injections are made had none to minimal fibroplasia and cartilage/bone damage. One knee had minimal marginal zone chondrogenesis.
[00133] Knees injected with 100 μg CG 53135-05 had moderate to marked synovial hyperplasia, inflammation and fibroplasia with moderate matrix deposition in fibrotic synovium. Articular cartilage had none to minimal proteoglycan loss or fibrillation. The central area of the joint where the cruciates attach and in which the intra-articular injections are made had minimal to marked fibroplasia and cartilage/bone damage. All knees had mild to moderate marginal zone chondrogenesis. One animal had chondrogenesis in areas associated with articular cartilage.
Conclusion
[00134] These results demonstrate that repetitive intra-articular inj ection of CG53135 -
05 induces synovial fibroplasia and chondrogenesis. Vehicle injections resulted in mild inflammation and fibroplasia thus suggesting that this vehicle has some irritant potential. Concentration responsive increases in synovial proliferative response as well as marginal zone chondrogenesis occurred in animals injected with protein. The area of the cruciate attachment where injections occurred had areas of bone resorption and fibroplasia which also increased in severity with increasing concentrations of the protein as did the synovial inflammation. The potentially adverse effects of observed synovial fibroplasia and bone resorption could have been due to either FGF-20 activity or endotoxin levels within the non- clinical grade hyaluronic acid used to formulate the protein. Jn addition, inflammation in the joint can induce bone resorption and marginal zone chondrogenesis so these results need to be interpreted in light of the possibility that the inflammatory response to the protein injection contributed to the proliferative response. The morphologic appearance of the proliferative changes and chondrogenesis clearly indicates that the biological activity of this protein (CG53135-05) is important in generating the response. [00135] The results of the experiments reported herein indicate repetitive intra- articular injection of CG53135-05 induces synovial fibroplasia and chondrogenesis.
5.7. Example 7: Intra-articular injection of CG53135-05 in Meniscal Tear model of Rat Osteoarthritis: Prophylactic and Therapeutic Dosing
[00136] Example 6 utilized CG53135-05 administration into the joints of normal rats to identify effects on relevant cell populations by histomorphometric analysis. At the dose of 100 ug/joint, CG53135-05 induced significant marginal zone chondrogenesis similar to that seen with other growth factors such as TGF-beta, suggesting an effect on pluripotent stem cells within the marginal zone. There was no apparent effect on mature chondrocytes as evidenced by the lack of a response in the mature cartilage areas of the joints. The potentially adverse effects of observed synovial fibroplasia and bone resorption could have been due to either FGF-20 activity or endotoxin levels within the non-clinical grade hyaluronic acid used to formulate the protein.
[00137] Further studies in osteoarthritic animals performe addressed the following: 1) synergy with an anti-inflammatory drag (standard approach for osteoarthritis patients), 2) whether CG53135-05 (FGF-20) can induce functional repair or protection of joint cartilage layers, and 3) whether synovial fibroplasia and bone resorption were FGF-20-induced or due to contaminating endotoxin within the formulation.
[00138] Thus one aspect of this study was to evaluate the protective and therapeutic effects of intra-articular injection of CG53135-05 on joint damage in osteoarthritis in the meniscal tear model of rat osteoarthritis. This relatively new model of OA has been shown to have morphologic alterations of cartilage degeneration and osteophyte formation that resemble changes occurring in spontaneous disease and surgically induced disease in other species (Bendele, A.M., Animal Models of Osteoarthritis. J. Musculoskel. Neuron Interact. 2001; 1:363-376, Bendele, A. M. and Hulman, J. F. Spontaneous cartilage degeneration in guinea pigs. Arthritis Rheum. 1988; 31:561-565). The model can be used to evaluate potential beneficial effects of anti-degenerative as well as regenerative therapies.
Experimental Design
[00139] Animals (10/group), housed 2/cage, were anesthetized with Isoflurane and the right knee area is prepared for surgery. A skin incision was made over the medial aspect of the knee and the medial collateral ligament was exposed by blunt dissection, and then transected. The medial meniscus was then reflected medially with a fine scissor and a cut was made through the full thickness to simulate a complete tear. The skin was closed with suture. [00140] Prophylactic Dosing: intra-articular dosing (CG53135-05) of the right knee joint was initiated on the day of surgery and is continued for 2 weeks post-surgery with intra- articular injections given Thursday, Saturday, and Monday (day 0, 2, 4, 7, 9, and 11) with rats under Isoflurane anesthesia. Indomethacin, a nonsteroidal anti-inflammatory drug, was dosed (lmg/kg/day) daily by the oral route starting on the day of surgery to reduce any potential inflammation due to the injection. Body weights were recorded on days 0, 7 and 14. After animal termination on day 14 post-surgery, both knees were collected for histopathologic evaluation. The study design is shown in Table 10.
Table 10. Prophylactic Dosing Study Design
administration 3 times per week for 2 weeks (100 μg/joint, intra-articular) administration daily for 2 weeks (0.5 mg/kg, PO)
[00141] Therapeutic Dosing: intra-articular dosing (CG53135-05) of the right knee joint is initiated on day 21 of post-surgery and is continued for 2 weeks with intra-articular injections given Friday, Sunday, and Tuesday (day 22, 25, 27, 29, 32, and 34) with rats under Isoflurane anesthesia. Indomethacin is dosed daily by the oral route starting on the day of surgery. Body weights are recorded on days 0, 7, 14, 21, 28, and 35. On day 35, both knees are collected for histopathologic evaluation. The study design is shown in Table 11.
Table 11. Therapeutic Dosing Study Design
administration 3 times per week for 2 weeks (100 μg/joint, intra-articular) administration daily for 2 weeks (0.5 mg/kg, PO)
[00142] Results of prophylactic dosing study: Observations made include the standards followed for this model. Multiple sections (3 levels) of right knee were analyzed microscopically and scored according to the following methods. In scoring the 3 sections, the worst case scenario for the 2 halves on each of the 3 slides representing 3 levels was determined for cartilage degeneration and osteophyte formation. This value for each parameter for each slide was then averaged to determine overall subjective cartilage degeneration scores for tibia and femur and osteophyte scores for tibia.
[00143] Cartilage degeneration was scored none to severe (numerical values 0-5) for depth and area (surface divided into thirds) using the following criteria:
0=no degeneration l=minimal degeneration, chondrocyte and proteoglycan loss with or without fibrillation involving the superficial zone
2= mild degeneration, chondrocyte and proteoglycan loss with or without fibrillation involving the upper 1/3
3=moderate degeneration, chondrocyte and proteoglycan loss with fibrillation extending well into the midzone and generally affecting 1/2 of the total cartilage thickness
4=marked degeneration, chondrocyte and proteoglycan loss with fibrillation extending well into the deep zone but without complete (to the tidemark) loss of matrix
5=severe degeneration, matrix loss to tidemark
[00144] Strict attention to zones (outside, middle, inside thirds) was adhered to in this scoring method and the summed scores reflect a global summation of severity of tibial degeneration.
[00145] In addition to this overall subjective analysis of cartilage degeneration, an additional subjective assessment was done using similar criteria to evaluate severity of degeneration but with attention to specific regional differences across the tibial plateau. In this OA model, generally the outside 1/3 of the tibia is most severely affected by the meniscal tear injury with lesions often extending to the tidemark by 3 weeks post-surgery. The middle 1/3 is usually a transition zone where severe or marked change becomes moderate or mild and the inner 1/3 seldom has changes greater than mild or minimal. In an attempt to determine potential differences of treatment on the severe lesion of the outside 1/3 vs. the milder lesions of the middle 1/3 and inside 1/3, these regions were each scored separately. The sum of the regional values was calculated and expressed as sum of 3 zones.
[00146] In addition to the above subjective scoring, a micrometer measurement of total extent of tibial plateau affected by any severity of degeneration (Total Tibial Cartilage Degeneration Width μm) extended from the origination of the osteophyte or marginal zone if no osteophyte was present with adjacent cartilage degeneration (outside 1/3) across the surface to the point where tangential layer and underlying cartilage appeared histologically normal.
[00147] An additional measurement (Significant Cartilage Degeneration Width μm) reflected areas of tibial cartilage degeneration in which chondrocyte and matrix loss extended through greater than 50% of the cartilage thickness.
[00148] Finally, a micrometer depth of any type of lesion (cell/proteoglycan loss, change in metachromasia, but may have good retention of collagenous matrix and no fibrillation) expressed as a ratio of depth of changed area vs. depth to tidemark was included and taken over 4 equally spaced points on the tibial surface. These measurements were taken (1st) matrix adjacent to osteophyte (2nd) 1/4 of the distance across the tibial plateau (3rd) 1/2 of the distance across the tibial plateau (4th) 3/4 of the distance across the tibial plateau. This measurement was the most critical analysis of any type of microscopic change present. The depth to tidemark measurement (denominator) also gives an indication of cartilage thickness across the tibial plateau and therefore allows comparisons across groups when trying to determine if hypertrophy or hyperplasia has occurred.
[00149] A single tibial growth plate measurement was taken for each section in an area thought to best represent the overall width in the non tangential plane of the section.
[00150] Scoring of the osteophytes and categorization into small, medium and large was done with an ocular micrometer.
None = 0 no measurable proliferative response at marginal zone Small osteophytes =1 (up to 299 μm) Medium osteophytes=2 (300-399 μm) Large osteophytes=3 (>400μm) [00151] The score (0-3) was included in the overall joint score. In addition, the mean±SE for the actual osteophyte measurement (average for 3 sections) was also determined.
[00152] Generally, in doing the surgery, attempts were made to transect the collateral ligament at a location that results in the meniscus being reflected proximally toward the femur. The cut was then made by inserting the scissors tip toward the femur rather than the tibia. Some mechanical damage may then be detected in the femoral condylar cartilage but is rarely encountered on the tibia, thus making the tibia the most appropriate site for assessment of chondroprotection.
[00153] Focal small areas of proteoglycan and cell loss that were likely a result of physical trauma to the femoral cartilage were described but not included in the score with larger more diffuse areas receiving subjective scores according to methods described for the tibia. These larger areas were more consistent with non traumatic degeneration. Because of the possibility of iatrogenic lesions on the femur, overall joint scores were expressed both with and without femoral cartilage degeneration scores.
[00154] Damage to the calcified cartilage layer and subchondral bone was scored using the following criteria:
0=No changes l=lncreased basophilia at tidemark: no fragmentation of tidemark or marrow changes
2=Increased basophilia at tidemark: minimal to mild fragmentation of calcified cartilage of tidemark, mesenchymal change in marrow involves 1/4 of total area but generally is restricted to subchondral region under lesion
3=Increased basophilia at tidemark: Mild to marked fragmentation of calcified cartilage, Mesenchymal change in marrow is up to 3/4 of total area, Areas of marrow chondrogenesis may be evident but no collapse of articular cartilage into epiphyseal bone
4=Increased basophilia at tidemark: Marked to severe fragmentation of calcified cartilage, Marrow mesenchymal change involves up to 3/4 of area and articular cartilage has collapsed into the epiphysis to a depth of 250μm or less from tidemark
5=Increased basophilia at tidemark: Marked to severe fragmentation of calcified cartilage, Marrow mesenchymal change involves up to 3/4 of area and Articular cartilage has collapsed into the epiphysis to a depth of greater than 250μm from tidemark [00155] Descriptive comments were made on degree of synovial inflammation, synovial fibrosis, marginal zone chondrogenesis, bone resorption, fibrous overgrowth with or without chondrogenesis/incorcoration into existing cartilage
[00156] Statistical Analysis: statistical analysis of histopathologic parameters was done by comparing group means using the Student's two-tailed t-test with significance set at p<0.05. Because of the nature of the data, a non Parametric ANOVA (Kruskal-Wallis test) was used to analyze the scored parameters and a parametric ANOVA was used to analyze the measurements. The appropriate post test used was Dunnett's multiple comparisons test on the parametric data and a Dunn's test was used on the non parametric data. Significance was set at ρ<0.05 for all parameters.
[00157] Results: intra-articular injection of 100 μg CG53135-05 with or without concurrent indomethacin administration resulted in significant inhibition (39%) of tibial cartilage degeneration on the middle 1/3 (40-43% for zone 1) and an overall insignificant inhibition of the summed 3 zones of 41% (Figure 12). Total cartilage degeneration width was significantly decreased 35-37% (Figure 13) and significant degeneration was reduced 70-89% with this inhibition being significant only in the group treated with protein and indomethacin (Figure 14).
[00158] Results of the prophylactic dosing study: the data described indicate that intra-articular injection of 100 μg of CG53135-05 in knee joints of rats with medial meniscal tear results in chondroprotective effects as a result of both inhibition of cartilage degeneration and stimulation of cartilage repair. Some joints had layering of proliferated new cartilage over existing normal appearing or damaged cartilage. This observation is particularly exciting as it demonstrates the potential for resurfacing to occur.
[00159] These beneficial effects were always associated with diffuse synovial fibroplasia, bone resorption and increased synovial inflammation. Concurrent indomethacin treatment (1 mg/kg/day) had minimal if any effect on the disease process in knees injected with Synvisc alone or the disease process and reaction to the protein in knees injected with Synvisc containing protein. The single exception to this statement is reflected in the data for osteophyte measurements where all groups had similar measurements except the group treated with protein and vehicle po. This group had greater measurements thus suggesting greater marginal zone stimulation, not an uncommon occurrence in inflamed joints.
[00160] The morphologic changes induced by injection of 100 μg of this protein demonstrate the potential for CG53135-05 to be effective in cartilage repair processes. It has the capacity to induce fibrous tissue proliferation with differentiation to cartilage and importantly, integration of that newly proliferated tissue. Tne proliferative processes are somewhat disorganized and counter productive in areas such as the marginal zone and subchondral bone. However, rodents definitely have much greater propensity to exhibit marginal zone, periosteal and marrow proliferation from a variety of stimuh including inflammatory mediators so some of the excessive and counter productive responses seen in rats might not occur in dogs or primates. Also, there may have been some induction of an antibody response thus leading to enhanced knee inflammation that would not occur in humans or other animals that did not have an antibody response.
[00161] Additional studies that are useful in delineating the potential efficacy of
CG53135-05 in osteoarthritis include:
[00162] 1. Evaluation in a dog model of OA-this would allow evaluation in a larger joint with cartilage and bone structure that is more similar to humans and this is a species that has less tendency to exhibit hyperproliferative responses such as those that occur in rodents.
[00163] 2. Evaluation of ia injections for 3-4 weeks, possibly with more aggressive anti-inflammatory systemic therapy followed by a recovery period to see how the new tissue remodels would be interesting. It may be that allowing the joint to remodel with no further proliferative stimulus would result in a more pleasing morphologic endpoint. Cycles of treatment with periods of remodeling might be the way to achieve the most satisfactory repair. Studies such as these would also answer the question of whether the repair tissue will hold up long term. Generally fibrocartilage has less of a tendency to do this.
[00164] Results: Intra-articular injection of 100 μg CG53135-05 with or without concurrent oral indomethacin administration did not result in significant inhibition of tibial cartilage degeneration scores (Figure 15). Total or significant cartilage degeneration width was not decreased (Figures 16, 17).
[00165] Results of the therapeutic dosing study: The data described demonstrated the potential chondroproliferative activities of CG53135-05 administered intra-articularly. However, protein injected joints had markedly increased inflammation, fibroplasia and connective tissue resorptive process.
[00166] The most important difference between the prophylactic and therapeutic dosing studies was the nature of the OA lesion at the time of initiation of dosing. Rats in the therapeutic dosing study had an area of severe matrix loss in the outer to middle 1/3 of the cartilage thus exposing the calcified cartilage/subchondral bone to the protein. Effective repair thus required filling of this defect with newly proliferated tissue coming from the marginal zone or exposed marrow pleuripotential cells. In the prophylactic dosing study, beneficial effects required inhibition of matrix degradation and stimulation of repair on a degenerating scaffold with repair tissue originating from the marginal zone only. Since the filling of a defect would be much more difficult than repairing a damaged scaffold, it may be that a longer duration of treatment would be required in a therapeutic model in order to see beneficial effects.
[00167] Indomethacin treatment was not effective in reducing the inflammatory changes and it had no beneficial effects on inhibiting the resorptive processes occurring in bone. In order to achieve effective proliferation and differentiation to cartilage in the absence of inflammation and tissue destruction, following modification to the therapeutic dosing study can be attempted: Increasing the dosing interval to once or twice weekly and/or increasing the study duration to allow time for the prohferative tissue to fill the large cartilage defects induced by this disease process. Another possibility is to investigate the effects of CG53135-05 in a larger species such as the dog as dogs have less of a tendency to proliferate connective tissue and resorb bone in response to various stimuli than rodents.
[00168] The results detailed herein (both prophylactic and therapeutic dosing studies) indicate that CG53135-05 has specific utility in severely osteoarthritic joints that are destined for joint replacement. These types of agents would be injected into joints that have little or no normal cartilage remaining and are in need of resurfacing. Jn this situation, repair could originate from pleuripotential cells in the marginal zones or bone marrow. Repair originating from these locations will likely result in production of fibrocartilage rather than hyaline cartilage. However, some cartilage would be preferable to no cartilage and it may be that an injectable method of sustaining a cartilage surface would be acceptable even though treatments would likely have to be repeated over time to sustain the repair. Treatments with injectable anabolic agents will likely require some kind of cyclical process in conjunction with continuous passive motion rather than sustained active load bearing motion.
6. EQUIVALENCE AND REFERENCE CITED [00169] All references cited herein are incorporated herein by reference in their entirety and for all purposes to the same extent as if each individual publication or patent or patent application was specifically and individually indicated to be incorporated by reference in its entirety for all purposes. [00170] Many modifications and variations of this invention can be made without departing from its spirit and scope, as will be apparent to those skilled in the art. The specific embodiments described herein are offered by way of example only. We therefore do not wish to be limited to the precis terms set forth, but desire to avail ourselves of such changes and alterations that may be made for adapting the invention to various usages and conditions. Such alterations and changes may include, but not limited to, different compositions for the administration of the polypeptides according to the present invention to a subject; different amounts of the polypeptide; different times and means of administration; different materials contained in the administration dose including, for example, combinations of different peptides, or combinations of peptides with different biologically active compounds. Such changes and alterations also are intended to include modifications in the amino acid sequence of the specific polypeptides described herein in which such changes alter the sequence in a manner as not to change the functionality of the polypeptide, but as to change solubility of the peptide in the composition to be administered to a subject, absorption of the peptide by the body, protection of the polypeptide for either shelf life or within the body until such time as the biological action of the peptide is able to bring about the desired effect, and such similar modifications. Accordingly, such changes and alterations are properly intended to be within the full range of equivalents of the present invention.

Claims

WHAT IS CLAIMED IS:
1. A method of treating osteoarthritis-related disorders in a subject comprising administering to the subject a composition comprising CG53135-05 polypeptide.
2. The method of claim 1, wherein the subject is a human.
3. The method of claim 1, wherein a prophylactic effective dose of the said polypeptide is administered to the subject.
4. The method of claim 1, wherein a therapeutically effective dose of the said polypeptide is administered to the subject.
5. The method of claim 1, wherein the said polypeptide is administered by parenteral route.
6. The method of claim 5, wherein the said route of administration consists of intra-articular, intravenous, intramuscular, subcutaneous or intradermal administration.
7. The method of claim 1, wherein a therapeutically effective amount of the said polypeptide is formulated in a pharmaceutical composition.
8. A method of reducing cartilage degeneration in a subject comprising administering to the subject a composition comprising CG53135-05 polypeptide.
9. A method of stimulating cartilage repair in a subject comprising administering to the subject a composition comprising CG53135-05 polypeptide.
EP04751821A 2003-05-09 2004-05-10 Novel fibroblast growth factors and methods of use thereof Withdrawn EP1626696A2 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US46935303P 2003-05-09 2003-05-09
PCT/US2004/014623 WO2004100892A2 (en) 2003-05-09 2004-05-10 Novel fibroblast growth factors and methods of use thereof

Publications (1)

Publication Number Publication Date
EP1626696A2 true EP1626696A2 (en) 2006-02-22

Family

ID=33452279

Family Applications (1)

Application Number Title Priority Date Filing Date
EP04751821A Withdrawn EP1626696A2 (en) 2003-05-09 2004-05-10 Novel fibroblast growth factors and methods of use thereof

Country Status (5)

Country Link
EP (1) EP1626696A2 (en)
JP (1) JP2007516223A (en)
AU (1) AU2004238332A1 (en)
CA (1) CA2525107A1 (en)
WO (1) WO2004100892A2 (en)

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5011691A (en) * 1988-08-15 1991-04-30 Stryker Corporation Osteogenic devices
US7056885B1 (en) * 1999-07-27 2006-06-06 Curagen Corporation Fibroblast growth factor and nucleic acids encoding same
AU7181101A (en) * 2000-07-03 2002-01-14 Curagen Corp Novel fibroblast growth factors and nucleic acids encoding same
US20060094647A1 (en) * 2000-11-06 2006-05-04 Jeffers Michael E Treatment of inflammatory bowel disease using growth factors

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO2004100892A2 *

Also Published As

Publication number Publication date
AU2004238332A2 (en) 2004-11-25
WO2004100892A2 (en) 2004-11-25
CA2525107A1 (en) 2004-11-25
JP2007516223A (en) 2007-06-21
AU2004238332A1 (en) 2004-11-25
WO2004100892A3 (en) 2008-04-10

Similar Documents

Publication Publication Date Title
EP2686431B1 (en) Antagonists of the interleukin- 1 receptor
AU2007287510B2 (en) Treatment of cartilage disorders with FGF-18
KR20120082909A (en) Synthetic myostatin peptide antagonists
EP3967755B1 (en) Soluble npp1 for use in a method for treating pseudoxanthoma elasticum
TW201444865A (en) Peptides and compositions for treating joint damage
CA2693378A1 (en) Myostatin antagonists
US7795215B2 (en) MNTF peptides and compositions and methods of use
EA013565B1 (en) Variants of neublastin polypeptides, methods for producing thereof and their use
JP7010934B2 (en) Peptides for the treatment of osteoarthritis
US20050256039A1 (en) Novel fibroblast growth factors and methods of use thereof
CA2586213A1 (en) Formulations, methods of production and uses of fgf-20
WO2004100892A2 (en) Novel fibroblast growth factors and methods of use thereof
US20210113652A1 (en) Maspin-based inhibition of osteoclast activity and promotion of bone formation
US20080287349A1 (en) Fibroblast growth factor 20 and methods of use thereof
US20050256042A1 (en) Methods of preventing and treating alimentary mucositis
WO2019246013A1 (en) Peptides to enhance bone growth, repair and cell function
JP2008519032A (en) Formulation, production method and use of FGF-20
RU2813889C2 (en) Therapeutic agent for cartilage disease
KR20240086947A (en) Peptide for cartilage regeneration and uses thereof
NZ615710B2 (en) Antagonists of the interleukin- 1 receptor
AU2005244737A1 (en) Methods of preventing and treating alimentary mucositis
HK40070846B (en) Soluble npp1 for use in a method for treating pseudoxanthoma elasticum
EA042134B1 (en) apoC-II MIMETIC PEPTIDES

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20051207

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LI LU MC NL PL PT RO SE SI SK TR

AX Request for extension of the european patent

Extension state: AL HR LT LV MK

DAX Request for extension of the european patent (deleted)
RIN1 Information on inventor provided before grant (corrected)

Inventor name: CHERNAYA, GALINA

Inventor name: RUIZ-MARTINEZ, MARIE

Inventor name: LAROCHELLE, WILLIAM

Inventor name: JEFFERS, MICHAEL

Inventor name: LICHTENSTEIN, HENRI

Inventor name: MEZES, PETER

Inventor name: SCIORE, PAUL

Inventor name: PETERSON, JEFFREY

PUAK Availability of information related to the publication of the international search report

Free format text: ORIGINAL CODE: 0009015

RIC1 Information provided on ipc code assigned before grant

Ipc: C07K 14/50 20060101ALI20080428BHEP

Ipc: A61K 38/18 20060101AFI20080428BHEP

RIN1 Information on inventor provided before grant (corrected)

Inventor name: CHERNAYA, GALINA

Inventor name: RUIZ-MARTINEZ, MARIE

Inventor name: LAROCHELLE, WILLIAM

Inventor name: JEFFERS, MICHAEL

Inventor name: LICHENSTEIN, HENRI

Inventor name: MEZES, PETER

Inventor name: SCIORE, PAUL

Inventor name: PETERSON, JEFFREY

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20081202