EP1407043A2 - Gamma-secretase in vitro screening assay - Google Patents
Gamma-secretase in vitro screening assayInfo
- Publication number
- EP1407043A2 EP1407043A2 EP02745414A EP02745414A EP1407043A2 EP 1407043 A2 EP1407043 A2 EP 1407043A2 EP 02745414 A EP02745414 A EP 02745414A EP 02745414 A EP02745414 A EP 02745414A EP 1407043 A2 EP1407043 A2 EP 1407043A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- ctfγ
- secretase activity
- secretase
- substrate
- activity
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 102000002659 Amyloid Precursor Protein Secretases Human genes 0.000 title claims description 110
- 108010043324 Amyloid Precursor Protein Secretases Proteins 0.000 title claims description 110
- 238000000338 in vitro Methods 0.000 title description 21
- 238000007423 screening assay Methods 0.000 title description 11
- 230000000694 effects Effects 0.000 claims abstract description 82
- 238000000034 method Methods 0.000 claims abstract description 46
- 239000000126 substance Substances 0.000 claims abstract description 43
- 239000000758 substrate Substances 0.000 claims abstract description 33
- 238000012360 testing method Methods 0.000 claims abstract description 24
- 210000004900 c-terminal fragment Anatomy 0.000 claims abstract description 16
- 238000012216 screening Methods 0.000 claims abstract description 5
- DZHSAHHDTRWUTF-SIQRNXPUSA-N amyloid-beta polypeptide 42 Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)CC)C(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C(C)C)C1=CC=CC=C1 DZHSAHHDTRWUTF-SIQRNXPUSA-N 0.000 claims description 114
- 238000003776 cleavage reaction Methods 0.000 claims description 61
- 230000007017 scission Effects 0.000 claims description 61
- 210000004027 cell Anatomy 0.000 claims description 52
- 239000012528 membrane Substances 0.000 claims description 41
- 150000001413 amino acids Chemical class 0.000 claims description 40
- 238000003556 assay Methods 0.000 claims description 22
- 239000012634 fragment Substances 0.000 claims description 20
- 238000003119 immunoblot Methods 0.000 claims description 16
- 238000002360 preparation method Methods 0.000 claims description 14
- 230000002401 inhibitory effect Effects 0.000 claims description 11
- 208000024827 Alzheimer disease Diseases 0.000 claims description 9
- 238000013537 high throughput screening Methods 0.000 claims description 9
- 230000002255 enzymatic effect Effects 0.000 claims description 8
- 238000011534 incubation Methods 0.000 claims description 6
- 238000002965 ELISA Methods 0.000 claims description 5
- 210000003734 kidney Anatomy 0.000 claims description 4
- 208000015122 neurodegenerative disease Diseases 0.000 claims description 4
- 239000003814 drug Substances 0.000 claims description 3
- 239000008194 pharmaceutical composition Substances 0.000 claims description 3
- 230000004770 neurodegeneration Effects 0.000 claims description 2
- 102400000575 C99 Human genes 0.000 description 43
- 101800001517 C99 Proteins 0.000 description 43
- 229940024606 amino acid Drugs 0.000 description 34
- 238000004519 manufacturing process Methods 0.000 description 19
- DWJXYEABWRJFSP-XOBRGWDASA-N DAPT Chemical compound N([C@@H](C)C(=O)N[C@H](C(=O)OC(C)(C)C)C=1C=CC=CC=1)C(=O)CC1=CC(F)=CC(F)=C1 DWJXYEABWRJFSP-XOBRGWDASA-N 0.000 description 14
- 238000011977 dual antiplatelet therapy Methods 0.000 description 14
- 108090000623 proteins and genes Proteins 0.000 description 14
- 230000002797 proteolythic effect Effects 0.000 description 14
- 102000004169 proteins and genes Human genes 0.000 description 13
- 239000003112 inhibitor Substances 0.000 description 12
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 12
- 238000006243 chemical reaction Methods 0.000 description 11
- 238000001514 detection method Methods 0.000 description 11
- 238000001114 immunoprecipitation Methods 0.000 description 11
- 230000001419 dependent effect Effects 0.000 description 10
- 238000001727 in vivo Methods 0.000 description 10
- 239000000047 product Substances 0.000 description 10
- 102000013455 Amyloid beta-Peptides Human genes 0.000 description 9
- 108010090849 Amyloid beta-Peptides Proteins 0.000 description 9
- 108010070047 Notch Receptors Proteins 0.000 description 9
- 101710205482 Nuclear factor 1 A-type Proteins 0.000 description 9
- 102100022165 Nuclear factor 1 B-type Human genes 0.000 description 9
- 101710170464 Nuclear factor 1 B-type Proteins 0.000 description 9
- 101710113455 Nuclear factor 1 C-type Proteins 0.000 description 9
- 101710140810 Nuclear factor 1 X-type Proteins 0.000 description 9
- 108010064539 amyloid beta-protein (1-42) Proteins 0.000 description 9
- 239000013311 covalent triazine framework Substances 0.000 description 9
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 9
- 239000003540 gamma secretase inhibitor Substances 0.000 description 9
- 230000035772 mutation Effects 0.000 description 9
- 108090000765 processed proteins & peptides Proteins 0.000 description 9
- 108010050254 Presenilins Proteins 0.000 description 8
- 102000015499 Presenilins Human genes 0.000 description 8
- 108010064397 amyloid beta-protein (1-40) Proteins 0.000 description 8
- 210000004556 brain Anatomy 0.000 description 8
- 150000001875 compounds Chemical class 0.000 description 8
- 238000012545 processing Methods 0.000 description 8
- 230000002829 reductive effect Effects 0.000 description 8
- 230000015556 catabolic process Effects 0.000 description 7
- 238000006731 degradation reaction Methods 0.000 description 7
- 238000002474 experimental method Methods 0.000 description 7
- 230000005764 inhibitory process Effects 0.000 description 7
- 102000014736 Notch Human genes 0.000 description 6
- 210000004899 c-terminal region Anatomy 0.000 description 6
- 239000006228 supernatant Substances 0.000 description 6
- 238000005199 ultracentrifugation Methods 0.000 description 6
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 5
- 102100022033 Presenilin-1 Human genes 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- 238000005119 centrifugation Methods 0.000 description 5
- 230000001086 cytosolic effect Effects 0.000 description 5
- 238000000099 in vitro assay Methods 0.000 description 5
- 229930182817 methionine Natural products 0.000 description 5
- 239000008188 pellet Substances 0.000 description 5
- 229940125373 Gamma-Secretase Inhibitor Drugs 0.000 description 4
- 239000000872 buffer Substances 0.000 description 4
- 239000002299 complementary DNA Substances 0.000 description 4
- 239000011539 homogenization buffer Substances 0.000 description 4
- 239000000203 mixture Substances 0.000 description 4
- 230000037361 pathway Effects 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 238000001262 western blot Methods 0.000 description 4
- CFBILACNYSPRPM-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;2-[[1,3-dihydroxy-2-(hydroxymethyl)propan-2-yl]amino]acetic acid Chemical compound OCC(N)(CO)CO.OCC(CO)(CO)NCC(O)=O CFBILACNYSPRPM-UHFFFAOYSA-N 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 102000005650 Notch Receptors Human genes 0.000 description 3
- 102000035195 Peptidases Human genes 0.000 description 3
- 108091005804 Peptidases Proteins 0.000 description 3
- 239000007983 Tris buffer Substances 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 229940125904 compound 1 Drugs 0.000 description 3
- 239000003636 conditioned culture medium Substances 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 239000000499 gel Substances 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 235000019833 protease Nutrition 0.000 description 3
- 239000011535 reaction buffer Substances 0.000 description 3
- 239000011541 reaction mixture Substances 0.000 description 3
- 239000001509 sodium citrate Substances 0.000 description 3
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 230000036962 time dependent Effects 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 3
- -1 1 ,1-dimethylethoxy Chemical group 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 230000007351 Aβ plaque formation Effects 0.000 description 2
- 102100021257 Beta-secretase 1 Human genes 0.000 description 2
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 2
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 2
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 2
- 101000894895 Homo sapiens Beta-secretase 1 Proteins 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 108060001084 Luciferase Proteins 0.000 description 2
- 239000005089 Luciferase Substances 0.000 description 2
- 239000007993 MOPS buffer Substances 0.000 description 2
- 239000012083 RIPA buffer Substances 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- 239000012190 activator Substances 0.000 description 2
- 239000012131 assay buffer Substances 0.000 description 2
- 238000002820 assay format Methods 0.000 description 2
- 238000003149 assay kit Methods 0.000 description 2
- 239000012911 assay medium Substances 0.000 description 2
- 102000005936 beta-Galactosidase Human genes 0.000 description 2
- 108010005774 beta-Galactosidase Proteins 0.000 description 2
- 230000008827 biological function Effects 0.000 description 2
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 239000013068 control sample Substances 0.000 description 2
- 210000005220 cytoplasmic tail Anatomy 0.000 description 2
- 238000004925 denaturation Methods 0.000 description 2
- 230000036425 denaturation Effects 0.000 description 2
- 231100000673 dose–response relationship Toxicity 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 230000003241 endoproteolytic effect Effects 0.000 description 2
- 238000006911 enzymatic reaction Methods 0.000 description 2
- 210000002950 fibroblast Anatomy 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- 239000005090 green fluorescent protein Substances 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 238000004949 mass spectrometry Methods 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 230000006337 proteolytic cleavage Effects 0.000 description 2
- 230000019491 signal transduction Effects 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- BHQCQFFYRZLCQQ-UHFFFAOYSA-N (3alpha,5alpha,7alpha,12alpha)-3,7,12-trihydroxy-cholan-24-oic acid Natural products OC1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)C(O)C2 BHQCQFFYRZLCQQ-UHFFFAOYSA-N 0.000 description 1
- KSXTUUUQYQYKCR-LQDDAWAPSA-M 2,3-bis[[(z)-octadec-9-enoyl]oxy]propyl-trimethylazanium;chloride Chemical compound [Cl-].CCCCCCCC\C=C/CCCCCCCC(=O)OCC(C[N+](C)(C)C)OC(=O)CCCCCCC\C=C/CCCCCCCC KSXTUUUQYQYKCR-LQDDAWAPSA-M 0.000 description 1
- HJCMDXDYPOUFDY-WHFBIAKZSA-N Ala-Gln Chemical compound C[C@H](N)C(=O)N[C@H](C(O)=O)CCC(N)=O HJCMDXDYPOUFDY-WHFBIAKZSA-N 0.000 description 1
- 208000037259 Amyloid Plaque Diseases 0.000 description 1
- 101710137189 Amyloid-beta A4 protein Proteins 0.000 description 1
- 101710151993 Amyloid-beta precursor protein Proteins 0.000 description 1
- 102100022704 Amyloid-beta precursor protein Human genes 0.000 description 1
- 102000009091 Amyloidogenic Proteins Human genes 0.000 description 1
- 108010048112 Amyloidogenic Proteins Proteins 0.000 description 1
- 108010017640 Aspartic Acid Proteases Proteins 0.000 description 1
- 102000004580 Aspartic Acid Proteases Human genes 0.000 description 1
- 230000007466 Aβ secretion Effects 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 229940123150 Chelating agent Drugs 0.000 description 1
- 239000004380 Cholic acid Substances 0.000 description 1
- 240000004307 Citrus medica Species 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 102000005741 Metalloproteases Human genes 0.000 description 1
- 108010006035 Metalloproteases Proteins 0.000 description 1
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 239000002033 PVDF binder Substances 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 102100022036 Presenilin-2 Human genes 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 230000017488 activation-induced cell death of T cell Effects 0.000 description 1
- 230000003942 amyloidogenic effect Effects 0.000 description 1
- 229940019748 antifibrinolytic proteinase inhibitors Drugs 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 238000000376 autoradiography Methods 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 239000013060 biological fluid Substances 0.000 description 1
- 239000012620 biological material Substances 0.000 description 1
- 230000007321 biological mechanism Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 210000005013 brain tissue Anatomy 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- BHQCQFFYRZLCQQ-OELDTZBJSA-N cholic acid Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 BHQCQFFYRZLCQQ-OELDTZBJSA-N 0.000 description 1
- 229960002471 cholic acid Drugs 0.000 description 1
- 235000019416 cholic acid Nutrition 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 238000013500 data storage Methods 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000000593 degrading effect Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000010217 densitometric analysis Methods 0.000 description 1
- KXGVEGMKQFWNSR-UHFFFAOYSA-N deoxycholic acid Natural products C1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)C(O)C2 KXGVEGMKQFWNSR-UHFFFAOYSA-N 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- DEFVIWRASFVYLL-UHFFFAOYSA-N ethylene glycol bis(2-aminoethyl)tetraacetic acid Chemical compound OC(=O)CN(CC(O)=O)CCOCCOCCN(CC(O)=O)CC(O)=O DEFVIWRASFVYLL-UHFFFAOYSA-N 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 230000008020 evaporation Effects 0.000 description 1
- 230000000367 exoproteolytic effect Effects 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 230000002518 glial effect Effects 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 238000000265 homogenisation Methods 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 230000010189 intracellular transport Effects 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 230000000936 membranestabilizing effect Effects 0.000 description 1
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 1
- 150000004702 methyl esters Chemical class 0.000 description 1
- KRUHEOAODSPEQO-UHFFFAOYSA-N methyl hydrogen sulfate;propane Chemical compound CCC.COS(O)(=O)=O KRUHEOAODSPEQO-UHFFFAOYSA-N 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 210000000287 oocyte Anatomy 0.000 description 1
- 230000009543 pathological alteration Effects 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 229950000964 pepstatin Drugs 0.000 description 1
- 108010091212 pepstatin Proteins 0.000 description 1
- FAXGPCHRFPCXOO-LXTPJMTPSA-N pepstatin A Chemical compound OC(=O)C[C@H](O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)C[C@H](O)[C@H](CC(C)C)NC(=O)[C@H](C(C)C)NC(=O)[C@H](C(C)C)NC(=O)CC(C)C FAXGPCHRFPCXOO-LXTPJMTPSA-N 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 102000004196 processed proteins & peptides Human genes 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 238000002331 protein detection Methods 0.000 description 1
- 230000007026 protein scission Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 239000011550 stock solution Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 238000012036 ultra high throughput screening Methods 0.000 description 1
- 239000013598 vector Substances 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/34—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase
- C12Q1/37—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase involving peptidase or proteinase
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
- G01N2500/04—Screening involving studying the effect of compounds C directly on molecule A (e.g. C are potential ligands for a receptor A, or potential substrates for an enzyme A)
Definitions
- the invention relates to a novel peptide playing an important role in Alzheimer's disease, to screening assays and test kits based on the detection of said novel peptide and to the use thereof for the identification of modulators of ⁇ -secretase activity.
- the invention further relates to inhibitors identified by the above screening assays and to pharmaceutical compositions comprising the inhibitors.
- AD Alzheimer's disease
- Selkoe a major pathological alteration in the brain of AD patients
- FAD familial AD
- a ⁇ is produced from the ⁇ -amyloid precursor protein ( ⁇ APP) by endoproteolysis, whereby at least two proteolytic activities are required for A ⁇ generation: beta-secretase ( ⁇ -secretase; BACE) mediates the N-terminal cleavage producing a membrane associated C-terminal fragment of ⁇ APP, called C99 or CTF ⁇ (SEQ ID NO:2) (Vassar and Citron, 2000).
- C99 is the immediate precursor for the next proteolytic processing step: the (presumably intramembraneous) cleavage of C99 by ⁇ -secretase to A ⁇ and a C-terminal fragment.
- ⁇ -Secretase cleavage of C99 results in the secretion of A ⁇ into biological fluids.
- the C-terminal product of this cleavage previously described as p7 (Haass and Selkoe, 1993) and also called C-terminal fragment gamma (CTF ⁇ ), has so far not been observed in vivo.
- CTF ⁇ C-terminal fragment gamma
- the C-terminus of A ⁇ is heterogenous in that A ⁇ may end at position 40 or at position 42 of its precursor C99.
- CTF ⁇ /59 C-terminal fragments consisting of 59 amino acids
- CTF ⁇ /57 C-terminal fragments consisting of 57 amino acids
- a peptide supposed to be CTF ⁇ /59 or CTF ⁇ /57 has been observed in vitro (McLendon et al., 2000; Pinnix et al., 2001).
- ⁇ - secretase activity playing a key role in A ⁇ plaque formation, might be a major target for new therapeutical, especially pharmacological, approaches.
- Pinnix et al. (2001 ) describe experiments designed to detect a C-terminal fragment of ⁇ APP derived from guinea pig brain.
- the fragment obtained therein is characterized as a peptide consisting of 57 amino acids.
- the technical problem underlying the present invention is to provide novel methods and means for the development of therapies of Alzheimer's disease and other neurodegenerative disorders in which A ⁇ - plaque formation and/or ⁇ - secretase activity is involved.
- a method for identifying substances capable of modulating the activity of ⁇ -secretase comprising the steps: providing a source of ⁇ -secretase activity, providing a substrate of ⁇ - secretase activity having a cleavage site corresponding to the naturally occuring cleavage site between amino acid 49 and amino acid 50 of the substrate C99, incubating said source and said substrate with a test substance under conditions allowing enzymatic activity of said ⁇ -secretase activity, and determining ⁇ -secretase activity by detecting the C-terminal fragment (and especially the amount thereof) released due to the proteolytic acitivity of said ⁇ - secretase activity.
- the N-terminus of the previously unknown C-terminal fragment corresponds to amino acid 50 of C99.
- the invention is based on the surprising finding that an enzymatic cleavage of C99 between its amino acids 49 and 50 is involved in the processing of C99 to A ⁇ .
- the inventors have discovered and characterized the product of this processing step, now called CTF ⁇ /50 (amino acid sequence: VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN; SEQ ID NO:1 ; N-terminus corresponding to amino acid 50 of C99). They have demonstrated that a ⁇ -secretase activity is responsible for this processing step.
- CTF ⁇ /50 is an immediate product of ⁇ - secretase activity acting on C99 and not the product of a further degradation of the previously described CTF ⁇ /57 or CTF ⁇ /59.
- ⁇ -secretase activity acts at a previously unknown cleavage site of C99.
- the identification of this proteolytic activity offers a novel approach for the pharmaceutical modulation of the enzymatic reactions involved in A ⁇ production and, thus, for therapeutical intervention.
- ⁇ -secretase activity has been determined by measuring release of A ⁇ (Wolfe et al., 1999; WO 01/16355).
- formation of the known A ⁇ variants A ⁇ 40 (C-teminus at position 40 of C99) and A ⁇ 42 (C-terminus at position 42 of C99) reflects a cleavage between amino acids 40 and 41 and between amino acids 42 and 43 of C99, respectively.
- these methods do not allow the assessment of the proteolytic activity at the cleavage site between amino acids 49 and 50.
- This difference is of great importance as release of A ⁇ 40 and A ⁇ 42 possibly requires an additional (exo)peptidase activity which might interfere with the ⁇ -secretase activity to be determined.
- screening assays for the detection of modulators of ⁇ -secretase activity that are based on the determination of cleavage products which are not the immediate products of said activity but result from additional cleavage events might give misleading data as it is unclear whether said modulators act on said ⁇ -secretase activity or on other enzymatic activities involved in A ⁇ formation.
- CTF ⁇ /50 being a processing product not only in the BACE / ⁇ -secretase pathway but also in the ⁇ -secretase / ⁇ -secretase pathway, can be easily assessed in in vitro assays, e.g. by immunoblotting or ELISA. Thus, determination of the amount of CTF ⁇ /50 released can be used as a simple and cost-effective read-out in methods for the identification of substances that modulate ⁇ -secretase activity.
- a ⁇ 40 production vis-a-vis A ⁇ 42 production is an unclarified issue.
- candidate inhibitors seem to inhibit A ⁇ 40 release but stimulate A ⁇ 42 secretion. It may be hypothesized that such substances might specifically inhibit an (exo)peptidase acting downstream of ⁇ - secretase activity, i.e. further degrading A ⁇ 42 to A ⁇ 40.
- the method according to the invention would not be affected by this phenomenon as only substances specifically inhibiting ⁇ -secretase activity would be detected.
- the method according to the invention allows the specific identification of substances which interfere with the previously unknown cleavage between amino acids 49 and 50 of C99 but not with other endo- or exoproteolytic activities that might be involved in the ⁇ APP processing pathway.
- Fig. 1 Identification of in vivo produced CTF ⁇ in human cells and mouse brain according to Example 1 :
- A Membrane fractions of HEK 293 cells stably transfected with Swedish mutant ⁇ APP ⁇ gs (swAPP) were analyzed by combined immunoprecipitation/immunoblotting with antibody 6687 to the C-terminus of ⁇ APP.
- the same ⁇ APP CTFs including the approximately 6 kDa CTF ⁇ were also observed by immunoblotting with antibody 6687 in mouse brain.
- B The ⁇ -secretase inhibitor DAPT inhibits CTF ⁇ production.
- HEK 293 cells stably transfected with swAPP were treated with the indicated concentrations of DAPT for 4h.
- Upper and middle panel Membrane fractions were prepared and analyzed for ⁇ APP CTFs by combined immunoprecipitation/immunoblotting with antibody 6687. Increasing concentrations of DAPT lead to a build up of CTF ⁇ and CTF ⁇ (upper panel) with a concomitant significant block of CTF ⁇ generation (middle panel).
- Lower panel Conditioned media were analyzed for secreted A ⁇ by combined immunoprecipitation/immunoblotting with antibodies 3926/6E10. The same dose dependent inhibition of CTF ⁇ production by DAPT was observed for A ⁇ generation.
- FIG. 2 In vitro generation of CTF ⁇ according to Example 1 : (A) Time dependent in vitro production of CTF ⁇ . Membrane preparations were incubated at 37°C for the indicated time points. The reaction mixtures were then separated in a soluble fraction (S100; lower panel) and a pellet fraction (P100; upper panel) by ultracentrifugation.
- Compound 1 inhibit the in vitro production of CTF ⁇ .
- Membrane preparations were incubated with (+) or without (-) 250 nM DAPT (left panel) or 50 ⁇ M CM256 (right panel).
- the S100 fractions of the reaction mixtures were immunoblotted with antibody 6687. Note that both inhibitors significantly reduce CTF ⁇ generation.
- C In vitro generation of CTF ⁇ depends on biologically active presenilins. Left panel: time dependent in vitro production of CTF ⁇ by membrane preparations derived from cells expressing PS1 wt. Right panel: Inhibition of CTF ⁇ production in membrane preparations derived from cells expressing the biologically inactive PS1 D385N mutation.
- ⁇ APP CTFs were identified by immunoblotting with antibody 6687.
- D The ⁇ -secretase inhibitor DAPT reduces the remaining in vitro CTF ⁇ production observed in C (right panel).
- Left panel time dependent in vitro production of CTF ⁇ by membrane preparations derived from cells expressing PS1 wt in the presence (+) or absence (-) of 250 nM DAPT.
- Right panel Inhibition of CTF ⁇ production in membrane preparations derived from cells expressing the biologically inactive PS1 D385N mutation in the presence (+) or absence (-) of 250 nM DAPT.
- ⁇ APP CTFs were identified by immunoblotting with antibody 6687.
- Fig. 3 Radiosequencing and mass spectrometry analysis of CTF ⁇ as described in Example 1.
- A CTF ⁇ generated in vitro from membrane preparations of 35 S- methionine labeled HEK 293 cells stably expressing swAPP was subjected to radiosequencing. A major methionine peak was observed at cycle 2 and a second peak at cycle 32 of the Edman degradation. The corresponding amino acid sequence of CTF ⁇ starting at valine 50 is shown below.
- B In vivo detection of a truncated CTF ⁇ in living HEK 293 cells stably overexpressing swAPP.
- Fig. 4 Illustration of the similarity of endoproteolytic processing of ⁇ APP and Notch as mentioned in Example 1. Human ⁇ APP is presumably cleaved after position 40, 42 and 49 of the ⁇ -amyloid domain. Mouse Notchl is cleaved PS dependent after amino acid 1743 (Schroeter et al., 1998).
- the amino acid abbreviations are according to the standard one or three letter code.
- the numbering of the amino acids in A ⁇ , in other fragments of C99 and in C99 itself is based on C99, i.e. the N-terminal amino acid of C99 is amino acid no. 1 and so on.
- the sequence of C99 is:
- ⁇ APP is meant to encompass naturally occuring human full length ⁇ APP, any known splice variant thereof (including e.g. splice variants APP 6 95, APP751 and APP770; cf. e.g. NCBI database entry P05067), any naturally occuring variation or mutation thereof (such as the so-called “Swedish mutation” ⁇ APP, swAPP (Citron et al., 1992), and corresponding molecules of other species, as long as they may serve as a substrate for ⁇ -secretase activity in an assay as described hereafter, i.e.
- ⁇ APP is also meant to encompass the genuine substrates of ⁇ -secretase activity, i.e. C99 and C83 and respective variants and derivatives.
- C99 and C83 can be provided to the assay either directly in the form of C99 or C83 or, alternatively, in the form of a full-length ⁇ APP being processed "in situ" to C99 or C83.
- ⁇ APP may also stand for a fragment and for a modified (e.g. genetically engineered or chemically modified) derivative of full-length ⁇ APP, C99 or C83, as long as such a fragment or derivative may serve as substrate for ⁇ -secretase activity in an assay as described hereafter.
- Genetically engineered ⁇ APP may be a ⁇ APP in the above defined sense and modified by amino acid substitutions, deletions or insertions, under the proviso that the screening method according to the invention can still be performed therewith.
- a modified ⁇ APP not comprising a cleavage site corresponding to the cleavage site identified by the inventors or a modified ⁇ APP targeted to cellular compartments where no ⁇ -secretase activity is present would not be suited to the method of the invention.
- genetically engineered ⁇ APP might be a ⁇ APP fused with a reporter protein such as green fluorescent protein, luciferase, ⁇ -galactosidase and so on.
- swAPP 695 is especially preferred in an assay as described hereafter, because it is a better substrate for ⁇ -secretase than wild type APP, thus providing high levels of C99, the immediate substrate of ⁇ -secretase activity.
- ⁇ -secretase activity means in the context of this invention any proteolytic activity that is capable of cleaving the substrate C99 between amino acids 49 and 50 and whose physiological substrate is C99 in its physiological environment (e.g. in cell membranes).
- ⁇ -secretase activity may be the proteolytic activity presently ascribed to the not yet fully characterized ⁇ - ' secretase per se, a proteolytic activity of ⁇ -secretase in combination with one or more presenilins or, if applicable, presenilin activity per se.
- the term "source of ⁇ -secretase activity” comprises any biological material such as cells, homogenized cells, enriched membrane fractions, purified membranes, protein fractions, proteins reconstituted in membranes etc. which possess ⁇ - secretase activity.
- the source are human embryonic kidney (HEK) 293 cells, more preferably membrane preparations thereof that can be obtained e.g. as described in Example 1.
- HEK human embryonic kidney
- the methods for the purification of membranes are known in the art (cf. e.g. Methods in Enzymology, Vol. 219: “Reconstitution of intracellular Transport” and T.G. Cooper: “Biochemische vonmethoden", De Gruyter Verlag, 1981).
- substrate of ⁇ -secretase activity is meant to encompass “ ⁇ APP” according to the definition above as well as artificially designed proteins that encompass the cleavage site detected by the inventors.
- the cleavage site may be defined by the sequence ITLVML (SEQ ID NO: 3) or VIVITLVMLKKK (SEQ ID NO: 4).
- swAPP 695 over)expressed in e.g. HEK 293 cells (and endogenously cleaved to C99) is the substrate of ⁇ -secretase activity.
- substance capable of modulating ⁇ -secretase activity means naturally occurring and synthetic compounds capable of activating or inhibiting enzymatic ⁇ -secretase activity as defined above, whereby substances unspecifically interfering with enzymatic reactions (such as e.g. agents that cause denaturation of proteins) should, of course, not be encompassed. Persons skilled in the art will be able to differentiate between specific and unspecific inhibition or activation of enzymatic activity.
- fragment beginning with a sequence corresponding to the N-terminal sequence of CTF ⁇ /50 encompasses, of course, CTF ⁇ /50 itself.
- a ⁇ APP modified C-terminal of the cleavage site identified by the inventors is used as a substrate for ⁇ -secretase activity, a modified C- terminal fragment will result that will have to be detected according to the method of the invention.
- said fragment originates from proteolytic cleavage of a ⁇ APP as defined above at the cleavage site identified by the inventors, i.e. the site corresponding to amino acids 49 and 50 of C99.
- condition allowing enzymatic activity of ⁇ -secretase activity means that reaction conditions are chosen under which proteolytic cleavage by ⁇ - secretase activity is enabled. Examples for such conditions are given below.
- the substrate of ⁇ -secretase activity is an endogenous ⁇ APP that is constitutively expressed in the cell.
- cells expressing an exogenous ⁇ APP are used. Especially preferred is exogenous swAPP 695 . Expression of exogenous ⁇ APP may be achieved by transfecting cells with a gene coding for ⁇ APP in a suitable expression vector. Endogenous and exogenous substrates are described in detail in WO 01/16355.
- ⁇ APP substrate is a fusion protein of a reporter protein with e.g. wild-type ⁇ APP, swAPP or C99.
- reporter proteins are green fluorescent protein, luciferase, ⁇ - galactosidase, etc.
- the cell line used in the example below is HEK 293.
- other cells and cell lines such as H4, U373, NT2, PC12, COS, CHO, fibroblasts, myeloma cells, neuroblastoma cells, hybridoma cells, oocytes, empryonic stem cells and so on can be used as well. Cells and cell lines of neuronal or glial origin or fibroblasts are especially preferred.
- cells and tissues of the brain as well as homogenates and membrane preparations thereof may be used.
- CTF ⁇ /50 or of a fragment beginning with a sequence corresponding to the N-terminal sequence of CTF ⁇ /50 can be performed by immunoblotting/western blotting, by ELISA and other suitable peptide or protein detection methods known in the art.
- Antibodies useful for the detection of CTF ⁇ /50 are, e.g., polyclonal antibody 6687 binding to the last 20 C-terminal amino acids of ⁇ APP (Steiner et al., 2000) and SAD3128 available from LABGEN®.
- a ⁇ APP fused to a reporter protein as mentioned above it is possible to estimate the amount of cleaved substrate by detection of the reporter protein. In this case, a separation of cleaved and uncleaved substrate followed by the respective detection method depending on the reporter protein might be performed.
- a source of ⁇ -secretase activity and a substrate thereof are incubated with a test substance under conditions allowing enzymatic activity of the source of ⁇ -secretase activity.
- the amount of substrate cleaved in presence of the test substance is determined by measuring the amount of CTF ⁇ /50 (or a derivative thereof, respectively, if a derivative of C99 or ⁇ APP has been used as the substrate) produced.
- the amount of CTF ⁇ /50 (or derivative) released during the incubation step reflects the activity of ⁇ -secretase activity acting at the cleavage site of ⁇ APP as defined above.
- control experiments will be included in the assay, wherein the experiment described before will be performed under essentially the same conditions as above but without addition of said test substance or with addition of a substance known to have no effect on ⁇ -secretase activity.
- the results of both experiments will be compared and a reduced amount of released CTF ⁇ /50 (or the derivative) will be indicative of an inhibitory effect of the test substance on ⁇ -secretase activity (inhibitor), whereas an increased amount of CTF ⁇ /50 indicates that the test substance activates said activity (activator).
- said test substance is classified as "modulator".
- a broad range of buffers can be used.
- a reaction buffer having a pH in the range of 5 to 10, more preferably in the range of 6 to 8 and most preferably in the range of 6.3 to 6.9 may be used.
- a suitable buffer is 150 mM sodium citrate, pH 6.4.
- the reaction temperature may be selected, for example, in the range of 20 °C to 37 °C. A higher temperature might result in denaturation of proteins, a lower temperature will result in a decrease of the speed of the reaction.
- the reaction mixture may additionally comprise membrane stabilizing agents such as sucrose and sorbitol, preferably in an amount of 200 to 1000 mM, more preferably in an amount of 200 to 500 mM and most preferably in an amount of 200 to 300 mM.
- the reaction buffer may contain proteinase inhibitors, e.g. the "PI Complete" mix, available from Roche®, and EDTA. EDTA serves to inhibit metalloproteinases responsible for the degradation of CTF ⁇ .
- Said proteinase inhibitor mix does not include pepstatin which is an inhibitor of ⁇ -secretase activity.
- an assay based on the method according to the invention will be used in a two step analysis of test substances:
- several assays are known in the art in which ⁇ -secretase activity is measured by assessing release of A ⁇ (Wolfe et al., 1999; "A ⁇ release based assays").
- a ⁇ release might be the result of an at least two-step cleavage process: one cleavage occuring at the site identified by the inventors (amino acid 49 / 50 of C99), the other at site 40 / 41 (resulting in A ⁇ 40) or site 42 / 43 (resulting in A ⁇ 42) of C99.
- a ⁇ release based assays do not discriminate between inhibitors (or, more generally, modulators) of these two cleavage activities.
- the known A ⁇ release based assay By coupling the known A ⁇ release based assay to the assay according to the invention, it is possible to make said discrimination. For example, it is possible to first identify inhibitors by performing the A ⁇ release based assay and, afterwards, including test substances having shown to be effective in said first assay in the second assay based on the method according to the invention. Substances not being effective in said second assay can be classified as substances modulating the proteolytic activity acting at amino acids 40 / 41 or 42 / 43, whereas substances found to be effective in both assays act on cleavage site 49 / 50.
- the two-step assay outlined above is of great importance because of the following reason: as discovered by the inventors, the cleavage site 49 / 50 in C99 shows similarity to the known S3 cleavage site of Notch protein (Schroeter et al., 1998). If both cleavage events are mediated by the same or closely related proteinases, it is expected that substances inhibiting cleavage of C99 at site 49 / 50 might also inhibit Notch protein cleavage, possibly resulting in severe and undesirable side-effects of medicaments ultimately derived from a respective substance.
- the novel screening method has the additional advantage that it provides a means for the discrimination between substances that are suspected to affect Notch protein proteolysis and substances not expected to do so.
- HTS high throughput screening
- a method according to the invention is a high throughput screening (HTS) method.
- HTS relates to an experimental setup wherein a large number of compounds is tested simultaneously.
- said HTS setup may be carried out in microplates, may be partially or fully automated and may be linked to electronic devices such as computers for data storage, analysis, and interpretation using bioinformatics.
- said automation may involve robots capable of handling large numbers of microplates and capable of carrying out several thousand tests per day.
- a test compound which is known to show the desired modulating or inhibitory function will also be included in the assay as a positive control.
- the term HTS also comprises ultra high throughput screening formats (UHTS).
- said UHTS formats may be carried out using 384- or 1536-well microplates, sub-microliter or sub-nanoliter pipettors, improved plate readers and procedures to deal with evaporation.
- HTS methods are described e.g. in US 5,876,946 and US 5,902,732.
- the expert in the field can adapt the method described below to a HTS or UHTS format without the need of carrying out an inventive step.
- the source of ⁇ -secretase activity e.g. membrane preparations
- the substrate of ⁇ -secretase activity e.g. C99 or a modified derivative as outlined above
- a reaction buffer and a means for specifically detecting the reaction product CTF ⁇ /50 may be assembled to a test kit.
- the detection means may be a monoclonal or a polyclonal antibody or derivative specifically reacting with CTF ⁇ /50.
- the test kit may additionally comprise microtiter plates, labeled second antibodies used for immunoblotting / western blotting techniques (known in the art), reaction vessels, blotting membranes, buffers etc.
- inhibitors such at DAPT (N-[N-(3,5-difluorophenacetyl)-L-alanyl]-S- phenylglycin t-butyl ester) and "Compound 1" (N-[(1 ,1-dimethylethoxy)carbonyl]- L-valyl-(4S,5S)-4-amino-2,2-difluoro-5-methyl-3-oxoheptanoyl-L-valyl-L- Isoleucine methyl ester; also called CM256) will be excluded from the scope of protection.
- compositions comprising substances identified with the method according to the invention and pharmaceutical acceptable carriers or excipients.
- a pharmaceutically acceptable carrier can contain physiologically acceptable compounds that act, for example, to stabilize or to increase the absorption of a substance capable of inhibiting ⁇ -secretase activity.
- physiologically acceptable compounds include, for example, carbohydrates such as glucose, sucrose or dextrans, antioxidants such as ascorbic acid or glutathione, chelating agents, low molecular weight proteins or other stabilizers or excipients (as disclosed e.g. in Remington's Pharmaceutical Sciences (1990), 18 th ed., Mack Publ., Easton).
- the person skilled in the art will know that the choice of a pharmaceutically acceptable carrier, including a physiologically acceptable compound, depends, for example, on the route of administration of the composition.
- a substance identified with the method according to the invention is used for the preparation of a medicament for the treatment of neurodegenerative diseases, especially Alzheimer's disease.
- the invention provides the previously unknown CTF ⁇ /50 (SEQ ID No. 1 ). It is clear that allelic variations and functionally equivalent derivatives thereof will also be encompassed by the invention. Examples
- Human embryonic kidney 293 (HEK 293) cells expressing swAPP were generated and cultured as described (Steiner et al., 2000).
- HEK 293 cells were transiently transfected with cDNA encoding recombinant CTF ⁇ 57 using DOTAP (liposome formulation of the monocationic lipid N-[1-(2,3-Dioleoyloxy)]-N,N,N-trimethylammonium propane methylsulfate in water; Roche) according to the supplier ' s instructions.
- DOTAP liposome formulation of the monocationic lipid N-[1-(2,3-Dioleoyloxy)]-N,N,N-trimethylammonium propane methylsulfate in water; Roche
- a cDNA encoding recombinant CTF ⁇ 57 was amplified by PCR and cloned into pcDNA3 vector (Invitrogen) as an Hindlll and Xbal fragment.
- Recombinant CTF ⁇ 57 consists of an N-terminal methionine followed by the C-terminus of ⁇ APP starting at position 43 of the ⁇ -amyloid domain.
- Antibodies The polyclonal antibodies 6687 to the last 20 C-terminal amino acids of ⁇ APP (Steiner et al., 2000) and 3926 to A ⁇ 1-42 (Wild-Bode et al., 1997) have been described.
- DAPT N-[N-(3,5-difluorophenacetyl)-L- alanyl]-S-phenylglycin t-butyl ester
- CM256 N-[(1,1- dimethylethoxy)carbonyl]-L-valyl-(4S,5S)-4-amino-2,2-difluoro-5-methyl-3- oxoheptanoyl-L-valyl-L-lsoleucine methyl ester; gift from Dr. M. Wolfe), previously designated "Compound 1" (Esler et al., 2000), that were diluted from stock solutions in DMSO to the concentrations described.
- a ⁇ was immunoprecipitated from conditioned media collected for 4 h with antibody 3926, separated on Tris-Tricine gels and detected by immunoblotting with antibody 6E10 using a chemiluminescent detection system (Tropix, USA).
- CTF ⁇ was analyzed by combined immunoprecipitation/westernblotting with antibody 6687 of membrane extracts from stably transfected HEK 293 cells or from mouse brain. Briefly, homogenates of cells or brain tissue were prepared in hypotonic buffer (10 mM Tris, pH 7.4, 1 mM EDTA, 1 mM EGTA, pH 7.0) containing 1x protease inhibitors (PI) (Complete, Roche) as described (Steiner et al., 1998). Following homogenization membranes were isolated from the postnuclear supernatant (PNS) by centrifugation at 16.000 g for 45 min at 4°C.
- PPS postnuclear supernatant
- the membranes were resuspended in RIPA buffer (150 mM NaCI, 10 mM Tris, 1% NP-40, 0.5% cholic acid, 0.1% SDS, 5 mM EDTA, pH 8.0, 1x PI) following a clarifying spin at 16.000 g for 10 min at 4°C, and subjected to immunoprecipitation with antibody 6687.
- RIPA buffer 150 mM NaCI, 10 mM Tris, 1% NP-40, 0.5% cholic acid, 0.1% SDS, 5 mM EDTA, pH 8.0, 1x PI
- lysates were prepared with RIPA buffer 48 h after transfection and subjected to immunoprecipitation with antibody 6687.
- CTF ⁇ was generated in vitro from membrane preparations of HEK 293 cells stably transfected with swAPP following previously described procedures (McLendon et al., 2000; Pinnix et al., 2001 ). In brief, cells were resuspended (0.5 ml/10-cm dish) in homogenization buffer (10 mM MOPS, pH 7.0, 10 mM KCI, 1x PI). Cell homogenates and a PNS were prepared as described (Steiner et al., 1998).
- Membranes were pelleted from the PNS by centrifugation for 20 min at 16.000 g at 4°C, washed with homogenization buffer and resuspended (50 ⁇ l/10-cm dish) in assay buffer (150 mM sodium citrate, pH 6.4, 1x PI). To allow generation of CTF ⁇ , samples were incubated at 37°C for the indicated time points in a volume of 25 ⁇ l/assay. Control samples were kept on ice. After termination of the assay reactions on ice, samples were separated into pellet (P100) and supernatant (S100) fractions by ultracentrifugation for 1 h at 100.000 g at 4°C. Following SDS-PAGE on 10-20% Tris-Tricine gels (Invitrogen) samples were analyzed for CTF ⁇ by immunoblotting with antibody 6687.
- assay buffer 150 mM sodium citrate, pH 6.4, 1x PI
- CTF ⁇ was then generated in vitro from membrane preparations as described above except that after termination of CTF ⁇ generation the assay reactions were separated into pellet (P16 ⁇ and supernatant (S16) fractions by centrifugation at 16.000 g for 30 min at 4°C. After isolation of CTF ⁇ from S16 by immunoprecipitation with antibody 6687 immunocomplexes were separated by SDS-PAGE on 10-20% Tris-Tricine gels (Invitrogen) and blotted onto a PVDF membrane. After autoradiography, the CTF ⁇ band was excised and subjected to radiosequencing by automated Edman degradation as described (Haass et al., 1992).
- PS mediated ⁇ -secretase cleavage does not only result in the generation of soluble A ⁇ but also in the generation of a ⁇ APP C-terminal fragment (CTF ⁇ ) representing the counterpart of A ⁇ .
- CTF ⁇ C-terminal fragment
- two species of CTF ⁇ have been postulated, CTF ⁇ /57 and CTF ⁇ /59, respectively.
- C-terminal fragments of ⁇ APP were immunoprecipitated from membrane fractions of human embryonic kidney 293 (HEK 293) cells stably transfected with ⁇ APP ⁇ gs carrying the Swedish mutation (swAPP) (Citron et al., 1992).
- PS1 D385N acts like a dominant negative mutation that inhibits the biological function of PSs required for the ⁇ -secretase cleavage of ⁇ APP.
- a strong increase of ⁇ APP CTF ⁇ and CTF ⁇ was observed, indicating a significant inhibition of ⁇ - secretase cleavage (Fig. 1C).
- generation of CTF ⁇ was strongly reduced (Fig. 1C).
- Membranes from HEK 293 cells stably expressing swAPP were incubated under the conditions described under item "Generation and analysis of CTF ⁇ in vitro" above in the presence of a protease inhibitor cocktail (McLendon et al., 2000; Pinnix et al., 2001). After termination of the in vitro assay, membranes were separated by ultracentrifugation. The pellet (P100) and the supernatant (S100) fraction were analyzed for the presence of ⁇ APP CTFs. CTF ⁇ and CTF ⁇ were predominantly observed within the P100 fraction (Fig. 2A; upper panel), whereas CTF ⁇ was significantly enriched in the S100 fraction (Fig. 2A; lower panel).
- the inventors then used the in vitro assay to isolate sufficient amounts of CTF ⁇ to allow the further structural characterization of this peptide.
- attempts to perform mass spectroscopy with the isolated peptide were unsuccessful for unknown reasons.
- the inventors tried to determine the sequence of the peptide's N-terminus by radiosequencing.
- HEK 293 cells stably expressing swAPP were metabolically labeled with 35 S- methionine. Radiolabeled CTF ⁇ was generated in vitro as described above. After ultracentrifugation, CTF ⁇ was immunoprecipitated from the S100 fraction with antibody 6687 to the last 20 amino acids of ⁇ APP.
- Radiolabeled CTF ⁇ was then subjected to automated Edman degradation (Haass et al., 1992). Surprisingly, this revealed a major peak of radioactivity in fraction 2 and not in fractions 9 and 11 as one would have expected for a CTF ⁇ beginning at position , 41 or 43 (Fig. 3A). This indicates that CTF ⁇ is generated by a proteolytic
- the N-terminus of CTF ⁇ is located at a position, which is homologous to the PS dependent S3 cleavage of Notch (Fig. 4).
- the S3 cleavage of Notch occurs right at the cytoplasmic boarder of the membrane (Schroeter et al., 1998).
- the novel cleavage site of ⁇ APP may also occur close to the cytoplasmic boarder of the membrane. Based on the results by Tischler et al. (Tischler and Cordell, 1996), the cut between amino acid 49 and 50 would indeed occur within the cytoplasmatic domain.
- cytoplasmatic cleavage would be more likely than an intramembraneous proteolytic cut, which is likely to be inhibited by the higly hydrophobic environment within a phospholipid bilayer.
- a cytoplasmic cleavage may facilitate a shift of the remaining stub into the cytoplasm, where it could easily be attacked by the final ⁇ -secretase cut. Indeed, Murphy et al., 1999, provided evidence for such a model.
- cytoplasmic tail of ⁇ APP requires "shedding" before/during it undergoes the final ⁇ -secretase cut, a phenomenon which would be very similar to the required ectodomain shedding of ⁇ -secretase substrates (Struhl and Adachi, 2000).
- the identification of CTF ⁇ in vivo may also raise the interesting possibility that this fragment similar the Notch intracellular cytoplasmic domain (NICD) may have a biological function in signal transduction. Based on the striking similarity of the biological mechanisms involved in the generation of NICD and CTF ⁇ as well as potentially similar functions in signal transduction, the term AICD for the Amyloid precursor protein intracellular domain is proposed.
- ⁇ -secretase may cut first at position 40/42 of the ⁇ -amyloid domain followed by a second cleavage after position 49 releasing CTF ⁇ from the membrane.
- the data may indicate simultaneous cleavage at all three sites.
- Example 2 Screening assay - medium throughput
- HEK 293 cells stably transfected with ⁇ APP 69 5 carrying the Swedish mutation (swAPP) were grown as described in Citron et al., 1992, i.e. in DMEM with Glutamax (Gibco BRL) containing 10 % FCS, 1 % Penicillin/Streptavidin, 200 ⁇ g/ml G418.
- the cells were resuspended (0.5 ml/10-cm dish) in homogenization buffer (10 mM MOPS, pH 7.0, 10 mM KCI, 1x PI).
- PPS post nuclear supernatant
- Membranes were pelleted from the PNS by centrifugation for 20 min at 16.000 g at 4°C, washed with homogenization buffer and resuspended (50 ⁇ l/10-cm dish) in assay buffer (150 mM sodium citrate, pH 6.4, 1x PI). To allow generation of CTF ⁇ , control samples without added test substance and samples comprising different concentrations of substances to be screened were incubated at 37°C for e.g. 1 h. The reactions were stopped by cooling them to 4 °C.
- the samples are separated into pellet (P100) and supernatant (S100) fractions by ultracentrifugation for 1 h at 100.000 g al 4°C.
- CTF ⁇ /50 is detected and quantified by ELISA using an antibody specific for the N-terminal sequence of CTF ⁇ /50.
- a reduced signal compared to the control sample indicates that the respective test compound inhibits ⁇ -secretase activity acting at amino acid 49 / 50 of C99.
- Example 3 Screening assay - medium throughput
- the screening assay is carried out as described in Example 2 with the exception that instead of the ultracentrifugation step membranes are solubilized by adding STEN - lysis buffer (50 mM Tris, pH 7.6; 150 mM NaCI; 2 mM EDTA; 1 % NP-40 (final)). CTF ⁇ /50 is detected and quantified in this solution by ELISA as described in Example 2.
- STEN - lysis buffer 50 mM Tris, pH 7.6; 150 mM NaCI; 2 mM EDTA; 1 % NP-40 (final)
- the screening assay is carried out as described in Example 2 with the exception that the release of CTF ⁇ /50 is determined by immunoprecipitation and immunoblotting of CTF ⁇ /50 and densitometric analysis of the resulting bands. A reduced signal compared to the control sample indicates that the respective test compound inhibits ⁇ -secretase activity acting at amino acid 49 / 50 of C99.
- Amyloid ⁇ -peptide is produced by cultured cells during normal metabolism. Nature, 359, 322-325.
- Notch-1 signalling requires iigand-induced proteolytic release of intracellular domain. Nature, 393, 382-386.
- Selkoe, D.J. (1999) Translating cell biology into therapeutic advances in Alzheimer's disease. Nature, 399, A23-31.
- Glycine 384 is required for presenilin-1 function and is conserved in polytopic bacterial aspartyl proteases. Nature Cell Biol, 2, 848-851.
- Beta-amyloid precursor protein Location of transmembrane domain and specificity of gamma-secretase cleavage. J Biol Chem. 1996 Sep 6;271(36):21914-9.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Life Sciences & Earth Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- General Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Zoology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Wood Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Microbiology (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Analytical Chemistry (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Hospice & Palliative Care (AREA)
- Psychiatry (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
According to the screening method of the invention substances capable of modulating η-secretase activity are identified by incubating a source and a substrate of η-secretase activity with a test substance and detecting a C-terminal fragment released from said substrate.
Description
γ - Secretase in vitro Screening Assay
The invention relates to a novel peptide playing an important role in Alzheimer's disease, to screening assays and test kits based on the detection of said novel peptide and to the use thereof for the identification of modulators of γ-secretase activity. The invention further relates to inhibitors identified by the above screening assays and to pharmaceutical compositions comprising the inhibitors.
Several documents are cited throughout the text of this specification. Each of the documents cited herein (including any manufacturer's specifications, instructions, etc.) are hereby incorporated by reference; however, there is no admission that any document cited is indeed prior art of the present invention.
Alzheimer's disease (AD) is the most abundant neurodegenerative disorder worldwide. Senile plaques, composed of amyloid β-peptide (Aβ) appear to be a major pathological alteration in the brain of AD patients (Selkoe, 1999). Almost all familial AD (FAD) associated mutations affect the generation of Aβ by increasing the production of the highly amyloidogenic 42 amino acid variant (Selkoe, 1999). Aβ is produced from the β-amyloid precursor protein (βAPP) by endoproteolysis, whereby at least two proteolytic activities are required for Aβ generation: beta-secretase (β-secretase; BACE) mediates the N-terminal cleavage producing a membrane associated C-terminal fragment of βAPP, called C99 or CTFβ (SEQ ID NO:2) (Vassar and Citron, 2000). C99 is the immediate precursor for the next proteolytic processing step: the (presumably intramembraneous) cleavage of C99 by γ-secretase to Aβ and a C-terminal fragment. This cleavage is facilitated by the presenilins, PS1 and PS2, and there is evidence that presenilins themselves could be unusual aspartyl proteases, which mediate the γ-secretase cleavage (Steiner and Haass, 2000; Wolfe and Haass, 2001). An alternative processing pathway of βAPP is
initialized by the endoproteolytic activity of alpha-secretase, resulting in a membrane associated C-terminal fragment of βAPP, the fragment having a length of 83 amino acids (C83). Cleavage of C83 by γ-secretase results in the formation of (non-plaque-forming) p3 and a C-terminal fragment.
γ-Secretase cleavage of C99 results in the secretion of Aβ into biological fluids. The C-terminal product of this cleavage, previously described as p7 (Haass and Selkoe, 1993) and also called C-terminal fragment gamma (CTFγ), has so far not been observed in vivo. However, it is known that the C-terminus of Aβ is heterogenous in that Aβ may end at position 40 or at position 42 of its precursor C99. Accordingly, two species of CTFγ resulting from γ-secretase cleavage have been expected in the prior art, namely C-terminal fragments consisting of 59 amino acids (CTFγ/59; derived from Aβ40 generation) and consisting of 57 amino acids (CTFγ/57; derived from Aβ42 generation), respectively. Recently, a peptide supposed to be CTFγ/59 or CTFγ/57 has been observed in vitro (McLendon et al., 2000; Pinnix et al., 2001).
From a medical point of view, there is a strong need for means and methods useful for therapeutic intervention in Alzheimer's disease. In this respect, γ- secretase activity, playing a key role in Aβ plaque formation, might be a major target for new therapeutical, especially pharmacological, approaches.
Wolfe et al. (1999) describe an in vitro test system for the assessment of γ- secretase activity. Membranes of cells stably expressing PS1 were prepared. C99 was provided by transfection of the cells with a plasmid encoding C99 fused to the βAPP signal sequence. After incubation, activity of γ-secretase was determined by assessing the amount of Aβ released.
Pinnix et al. (2001 ) describe experiments designed to detect a C-terminal fragment of βAPP derived from guinea pig brain. The fragment obtained therein is characterized as a peptide consisting of 57 amino acids.
The technical problem underlying the present invention is to provide novel methods and means for the development of therapies of Alzheimer's disease and other neurodegenerative disorders in which Aβ - plaque formation and/or γ- secretase activity is involved.
Disclosure of the invention
The above problem of the invention is solved by a method for identifying substances capable of modulating the activity of γ-secretase, comprising the steps: providing a source of γ-secretase activity, providing a substrate of γ- secretase activity having a cleavage site corresponding to the naturally occuring cleavage site between amino acid 49 and amino acid 50 of the substrate C99, incubating said source and said substrate with a test substance under conditions allowing enzymatic activity of said γ-secretase activity, and determining γ-secretase activity by detecting the C-terminal fragment (and especially the amount thereof) released due to the proteolytic acitivity of said γ- secretase activity. The N-terminus of the previously unknown C-terminal fragment corresponds to amino acid 50 of C99.
As will be explained in detail below (Example 1), the invention is based on the surprising finding that an enzymatic cleavage of C99 between its amino acids 49 and 50 is involved in the processing of C99 to Aβ. The inventors have discovered and characterized the product of this processing step, now called CTFγ/50 (amino acid sequence: VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN; SEQ ID NO:1 ; N-terminus corresponding to amino acid 50 of C99). They have demonstrated that a γ-secretase activity is responsible for this processing step. Furthermore, it could be shown that CTFγ/50 is an immediate product of γ- secretase activity acting on C99 and not the product of a further degradation of the previously described CTFγ/57 or CTFγ/59. Thus, these results clearly demonstate that γ-secretase activity acts at a previously unknown cleavage site of C99. The identification of this proteolytic activity offers a novel approach for
the pharmaceutical modulation of the enzymatic reactions involved in Aβ production and, thus, for therapeutical intervention.
In the prior art, γ-secretase activity has been determined by measuring release of Aβ (Wolfe et al., 1999; WO 01/16355). However, formation of the known Aβ variants Aβ40 (C-teminus at position 40 of C99) and Aβ42 (C-terminus at position 42 of C99) reflects a cleavage between amino acids 40 and 41 and between amino acids 42 and 43 of C99, respectively. Thus, these methods do not allow the assessment of the proteolytic activity at the cleavage site between amino acids 49 and 50. This difference is of great importance as release of Aβ40 and Aβ42 possibly requires an additional (exo)peptidase activity which might interfere with the γ-secretase activity to be determined. In other words, screening assays for the detection of modulators of γ-secretase activity that are based on the determination of cleavage products which are not the immediate products of said activity but result from additional cleavage events might give misleading data as it is unclear whether said modulators act on said γ-secretase activity or on other enzymatic activities involved in Aβ formation.
CTFγ/50, being a processing product not only in the BACE / γ-secretase pathway but also in the α-secretase / γ-secretase pathway, can be easily assessed in in vitro assays, e.g. by immunoblotting or ELISA. Thus, determination of the amount of CTFγ/50 released can be used as a simple and cost-effective read-out in methods for the identification of substances that modulate γ-secretase activity.
In addition, the regulation of Aβ40 production vis-a-vis Aβ42 production is an unclarified issue. Especially, some candidate inhibitors seem to inhibit Aβ40 release but stimulate Aβ42 secretion. It may be hypothesized that such substances might specifically inhibit an (exo)peptidase acting downstream of γ- secretase activity, i.e. further degrading Aβ42 to Aβ40. The method according
to the invention would not be affected by this phenomenon as only substances specifically inhibiting γ-secretase activity would be detected.
Thus, in summary, the method according to the invention allows the specific identification of substances which interfere with the previously unknown cleavage between amino acids 49 and 50 of C99 but not with other endo- or exoproteolytic activities that might be involved in the βAPP processing pathway.
Figure legends
Fig. 1 : Identification of in vivo produced CTFγ in human cells and mouse brain according to Example 1 : (A) Membrane fractions of HEK 293 cells stably transfected with Swedish mutant βAPPβgs (swAPP) were analyzed by combined immunoprecipitation/immunoblotting with antibody 6687 to the C-terminus of βAPP. Three βAPP CTFs were detected (C99 (=CTFβ), C83 (=CTFα), and the approximately 6 kDa CTFγ). The same βAPP CTFs including the approximately 6 kDa CTFγ were also observed by immunoblotting with antibody 6687 in mouse brain. (B) The γ-secretase inhibitor DAPT inhibits CTFγ production. HEK 293 cells stably transfected with swAPP were treated with the indicated concentrations of DAPT for 4h. Upper and middle panel: Membrane fractions were prepared and analyzed for βAPP CTFs by combined immunoprecipitation/immunoblotting with antibody 6687. Increasing concentrations of DAPT lead to a build up of CTFβ and CTFα (upper panel) with a concomitant significant block of CTFγ generation (middle panel). Lower panel: Conditioned media were analyzed for secreted Aβ by combined immunoprecipitation/immunoblotting with antibodies 3926/6E10. The same dose dependent inhibition of CTFγ production by DAPT was observed for Aβ generation. (C) CTFγ production is dependent on biologically active presenilins. Membrane fractions from control cells expressing PS1 wt or cells stably expressing PS1 D385N were analyzed by combined ι immunoprecipitation/immunoblotting with antibody 6687. Expression of the non-functional PS1 D385N variant significantly reduces CTFγ production.
Fig. 2: In vitro generation of CTFγ according to Example 1 : (A) Time dependent in vitro production of CTFγ. Membrane preparations were incubated at 37°C for the indicated time points. The reaction mixtures were then separated in a soluble fraction (S100; lower panel) and a pellet fraction (P100; upper panel) by ultracentrifugation. These fractions were immunoblotted with antibody 6687. Note the selective accumulation of CTFγ in the S100 (lower panel) fraction after 1-2 h incubation time. Very minor amounts of CTFγ were detected in the P100 fraction, which may be due to sticking of the highly hydrophobic CTFγ to membranes or to contamination of the P100 fraction with minor amounts of soluble proteins. (B) Two independent γ-secretase inhibitors (DAPT and
"Compound 1") inhibit the in vitro production of CTFγ. Membrane preparations were incubated with (+) or without (-) 250 nM DAPT (left panel) or 50 μM CM256 (right panel). The S100 fractions of the reaction mixtures were immunoblotted with antibody 6687. Note that both inhibitors significantly reduce CTFγ generation. (C) In vitro generation of CTFγ depends on biologically active presenilins. Left panel: time dependent in vitro production of CTFγ by membrane preparations derived from cells expressing PS1 wt. Right panel: Inhibition of CTFγ production in membrane preparations derived from cells expressing the biologically inactive PS1 D385N mutation. After termination of the in vitro reactions, βAPP CTFs were identified by immunoblotting with antibody 6687. (D) The γ -secretase inhibitor DAPT reduces the remaining in vitro CTFγ production observed in C (right panel). Left panel: time dependent in vitro production of CTFγ by membrane preparations derived from cells expressing PS1 wt in the presence (+) or absence (-) of 250 nM DAPT. Right panel: Inhibition of CTFγ production in membrane preparations derived from cells expressing the biologically inactive PS1 D385N mutation in the presence (+) or absence (-) of 250 nM DAPT. After termination of the in vitro reactions, βAPP CTFs were identified by immunoblotting with antibody 6687.
Fig. 3: Radiosequencing and mass spectrometry analysis of CTFγ as described in Example 1. (A) CTFγ generated in vitro from membrane preparations of 35S- methionine labeled HEK 293 cells stably expressing swAPP was subjected to
radiosequencing. A major methionine peak was observed at cycle 2 and a second peak at cycle 32 of the Edman degradation. The corresponding amino acid sequence of CTFγ starting at valine 50 is shown below. (B) In vivo detection of a truncated CTFγ in living HEK 293 cells stably overexpressing swAPP. Cell lysates from HEK 293 cells stably overexpressing swAPP or a recombinant CTFγ starting at amino acid 43 were co-migrated. CTFs were detected by immunoblotting with antibody 6687. Note that the in vivo produced CTFγ migrates faster than the recombinant fragment.
Fig. 4: Illustration of the similarity of endoproteolytic processing of βAPP and Notch as mentioned in Example 1. Human βAPP is presumably cleaved after position 40, 42 and 49 of the β-amyloid domain. Mouse Notchl is cleaved PS dependent after amino acid 1743 (Schroeter et al., 1998).
Detailed description of the invention
Before describing the invention in greater detail, it should be noted that in the specification and the appended claims, the singular forms "a", "an" and "the" include plural reference unless the context clearly dictates otherwise. Thus, for example, reference to "a cell line" is a reference to one or more cell lines, and the like.
The amino acid abbreviations are according to the standard one or three letter code. The numbering of the amino acids in Aβ, in other fragments of C99 and in C99 itself is based on C99, i.e. the N-terminal amino acid of C99 is amino acid no. 1 and so on. The sequence of C99 is:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGWIATVIVITLVMLKK KQYTSIHHGWEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN (SEQ ID NO:2).
Furthermore, in the specification and in the claims, reference will be made to a number of terms which shall be defined to have the following meanings:
If not indicated otherwise, the term "βAPP" is meant to encompass naturally occuring human full length βAPP, any known splice variant thereof (including e.g. splice variants APP695, APP751 and APP770; cf. e.g. NCBI database entry P05067), any naturally occuring variation or mutation thereof (such as the so-called "Swedish mutation" βAPP, swAPP (Citron et al., 1992), and corresponding molecules of other species, as long as they may serve as a substrate for γ-secretase activity in an assay as described hereafter, i.e. comprise a cleavage site as discovered by the inventors. Unless the context clearly dictates otherwise, "βAPP" is also meant to encompass the genuine substrates of γ-secretase activity, i.e. C99 and C83 and respective variants and derivatives. The reason for this definition in the context of this invention is the fact that most assay formats suitable for the method according to the invention comprise endogenous α-secretase- and/or β-secretase activity. Thus, C99 and C83 can be provided to the assay either directly in the form of C99 or C83 or, alternatively, in the form of a full-length βAPP being processed "in situ" to C99 or C83.
Furthermore, "βAPP" may also stand for a fragment and for a modified (e.g. genetically engineered or chemically modified) derivative of full-length βAPP, C99 or C83, as long as such a fragment or derivative may serve as substrate for γ-secretase activity in an assay as described hereafter. Genetically engineered βAPP may be a βAPP in the above defined sense and modified by amino acid substitutions, deletions or insertions, under the proviso that the screening method according to the invention can still be performed therewith. For instance, a modified βAPP not comprising a cleavage site corresponding to the cleavage site identified by the inventors or a modified βAPP targeted to cellular compartments where no γ-secretase activity is present would not be suited to the method of the invention. Furthermore, genetically engineered βAPP might be a βAPP fused with a reporter protein such as green fluorescent protein, luciferase, β-galactosidase and so on.
swAPP695 is especially preferred in an assay as described hereafter, because it is a better substrate for β-secretase than wild type APP, thus providing high levels of C99, the immediate substrate of γ-secretase activity.
The term "γ-secretase activity" means in the context of this invention any proteolytic activity that is capable of cleaving the substrate C99 between amino acids 49 and 50 and whose physiological substrate is C99 in its physiological environment (e.g. in cell membranes). Thus, "γ-secretase activity" may be the proteolytic activity presently ascribed to the not yet fully characterized γ- ' secretase per se, a proteolytic activity of γ-secretase in combination with one or more presenilins or, if applicable, presenilin activity per se.
The term "source of γ-secretase activity" comprises any biological material such as cells, homogenized cells, enriched membrane fractions, purified membranes, protein fractions, proteins reconstituted in membranes etc. which possess γ- secretase activity. Preferably, the source are human embryonic kidney (HEK) 293 cells, more preferably membrane preparations thereof that can be obtained e.g. as described in Example 1. The methods for the purification of membranes are known in the art (cf. e.g. Methods in Enzymology, Vol. 219: "Reconstitution of intracellular Transport" and T.G. Cooper: "Biochemische Arbeitsmethoden", De Gruyter Verlag, 1981).
The term "substrate of γ-secretase activity" is meant to encompass "βAPP" according to the definition above as well as artificially designed proteins that encompass the cleavage site detected by the inventors. The cleavage site may be defined by the sequence ITLVML (SEQ ID NO: 3) or VIVITLVMLKKK (SEQ ID NO: 4). Preferably, swAPP695 (over)expressed in e.g. HEK 293 cells (and endogenously cleaved to C99) is the substrate of γ-secretase activity.
The term "substance capable of modulating γ-secretase activity" means naturally occurring and synthetic compounds capable of activating or inhibiting enzymatic γ-secretase activity as defined above, whereby substances
unspecifically interfering with enzymatic reactions (such as e.g. agents that cause denaturation of proteins) should, of course, not be encompassed. Persons skilled in the art will be able to differentiate between specific and unspecific inhibition or activation of enzymatic activity.
The term "fragment beginning with a sequence corresponding to the N-terminal sequence of CTFγ/50" encompasses, of course, CTFγ/50 itself. However, it is understood that if a βAPP modified C-terminal of the cleavage site identified by the inventors is used as a substrate for γ-secretase activity, a modified C- terminal fragment will result that will have to be detected according to the method of the invention. In other words, said fragment originates from proteolytic cleavage of a βAPP as defined above at the cleavage site identified by the inventors, i.e. the site corresponding to amino acids 49 and 50 of C99.
The term "conditions allowing enzymatic activity of γ-secretase activity" means that reaction conditions are chosen under which proteolytic cleavage by γ- secretase activity is enabled. Examples for such conditions are given below.
According to one embodiment of the invention, the substrate of γ-secretase activity is an endogenous βAPP that is constitutively expressed in the cell. According to another embodiment of the invention, cells expressing an exogenous βAPP are used. Especially preferred is exogenous swAPP695. Expression of exogenous βAPP may be achieved by transfecting cells with a gene coding for βAPP in a suitable expression vector. Endogenous and exogenous substrates are described in detail in WO 01/16355.
According to a further embodiment of the invention, βAPP substrate is a fusion protein of a reporter protein with e.g. wild-type βAPP, swAPP or C99. Such substrates and their production are described in detail in WO 01/16355. Commonly used reporter proteins are green fluorescent protein, luciferase, β- galactosidase, etc.
The cell line used in the example below is HEK 293. However, other cells and cell lines, such as H4, U373, NT2, PC12, COS, CHO, fibroblasts, myeloma cells, neuroblastoma cells, hybridoma cells, oocytes, empryonic stem cells and so on can be used as well. Cells and cell lines of neuronal or glial origin or fibroblasts are especially preferred. Furthermore, cells and tissues of the brain as well as homogenates and membrane preparations thereof may be used.
The detection of CTFγ/50 or of a fragment beginning with a sequence corresponding to the N-terminal sequence of CTFγ/50 can be performed by immunoblotting/western blotting, by ELISA and other suitable peptide or protein detection methods known in the art.
An even higher sensitivity of detection can be achieved by immunoprecipitation with subsequent immunoblotting/western blotting. Respective protocols can be found e.g. in Ida et al. (1996). Antibodies useful for the detection of CTFγ/50 are, e.g., polyclonal antibody 6687 binding to the last 20 C-terminal amino acids of βAPP (Steiner et al., 2000) and SAD3128 available from LABGEN®.
If a βAPP fused to a reporter protein as mentioned above is used, it is possible to estimate the amount of cleaved substrate by detection of the reporter protein. In this case, a separation of cleaved and uncleaved substrate followed by the respective detection method depending on the reporter protein might be performed.
In the method according to the invention, a source of γ-secretase activity and a substrate thereof are incubated with a test substance under conditions allowing enzymatic activity of the source of γ-secretase activity. After the incubation, the amount of substrate cleaved in presence of the test substance is determined by measuring the amount of CTFγ/50 (or a derivative thereof, respectively, if a derivative of C99 or βAPP has been used as the substrate) produced. The amount of CTFγ/50 (or derivative) released during the incubation step reflects the activity of γ-secretase activity acting at the cleavage site of βAPP as defined
above. In most cases, control experiments will be included in the assay, wherein the experiment described before will be performed under essentially the same conditions as above but without addition of said test substance or with addition of a substance known to have no effect on γ-secretase activity. In this case, the results of both experiments will be compared and a reduced amount of released CTFγ/50 (or the derivative) will be indicative of an inhibitory effect of the test substance on γ-secretase activity (inhibitor), whereas an increased amount of CTFγ/50 indicates that the test substance activates said activity (activator). In both cases, said test substance is classified as "modulator".
Concerning the reaction conditions to be applied, a broad range of buffers can be used. Especially, a reaction buffer having a pH in the range of 5 to 10, more preferably in the range of 6 to 8 and most preferably in the range of 6.3 to 6.9 may be used. One example for a suitable buffer is 150 mM sodium citrate, pH 6.4. The reaction temperature may be selected, for example, in the range of 20 °C to 37 °C. A higher temperature might result in denaturation of proteins, a lower temperature will result in a decrease of the speed of the reaction. The reaction mixture may additionally comprise membrane stabilizing agents such as sucrose and sorbitol, preferably in an amount of 200 to 1000 mM, more preferably in an amount of 200 to 500 mM and most preferably in an amount of 200 to 300 mM. Moreover, the reaction buffer may contain proteinase inhibitors, e.g. the "PI Complete" mix, available from Roche®, and EDTA. EDTA serves to inhibit metalloproteinases responsible for the degradation of CTFγ. Said proteinase inhibitor mix does not include pepstatin which is an inhibitor of γ-secretase activity.
According to another embodiment of the invention, an assay based on the method according to the invention will be used in a two step analysis of test substances: As mentioned above, several assays are known in the art in which γ-secretase activity is measured by assessing release of Aβ (Wolfe et al., 1999; "Aβ release based assays"). As also mentioned above, Aβ release might be the result of an at least two-step cleavage process: one cleavage occuring at
the site identified by the inventors (amino acid 49 / 50 of C99), the other at site 40 / 41 (resulting in Aβ40) or site 42 / 43 (resulting in Aβ42) of C99. Thus, Aβ release based assays do not discriminate between inhibitors (or, more generally, modulators) of these two cleavage activities. By coupling the known Aβ release based assay to the assay according to the invention, it is possible to make said discrimination. For example, it is possible to first identify inhibitors by performing the Aβ release based assay and, afterwards, including test substances having shown to be effective in said first assay in the second assay based on the method according to the invention. Substances not being effective in said second assay can be classified as substances modulating the proteolytic activity acting at amino acids 40 / 41 or 42 / 43, whereas substances found to be effective in both assays act on cleavage site 49 / 50.
The two-step assay outlined above is of great importance because of the following reason: as discovered by the inventors, the cleavage site 49 / 50 in C99 shows similarity to the known S3 cleavage site of Notch protein (Schroeter et al., 1998). If both cleavage events are mediated by the same or closely related proteinases, it is expected that substances inhibiting cleavage of C99 at site 49 / 50 might also inhibit Notch protein cleavage, possibly resulting in severe and undesirable side-effects of medicaments ultimately derived from a respective substance. Thus, the novel screening method has the additional advantage that it provides a means for the discrimination between substances that are suspected to affect Notch protein proteolysis and substances not expected to do so.
Yet another important embodiment of the present invention is a method according to the invention, characterized in that said method is a high throughput screening (HTS) method. HTS relates to an experimental setup wherein a large number of compounds is tested simultaneously. Preferably, said HTS setup may be carried out in microplates, may be partially or fully automated and may be linked to electronic devices such as computers for data storage, analysis, and interpretation using bioinformatics. Preferably, said automation may involve robots capable of handling large numbers of
microplates and capable of carrying out several thousand tests per day. Preferably, a test compound which is known to show the desired modulating or inhibitory function will also be included in the assay as a positive control. The term HTS also comprises ultra high throughput screening formats (UHTS). Preferably, said UHTS formats may be carried out using 384- or 1536-well microplates, sub-microliter or sub-nanoliter pipettors, improved plate readers and procedures to deal with evaporation. HTS methods are described e.g. in US 5,876,946 and US 5,902,732. The expert in the field can adapt the method described below to a HTS or UHTS format without the need of carrying out an inventive step.
The source of γ-secretase activity (e.g. membrane preparations), the substrate of γ-secretase activity (e.g. C99 or a modified derivative as outlined above), a reaction buffer and a means for specifically detecting the reaction product CTFγ/50 (or a respective derivative) may be assembled to a test kit. The detection means may be a monoclonal or a polyclonal antibody or derivative specifically reacting with CTFγ/50. The test kit may additionally comprise microtiter plates, labeled second antibodies used for immunoblotting / western blotting techniques (known in the art), reaction vessels, blotting membranes, buffers etc.
Although the method according to the invention is useful for the detection of both, inhibitors and activators of γ-secretase activity, screening methods and test kits directed to the identification of inhibitors are of special interest.
Also encompassed by the present invention are substances modulating γ- secretase activity that will be identified by the method according to the invention and, especially, inhibitors of γ-secretase activity. It is understood that already known inhibitors such at DAPT (N-[N-(3,5-difluorophenacetyl)-L-alanyl]-S- phenylglycin t-butyl ester) and "Compound 1" (N-[(1 ,1-dimethylethoxy)carbonyl]- L-valyl-(4S,5S)-4-amino-2,2-difluoro-5-methyl-3-oxoheptanoyl-L-valyl-L-
Isoleucine methyl ester; also called CM256) will be excluded from the scope of protection.
According to a further aspect of the invention, there are provided pharmaceutical compositions comprising substances identified with the method according to the invention and pharmaceutical acceptable carriers or excipients. A pharmaceutically acceptable carrier can contain physiologically acceptable compounds that act, for example, to stabilize or to increase the absorption of a substance capable of inhibiting γ-secretase activity. Such physiologically acceptable compounds include, for example, carbohydrates such as glucose, sucrose or dextrans, antioxidants such as ascorbic acid or glutathione, chelating agents, low molecular weight proteins or other stabilizers or excipients (as disclosed e.g. in Remington's Pharmaceutical Sciences (1990), 18th ed., Mack Publ., Easton). The person skilled in the art will know that the choice of a pharmaceutically acceptable carrier, including a physiologically acceptable compound, depends, for example, on the route of administration of the composition.
According to yet another aspect of the invention, a substance identified with the method according to the invention is used for the preparation of a medicament for the treatment of neurodegenerative diseases, especially Alzheimer's disease.
Moreover, the invention provides the previously unknown CTFγ/50 (SEQ ID No. 1 ). It is clear that allelic variations and functionally equivalent derivatives thereof will also be encompassed by the invention.
Examples
Example 1 : Identification of CTFγ/50
In the experiments outlined below, the following materials and methods have been used:
Cell lines, cell culture and cDNA transfection
Human embryonic kidney 293 (HEK 293) cells expressing swAPP were generated and cultured as described (Steiner et al., 2000).
For control experiments demonstrating that CTFγ/50 is not identical with CTFγ57, HEK 293 cells were transiently transfected with cDNA encoding recombinant CTFγ57 using DOTAP (liposome formulation of the monocationic lipid N-[1-(2,3-Dioleoyloxy)]-N,N,N-trimethylammonium propane methylsulfate in water; Roche) according to the supplier's instructions.
cDNA constructs
A cDNA encoding recombinant CTFγ57 was amplified by PCR and cloned into pcDNA3 vector (Invitrogen) as an Hindlll and Xbal fragment. Recombinant CTFγ57 consists of an N-terminal methionine followed by the C-terminus of βAPP starting at position 43 of the β-amyloid domain.
Antibodies The polyclonal antibodies 6687 to the last 20 C-terminal amino acids of βAPP (Steiner et al., 2000) and 3926 to Aβ1-42 (Wild-Bode et al., 1997) have been described. The monoclonal antibody 6E10 to Aβ1-17 was obtained from Senetek, USA.
Inhibition of γ-secretase activity γ-Secretase activity was inhibited using DAPT (N-[N-(3,5-difluorophenacetyl)-L- alanyl]-S-phenylglycin t-butyl ester) (Dovey et al., 2001) and CM256 (N-[(1,1-
dimethylethoxy)carbonyl]-L-valyl-(4S,5S)-4-amino-2,2-difluoro-5-methyl-3- oxoheptanoyl-L-valyl-L-lsoleucine methyl ester; gift from Dr. M. Wolfe), previously designated "Compound 1" (Esler et al., 2000), that were diluted from stock solutions in DMSO to the concentrations described.
Analysis of secreted Aβ
Aβ was immunoprecipitated from conditioned media collected for 4 h with antibody 3926, separated on Tris-Tricine gels and detected by immunoblotting with antibody 6E10 using a chemiluminescent detection system (Tropix, USA).
Analysis of CTFγ in vivo
CTFγ was analyzed by combined immunoprecipitation/westernblotting with antibody 6687 of membrane extracts from stably transfected HEK 293 cells or from mouse brain. Briefly, homogenates of cells or brain tissue were prepared in hypotonic buffer (10 mM Tris, pH 7.4, 1 mM EDTA, 1 mM EGTA, pH 7.0) containing 1x protease inhibitors (PI) (Complete, Roche) as described (Steiner et al., 1998). Following homogenization membranes were isolated from the postnuclear supernatant (PNS) by centrifugation at 16.000 g for 45 min at 4°C. The membranes were resuspended in RIPA buffer (150 mM NaCI, 10 mM Tris, 1% NP-40, 0.5% cholic acid, 0.1% SDS, 5 mM EDTA, pH 8.0, 1x PI) following a clarifying spin at 16.000 g for 10 min at 4°C, and subjected to immunoprecipitation with antibody 6687.
To analyze expression of recombinant CTFγ57, lysates were prepared with RIPA buffer 48 h after transfection and subjected to immunoprecipitation with antibody 6687.
Generation and analysis of CTFγ in vitro
CTFγ was generated in vitro from membrane preparations of HEK 293 cells stably transfected with swAPP following previously described procedures (McLendon et al., 2000; Pinnix et al., 2001 ). In brief, cells were resuspended (0.5 ml/10-cm dish) in homogenization buffer (10 mM MOPS, pH 7.0, 10 mM
KCI, 1x PI). Cell homogenates and a PNS were prepared as described (Steiner et al., 1998). Membranes were pelleted from the PNS by centrifugation for 20 min at 16.000 g at 4°C, washed with homogenization buffer and resuspended (50 μl/10-cm dish) in assay buffer (150 mM sodium citrate, pH 6.4, 1x PI). To allow generation of CTFγ, samples were incubated at 37°C for the indicated time points in a volume of 25 μl/assay. Control samples were kept on ice. After termination of the assay reactions on ice, samples were separated into pellet (P100) and supernatant (S100) fractions by ultracentrifugation for 1 h at 100.000 g at 4°C. Following SDS-PAGE on 10-20% Tris-Tricine gels (Invitrogen) samples were analyzed for CTFγ by immunoblotting with antibody 6687.
Radiosequencing of CTFγ
Confluent swAPP transfected HEK 293 cells in 10-cm dishes were radioactively labeled with 1.4 mCi/dish 35S-methionine (Promix, Amersham Pharmacia
Biotech) for 4 h in methionine-free MEM. CTFγ was then generated in vitro from membrane preparations as described above except that after termination of CTFγ generation the assay reactions were separated into pellet (P16}and supernatant (S16) fractions by centrifugation at 16.000 g for 30 min at 4°C. After isolation of CTFγ from S16 by immunoprecipitation with antibody 6687 immunocomplexes were separated by SDS-PAGE on 10-20% Tris-Tricine gels (Invitrogen) and blotted onto a PVDF membrane. After autoradiography, the CTFγ band was excised and subjected to radiosequencing by automated Edman degradation as described (Haass et al., 1992).
Results:
A mentioned above, PS mediated γ-secretase cleavage does not only result in the generation of soluble Aβ but also in the generation of a βAPP C-terminal fragment (CTFγ) representing the counterpart of Aβ. Based on the known heterogenous C-terminal sequences of Aβ, two species of CTFγ have been postulated, CTFγ/57 and CTFγ/59, respectively.
To investigate this cleavage in living cells, C-terminal fragments of βAPP were immunoprecipitated from membrane fractions of human embryonic kidney 293 (HEK 293) cells stably transfected with βAPPβgs carrying the Swedish mutation (swAPP) (Citron et al., 1992). This revealed the presence of an approximately 6 kDa C-terminal fragment migrating below the major βAPP CTFs generated by α- and β-secretase (Fig. 1A; left panel). A CTF of similar molecular weight was also found in homogenates of mouse brain (Fig. 1 A; right panel).
In order to investigate whether this polypeptide represents the γ-secretase generated CTFγ, swAPP transfected cells were treated with the previously described γ-secretase inhibitor DAPT (Dovey et al., 2001). As shown in Fig. 1B, concomitant with an increase of βAPP CTFβ and CTFα (upper panel; CTFα is a cleavage product of the proteolytic activity of alpha-secretase), a dose dependent inhibition of CTFγ generation was observed (middle panel). This was further confirmed by the immunoprecipitation of Aβ from the conditioned media of these cells, which consistent with previous results (Dovey et al., 2001) revealed a severely reduced Aβ production (Fig. 1 B; lower panel).
To demonstrate the PS dependency of this cleavage, βAPP and its proteolytic fragments were immunoprecipitated from cells expressing PS1 D385N. As shown previously (Steiner et al., 1999; Wolfe et al., 1999), PS1 D385N acts like a dominant negative mutation that inhibits the biological function of PSs required for the γ-secretase cleavage of βAPP. As expected, a strong increase of βAPP CTFβ and CTFα was observed, indicating a significant inhibition of γ- secretase cleavage (Fig. 1C). Moreover, generation of CTFγ was strongly reduced (Fig. 1C). These results demonstrate that the observed low molecular weight C-terminal cleavage product of βAPP fulfills the criteria of being produced by γ-secretase cleavage. However, rather small amounts of this fragment accumulate in vivo, most likely due to the very rapid degradation of this fragment. Therefore, the inventors attempted to generate CTFγ in an in
vitro assay, which could allow the efficient stabilization of this fragment by the use of a variety of protease inhibitors.
Membranes from HEK 293 cells stably expressing swAPP were incubated under the conditions described under item "Generation and analysis of CTFγ in vitro" above in the presence of a protease inhibitor cocktail (McLendon et al., 2000; Pinnix et al., 2001). After termination of the in vitro assay, membranes were separated by ultracentrifugation. The pellet (P100) and the supernatant (S100) fraction were analyzed for the presence of βAPP CTFs. CTFα and CTFβ were predominantly observed within the P100 fraction (Fig. 2A; upper panel), whereas CTFγ was significantly enriched in the S100 fraction (Fig. 2A; lower panel). The predominant accumulation of CTFγ within the cytoplasmic fraction demonstrates that this fragment is released from the membrane. Prolonged incubation resulted in the generation of robust levels of CTFγ (Fig. 2A, lower panel). The maximum production of CTFγ was observed after approximately 1 to 2 h (Fig. 2A). To show that the in vitro generated CTFγ is indeed the product of an authentic PS dependent γ-secretase cut, the membrane fractions were incubated in the presence of two previously described γ-secretase inhibitors, DAPT (Dovey et al., 2001) and CM256 (Esler et al., 2000). As shown in Fig. 2B, both γ-secretase inhibitors efficiently reduced in vitro generation of CTFγ. Moreover, CTFγ generation was also significantly reduced when membranes were isolated from HEK 293 cells coexpressing swAPP and the functionally inactive PS1 D385N mutation described above (Fig. 2C). The remaining minor production of CTFγ was further reduced by the addition of the γ-secretase inhibitor DAPT (Fig. 2D). Taken together, these results demonstrate that the in vitro assay produces very robust levels of CTFγ in a PS and γ-secretase dependent manner. Moreover, the same fragment is also produced in vivo and can be found in mouse brain.
The inventors then used the in vitro assay to isolate sufficient amounts of CTFγ to allow the further structural characterization of this peptide. However, attempts to perform mass spectroscopy with the isolated peptide were
unsuccessful for unknown reasons. In a further approach, the inventors tried to determine the sequence of the peptide's N-terminus by radiosequencing. HEK 293 cells stably expressing swAPP were metabolically labeled with 35S- methionine. Radiolabeled CTFγ was generated in vitro as described above. After ultracentrifugation, CTFγ was immunoprecipitated from the S100 fraction with antibody 6687 to the last 20 amino acids of βAPP. Radiolabeled CTFγ was then subjected to automated Edman degradation (Haass et al., 1992). Surprisingly, this revealed a major peak of radioactivity in fraction 2 and not in fractions 9 and 11 as one would have expected for a CTFγ beginning at position , 41 or 43 (Fig. 3A). This indicates that CTFγ is generated by a proteolytic
, cleavage between amino acids 49 and 50 (Fig. 3A). The peak of radioactivity in fraction 2 thus corresponds to methionine 51. Consistent with a proteolytic fragment starting at valine 50, a second peak of radioactivity was observed at position 32 thus confirming that CTFγ predominantly begins with amino acid 50. In order to demonstrate that such a truncated CTFγ is also generated under in vivo conditions (where it is impossible to obtain sufficient amounts for sequencing), we co-migrated a recombinant CTFγ beginning at amino acid 43 with CTFγ produced in living HEK 293 cells. As shown in Fig. 3B, this revealed that in vivo generated CTFγ migrated at a lower molecular weight than the recombinant CTFγ. Together with the experiments described in Fig. 1, this confirms that a major PS dependent cut of βAPP occurs C-terminal of the authentic γ-secretase cleavage after amino acids 40 and 42. Moreover, this also demonstrates that the smaller CTFγ is not simply generated by unspecific degradation, since the recombinant fragment should have been cleaved as well under these conditions.
Thus, biochemical characterization of CTFγ surprisingly revealed a major cut of APPβθδ after amino acid 645 (Fig.3), corresponding to amino acid 49 of the β- amyloid domain of βAPP. This cleavage is fully dependent on biologically active presenilins (Fig. 2). Moreover, two independent γ-secretase inhibitors that were both described to efficiently block Aβ40 and Aβ42 generation also inhibited the cleavage after amino acid 49 of the β-amyloid domain (Fig. 2B and 2D). Thus it appears likely that this cleavage occurs by the γ-secretase itself.
The above results therefore suggest that γ-secretase mediates at least three different cuts within the C-terminal domain of βAPP.
Interestingly, the N-terminus of CTFγ is located at a position, which is homologous to the PS dependent S3 cleavage of Notch (Fig. 4). The S3 cleavage of Notch occurs right at the cytoplasmic boarder of the membrane (Schroeter et al., 1998). Moreover, the novel cleavage site of βAPP may also occur close to the cytoplasmic boarder of the membrane. Based on the results by Tischler et al. (Tischler and Cordell, 1996), the cut between amino acid 49 and 50 would indeed occur within the cytoplasmatic domain. Such a cytoplasmatic cleavage would be more likely than an intramembraneous proteolytic cut, which is likely to be inhibited by the higly hydrophobic environment within a phospholipid bilayer. In fact a cytoplasmic cleavage may facilitate a shift of the remaining stub into the cytoplasm, where it could easily be attacked by the final γ-secretase cut. Indeed, Murphy et al., 1999, provided evidence for such a model. Moreover, this may indicate that the cytoplasmic tail of βAPP requires "shedding" before/during it undergoes the final γ-secretase cut, a phenomenon which would be very similar to the required ectodomain shedding of γ-secretase substrates (Struhl and Adachi, 2000). Furthermore, the identification of CTFγ in vivo may also raise the interesting possibility that this fragment similar the Notch intracellular cytoplasmic domain (NICD) may have a biological function in signal transduction. Based on the striking similarity of the biological mechanisms involved in the generation of NICD and CTFγ as well as potentially similar functions in signal transduction, the term AICD for the Amyloid precursor protein intracellular domain is proposed.
Both cleavages are PS dependent and can be blocked by γ-secretase inhibitors (De Strooper etal., 1999; De Strooper et al., 1998). Thus, it is likely thatγ- secretase cleavage at position 49 of βAPP and S3 cleavage of Notch are mediated by the same PS dependent enyzme. The fact that no N-terminal heterogeneity has been observed for both NICD (Schroeter et al., 1998) and CTFγ (data shown here) outlines a further similarity between these two γ- secretase cleavages. Furthermore, PS dependent cleavage of βAPP and
Notch at similar sites provides additional evidence for a direct function of presenilins in γ-secretase/S3 cleavage.
The finding of an additional γ-secretase cut close to the predicted border of the transmembrane domain may indicate that the cytoplasmic tail of βAPP requires "shedding" before/during it undergoes the final γ-secretase cut after positions 40/42 of the β-amyloid domain. Alternatively, γ-secretase may cut first at position 40/42 of the β-amyloid domain followed by a second cleavage after position 49 releasing CTFγ from the membrane. However, since neither an Aβ49 species nor a CTFγ starting at position 41/43 of the β-amyloid domain has been found, the data may indicate simultaneous cleavage at all three sites.
Example 2: Screening assay - medium throughput
In the following, a screening assay will be described in detail. However, it is to be understood that this invention is not limited to specific assay formats, materials or reagents, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting.
HEK 293 cells stably transfected with βAPP695 carrying the Swedish mutation (swAPP) were grown as described in Citron et al., 1992, i.e. in DMEM with Glutamax (Gibco BRL) containing 10 % FCS, 1 % Penicillin/Streptavidin, 200 μg/ml G418. The cells were resuspended (0.5 ml/10-cm dish) in homogenization buffer (10 mM MOPS, pH 7.0, 10 mM KCI, 1x PI). Cell homogenates and a post nuclear supernatant (PNS) were prepared by centrifugation at 2500 g for 15 min. Membranes were pelleted from the PNS by centrifugation for 20 min at 16.000 g at 4°C, washed with homogenization buffer and resuspended (50 μl/10-cm dish) in assay buffer (150 mM sodium citrate, pH 6.4, 1x PI). To allow generation of CTFγ, control samples without added test substance and samples comprising different concentrations of substances to be
screened were incubated at 37°C for e.g. 1 h. The reactions were stopped by cooling them to 4 °C.
After termination of the reactions, the samples are separated into pellet (P100) and supernatant (S100) fractions by ultracentrifugation for 1 h at 100.000 g al 4°C. CTFγ/50 is detected and quantified by ELISA using an antibody specific for the N-terminal sequence of CTFγ/50. A reduced signal compared to the control sample indicates that the respective test compound inhibits γ-secretase activity acting at amino acid 49 / 50 of C99.
Example 3: Screening assay - medium throughput
The screening assay is carried out as described in Example 2 with the exception that instead of the ultracentrifugation step membranes are solubilized by adding STEN - lysis buffer (50 mM Tris, pH 7.6; 150 mM NaCI; 2 mM EDTA; 1 % NP-40 (final)). CTFγ/50 is detected and quantified in this solution by ELISA as described in Example 2.
Example 4: Screening assay - low throughput
The screening assay is carried out as described in Example 2 with the exception that the release of CTFγ/50 is determined by immunoprecipitation and immunoblotting of CTFγ/50 and densitometric analysis of the resulting bands. A reduced signal compared to the control sample indicates that the respective test compound inhibits γ-secretase activity acting at amino acid 49 / 50 of C99.
References
Citron, M., Oltersdorf, T., Haass, C, McConlogue, L., Hung, A.Y., Seubert, P., Vigo-Pelfrey, C, Lieberburg, I. and Selkoe, D.J. (1992) Mutation of the β- amyloid precursor protein in familial Alzheimer's disease increases β-protein production. Nature, 360, 672-674.
De Strooper, B., Annaert, W., Cupers, P., Saftig, P., Craessaerts, K., Mumm, J.S., Schroeter, E.H., Schrijvers, V., Wolfe, M.S., Ray, W.J., Goate, A. and Kopan, R. (1999) A presenilin-1 -dependent γ-secretase-like protease mediates release of Notch intracellular domain. Nature, 398, 518-522.
De Strooper, B., Saftig, P., Craessaerts, K., Vanderstichele, H., Guhde, G., Annaert, W., Von Figura, K. and Van Leuven, F. (1998) Deficiency of presenilin- 1 inhibits the normal cleavage of amyloid precursor protein. Nature, 391 , 387- 390.
Dovey, H.F., John, V., Anderson, J.P., Chen, L.Z., de Saint Andrieu, P., Fang, L.Y., Freedman, S.B., Folmer, B., Goldbach, E., Holsztynska, E.J., Hu, K.L., Johnson-Wood, K.L., Kennedy, S.L., Kholodenko, D., Knops, J.E., Latimer, L.H., Lee, M., Liao, Z., Lieberburg, I.M., Motter, R.N., Mutter, L.C., Nietz, J., Quinn, K.P., Sacchi, K.L., Seubert, P.A., Shopp, G.M., Thorsett, E.D., Tung, J.S., Wu, J., Yang, S., Yin, C.T., Schenk, D.B., May, P.C., Altstiel, L.D., Bender, M.H., Boggs, L.N., Britton, T.C., Clemens, J.C., Czilli, D.L., Dieckman-McGinty, D.K., Droste, J.J., Fuson, K.S., Gitter, B.D., Hyslop, P.A., Johnstone, E.M., Li, W.Y., Little, S.P., Mabry, T.E., Miller, F.D. and Audia, J.E. (2001) Functional γ- secretase inhibitors reduce b-amyloid peptide levels in brain. J Neurochem, 76, 173-181.
Esler, W.P., Kimberly, W.T., Ostaszewski, B.L., Diehl, T.S., Moore, C.L., Tsai, J.-Y., Rahmati, T., Xia, W., Selkoe, D.J. and Wolfe, M.S. (2000) Transition-state
analogue inhibitors of γ -secretase bind directly to presenilin-1. Nature Cell Biol, 2, 428-433.
Haass, C, Schlossmacher, M.G., Hung, A.Y., Vigo-Pelfrey, C, Mellon, A., Ostaszewski, B.L., Lieberburg, I., Koo, E.H., Schenk, D., Teplow, D.B. and Selkoe, D.J. (1992) Amyloid β-peptide is produced by cultured cells during normal metabolism. Nature, 359, 322-325.
Haass, C. and Selkoe, D.J. (1993) Cellular processing of β-amyloid precursor protein and the genesis of amyloid β-peptide. Cell, 75, 1039-1042.
Ida et al. (1996). J. Biol. Chem. 271, 22908-22914.
McLendon, C, Xin, T., Ziani-Cherif, C, Murphy, M.P., Findlay, K.A., Lewis, P.A., Pinnix, I., Sambamurti, K., Wang, R., Fauq, A. and Golde, T.E. (2000) Cell-free assays for γ -secretase activity. Faseb J, 14, 2383-2386.
Murphy MP, Hickman LJ, Eckman CB, Uljon SN, Wang R, Golde TE (1999) gamma-Secretase, evidence for multiple proteolytic activities and influence of membrane positioning of substrate on generation of amyloid beta peptides of varying length. J. Biol. Chem. 1999 Apr 23;274(17): 11914-23.
Pinnix, I., Musunuru, U., Tun, H., Sridharan, A., Golde, T., Eckman, C, Ziani- Cherif, C, Onstead, L. and Sambamurti, K. (2001) A novel γ -secretase assay based on detection of the putative C-terminal fragment-γ of amyloid β protein precursor. J Biol Chem, 276, 481-487.
Schroeter, E.H., Kisslinger, J.A. and Kopan, R. (1998) Notch-1 signalling requires iigand-induced proteolytic release of intracellular domain. Nature, 393, 382-386.
Selkoe, D.J. (1999) Translating cell biology into therapeutic advances in Alzheimer's disease. Nature, 399, A23-31.
Steiner, H., Capell, A., Pesold, B., Citron, M., Kloetzel, P.M., Selkoe, D.J., Romig, H., Mendla, K. and Haass, C. (1998) Expression of Alzheimer's disease- associated presenilin-1 is controlled by proteolytic degradation and complex formation. J Biol Chem, 273, 32322-32331.
Steiner, H. and Haass, C. (2000) Intramembrane proteolysis by presenilins. Nature Reviews Molecular Cell Biology, 1 , 217-224.
Steiner, H., Kostka, M., Romig, H., Basset, G., Pesold, B., Hardy, J., Capell, A., Meyn, L., Grim, M.G., Baumeister, R., Fechteler, K. and Haass, C. (2000) Glycine 384 is required for presenilin-1 function and is conserved in polytopic bacterial aspartyl proteases. Nature Cell Biol, 2, 848-851.
Steiner, H., Romig, H., Pesold, B., Philipp, U., Baader, M., Citron, M., Loetscher, H., Jacobsen, H. and Haass, C. (1999) Amyloidogenic function of the Alzheimer's disease-associated presenilin 1 in the absence of endoproteolysis. Biochemistry, 38, 14600-14605.
Struhl, G. and Adachi, A. (2000) Requirements for presenilin-dependent cleavage of Notch and other transmembrane proteins. Mol. Cell, 6, 625-636.
Tischer E, Cordell B. (1996) Beta-amyloid precursor protein. Location of transmembrane domain and specificity of gamma-secretase cleavage. J Biol Chem. 1996 Sep 6;271(36):21914-9.
Vassar, R. and Citron, M. (2000) Ab-generating enzymes: recent advances in β- and γ-secretase research. Neuron, 27, 419-422.
Wild-Bode, C, Yamazaki, T., Capell, A., Leimer, U., Steiner, H., Ihara, Y. and Haass, C. (1997) Intracellular generation and accumulation of amyloid β- peptide terminating at amino acid 42. J Biol Chem, 272, 16085-16088.
' Wolfe, M.S. and Haass, C. (2001) The role of presenilins in g-secretase activity. J Biol Chem, 276, 5413-5416.
Wolfe, M.S., Xia, W., Ostaszewski, B.L., Diehl, T.S., Kimberly, W.T. and Selkoe, D.J. (1999) Two transmembrane aspartates in presenilin-1 required for presenilin endoproteolysis and γ-secretase activity. Nature, 398, 513-517.
Claims
1. A method of screening for substances capable of modulating γ-secretase activity comprising the steps: - providing a source of γ-secretase activity,
- providing a substrate of γ-secretase activity, said substrate comprising a cleavage site corresponding to the naturally occuring cleavage site between amino acid 49 and amino acid 50 of the γ-secretase substrate C99 (SEQ ID NO:2), - incubating said source and said substrate with a test substance under conditions allowing enzymatic acitvity of γ-secretase activity, and
- determining γ-secretase activity by detecting a C-terminal fragment released from said substrate, wherein said C-terminal fragment is a fragment beginning with a sequence corresponding to the N-terminal sequence of CTFγ/50 (SEQ ID NO:1).
2. The method according to claim 1 , comprising the additional step of comparing said determined γ-secretase activity to the activity obtained upon carrying out said incubation in the absence of said test substance.
3. The method according to claim 1 or 2, wherein the test substances are screened for an inhibitory effect on γ-secretase activity.
4. The method according to any one of claims 1 to 3, wherein the source of γ-secretase activity are membranes of human embryonic kidney (HEK) 293 cells.
5. The method according to any one of claims 1 to 4, wherein said substrate of γ-secretase activity is selected from the group consisting of human wild type βAPP77o, wild type βAPP695, swAPP695, C99 and C83.
6. The method according to any one of claims 1 to 5, wherein said step of determining γ-secretase activity comprises measuring the release of CTFγ/50.
7. The method according to claim 6, wherein CTFγ/50 is measured by immunoblotting or ELISA.
8. The method according to any one of claims 1 to 7, wherein the test substance is selected from substances showing an inhibitory effect in an Aβ release based assay.
9. The method according to any one of claims 1 to 8, wherein the method is carried out in a high throughput screening (HTS) format.
10. Kit for the identification of substances capable of inhibiting γ-secretase activity comprising a source of γ-secretase activity and a substrate of γ- secretase activity.
11. Use of a method according to any one of claims 1 to 9 or a test kit according to claim 10 for the identification of substances capable of inhibiting γ- secretase activity.
12. Substance capable of inhibiting γ-secretase activity, identified with a method according to any one of claims 1 to 9 or a test kit according to claim 10.
13. Pharmaceutical composition comprising a substance according to claim 12.
14. Use of a substance according to claim 12 for the preparation of a medicament for the treatment of neurodegenerative diseases, especially Alzheimer's disease.
15. CTFγ/50 having the amino acid sequence shown in Fig. 3A (SEQ ID NO: 1)-
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DE10131899A DE10131899A1 (en) | 2001-07-04 | 2001-07-04 | In Vitro Screening Assay for Gamma Secretase |
| DE10131899 | 2001-07-04 | ||
| PCT/EP2002/007095 WO2003008635A2 (en) | 2001-07-04 | 2002-06-27 | η-SECRETASE IN VITRO SCREENING ASSAY |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP1407043A2 true EP1407043A2 (en) | 2004-04-14 |
Family
ID=7690254
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP02745414A Withdrawn EP1407043A2 (en) | 2001-07-04 | 2002-06-27 | Gamma-secretase in vitro screening assay |
Country Status (6)
| Country | Link |
|---|---|
| EP (1) | EP1407043A2 (en) |
| JP (1) | JP2004535206A (en) |
| CA (1) | CA2452832A1 (en) |
| DE (1) | DE10131899A1 (en) |
| MX (1) | MXPA03011898A (en) |
| WO (1) | WO2003008635A2 (en) |
Families Citing this family (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB0229582D0 (en) * | 2002-12-19 | 2003-01-22 | Merck Sharp & Dohme | Novel assay |
| EP1849762B1 (en) | 2006-04-21 | 2009-07-15 | Cellzome Limited | Substituted biphenyl carboxylic acids and derivatives thereof |
| AU2008222749A1 (en) | 2007-03-07 | 2008-09-12 | Janssen Pharmaceutica N.V. | Substituted phenoxy N-alkylated thiazoledinedione as estrogen related receptor-alpha modulators |
| UA98484C2 (en) | 2007-03-07 | 2012-05-25 | Янссен Фармацевтика Н.В. | Substituted phenoxy aminothiazolones as estrogen related receptor-alpha modulators |
| US20090023158A1 (en) * | 2007-07-13 | 2009-01-22 | Elan Pharmaceuticals, Inc. | Compositions and Methods for Identifying Substrate Specificity of Inhibitors of Gamma Secretase |
| AU2008312771B2 (en) | 2007-10-17 | 2012-11-01 | Janssen Pharmaceutica, N.V. | Biphenyl carboxylic acids and derivatives thereof |
| BRPI0817425A2 (en) | 2007-10-19 | 2015-06-16 | Janssen Pharmaceutica Nv | Amide-linked gamma secretase modulators |
| BRPI0817433A2 (en) | 2007-10-19 | 2015-06-16 | Janssen Pharmaceutica Nv | Piperidinyl and piperazinyl gamma secretase modulators |
| AU2008312355B2 (en) | 2007-10-19 | 2013-07-04 | Janssen Pharmaceutica, N.V. | Carbon linked modulators of y-secretase |
| EA018862B1 (en) | 2007-10-19 | 2013-11-29 | Янссен Фармацевтика, Н.В. | MODULATORS OF γ-SECRETASE |
| US7968725B2 (en) | 2008-07-22 | 2011-06-28 | Janssen Pharmaceutica N.V. | Pyridinyl modulators of γ-secretase |
| US9023767B2 (en) | 2009-05-07 | 2015-05-05 | Memorial Sloan-Kettering Cancer Center | γ-Secretase substrates and methods of use |
| US9632088B2 (en) | 2010-09-07 | 2017-04-25 | Memorial Sloan-Kettering Cancer Center | Methods and compositions for gamma-secretase assay |
| WO2014062771A1 (en) * | 2012-10-16 | 2014-04-24 | The Johns Hopkins University | An inducible reconstitution and real-time quantitative kinetic system for the study of intramembrane enzymes |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1998015828A1 (en) * | 1996-10-07 | 1998-04-16 | Scios Inc. | Method to identify direct inhibitors of the beta-amyloid forming enzyme gamma-secretase |
| DE19941039A1 (en) * | 1999-08-28 | 2001-03-01 | Boehringer Ingelheim Pharma | gamma-secretase in vitro test system |
-
2001
- 2001-07-04 DE DE10131899A patent/DE10131899A1/en not_active Withdrawn
-
2002
- 2002-06-27 JP JP2003514950A patent/JP2004535206A/en active Pending
- 2002-06-27 EP EP02745414A patent/EP1407043A2/en not_active Withdrawn
- 2002-06-27 CA CA002452832A patent/CA2452832A1/en not_active Abandoned
- 2002-06-27 WO PCT/EP2002/007095 patent/WO2003008635A2/en not_active Ceased
- 2002-06-27 MX MXPA03011898A patent/MXPA03011898A/en unknown
Non-Patent Citations (1)
| Title |
|---|
| See references of WO03008635A2 * |
Also Published As
| Publication number | Publication date |
|---|---|
| CA2452832A1 (en) | 2003-01-30 |
| MXPA03011898A (en) | 2004-03-26 |
| WO2003008635A8 (en) | 2003-10-30 |
| JP2004535206A (en) | 2004-11-25 |
| WO2003008635A3 (en) | 2004-01-29 |
| WO2003008635A2 (en) | 2003-01-30 |
| DE10131899A1 (en) | 2003-02-27 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Beher et al. | Generation of C‐terminally truncated amyloid‐β peptides is dependent on γ‐secretase activity | |
| US6245884B1 (en) | Secretases related to alzheimer's dementia | |
| Bhattacharyya et al. | Palmitoylation of amyloid precursor protein regulates amyloidogenic processing in lipid rafts | |
| US6329163B1 (en) | Assays for detecting β-secretase inhibition | |
| US20020132281A1 (en) | Secretases related to alzheimer's dementia | |
| WO2003008635A2 (en) | η-SECRETASE IN VITRO SCREENING ASSAY | |
| JP4454230B2 (en) | β-secretase substrate and use thereof | |
| Beard et al. | Discovery of cellular roles of intramembrane proteases | |
| US20020025508A1 (en) | Process for finding a protease inhibitor | |
| US20030022251A1 (en) | Gamma-secretase in vitro screening assay | |
| Murphy et al. | FAD-linked mutations in presenilin 1 alter the length of Aβ peptides derived from βAPP transmembrane domain mutants | |
| EP3568489B1 (en) | Gamma-secretase stabilizing compound screening assay | |
| EP1795895A1 (en) | A tissue-based assay system for Alzheimer-specific degeneration and pathology | |
| Tan et al. | Effects of γ‐secretase cleavage‐region mutations on APP processing and Aβ formation: interpretation with sequential cleavage and α‐helical model | |
| CA2381952A1 (en) | .gamma.-secretase in vitro test system | |
| US20050065076A1 (en) | Gamma three protease | |
| US20100291596A1 (en) | Screening method for agents suitable for therapy of alzheimer's disease | |
| Qiu et al. | A novel approach for studying endogenous aβ processing using cultured primary neurons isolated from APP transgenic mice | |
| WO2001049871A2 (en) | Process for finding a protease inhibitor | |
| Ko | The aspartate-257 of presenilin 1 is indispensable for mouse development and production of-amyloid peptides through-catenin-independent mechanisms | |
| Steiner et al. | Presenilin Dependent γ-Secretase Processing of ß-Amyloid Precursor Protein at a Site Corresponding to the S3 Cleavage of Notch | |
| Zhao | Identification of a novel cleavage site within the transmembrane domain of β-amyloid precursor protein and its implications in Aβ generation | |
| Brown et al. | Characterization of endogenous APP processing in a cell-free system | |
| Octave et al. | 398 Adenoviral expression of the human amyloid precursor protein in rat cultured neurons | |
| Steinhilb | Cellular trafficking and metabolism of the Alzheimer's disease amyloid precursor protein (APP) in the secretory and endocytic pathways |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE TR |
|
| AX | Request for extension of the european patent |
Extension state: AL LT LV MK RO SI |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20040730 |