EP1379668B1 - The use of genes encoding abc transporters to stimulate the production of secondary metabolites in biological cells - Google Patents
The use of genes encoding abc transporters to stimulate the production of secondary metabolites in biological cells Download PDFInfo
- Publication number
- EP1379668B1 EP1379668B1 EP02730178A EP02730178A EP1379668B1 EP 1379668 B1 EP1379668 B1 EP 1379668B1 EP 02730178 A EP02730178 A EP 02730178A EP 02730178 A EP02730178 A EP 02730178A EP 1379668 B1 EP1379668 B1 EP 1379668B1
- Authority
- EP
- European Patent Office
- Prior art keywords
- cells
- plant
- secretion
- abc
- production
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Lifetime
Links
- 229930000044 secondary metabolite Natural products 0.000 title claims abstract description 98
- 238000004519 manufacturing process Methods 0.000 title claims abstract description 48
- 108090000623 proteins and genes Proteins 0.000 title claims description 99
- 108010006533 ATP-Binding Cassette Transporters Proteins 0.000 title abstract description 55
- 102000005416 ATP-Binding Cassette Transporters Human genes 0.000 title abstract description 54
- 230000028327 secretion Effects 0.000 claims abstract description 47
- 238000004113 cell culture Methods 0.000 claims abstract description 40
- 210000004027 cell Anatomy 0.000 claims description 155
- 230000014509 gene expression Effects 0.000 claims description 52
- 229930013930 alkaloid Natural products 0.000 claims description 40
- 210000003934 vacuole Anatomy 0.000 claims description 20
- 230000004807 localization Effects 0.000 claims description 18
- 239000013604 expression vector Substances 0.000 claims description 13
- 230000009261 transgenic effect Effects 0.000 claims description 12
- 230000032258 transport Effects 0.000 claims description 11
- 239000002207 metabolite Substances 0.000 claims description 10
- 230000001965 increasing effect Effects 0.000 claims description 7
- 206010059866 Drug resistance Diseases 0.000 claims description 4
- 230000001131 transforming effect Effects 0.000 claims description 4
- 230000002708 enhancing effect Effects 0.000 claims description 3
- 230000002538 fungal effect Effects 0.000 claims description 3
- 230000006698 induction Effects 0.000 claims description 3
- 230000004983 pleiotropic effect Effects 0.000 claims description 3
- 210000004962 mammalian cell Anatomy 0.000 claims description 2
- 230000001902 propagating effect Effects 0.000 claims 1
- 108010078791 Carrier Proteins Proteins 0.000 abstract description 23
- 241000196324 Embryophyta Species 0.000 description 178
- 239000002609 medium Substances 0.000 description 41
- 235000018102 proteins Nutrition 0.000 description 36
- 102000004169 proteins and genes Human genes 0.000 description 36
- 238000000034 method Methods 0.000 description 35
- 108020004414 DNA Proteins 0.000 description 34
- 230000009466 transformation Effects 0.000 description 29
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 28
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 27
- 101100433759 Arabidopsis thaliana ABCG33 gene Proteins 0.000 description 20
- 101100433758 Oryza sativa subsp. japonica ABCG32 gene Proteins 0.000 description 20
- 101100107599 Oryza sativa subsp. japonica ABCG43 gene Proteins 0.000 description 20
- 101100028967 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) PDR5 gene Proteins 0.000 description 20
- 150000003797 alkaloid derivatives Chemical class 0.000 description 20
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 18
- 239000013598 vector Substances 0.000 description 18
- RKUNBYITZUJHSG-UHFFFAOYSA-N Hyosciamin-hydrochlorid Natural products CN1C(C2)CCC1CC2OC(=O)C(CO)C1=CC=CC=C1 RKUNBYITZUJHSG-UHFFFAOYSA-N 0.000 description 17
- 239000012528 membrane Substances 0.000 description 17
- 210000001519 tissue Anatomy 0.000 description 17
- SNICXCGAKADSCV-JTQLQIEISA-N (-)-Nicotine Chemical class CN1CCC[C@H]1C1=CC=CN=C1 SNICXCGAKADSCV-JTQLQIEISA-N 0.000 description 16
- RKUNBYITZUJHSG-FXUDXRNXSA-N (S)-atropine Chemical compound C1([C@@H](CO)C(=O)O[C@H]2C[C@H]3CC[C@@H](C2)N3C)=CC=CC=C1 RKUNBYITZUJHSG-FXUDXRNXSA-N 0.000 description 16
- 230000012010 growth Effects 0.000 description 16
- 229930005342 hyoscyamine Natural products 0.000 description 16
- 229960003210 hyoscyamine Drugs 0.000 description 16
- 108090000765 processed proteins & peptides Proteins 0.000 description 16
- 244000061176 Nicotiana tabacum Species 0.000 description 15
- 239000003814 drug Substances 0.000 description 15
- SNICXCGAKADSCV-UHFFFAOYSA-N nicotine Natural products CN1CCCC1C1=CC=CN=C1 SNICXCGAKADSCV-UHFFFAOYSA-N 0.000 description 15
- 229960002715 nicotine Drugs 0.000 description 15
- 102000004196 processed proteins & peptides Human genes 0.000 description 15
- 239000000725 suspension Substances 0.000 description 15
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 14
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 14
- YKYOUMDCQGMQQO-UHFFFAOYSA-L cadmium dichloride Chemical compound Cl[Cd]Cl YKYOUMDCQGMQQO-UHFFFAOYSA-L 0.000 description 14
- 229920001184 polypeptide Polymers 0.000 description 14
- 108091028043 Nucleic acid sequence Proteins 0.000 description 13
- 230000000694 effects Effects 0.000 description 13
- 239000000126 substance Substances 0.000 description 13
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 12
- 210000004748 cultured cell Anatomy 0.000 description 12
- -1 for example Substances 0.000 description 12
- 239000000047 product Substances 0.000 description 12
- GEWDNTWNSAZUDX-WQMVXFAESA-N (-)-methyl jasmonate Chemical compound CC\C=C/C[C@@H]1[C@@H](CC(=O)OC)CCC1=O GEWDNTWNSAZUDX-WQMVXFAESA-N 0.000 description 11
- 150000001413 amino acids Chemical class 0.000 description 11
- 108091033319 polynucleotide Proteins 0.000 description 11
- 102000040430 polynucleotide Human genes 0.000 description 11
- 239000002157 polynucleotide Substances 0.000 description 11
- 230000001105 regulatory effect Effects 0.000 description 11
- 241000589158 Agrobacterium Species 0.000 description 10
- 229930010555 Inosine Natural products 0.000 description 10
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 10
- 238000004458 analytical method Methods 0.000 description 10
- 229960003786 inosine Drugs 0.000 description 10
- 239000013612 plasmid Substances 0.000 description 10
- 230000030833 cell death Effects 0.000 description 9
- 150000001875 compounds Chemical class 0.000 description 9
- 229940079593 drug Drugs 0.000 description 9
- 239000012634 fragment Substances 0.000 description 9
- GEWDNTWNSAZUDX-UHFFFAOYSA-N methyl 7-epi-jasmonate Natural products CCC=CCC1C(CC(=O)OC)CCC1=O GEWDNTWNSAZUDX-UHFFFAOYSA-N 0.000 description 9
- 231100000419 toxicity Toxicity 0.000 description 9
- 230000001988 toxicity Effects 0.000 description 9
- 229930004668 tropane alkaloid Natural products 0.000 description 9
- 210000000170 cell membrane Anatomy 0.000 description 8
- 239000005090 green fluorescent protein Substances 0.000 description 8
- 239000001963 growth medium Substances 0.000 description 8
- 239000002773 nucleotide Substances 0.000 description 8
- 125000003729 nucleotide group Chemical group 0.000 description 8
- SOPPBXUYQGUQHE-JTQLQIEISA-N Anatabine Chemical compound C1C=CCN[C@@H]1C1=CC=CN=C1 SOPPBXUYQGUQHE-JTQLQIEISA-N 0.000 description 7
- SOPPBXUYQGUQHE-UHFFFAOYSA-N Anatabine Natural products C1C=CCNC1C1=CC=CN=C1 SOPPBXUYQGUQHE-UHFFFAOYSA-N 0.000 description 7
- 101150076881 PDR5 gene Proteins 0.000 description 7
- 230000015572 biosynthetic process Effects 0.000 description 7
- 238000010367 cloning Methods 0.000 description 7
- 230000001404 mediated effect Effects 0.000 description 7
- 229930000223 plant secondary metabolite Natural products 0.000 description 7
- 230000008569 process Effects 0.000 description 7
- 230000010076 replication Effects 0.000 description 7
- 239000000758 substrate Substances 0.000 description 7
- 150000003813 tropane derivatives Chemical class 0.000 description 7
- 229930000680 A04AD01 - Scopolamine Natural products 0.000 description 6
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 6
- STECJAGHUSJQJN-GAUPFVANSA-N Hyoscine Natural products C1([C@H](CO)C(=O)OC2C[C@@H]3N([C@H](C2)[C@@H]2[C@H]3O2)C)=CC=CC=C1 STECJAGHUSJQJN-GAUPFVANSA-N 0.000 description 6
- 241001495123 Hyoscyamus muticus Species 0.000 description 6
- 206010020649 Hyperkeratosis Diseases 0.000 description 6
- STECJAGHUSJQJN-UHFFFAOYSA-N N-Methyl-scopolamin Natural products C1C(C2C3O2)N(C)C3CC1OC(=O)C(CO)C1=CC=CC=C1 STECJAGHUSJQJN-UHFFFAOYSA-N 0.000 description 6
- 108700026244 Open Reading Frames Proteins 0.000 description 6
- 238000003556 assay Methods 0.000 description 6
- 230000002018 overexpression Effects 0.000 description 6
- STECJAGHUSJQJN-FWXGHANASA-N scopolamine Chemical compound C1([C@@H](CO)C(=O)O[C@H]2C[C@@H]3N([C@H](C2)[C@@H]2[C@H]3O2)C)=CC=CC=C1 STECJAGHUSJQJN-FWXGHANASA-N 0.000 description 6
- 229960002646 scopolamine Drugs 0.000 description 6
- 230000008685 targeting Effects 0.000 description 6
- 241000219194 Arabidopsis Species 0.000 description 5
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 5
- 239000002299 complementary DNA Substances 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- BRZYSWJRSDMWLG-CAXSIQPQSA-N geneticin Natural products O1C[C@@](O)(C)[C@H](NC)[C@@H](O)[C@H]1O[C@@H]1[C@@H](O)[C@H](O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](C(C)O)O2)N)[C@@H](N)C[C@H]1N BRZYSWJRSDMWLG-CAXSIQPQSA-N 0.000 description 5
- 238000011534 incubation Methods 0.000 description 5
- 239000003550 marker Substances 0.000 description 5
- 230000036457 multidrug resistance Effects 0.000 description 5
- 230000037361 pathway Effects 0.000 description 5
- 230000002441 reversible effect Effects 0.000 description 5
- 238000004114 suspension culture Methods 0.000 description 5
- 238000012546 transfer Methods 0.000 description 5
- 102100033350 ATP-dependent translocase ABCB1 Human genes 0.000 description 4
- 241000589155 Agrobacterium tumefaciens Species 0.000 description 4
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 4
- 241000894006 Bacteria Species 0.000 description 4
- COXVTLYNGOIATD-HVMBLDELSA-N CC1=C(C=CC(=C1)C1=CC(C)=C(C=C1)\N=N\C1=C(O)C2=C(N)C(=CC(=C2C=C1)S(O)(=O)=O)S(O)(=O)=O)\N=N\C1=CC=C2C(=CC(=C(N)C2=C1O)S(O)(=O)=O)S(O)(=O)=O Chemical compound CC1=C(C=CC(=C1)C1=CC(C)=C(C=C1)\N=N\C1=C(O)C2=C(N)C(=CC(=C2C=C1)S(O)(=O)=O)S(O)(=O)=O)\N=N\C1=CC=C2C(=CC(=C(N)C2=C1O)S(O)(=O)=O)S(O)(=O)=O COXVTLYNGOIATD-HVMBLDELSA-N 0.000 description 4
- 108010047230 Member 1 Subfamily B ATP Binding Cassette Transporter Proteins 0.000 description 4
- 238000000636 Northern blotting Methods 0.000 description 4
- 229930012538 Paclitaxel Natural products 0.000 description 4
- LOUPRKONTZGTKE-WZBLMQSHSA-N Quinine Chemical compound C([C@H]([C@H](C1)C=C)C2)C[N@@]1[C@@H]2[C@H](O)C1=CC=NC2=CC=C(OC)C=C21 LOUPRKONTZGTKE-WZBLMQSHSA-N 0.000 description 4
- 241000208292 Solanaceae Species 0.000 description 4
- 108700019146 Transgenes Proteins 0.000 description 4
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 4
- 238000009825 accumulation Methods 0.000 description 4
- ZPUCINDJVBIVPJ-LJISPDSOSA-N cocaine Chemical compound O([C@H]1C[C@@H]2CC[C@@H](N2C)[C@H]1C(=O)OC)C(=O)C1=CC=CC=C1 ZPUCINDJVBIVPJ-LJISPDSOSA-N 0.000 description 4
- OROGSEYTTFOCAN-DNJOTXNNSA-N codeine Chemical compound C([C@H]1[C@H](N(CC[C@@]112)C)C3)=C[C@H](O)[C@@H]1OC1=C2C3=CC=C1OC OROGSEYTTFOCAN-DNJOTXNNSA-N 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 201000010099 disease Diseases 0.000 description 4
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 4
- 239000005712 elicitor Substances 0.000 description 4
- 229960003699 evans blue Drugs 0.000 description 4
- 210000001723 extracellular space Anatomy 0.000 description 4
- 101150032598 hisG gene Proteins 0.000 description 4
- 230000005764 inhibitory process Effects 0.000 description 4
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 4
- BQJCRHHNABKAKU-KBQPJGBKSA-N morphine Chemical compound O([C@H]1[C@H](C=C[C@H]23)O)C4=C5[C@@]12CCN(C)[C@@H]3CC5=CC=C4O BQJCRHHNABKAKU-KBQPJGBKSA-N 0.000 description 4
- 229960001592 paclitaxel Drugs 0.000 description 4
- 229930010796 primary metabolite Natural products 0.000 description 4
- 230000000644 propagated effect Effects 0.000 description 4
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 4
- 231100000331 toxic Toxicity 0.000 description 4
- 230000002588 toxic effect Effects 0.000 description 4
- MYPYJXKWCTUITO-UHFFFAOYSA-N vancomycin Natural products O1C(C(=C2)Cl)=CC=C2C(O)C(C(NC(C2=CC(O)=CC(O)=C2C=2C(O)=CC=C3C=2)C(O)=O)=O)NC(=O)C3NC(=O)C2NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(CC(C)C)NC)C(O)C(C=C3Cl)=CC=C3OC3=CC2=CC1=C3OC1OC(CO)C(O)C(O)C1OC1CC(C)(N)C(O)C(C)O1 MYPYJXKWCTUITO-UHFFFAOYSA-N 0.000 description 4
- 229960003048 vinblastine Drugs 0.000 description 4
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 4
- 241000701489 Cauliflower mosaic virus Species 0.000 description 3
- 241000157855 Cinchona Species 0.000 description 3
- 235000001258 Cinchona calisaya Nutrition 0.000 description 3
- 108010079245 Cystic Fibrosis Transmembrane Conductance Regulator Proteins 0.000 description 3
- STECJAGHUSJQJN-USLFZFAMSA-N LSM-4015 Chemical compound C1([C@@H](CO)C(=O)OC2C[C@@H]3N([C@H](C2)[C@@H]2[C@H]3O2)C)=CC=CC=C1 STECJAGHUSJQJN-USLFZFAMSA-N 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 102000004855 Multi drug resistance-associated proteins Human genes 0.000 description 3
- 108090001099 Multi drug resistance-associated proteins Proteins 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- 108010076504 Protein Sorting Signals Proteins 0.000 description 3
- 101710120355 Uncharacterized membrane protein ycf78 Proteins 0.000 description 3
- 108010059993 Vancomycin Proteins 0.000 description 3
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 230000006696 biosynthetic metabolic pathway Effects 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 238000001784 detoxification Methods 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 238000006911 enzymatic reaction Methods 0.000 description 3
- 238000000605 extraction Methods 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 229940088597 hormone Drugs 0.000 description 3
- 239000005556 hormone Substances 0.000 description 3
- 230000002209 hydrophobic effect Effects 0.000 description 3
- 108010002685 hygromycin-B kinase Proteins 0.000 description 3
- 230000003834 intracellular effect Effects 0.000 description 3
- 229930027917 kanamycin Natural products 0.000 description 3
- 229960000318 kanamycin Drugs 0.000 description 3
- 229930182823 kanamycin A Natural products 0.000 description 3
- 231100000518 lethal Toxicity 0.000 description 3
- 230000001665 lethal effect Effects 0.000 description 3
- 210000000056 organ Anatomy 0.000 description 3
- 230000005305 organ development Effects 0.000 description 3
- 230000019525 primary metabolic process Effects 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 231100000167 toxic agent Toxicity 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 238000011282 treatment Methods 0.000 description 3
- 229960003165 vancomycin Drugs 0.000 description 3
- MYPYJXKWCTUITO-LYRMYLQWSA-N vancomycin Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=C2C=C3C=C1OC1=CC=C(C=C1Cl)[C@@H](O)[C@H](C(N[C@@H](CC(N)=O)C(=O)N[C@H]3C(=O)N[C@H]1C(=O)N[C@H](C(N[C@@H](C3=CC(O)=CC(O)=C3C=3C(O)=CC=C1C=3)C(O)=O)=O)[C@H](O)C1=CC=C(C(=C1)Cl)O2)=O)NC(=O)[C@@H](CC(C)C)NC)[C@H]1C[C@](C)(N)[C@H](O)[C@H](C)O1 MYPYJXKWCTUITO-LYRMYLQWSA-N 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- CZJDUZOWQVAEEV-XIEZEKGWSA-N (+)-19-epi-Ajmalicine Natural products O=C(OC)C=1[C@@H]2[C@@H]([C@@H](C)OC=1)C[N+]1[C@H](c3[nH]c4c(c3CC1)cccc4)C2 CZJDUZOWQVAEEV-XIEZEKGWSA-N 0.000 description 2
- JLIDBLDQVAYHNE-YKALOCIXSA-N (+)-Abscisic acid Chemical compound OC(=O)/C=C(/C)\C=C\[C@@]1(O)C(C)=CC(=O)CC1(C)C JLIDBLDQVAYHNE-YKALOCIXSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- XIIAYQZJNBULGD-XWLABEFZSA-N 5α-cholestane Chemical compound C([C@@H]1CC2)CCC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@H](C)CCCC(C)C)[C@@]2(C)CC1 XIIAYQZJNBULGD-XWLABEFZSA-N 0.000 description 2
- KDCGOANMDULRCW-UHFFFAOYSA-N 7H-purine Chemical compound N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 2
- 229920001817 Agar Polymers 0.000 description 2
- 241001106067 Atropa Species 0.000 description 2
- 108010035563 Chloramphenicol O-acetyltransferase Proteins 0.000 description 2
- 241000218631 Coniferophyta Species 0.000 description 2
- 102000012605 Cystic Fibrosis Transmembrane Conductance Regulator Human genes 0.000 description 2
- 108020003215 DNA Probes Proteins 0.000 description 2
- 239000003298 DNA probe Substances 0.000 description 2
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 2
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 2
- 241000208296 Datura Species 0.000 description 2
- LTMHDMANZUZIPE-AMTYYWEZSA-N Digoxin Natural products O([C@H]1[C@H](C)O[C@H](O[C@@H]2C[C@@H]3[C@@](C)([C@@H]4[C@H]([C@]5(O)[C@](C)([C@H](O)C4)[C@H](C4=CC(=O)OC4)CC5)CC3)CC2)C[C@@H]1O)[C@H]1O[C@H](C)[C@@H](O[C@H]2O[C@@H](C)[C@H](O)[C@@H](O)C2)[C@@H](O)C1 LTMHDMANZUZIPE-AMTYYWEZSA-N 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 2
- 206010053759 Growth retardation Diseases 0.000 description 2
- 241000208278 Hyoscyamus Species 0.000 description 2
- 244000017020 Ipomoea batatas Species 0.000 description 2
- 235000002678 Ipomoea batatas Nutrition 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 102000003939 Membrane transport proteins Human genes 0.000 description 2
- 108090000301 Membrane transport proteins Proteins 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 102100021339 Multidrug resistance-associated protein 1 Human genes 0.000 description 2
- 108700008625 Reporter Genes Proteins 0.000 description 2
- 101150030513 SNQ2 gene Proteins 0.000 description 2
- 101150017986 STE6 gene Proteins 0.000 description 2
- 101100160470 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) YOR1 gene Proteins 0.000 description 2
- INVGWHRKADIJHF-UHFFFAOYSA-N Sanguinarin Chemical compound C1=C2OCOC2=CC2=C3[N+](C)=CC4=C(OCO5)C5=CC=C4C3=CC=C21 INVGWHRKADIJHF-UHFFFAOYSA-N 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 108091023040 Transcription factor Proteins 0.000 description 2
- 102000040945 Transcription factor Human genes 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- 241000607479 Yersinia pestis Species 0.000 description 2
- 239000008272 agar Substances 0.000 description 2
- GRTOGORTSDXSFK-XJTZBENFSA-N ajmalicine Chemical compound C1=CC=C2C(CCN3C[C@@H]4[C@H](C)OC=C([C@H]4C[C@H]33)C(=O)OC)=C3NC2=C1 GRTOGORTSDXSFK-XJTZBENFSA-N 0.000 description 2
- 229940007897 ajmalicine Drugs 0.000 description 2
- 229910021529 ammonia Inorganic materials 0.000 description 2
- 229960001192 bekanamycin Drugs 0.000 description 2
- 229910052793 cadmium Inorganic materials 0.000 description 2
- BDOSMKKIYDKNTQ-UHFFFAOYSA-N cadmium atom Chemical compound [Cd] BDOSMKKIYDKNTQ-UHFFFAOYSA-N 0.000 description 2
- 229940041514 candida albicans extract Drugs 0.000 description 2
- 210000002421 cell wall Anatomy 0.000 description 2
- 210000003169 central nervous system Anatomy 0.000 description 2
- 210000000349 chromosome Anatomy 0.000 description 2
- LOUPRKONTZGTKE-UHFFFAOYSA-N cinchonine Natural products C1C(C(C2)C=C)CCN2C1C(O)C1=CC=NC2=CC=C(OC)C=C21 LOUPRKONTZGTKE-UHFFFAOYSA-N 0.000 description 2
- 229960003920 cocaine Drugs 0.000 description 2
- 229960004126 codeine Drugs 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- ZQSIJRDFPHDXIC-UHFFFAOYSA-N daidzein Chemical compound C1=CC(O)=CC=C1C1=COC2=CC(O)=CC=C2C1=O ZQSIJRDFPHDXIC-UHFFFAOYSA-N 0.000 description 2
- LTMHDMANZUZIPE-PUGKRICDSA-N digoxin Chemical compound C1[C@H](O)[C@H](O)[C@@H](C)O[C@H]1O[C@@H]1[C@@H](C)O[C@@H](O[C@@H]2[C@H](O[C@@H](O[C@@H]3C[C@@H]4[C@]([C@@H]5[C@H]([C@]6(CC[C@@H]([C@@]6(C)[C@H](O)C5)C=5COC(=O)C=5)O)CC4)(C)CC3)C[C@@H]2O)C)C[C@@H]1O LTMHDMANZUZIPE-PUGKRICDSA-N 0.000 description 2
- 229960005156 digoxin Drugs 0.000 description 2
- LTMHDMANZUZIPE-UHFFFAOYSA-N digoxine Natural products C1C(O)C(O)C(C)OC1OC1C(C)OC(OC2C(OC(OC3CC4C(C5C(C6(CCC(C6(C)C(O)C5)C=5COC(=O)C=5)O)CC4)(C)CC3)CC2O)C)CC1O LTMHDMANZUZIPE-UHFFFAOYSA-N 0.000 description 2
- 239000000975 dye Substances 0.000 description 2
- CTSPAMFJBXKSOY-UHFFFAOYSA-N ellipticine Chemical compound N1=CC=C2C(C)=C(NC=3C4=CC=CC=3)C4=C(C)C2=C1 CTSPAMFJBXKSOY-UHFFFAOYSA-N 0.000 description 2
- 230000013020 embryo development Effects 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000000284 extract Substances 0.000 description 2
- 229930003935 flavonoid Natural products 0.000 description 2
- 235000017173 flavonoids Nutrition 0.000 description 2
- 150000002215 flavonoids Chemical class 0.000 description 2
- 239000000796 flavoring agent Substances 0.000 description 2
- 235000013305 food Nutrition 0.000 description 2
- 238000005194 fractionation Methods 0.000 description 2
- 238000002290 gas chromatography-mass spectrometry Methods 0.000 description 2
- 238000012239 gene modification Methods 0.000 description 2
- 230000005017 genetic modification Effects 0.000 description 2
- 235000013617 genetically modified food Nutrition 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- 231100000001 growth retardation Toxicity 0.000 description 2
- OROGSEYTTFOCAN-UHFFFAOYSA-N hydrocodone Natural products C1C(N(CCC234)C)C2C=CC(O)C3OC2=C4C1=CC=C2OC OROGSEYTTFOCAN-UHFFFAOYSA-N 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 229930005303 indole alkaloid Natural products 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 239000000543 intermediate Substances 0.000 description 2
- ZNJFBWYDHIGLCU-HWKXXFMVSA-N jasmonic acid Chemical compound CC\C=C/C[C@@H]1[C@@H](CC(O)=O)CCC1=O ZNJFBWYDHIGLCU-HWKXXFMVSA-N 0.000 description 2
- 229930182824 kanamycin B Natural products 0.000 description 2
- SKKLOUVUUNMCJE-FQSMHNGLSA-N kanamycin B Chemical compound N[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SKKLOUVUUNMCJE-FQSMHNGLSA-N 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 230000000442 meristematic effect Effects 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 229960005181 morphine Drugs 0.000 description 2
- 108010066052 multidrug resistance-associated protein 1 Proteins 0.000 description 2
- 108010058731 nopaline synthase Proteins 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 150000007523 nucleic acids Chemical class 0.000 description 2
- 235000017807 phytochemicals Nutrition 0.000 description 2
- 230000008635 plant growth Effects 0.000 description 2
- 238000004161 plant tissue culture Methods 0.000 description 2
- 230000008488 polyadenylation Effects 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 210000001938 protoplast Anatomy 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 229960000948 quinine Drugs 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- ZLQMRLSBXKQKMG-UHFFFAOYSA-N rauniticine Natural products COC(=O)C1=CC2CC3N(CCc4c3[nH]c5ccccc45)CC2C(C)O1 ZLQMRLSBXKQKMG-UHFFFAOYSA-N 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 238000003757 reverse transcription PCR Methods 0.000 description 2
- 239000007320 rich medium Substances 0.000 description 2
- YGSDEFSMJLZEOE-UHFFFAOYSA-N salicylic acid Chemical compound OC(=O)C1=CC=CC=C1O YGSDEFSMJLZEOE-UHFFFAOYSA-N 0.000 description 2
- 230000024053 secondary metabolic process Effects 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 229960000268 spectinomycin Drugs 0.000 description 2
- UNFWWIHTNXNPBV-WXKVUWSESA-N spectinomycin Chemical compound O([C@@H]1[C@@H](NC)[C@@H](O)[C@H]([C@@H]([C@H]1O1)O)NC)[C@]2(O)[C@H]1O[C@H](C)CC2=O UNFWWIHTNXNPBV-WXKVUWSESA-N 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 239000003053 toxin Substances 0.000 description 2
- 231100000765 toxin Toxicity 0.000 description 2
- 108700012359 toxins Proteins 0.000 description 2
- 230000005026 transcription initiation Effects 0.000 description 2
- 210000004881 tumor cell Anatomy 0.000 description 2
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 2
- 229960004528 vincristine Drugs 0.000 description 2
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- 239000002676 xenobiotic agent Substances 0.000 description 2
- 210000005253 yeast cell Anatomy 0.000 description 2
- 239000012138 yeast extract Substances 0.000 description 2
- UIKROCXWUNQSPJ-VIFPVBQESA-N (-)-cotinine Chemical compound C1CC(=O)N(C)[C@@H]1C1=CC=CN=C1 UIKROCXWUNQSPJ-VIFPVBQESA-N 0.000 description 1
- NEKWBGYGPTVYPY-UHFFFAOYSA-N (1,2-dihydroxypyrrolidin-2-yl)methanediol Chemical compound OC(O)C1(O)CCCN1O NEKWBGYGPTVYPY-UHFFFAOYSA-N 0.000 description 1
- RKUNBYITZUJHSG-VFSICIBPSA-N (2S)-3-hydroxy-2-phenylpropanoic acid [(1R,5S)-8-methyl-8-azabicyclo[3.2.1]octan-3-yl] ester Chemical compound C1([C@@H](CO)C(=O)OC2C[C@H]3CC[C@@H](C2)N3C)=CC=CC=C1 RKUNBYITZUJHSG-VFSICIBPSA-N 0.000 description 1
- MTXSIJUGVMTTMU-JTQLQIEISA-N (S)-anabasine Chemical compound N1CCCC[C@H]1C1=CC=CN=C1 MTXSIJUGVMTTMU-JTQLQIEISA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- SZLZWPPUNLXJEA-UHFFFAOYSA-N 11,17-dimethoxy-18-[3-(3,4,5-trimethoxy-phenyl)-acryloyloxy]-yohimbane-16-carboxylic acid methyl ester Natural products C1C2CN3CCC(C4=CC=C(OC)C=C4N4)=C4C3CC2C(C(=O)OC)C(OC)C1OC(=O)C=CC1=CC(OC)=C(OC)C(OC)=C1 SZLZWPPUNLXJEA-UHFFFAOYSA-N 0.000 description 1
- CJDRUOGAGYHKKD-RQBLFBSQSA-N 1pon08459r Chemical compound CN([C@H]1[C@@]2(C[C@@]3([H])[C@@H]([C@@H](O)N42)CC)[H])C2=CC=CC=C2[C@]11C[C@@]4([H])[C@H]3[C@H]1O CJDRUOGAGYHKKD-RQBLFBSQSA-N 0.000 description 1
- AIQMLBKBQCVDEY-UHFFFAOYSA-N 7-epi-australine Natural products OC1CCN2C(CO)C(O)C(O)C21 AIQMLBKBQCVDEY-UHFFFAOYSA-N 0.000 description 1
- 108091006112 ATPases Proteins 0.000 description 1
- 101100451087 Acetobacter pasteurianus hisC gene Proteins 0.000 description 1
- 102000057290 Adenosine Triphosphatases Human genes 0.000 description 1
- 241000589156 Agrobacterium rhizogenes Species 0.000 description 1
- NEZONWMXZKDMKF-JTQLQIEISA-N Alkannin Chemical compound C1=CC(O)=C2C(=O)C([C@@H](O)CC=C(C)C)=CC(=O)C2=C1O NEZONWMXZKDMKF-JTQLQIEISA-N 0.000 description 1
- 206010002091 Anaesthesia Diseases 0.000 description 1
- COWQBMIVVHLMNO-UHFFFAOYSA-N Anatalline Chemical compound N1CCC(C=2C=NC=CC=2)CC1C1=CC=CN=C1 COWQBMIVVHLMNO-UHFFFAOYSA-N 0.000 description 1
- COWQBMIVVHLMNO-SWLSCSKDSA-N Anatalline Natural products C1([C@H]2C[C@H](CCN2)C=2C=NC=CC=2)=CC=CN=C1 COWQBMIVVHLMNO-SWLSCSKDSA-N 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 241000219195 Arabidopsis thaliana Species 0.000 description 1
- 101100433746 Arabidopsis thaliana ABCG29 gene Proteins 0.000 description 1
- 101100054297 Arabidopsis thaliana ABCG38 gene Proteins 0.000 description 1
- 101100054299 Arabidopsis thaliana ABCG39 gene Proteins 0.000 description 1
- 229930003347 Atropine Natural products 0.000 description 1
- AIQMLBKBQCVDEY-FMGWEMOISA-N Australine Natural products O[C@@H]1CCN2[C@@H](CO)[C@H](O)[C@H](O)[C@H]21 AIQMLBKBQCVDEY-FMGWEMOISA-N 0.000 description 1
- AIQMLBKBQCVDEY-OZRXBMAMSA-N Australine Chemical compound O[C@H]1CCN2[C@H](CO)[C@@H](O)[C@H](O)[C@H]21 AIQMLBKBQCVDEY-OZRXBMAMSA-N 0.000 description 1
- 231100000699 Bacterial toxin Toxicity 0.000 description 1
- 108010023063 Bacto-peptone Proteins 0.000 description 1
- 241001184073 Basilicum Species 0.000 description 1
- 240000000724 Berberis vulgaris Species 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- 241000759905 Camptotheca acuminata Species 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- JDVVGAQPNNXQDW-WCMLQCRESA-N Castanospermine Natural products O[C@H]1[C@@H](O)[C@H]2[C@@H](O)CCN2C[C@H]1O JDVVGAQPNNXQDW-WCMLQCRESA-N 0.000 description 1
- JDVVGAQPNNXQDW-TVNFTVLESA-N Castinospermine Chemical compound C1[C@H](O)[C@@H](O)[C@H](O)[C@H]2[C@@H](O)CCN21 JDVVGAQPNNXQDW-TVNFTVLESA-N 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 108091006146 Channels Proteins 0.000 description 1
- 101710116747 Chitinase A Proteins 0.000 description 1
- 102000012286 Chitinases Human genes 0.000 description 1
- 108010022172 Chitinases Proteins 0.000 description 1
- 229920001661 Chitosan Polymers 0.000 description 1
- 108010073254 Colicins Proteins 0.000 description 1
- 244000247747 Coptis groenlandica Species 0.000 description 1
- 235000002991 Coptis groenlandica Nutrition 0.000 description 1
- UIKROCXWUNQSPJ-UHFFFAOYSA-N Cotinine Natural products C1CC(=O)N(C)C1C1=CC=CN=C1 UIKROCXWUNQSPJ-UHFFFAOYSA-N 0.000 description 1
- 241000195493 Cryptophyta Species 0.000 description 1
- 102100023419 Cystic fibrosis transmembrane conductance regulator Human genes 0.000 description 1
- 108010066133 D-octopine dehydrogenase Proteins 0.000 description 1
- LXBIFEVIBLOUGU-UHFFFAOYSA-N Deoxymannojirimycin Natural products OCC1NCC(O)C(O)C1O LXBIFEVIBLOUGU-UHFFFAOYSA-N 0.000 description 1
- 241001469188 Duboisia Species 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 101710202612 Endochitinase A Proteins 0.000 description 1
- 240000006890 Erythroxylum coca Species 0.000 description 1
- FCEXWTOTHXCQCQ-UHFFFAOYSA-N Ethoxydihydrosanguinarine Natural products C12=CC=C3OCOC3=C2C(OCC)N(C)C(C2=C3)=C1C=CC2=CC1=C3OCO1 FCEXWTOTHXCQCQ-UHFFFAOYSA-N 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 230000005526 G1 to G0 transition Effects 0.000 description 1
- 208000018522 Gastrointestinal disease Diseases 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 102000053187 Glucuronidase Human genes 0.000 description 1
- 108010060309 Glucuronidase Proteins 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 102000005744 Glycoside Hydrolases Human genes 0.000 description 1
- 108010031186 Glycoside Hydrolases Proteins 0.000 description 1
- 239000005562 Glyphosate Substances 0.000 description 1
- ZIXGXMMUKPLXBB-UHFFFAOYSA-N Guatambuinine Natural products N1C2=CC=CC=C2C2=C1C(C)=C1C=CN=C(C)C1=C2 ZIXGXMMUKPLXBB-UHFFFAOYSA-N 0.000 description 1
- 108010006464 Hemolysin Proteins Proteins 0.000 description 1
- SQUHHTBVTRBESD-UHFFFAOYSA-N Hexa-Ac-myo-Inositol Natural products CC(=O)OC1C(OC(C)=O)C(OC(C)=O)C(OC(C)=O)C(OC(C)=O)C1OC(C)=O SQUHHTBVTRBESD-UHFFFAOYSA-N 0.000 description 1
- 240000005979 Hordeum vulgare Species 0.000 description 1
- 235000007340 Hordeum vulgare Nutrition 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 235000000177 Indigofera tinctoria Nutrition 0.000 description 1
- 102100034343 Integrase Human genes 0.000 description 1
- CJDRUOGAGYHKKD-UHFFFAOYSA-N Iso-ajmalin Natural products CN1C2=CC=CC=C2C2(C(C34)O)C1C1CC3C(CC)C(O)N1C4C2 CJDRUOGAGYHKKD-UHFFFAOYSA-N 0.000 description 1
- 239000007836 KH2PO4 Substances 0.000 description 1
- 108010025815 Kanamycin Kinase Proteins 0.000 description 1
- 235000013628 Lantana involucrata Nutrition 0.000 description 1
- 241000222722 Leishmania <genus> Species 0.000 description 1
- 241000209510 Liliopsida Species 0.000 description 1
- 241001071917 Lithospermum Species 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 235000007688 Lycopersicon esculentum Nutrition 0.000 description 1
- 108700041567 MDR Genes Proteins 0.000 description 1
- 241000218922 Magnoliophyta Species 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 235000006679 Mentha X verticillata Nutrition 0.000 description 1
- 235000002899 Mentha suaveolens Nutrition 0.000 description 1
- 235000001636 Mentha x rotundifolia Nutrition 0.000 description 1
- 235000006677 Monarda citriodora ssp. austromontana Nutrition 0.000 description 1
- 206010048723 Multiple-drug resistance Diseases 0.000 description 1
- MSPCIZMDDUQPGJ-UHFFFAOYSA-N N-methyl-N-(trimethylsilyl)trifluoroacetamide Chemical compound C[Si](C)(C)N(C)C(=O)C(F)(F)F MSPCIZMDDUQPGJ-UHFFFAOYSA-N 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 108010033272 Nitrilase Proteins 0.000 description 1
- 241000692656 Oenothera cinerea Species 0.000 description 1
- 240000007673 Origanum vulgare Species 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 101100054289 Oryza sativa subsp. japonica ABCG34 gene Proteins 0.000 description 1
- 101100054291 Oryza sativa subsp. japonica ABCG35 gene Proteins 0.000 description 1
- 108010087367 P-glycoprotein 2 Proteins 0.000 description 1
- 101150088582 PDR1 gene Proteins 0.000 description 1
- 235000011096 Papaver Nutrition 0.000 description 1
- 240000001090 Papaver somniferum Species 0.000 description 1
- 208000018737 Parkinson disease Diseases 0.000 description 1
- 240000005523 Peganum harmala Species 0.000 description 1
- 235000005126 Peganum harmala Nutrition 0.000 description 1
- 102100039032 Phosphatidylcholine translocator ABCB4 Human genes 0.000 description 1
- 108700001094 Plant Genes Proteins 0.000 description 1
- 108010064851 Plant Proteins Proteins 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 101800001295 Putative ATP-dependent helicase Proteins 0.000 description 1
- 101800001006 Putative helicase Proteins 0.000 description 1
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 238000010240 RT-PCR analysis Methods 0.000 description 1
- 101100131297 Rattus norvegicus Abcc2 gene Proteins 0.000 description 1
- 241000208332 Rauvolfia Species 0.000 description 1
- 244000061121 Rauvolfia serpentina Species 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 108700005075 Regulator Genes Proteins 0.000 description 1
- SZLZWPPUNLXJEA-FMCDHCOASA-N Rescinnamine Natural products O=C(O[C@H]1[C@@H](OC)[C@@H](C(=O)OC)[C@@H]2[C@H](C1)CN1[C@@H](c3[nH]c4c(c3CC1)ccc(OC)c4)C2)/C=C/c1cc(OC)c(OC)c(OC)c1 SZLZWPPUNLXJEA-FMCDHCOASA-N 0.000 description 1
- SUYXJDLXGFPMCQ-INIZCTEOSA-N SJ000287331 Natural products CC1=c2cnccc2=C(C)C2=Nc3ccccc3[C@H]12 SUYXJDLXGFPMCQ-INIZCTEOSA-N 0.000 description 1
- 101100519252 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) PDR10 gene Proteins 0.000 description 1
- 101100519253 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) PDR11 gene Proteins 0.000 description 1
- 241000242873 Scopolia Species 0.000 description 1
- 240000003768 Solanum lycopersicum Species 0.000 description 1
- 244000061456 Solanum tuberosum Species 0.000 description 1
- 235000002595 Solanum tuberosum Nutrition 0.000 description 1
- 108010091105 Subfamily B ATP Binding Cassette Transporter Proteins 0.000 description 1
- 102000018075 Subfamily B ATP Binding Cassette Transporter Human genes 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- 108010006785 Taq Polymerase Proteins 0.000 description 1
- 241001116500 Taxus Species 0.000 description 1
- 241000205578 Thalictrum Species 0.000 description 1
- JZRWCGZRTZMZEH-UHFFFAOYSA-N Thiamine Natural products CC1=C(CCO)SC=[N+]1CC1=CN=C(C)N=C1N JZRWCGZRTZMZEH-UHFFFAOYSA-N 0.000 description 1
- 241000592342 Tracheophyta Species 0.000 description 1
- 108700009124 Transcription Initiation Site Proteins 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 229960004332 ajmaline Drugs 0.000 description 1
- UNNKKUDWEASWDN-UHFFFAOYSA-N alkannin Natural products CC(=CCC(O)c1cc(O)c2C(=O)C=CC(=O)c2c1O)C UNNKKUDWEASWDN-UHFFFAOYSA-N 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 235000001014 amino acid Nutrition 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 229930014345 anabasine Natural products 0.000 description 1
- 238000001949 anaesthesia Methods 0.000 description 1
- 230000037005 anaesthesia Effects 0.000 description 1
- 230000003444 anaesthetic effect Effects 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 229930002877 anthocyanin Natural products 0.000 description 1
- 235000010208 anthocyanin Nutrition 0.000 description 1
- 239000004410 anthocyanin Substances 0.000 description 1
- 150000004636 anthocyanins Chemical class 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000001078 anti-cholinergic effect Effects 0.000 description 1
- 230000003178 anti-diabetic effect Effects 0.000 description 1
- 230000002001 anti-metastasis Effects 0.000 description 1
- 230000000840 anti-viral effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 229940055075 anticholinesterase parasympathomimetics Drugs 0.000 description 1
- 239000003472 antidiabetic agent Substances 0.000 description 1
- 239000000729 antidote Substances 0.000 description 1
- 229940075522 antidotes Drugs 0.000 description 1
- 230000030741 antigen processing and presentation Effects 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 230000003078 antioxidant effect Effects 0.000 description 1
- 101150037081 aroA gene Proteins 0.000 description 1
- 210000004507 artificial chromosome Anatomy 0.000 description 1
- RKUNBYITZUJHSG-SPUOUPEWSA-N atropine Chemical compound O([C@H]1C[C@H]2CC[C@@H](C1)N2C)C(=O)C(CO)C1=CC=CC=C1 RKUNBYITZUJHSG-SPUOUPEWSA-N 0.000 description 1
- 229960000396 atropine Drugs 0.000 description 1
- 239000000688 bacterial toxin Substances 0.000 description 1
- 239000007640 basal medium Substances 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 239000003139 biocide Substances 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 239000007844 bleaching agent Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 230000000747 cardiac effect Effects 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 230000010307 cell transformation Effects 0.000 description 1
- JQXXHWHPUNPDRT-YOPQJBRCSA-N chembl1332716 Chemical compound O([C@](C1=O)(C)O\C=C/[C@@H]([C@H]([C@@H](OC(C)=O)[C@H](C)[C@H](O)[C@H](C)[C@@H](O)[C@@H](C)/C=C\C=C(C)/C(=O)NC=2C(O)=C3C(O)=C4C)C)OC)C4=C1C3=C(O)C=2\C=N\N1CCN(C)CC1 JQXXHWHPUNPDRT-YOPQJBRCSA-N 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 229940044683 chemotherapy drug Drugs 0.000 description 1
- 210000003763 chloroplast Anatomy 0.000 description 1
- 239000000544 cholinesterase inhibitor Substances 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 239000001949 cinchona spp. Substances 0.000 description 1
- 238000013377 clone selection method Methods 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 230000002153 concerted effect Effects 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 229950006073 cotinine Drugs 0.000 description 1
- 229930182485 cyanogenic glycoside Natural products 0.000 description 1
- 150000008142 cyanogenic glycosides Chemical class 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 235000007240 daidzein Nutrition 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- FCRACOPGPMPSHN-UHFFFAOYSA-N desoxyabscisic acid Natural products OC(=O)C=C(C)C=CC1C(C)=CC(=O)CC1(C)C FCRACOPGPMPSHN-UHFFFAOYSA-N 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 150000004141 diterpene derivatives Chemical class 0.000 description 1
- 238000011143 downstream manufacturing Methods 0.000 description 1
- LXBIFEVIBLOUGU-JGWLITMVSA-N duvoglustat Chemical compound OC[C@H]1NC[C@H](O)[C@@H](O)[C@@H]1O LXBIFEVIBLOUGU-JGWLITMVSA-N 0.000 description 1
- 238000010291 electrical method Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 210000002257 embryonic structure Anatomy 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 210000002615 epidermis Anatomy 0.000 description 1
- 229960005542 ethidium bromide Drugs 0.000 description 1
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 230000008020 evaporation Effects 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- 238000010195 expression analysis Methods 0.000 description 1
- 239000003925 fat Substances 0.000 description 1
- 235000019197 fats Nutrition 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000012847 fine chemical Substances 0.000 description 1
- 235000019634 flavors Nutrition 0.000 description 1
- 235000013373 food additive Nutrition 0.000 description 1
- 239000002778 food additive Substances 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 239000003205 fragrance Substances 0.000 description 1
- 239000012737 fresh medium Substances 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 238000012215 gene cloning Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 235000006539 genistein Nutrition 0.000 description 1
- TZBJGXHYKVUXJN-UHFFFAOYSA-N genistein Natural products C1=CC(O)=CC=C1C1=COC2=CC(O)=CC(O)=C2C1=O TZBJGXHYKVUXJN-UHFFFAOYSA-N 0.000 description 1
- 229940045109 genistein Drugs 0.000 description 1
- ZCOLJUOHXJRHDI-CMWLGVBASA-N genistein 7-O-beta-D-glucoside Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=CC(O)=C2C(=O)C(C=3C=CC(O)=CC=3)=COC2=C1 ZCOLJUOHXJRHDI-CMWLGVBASA-N 0.000 description 1
- 229960002518 gentamicin Drugs 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 125000004383 glucosinolate group Chemical group 0.000 description 1
- 229930182480 glucuronide Natural products 0.000 description 1
- 150000008134 glucuronides Chemical class 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 239000003316 glycosidase inhibitor Substances 0.000 description 1
- XDDAORKBJWWYJS-UHFFFAOYSA-N glyphosate Chemical compound OC(=O)CNCP(O)(O)=O XDDAORKBJWWYJS-UHFFFAOYSA-N 0.000 description 1
- 229940097068 glyphosate Drugs 0.000 description 1
- 101150054900 gus gene Proteins 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 208000019622 heart disease Diseases 0.000 description 1
- 229910001385 heavy metal Inorganic materials 0.000 description 1
- 239000003228 hemolysin Substances 0.000 description 1
- 235000008216 herbs Nutrition 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 101150118121 hisC1 gene Proteins 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 230000003054 hormonal effect Effects 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 230000033444 hydroxylation Effects 0.000 description 1
- 238000005805 hydroxylation reaction Methods 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 230000008676 import Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 229940097275 indigo Drugs 0.000 description 1
- COHYTHOBJLSHDF-UHFFFAOYSA-N indigo powder Natural products N1C2=CC=CC=C2C(=O)C1=C1C(=O)C2=CC=CC=C2N1 COHYTHOBJLSHDF-UHFFFAOYSA-N 0.000 description 1
- 150000002475 indoles Chemical class 0.000 description 1
- HAJKHJOABGFIGP-UHFFFAOYSA-N indolizidine Chemical class C1CCCN2CCCC21 HAJKHJOABGFIGP-UHFFFAOYSA-N 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- CDAISMWEOUEBRE-GPIVLXJGSA-N inositol Chemical compound O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@@H]1O CDAISMWEOUEBRE-GPIVLXJGSA-N 0.000 description 1
- 229960000367 inositol Drugs 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 229930013686 lignan Natural products 0.000 description 1
- 235000009408 lignans Nutrition 0.000 description 1
- 150000005692 lignans Chemical class 0.000 description 1
- 238000009630 liquid culture Methods 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 230000013011 mating Effects 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 238000012269 metabolic engineering Methods 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 125000002950 monocyclic group Chemical group 0.000 description 1
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 1
- 229930003658 monoterpene Natural products 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 238000007857 nested PCR Methods 0.000 description 1
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 239000012044 organic layer Substances 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-N papa-hydroxy-benzoic acid Natural products OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 1
- 239000002304 perfume Substances 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 239000000575 pesticide Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 150000002989 phenols Chemical class 0.000 description 1
- 239000003016 pheromone Substances 0.000 description 1
- RGCLLPNLLBQHPF-HJWRWDBZSA-N phosphamidon Chemical compound CCN(CC)C(=O)C(\Cl)=C(/C)OP(=O)(OC)OC RGCLLPNLLBQHPF-HJWRWDBZSA-N 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 238000000053 physical method Methods 0.000 description 1
- 229930195732 phytohormone Natural products 0.000 description 1
- 239000000049 pigment Substances 0.000 description 1
- 230000019612 pigmentation Effects 0.000 description 1
- 150000003053 piperidines Chemical class 0.000 description 1
- 210000000745 plant chromosome Anatomy 0.000 description 1
- 235000021118 plant-derived protein Nutrition 0.000 description 1
- 125000003367 polycyclic group Chemical group 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- GNSKLFRGEWLPPA-UHFFFAOYSA-M potassium dihydrogen phosphate Chemical compound [K+].OP(O)([O-])=O GNSKLFRGEWLPPA-UHFFFAOYSA-M 0.000 description 1
- 239000008057 potassium phosphate buffer Substances 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 230000003405 preventing effect Effects 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 150000003236 pyrrolines Chemical class 0.000 description 1
- 125000003410 quininyl group Chemical group 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000001172 regenerating effect Effects 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 238000005067 remediation Methods 0.000 description 1
- 230000001850 reproductive effect Effects 0.000 description 1
- SMSAPZICLFYVJS-QEGASFHISA-N rescinnamine Chemical compound O([C@H]1[C@@H]([C@H]([C@H]2C[C@@H]3C4=C([C]5C=CC(OC)=CC5=N4)CCN3C[C@H]2C1)C(=O)OC)OC)C(=O)\C=C\C1=CC(OC)=C(OC)C(OC)=C1 SMSAPZICLFYVJS-QEGASFHISA-N 0.000 description 1
- 229960001965 rescinnamine Drugs 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 229960001225 rifampicin Drugs 0.000 description 1
- 229960004889 salicylic acid Drugs 0.000 description 1
- 229940084560 sanguinarine Drugs 0.000 description 1
- YZRQUTZNTDAYPJ-UHFFFAOYSA-N sanguinarine pseudobase Natural products C1=C2OCOC2=CC2=C3N(C)C(O)C4=C(OCO5)C5=CC=C4C3=CC=C21 YZRQUTZNTDAYPJ-UHFFFAOYSA-N 0.000 description 1
- CDAISMWEOUEBRE-UHFFFAOYSA-N scyllo-inosotol Natural products OC1C(O)C(O)C(O)C(O)C1O CDAISMWEOUEBRE-UHFFFAOYSA-N 0.000 description 1
- 230000009962 secretion pathway Effects 0.000 description 1
- 230000009919 sequestration Effects 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 229910001220 stainless steel Inorganic materials 0.000 description 1
- 239000010935 stainless steel Substances 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 229930003352 steroid alkaloid Natural products 0.000 description 1
- 150000001420 substituted heterocyclic compounds Chemical class 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- FXUAIOOAOAVCGD-UHFFFAOYSA-N swainsonine Natural products C1CCC(O)C2C(O)C(O)CN21 FXUAIOOAOAVCGD-UHFFFAOYSA-N 0.000 description 1
- 229960005566 swainsonine Drugs 0.000 description 1
- FXUAIOOAOAVCGD-FKSUSPILSA-N swainsonine Chemical compound C1CC[C@H](O)[C@H]2[C@H](O)[C@H](O)CN21 FXUAIOOAOAVCGD-FKSUSPILSA-N 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 235000019157 thiamine Nutrition 0.000 description 1
- KYMBYSLLVAOCFI-UHFFFAOYSA-N thiamine Chemical compound CC1=C(CCO)SCN1CC1=CN=C(C)N=C1N KYMBYSLLVAOCFI-UHFFFAOYSA-N 0.000 description 1
- 229960003495 thiamine Drugs 0.000 description 1
- 239000011721 thiamine Substances 0.000 description 1
- 238000004809 thin layer chromatography Methods 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 239000003440 toxic substance Substances 0.000 description 1
- 230000005029 transcription elongation Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 108091008023 transcriptional regulators Proteins 0.000 description 1
- 238000011426 transformation method Methods 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 150000003648 triterpenes Chemical class 0.000 description 1
- 229930004006 tropane Natural products 0.000 description 1
- XLRPYZSEQKXZAA-OCAPTIKFSA-N tropane Chemical compound C1CC[C@H]2CC[C@@H]1N2C XLRPYZSEQKXZAA-OCAPTIKFSA-N 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- MWOOGOJBHIARFG-UHFFFAOYSA-N vanillin Chemical compound COC1=CC(C=O)=CC=C1O MWOOGOJBHIARFG-UHFFFAOYSA-N 0.000 description 1
- FGQOOHJZONJGDT-UHFFFAOYSA-N vanillin Natural products COC1=CC(O)=CC(C=O)=C1 FGQOOHJZONJGDT-UHFFFAOYSA-N 0.000 description 1
- 235000012141 vanillin Nutrition 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 238000011179 visual inspection Methods 0.000 description 1
- 238000003260 vortexing Methods 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8242—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/37—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from fungi
- C07K14/39—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from fungi from yeasts
- C07K14/395—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from fungi from yeasts from Saccharomyces
Definitions
- the current invention relates to the field of secondary metabolite production in plants and plant cell cultures. More specifically, the invention relates to the use of ABC-to enhance the production and/or secretion of secondary metabolites in plants and plant cell cultures.
- Secondary metabolites play for example a role in the resistance against pests and diseases, attraction of pollinators and interaction with symbiotic microorganisms. Besides the importance for the plant itself, secondary metabolites are of great interest because they determine the quality of food (colour, taste, aroma) and ornamental plants (flower colour, smell).
- a number of secondary metabolites isolated from plants are commercially available as fine chemicals, for example, drugs, dyes, flavours, fragrances and even pesticides.
- various health improving effects and disease preventing activities of secondary metabolites have been discovered, such as anti-oxidative and anti-metastatic-lowering properties (e.g.
- the invention aims primarily at using genes encoding ABC-transporters to enhance the production of secondary metabolites in plant cell cultures.
- ABC-transporters are well known in the field of cancer therapy as molecular 'pumps' in tumour-cell membranes that actively expel chemotherapy drugs from the interior of the cells. This allows tumour cells to avoid the toxic effects of the drug or molecular processes within the nucleus or the cytoplasm.
- the two pumps commonly found to confer chemoresistance in cancer are P-glycoprotein and the so-called multidrug resistance-associated protein (MRP).
- ABC-transporters have been used in plants as a selection marker ( WO 99/10514 ) and for the protection of plants for the detrimental effects of certain exogenously added xenobiotics ( WO 00/18886 , Muhitch J.M. et al. (2000) Plant Science, 157, 201 ).
- WO 00/18886 Muhitch J.M. et al. (2000) Plant Science, 157, 201 .
- US patent 6,166,290 it is shown that the use of ABC-transporters in plants can be used to stimulate remediation, to strengthen the disease response and to modulate plant pigmentation.
- ABC-transporters can be used to enhance the level of secondary metabolites made in plant cell cultures neither has it been shown that ABC-transporters can be used to stimulate the secretion of endogenously synthesized secondary metabolites from the inside of plant cells to the extracellular space.
- Cocaine which has strong stimulant effects on the central nervous system and is used as a topical anaesthetic, is also a tropane alkaloid but is found outside Solanaceae in Erythroxylum coca . Although a lot of information is available on the pharmacological effects of tropane alkaloids, surprisingly little is known about how the plants synthesize these substances and almost nothing is known about how this synthesis is regulated.
- the present invention accordingly provides in one embodiment a method for inducing or enhancing the production or the secretion of at least one secondary metabolite in biological cells by transformation of said biological cells with an expression vector comprising an expression cassette that further comprises a gene coding for a transporter.
- at least one secondary metabolite it is meant related structures of secondary metabolites and intermediates or precursors thereof.
- Said biological cells can be plant cells, fungal cells, bacteria cells, algae cells and/or animal cells.
- a "transporter” is a protein capable of interacting with at least one specific secondary metabolite and transporting said metabolite across a membrane wherein said membrane comprises the vacuolar membrane (tonoplast), or chloroplast membrane or plasmamembrane.
- Said transporter gene can be heterologous or homologous to the biological cell.
- “Expression cassettes”, of the present invention are generally DNA constructs preferably including (5' to 3' in the direction of transcription): a promoter region, a gene encoding for a transporter operatively linked with the transcription initiation region, and a termination sequence including a stop signal for RNA polymerase and a polyadenylation signal. It is understood that all of these regions should be capable of operating in the biological cells to be transformed.
- the promoter region comprising the transcription initiation region, which preferably includes the RNA polymerase binding site, and the polyadenylation signal may be native to the biological cell to be transformed or may be derived from an alternative source, where the region is functional in the biological cell.
- the transporters of this invention may be expressed in for example a plant cell under the control of a promoter that directs constitutive expression or regulated expression.
- Regulated expression comprises temporally or spatially regulated expression and any other form of inducible or repressible expression.
- Temporally means that the expression is induced at a certain time point, for instance, when a certain growth rate of the plant cell culture is obtained (e.g. the promoter is induced only in the stationary phase or at a certain stage of development).
- Spatially means that the promoter is only active in specific organs, tissues, or cells (e.g. only in roots, leaves, epidermis, guard cells or the like.
- Other examples of regulated expression comprise promoters whose activity is induced or repressed by adding chemical or physical stimuli to the plant cell.
- the expression of the transporters is under control of environmental, hormonal, chemical, and/or developmental signals, also can be used for expression of transporters in plant cells, including promoters regulated by (1) heat, (2) light, (3) hormones, such as abscisic acid and methyl jasmonate (4) wounding or (5) chemicals such as salicylic acid, chitosans or metals.
- promoters regulated by (1) heat, (2) light, (3) hormones, such as abscisic acid and methyl jasmonate (4) wounding or (5) chemicals such as salicylic acid, chitosans or metals.
- the expression of secondary metabolites can be boosted by the addition of for example specific chemicals, jasmonate and elicitors.
- the co-expression of transporters, in combination with a stimulation of secondary metabolite synthesis is beneficial for an optimal and enhanced production of secondary metabolites.
- the transporters can be placed under the control of a constitutive promoter.
- a constitutive promoter directs expression in a wide range of cells under a wide range of conditions.
- constitutive plant promoters useful for expressing heterologous polypeptides in plant cells include, but are not limited to, the cauliflower mosaic virus (CaMV) 35S promoter, which confers constitutive, high-level expression in most plant tissues including monocots; the nopaline synthase promoter and the octopine synthase promoter.
- CaMV cauliflower mosaic virus
- the expression cassette is usually provided in a DNA or RNA construct which is typically called an "expression vector" which is any genetic element, e.g., a plasmid, a chromosome, a virus, behaving either as an autonomous unit of polynucleotide replication within a cell (i.e. capable of replication under its own control) or being rendered capable of replication by insertion into a host cell chromosome, having attached to it another polynucleotide segment, so as to bring about the replication and/or expression of the attached segment.
- Suitable vectors include, but are not limited to, plasmids, bacteriophages, cosmids, plant viruses and artificial chromosomes.
- the expression cassette may be provided in a DNA construct which also has at least one replication system.
- there will frequently be at least one marker present which may be useful in one or more hosts, or different markers for individual hosts.
- the markers may a) code for protection against a biocide, such as antibiotics, toxins, heavy metals, certain sugars or the like; b) provide complementation, by imparting prototrophy to an auxotrophic host: or c) provide a visible phenotype through the production of a novel compound in the plant.
- NPTII neomycin phosphotransferase
- HPT hygromycin phosphotransferase
- CAT chloramphenicol acetyltransferase
- NPTII neomycin phosphotransferase
- HPT hygromycin phosphotransferase
- CAT chloramphenicol acetyltransferase
- NPTII kanamycin resistance or G418 resistance
- HPT providing hygromycin resistance
- mutated aroA gene providing glyphosate resistance.
- promoter activity refers to the extent of transcription of a gene that is operably linked to the promoter whose promoter activity is being measured.
- the promoter activity may be measured directly by measuring the amount of RNA transcript produced, for example by Northern blot or indirectly by measuring the product coded for by the RNA transcript, such as when a reporter gene is linked to the promoter.
- operably linked refers to linkage of a DNA segment to another DNA segment in such a way as to allow the segments to function in their intended manners.
- a DNA sequence encoding a gene product is operably linked to a regulatory sequence when it is ligated to the regulatory sequence, such as, for example a promoter, in a manner which allows modulation of transcription of the DNA sequence, directly or indirectly.
- a DNA sequence is operably linked to a promoter when it is ligated to the promoter downstream with respect to the transcription initiation site of the promoter and allows transcription elongation to proceed through the DNA sequence.
- a DNA for a signal sequence is operably linked to DNA coding for a polypeptide if it is expressed as a pre-protein that participates in the transport of the polypeptide. Linkage of DNA sequences to regulatory sequences is typically accomplished by ligation at suitable restriction sites or adapters or linkers inserted in lieu thereof using restriction endonucleases known to one of skill in the art.
- heterologous DNA or “heterologous RNA” refers to DNA or RNA that does not occur naturally as part of the genome or DNA or RNA sequence in which it is present, or that is found in a cell or location in the genome or DNA or RNA sequence that differs from that which is found in nature.
- Heterologous DNA and RNA are not endogenous to the cell into which it is introduced, but has been obtained from another cell or synthetically or recombinantly produced.
- An example is a human gene, encoding a human protein, operably linked to a non-human promoter.
- Another example is a gene isolated from one plant species operably linked to a promoter isolated from another plant species.
- heterologous DNA or RNA may also refer to as foreign DNA or RNA. Any DNA or RNA that one of skill in the art would recognize as heterologous or foreign to the cell in which it is expressed is herein encompassed by the term heterologous DNA or heterologous RNA.
- heterologous DNA examples include, but are not limited to, DNA that encodes proteins, polypeptides, receptors, reporter genes, transcriptional and translational regulatory sequences, selectable or traceable marker proteins, such as a protein that confers drug resistance, RNA including mRNA and antisense RNA and ribozymes.
- a primary metabolite is any intermediate in, or product of the primary metabolism in cells.
- the primary metabolism in cells is the sum of metabolic activities that are common to most, if not all, living cells and are necessary for basal growth and maintenance of the cells.
- Primary metabolism thus includes pathways for generally modifying and synthesising certain carbohydrates, proteins, fats and nucleic acids, with the compounds involved in the pathways being designated primary metabolites.
- secondary metabolites usually do not appear to participate directly in growth and development. They are a group of chemically very diverse products that often have a restricted taxonomic distribution.
- Secondary metabolites normally exist as members of closely related chemical families, usually of a molecular weight of less than 1500 Dalton, although some bacterial toxins are considerably longer.
- Secondary plant metabolites include e.g. alkaloid compounds (e.g. terpenoid indole alkaloids, tropane alkaloids, steroid alkaloids, polyhydroxy alkaloids), phenolic compounds (e.g. quinines, lignans and flavonoids), terpenoid compounds (e.g. monoterpenoids, iridoids, sesquiterpenoids, diterpenoids and triterpenoids).
- secondary metabolites include small molecules (i.e.
- Plant pharmaceuticals include e.g. taxol, digoxin, colchicines, codeine, morphine, quinine, shikonin, ajmalicine and vinblastine.
- Alkaloids of which more than 12.000 structures have been described already, includes all nitrogen-containing natural products which are not otherwise classified as peptides, non-protein amino acids, amines, cyanogenic glycosides, glucosinolates, cofactors, phytohormones or primary metabolites (such as purine and pyrimidine bases).
- the "calystegins” constitute a unique subgroup of the tropane alkaloid class ( Goldmann et al. (1990) Phytochemistry, 29, 2125 ). They are characterized by the absence of an N-methyl substituent and a high degree of hydroxylation. Trihydroxylated calystegins are summarized as the calystegin A-group, tetrahydroxylated calystegins as the B-group, and pentahydroxylated derivates form the C-group.Calystegins represent a novel structural class of polyhydroxy alkaloids possessing potent glycosidase inhibitory properties next to longer known classes of the monocyclic pyrrolidones (e.g.
- Glycosidase inhibitors are potentially useful as antidiabetic, antiviral, antimetastatic, and immunomodulatory agents.
- the invention provides a method for enhancing the production of at least one secondary metabolite in biological cells by transformation of said biological cells with an expression vector comprising an expression cassette further comprising a gene coding for an ABC transporter.
- Genes useful to be incorporated in an expression cassette for carrying out the present invention include those coding for ATP-binding cassette (ABC) transporters.
- ABC-transporters can be of any species or origin, including microorganisms, plant and animal (Higgins (1992) Ann. Rev. Cell Biol. 8, 67), but are preferably of plant or fungal origin.
- the ATP-binding cassette (ABC) transporters also called the "traffic ATPases", comprise a superfamily of membrane proteins that mediate transport and channel functions in prokaryotes and eukaryotes ( Higgins, C. F. (1992) Annu. Rev. Cell Biol. 8:67-113 ; Theodoulou F. (2000) Biochimica et Biophysica Acta 1465, 79 ).
- an ABC transporter contains two copies each of two structural units: a highly hydrophobic transmembrane domain (TMD), and a peripherally located ATP binding domain or nucleotide binding fold (NBF), which together are often necessary and sufficient to mediate transport.
- the TMD domains form the pathway via which the substrate crosses the membrane, and in some cases, have been shown to contribute to the substrate specificity.
- the NBFs are oriented towards the cytoplasmic side of the membrane and couple ATP hydrolysis to transport. Within the NBF is a conserved region of approximately 200 amino acids, consisting of the Walker A and B boxes separated by the ABC signature motif. It is this signature motif which distinguishes ABC transporters from other NTP binding proteins, such as the kinases, which also contain the Walker sequences.
- Eukaryotic ABC proteins include: P-glycoproteins, also known as multidrug resistance (MDR) proteins, which are associated with resistance to a wide range of hydrophobic drugs (MDR1; Gottesman, M. M.
- cMOAT/cMRP1 which is associated with transport of glutathione, glucuronide, and sulfate conjugates across the canalicular membrane
- STE6 which exports the a-factor mating pheromone of S. cerevisiae ( Michaelis, S. (1993) Semin. Cell Biol. 4:17-27 ) and PDR5, the pleiotropic drug resistance protein of yeast.
- Prokaryotic ABC proteins include periplasmic nutrient permeases, such as those responsible for uptake of maltose (MalFGK) and histidine (HisMPQ) in gram-negative bacteria, and toxin exporters such as those required for export of hemolysin (HlyB) and colicin (COlV) from E. coli. Sequence comparisons between MRP1 and other ABC transporters reveal two major subgroups among these proteins ( Szczypka et ak. (1994) J. Biol. Chem. 269, 22853 ).
- MRP1 the Saccharomyces cerevisiae cadmium factor (YCF1) gene, the Leishmania P-glycoprotein-related molecule (Lei/PgpA) and the CFTRs.
- the other subgroup comprises the multiple drug resistance proteins (MDRs), MHC transporters and STE6. Homologues of ABC-transporters have been identified in plant species.
- MRP glutathione-conjugate transporter
- An MDR-like gene (atpgp1) has also been identified in A.
- Genes encoding ABC-transporters used in the present invention may be operably linked with a promoter for expression in a plant species may be derived from a chromosomal gene, cDNA, a synthetic gene, or combinations thereof.
- DNA sequences encoding ABC-transporters are used to enhance the production of at least one secondary metabolite in plant cells comprising the transformation of said plant cells with an expression vector comprising an expression cassette further comprising a gene coding for an ABC-transporter.
- enhanced production it is meant that the level of one or more metabolites may be enhanced by at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or at least 100% relative to the untransformed plant cell which was used to transform with an expression vector comprising an expression cassette further comprising a gene coding for a transporter or an ABC-transporter.
- An enhanced production of a secondary metabolite can result in a detection of a higher level of secondary metabolites in the extracellular medium of the plant cell culture.
- a higher level of secondary metabolites can be detected inside the plant cells, for example in the vacuole.
- the present invention can be practiced with any plant variety for which cells of the plant can be transformed with an expression cassette of the current invention and for which transformed cells can be cultured in vitro.
- Suspension culture, callus culture, hairy root culture, shoot culture or other conventional plant cell culture methods may be used (as described in: Drugs of Natural Origin, G. Samuelsson, 1999, ISBN 9186274813 ).
- plant cells it is understood any cell which is derived from a plant and can be subsequently propagated as callus, plant cells in suspension, organized tissue and organs (e.g. hairy roots).
- Tissue cultures derived from the plant tissue of interest can be established.
- Methods for establishing and maintaining plant tissue cultures are well known in the art (see, e.g. Trigiano R.N. and Gray D.J. (1999), "Plant Tissue Culture Concepts and Laboratory Exercises", ISBN: 0-8493-2029-1 ; Herman E.B. (2000), “Regeneration and Micropropagation: Techniques, -Systems and Media 1997-1999", Agricell Report ).
- the plant material is surface-sterilized prior to introducing it to the culture medium. Any conventional sterilization technique, such as chlorinated bleach treatment can be used.
- antimicrobial agents may be included in the growth medium. Under appropriate conditions plant tissue cells form callus tissue, which may be grown either as solid tissue on solidified medium or as a cell suspension in a liquid medium.
- Suitable culture media for callus induction and subsequent growth on aqueous or solidified media are known.
- Exemplary media include standard growth media, many of which are commercially available (e.g., Sigma Chemical Co., St. Louis, Mo.). Examples include Schenk-Hildebrandt (SH) medium, Linsmaier-Skoog (LS) medium, Murashige and Skoog (MS) medium, Gamborg's B5 medium, Nitsch & Nitsch medium, White's medium, and other variations and supplements well known to those of skill in the art (see, e.g., Plant Cell Culture, Dixon, ed. IRL Press, Ltd.
- suitable media include 1/2 MS, 1/2 L.P., DCR, Woody Plant Medium (WPM), Gamborg's B5 and its modifications, DV ( Durzan and Ventimiglia, In Vitro Cell Dev. Biol. 30:219-227 (1994 )), SH, and White's medium.
- a DNA sequence encoding an ABC-transporter can be used to induce or enhance the secretion of at least one secondary metabolite produced in plant cell cultures comprising transforming said plant cells that are producing secondary metabolites, with an expression vector comprising an expression cassette further comprising a gene coding for an ABC-transporter, and selecting transformed plant cells with an induced or enhanced secretion of at least one secondary metabolite.
- Such transformed plant cells can be subsequently propagated using methods described herein before.
- an “enhanced secretion of at least one secondary metabolite” means that there exists already a detectable secretion of the secondary metabolite(s) in the extracellular medium of the plant cell culture and that an increase of the secondary metabolite(s) can be measured by at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more than 90% compared to basal secretion by the untransformed plant cell culture.
- An enhanced secretion' does not necessarily mean that there is a higher production, it can also mean that there is exists the same level of production but that the secretion is enhanced.
- An "induced secretion of at least one secondary metabolite” means that there is no detectable secretion of the secondary metabolite(s) in the extracellular medium of the untransformed plant cell culture but that the detection becomes possible upon carrying out the transformation according to the invention.
- Generally secondary metabolites can be measured, intracellularly or in the extracellular space, by methods known in the art. Such methods comprise analysis by thin-layer chromatography, high pressure liquid chromatography, capillary chromatography, (gas chromatographic) mass spectrometric detection, radioimmunoassay (RIA) and enzyme immuno-assay (ELISA).
- methods known in the art comprise analysis by thin-layer chromatography, high pressure liquid chromatography, capillary chromatography, (gas chromatographic) mass spectrometric detection, radioimmunoassay (RIA) and enzyme immuno-assay (ELISA).
- secretion in the current invention one has to make a clear distinction between the secretion of proteins which is mediated by an amino-terminal signal peptide and the secretion of secondary metabolites which is independent of an amino-terminal leader sequence.
- secretion means secretion of a secondary metabolite across the plasma membrane or secretion across both the plasma membrane and the cell wall of a plant cell. It should be noted that, in the scientific literature the term "secretion” often is used to indicate secretion into the apoplastic space, i.e., secretion across the plasma membrane but not across the cell wall.
- the secretion can be induced by several possibilities: (1) by the transformation of the plant cell with a heterologous gene encoding an ABC-transporter or (2) by the overexpression of a homologous ABC-transporter which expressing is rate-limiting in the plant cell or (3) by the relocalisation of a homologous or heterologous ABC-transporter from a vacuolar localisation towards a membrane localisation.
- proteins destined for the vacuole are sorted away from proteins destined for secretion at the trans-Golgi netmaschine, a process that requires the presence of positive sorting signals on the vacuolar proteins.
- a homologous or heterologous ABC-transporter that is normally localized in the vacuolar membrane can be engineered by clipping off its vacuolar localisation signal (carboxy-terminal or amino-terminal propeptide) or by deleting its internal vacuolar targeting determinant.
- a heterologous or homologous amino-terminal leader sequence is spliced to the gene encoding the homologous or heterologous ABC-transporter in order to provide entry into the secretion system.
- said engineered ABC-transporter is not directed anymore in the secretion pathway towards its normal vacuolar localisation but is deviated towards the extracellular space.
- the ABC-transporter is not secreted into the extracellular medium but remains sequestered into the plasmamembrane of the plant cell.
- the novel intracellular localisation of the ABC-transporter results in a secretion of the produced secondary metabolites into the medium of the plant cell culture.
- an intermediary product of the secondary metabolite which causes negative feedback inhibition on an enzymatic reaction step involved in the biosynthesis of said secondary metabolite, can be secreted by (1) by the transformation of the plant cell with a heterologous gene encoding an ABC-transporter or (2) by the overexpression of a homologous ABC-transporter which expressing is rate-limiting in the plant cell or (3) by the relocalisation of a homologous or heterologous ABC-transporter from a vacuolar localisation towards a membrane localisation.
- the secretion of said intermediary product or an amount produced thereof reduces the negative feedback inhibition and consequently enhances the production of the secondary metabolite in the plant cell.
- the enhanced production of said secondary metabolite can be made secreted by the plant cell by the transformation of the already transformed plant cell, with a second expression cassette comprising a gene encoding an ABC transporter, according to the method described above.
- the directed secondary metabolites can be easily isolated from the surrounding medium since they are directed into the extracellular space. Consequently, the breaking up of the cells that is necessary in the case of intracellular production can be omitted.
- the production of secondary metabolites can be enhanced by stimulating the transport of secondary metabolites into the vacuole.
- the targeting of proteins and compounds into the vacuole is of particular interest (especially from the point of view of application) because the vacuole is the largest storage compartment in the cell for reserve substances, detoxification products and defence substances.
- the most important storage takes place in vacuoles in plant organs such as tubers, bulbs, roots and stems. Similar considerations also apply to substances that can be used in the control of pests or diseases, especially when those substances prove to be toxic to the plant itself. Indeed, in certain cases the vacuole also serves as a detoxification organel by, for example, storing the detoxification products synthesised by the plant.
- secondary metabolites can also be made secreted into the vacuole (1) by the transformation of a plant cell with a heterologous gene encoding an ABC-transporter or (2) by the overexpression of a homologous ABC-transporter which expressing is rate-limiting in the plant cell or (3) by the relocalisation of a homologous or heterologous ABC-transporter from a normally localised plasmamembrane localisation towards a vacuolar localisation.
- To perform said relocalisation it is necessary to modify the gene encoding an ABC-transporter by genetically fusing it to an amino-terminal or carboxy-terminal vacuolar localisation signal or by the genetic modification through the introduction of an existing internal vacuolar localisation signal.
- US patent 6,054,637 provides detailed information of genetic modification of genes through the addition or clipping off plant vacuolar localisation signals. We observe that the secretion or targeting of the produced secondary metabolites into the vacuole reduces the toxicity to the plant cell.
- an intermediary product of the secondary metabolite which causes negative feedback inhibition on an enzymatic reaction step involved in the biosynthesis of said secondary metabolite, can be made sequestered into the vacuole by (1) the transformation of the plant cell with a heterologous gene encoding an ABC-transporter or by (2) the overexpression of a homologous ABC-transporter which expressing is rate-limiting in the plant cell or (3) by the relocalisation of a homologous or heterologous ABC-transporter from a normal membrane localisation towards a vacuolar localisation.
- the import of said intermediary product, or an amount produced thereof, into the vacuole reduces the negative feedback inhibition of the enzymatic reaction which occurs outside the vacuole and consequently enhances the production of the secondary metabolite in the plant cell.
- the current invention can be combined with other known methods to enhance the production and/or the secretion of secondary metabolites in plant cell cultures such as (1) by improvement of the plant cell culture conditions, (2) by the transformation of the plant cells with a transcription factor capable of upregulating genes involved in the pathway of secondary metabolite formation, (3) by the addition of specific elicitors to the plant cell culture, and 4) by the induction of organogenesis.
- DNA sequences encoding ABC-transporters are used to enhance the production of at least one secondary metabolite in plants comprising the transformation of said plants with an expression vector comprising an expression cassette further comprising a gene coding for an ABC-transporter.
- the level of one or more metabolites may be enhanced by at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or at least 100% relative to the untransformed plant which was used to transform with an expression vector comprising an expression cassette further comprising a gene coding for a transporter or an ABC-transporter.
- An enhanced production of a secondary metabolite can result in a detection of a higher level of secondary metabolites in the plant, for example in the vacuole.
- the enhanced production of at least one secondary metabolite leads to an enhanced secretion.
- the same production of at least one secondary metabolite occurs in the transformed plant but an enhanced secretion of at least one secondary metabolite occurs by said transformed plant.
- Secondary metabolites can for example be efficiently produced by continuous secretion from the roots of hydroponically grown plants. This process of secretion is also been termed 'rhizosecretion'.
- the term "plant” as used herein refers to vascular plants (e.g. gymnosperms and angiosperms).
- the method comprises transforming a plant cell with an expression cassette of the present invention and regenerating such plant cell into a transgenic plant. Such plants can be propagated vegetatively or reproductively.
- the transforming step may be carried out by any suitable means, including by Agrobacterium -mediated transformation and non-Agrobacterium-mediated transformation, as discussed in detail below. Plants can be regenerated from the transformed cell (or cells) by techniques known to those skilled in the art. Where chimeric plants are produced by the process, plants in which all cells are transformed may be regenerated from chimeric plants having transformed germ cells, as is known in the art.
- Methods that can be used to transform plant cells or tissue with expression vectors of the present invention include both Agrobacterium and non-Agrobacterium vectors.
- Agrobacterium-mediated gene transfer exploits the natural ability of Agrobacterium tumefaciens to transfer DNA into plant chromosomes and is described in detail in Gheysen, G., Angenon, G. and Van Montagu, M. 1998.
- Agrobacterium-mediated plant transformation a scientifically interesting story with significant applications. In K. Lindsey (Ed.), Transgenic Plant Research. Harwood Academic Publishers, Amsterdam, pp. 1-33 and in Stafford, H.A. (2000) Botanical Review 66: 99-118 .
- a second group of transformation methods is the non-Agrobacterium mediated transformation and these methods are known as direct gene transfer methods.
- An overview is brought by Barcelo, P. and Lazzeri, P.A. (1998) Direct gene transfer: chemical, electrical and physical methods.
- Hairy root cultures can be obtained by transformation with virulent strains of Agrobacterium rhizogenes, and they can produce high contents of secondary metabolites characteristic to the mother plant. Protocols used for establishing of hairy root cultures vary, as well as the susceptibility of plant species to infection by Agrobacterium ( Toivunen L. (1993) Biotechnol. Prog.
- tissue or plant cells capable of subsequent clonal propagation may be transformed with an expression vector of the present invention.
- organogenesis' means a process by which shoots and roots are developed sequentially from meristematic centers; the term embryogenesis' means a process by which shoots and roots develop together in a concerted fashion (not sequentially), whether from somatic cells or gametes.
- the particular tissue chosen will vary depending on the clonal propagation systems available for, and best suited to, the particular species being transformed. Exemplary tissue targets include protoplasts, leaf disks, pollen, embryos, cotyledons, hypocotyls, megagametophytes, callus tissue, existing meristematic tissue (e.g. apical meristems, axillary buds, and root meristems), and induced meristem tissue (e.g., cotyledon meristem and hypocotyls meristem).
- plants may include, but not limited to, plants or plant cells of agronomically important crops, such as tomato, diverse herbs such as oregano, basilicum and mint. It may also be applied to plants that produce valuable compounds, e.g. useful as for instance pharmaceuticals, as ajmalicine, vinblastine, vincristine, ajmaline, rserpine, rescinnamine, camptothecine, ellipticine, quinine, and quinidien, taxol, morphine, scopolamine, atropine, cocaine, sanguinarine, codeine, genistein, daidzein, digoxin, colchicines, calystegins or as food additives such as anthocyanins, vanillin; including but not limited to the classes of compounds mentioned above.
- agronomically important crops such as tomato, diverse herbs such as oregano, basilicum and mint. It may also be applied to plants that produce valuable compounds, e.g. useful as for instance pharmaceutical
- Such plants include, but not limited to, Papaver spp., Rauvolfia spp., Taxus spp., Cinchona spp., Eschscholtzia califomica, Camptotheca acuminata, Hyoscyamus spp., Berberis spp., Coptis spp., Datura spp., Atropa spp., Thalictrum spp., Peganum spp.
- the present invention also describes an isolated polypeptide selected from the groups consisting of (a) an isolated polypeptide encoded by a polynucleotide comprising the sequence of SEQ ID NO: 1; (b) an isolated polypeptide comprising a polypeptide sequence having a least 83 % identity to the polypeptide sequence of SEQ ID NO: 2; (c) fragments and variants of such polypeptides in (a) to (b) that induce or enhance the production or the secretion of at least one secondary metabolite in plants or plant cells.
- the invention also describes an isolated polynucleotide selected from the groups consisting of (a) an isolated polynucleotide comprising a polynucleotide sequence of SEQ ID NO: 1; (b) an isolated polynucleotide comprising a polynucleotide sequence having at least 91% identity to SEQ ID NO: 1; (c) fragments and variants of such polynucleotides in (a) to (b) that induce or enhance the production or the secretion of at least one secondary metabolite in plants or plant cells.
- polynucleotide may be interpreted to mean the DNA and cDNA sequence as detailed by Yoshikai et al. (1990) Gene 87:257 , with or without a promoter DNA sequence as described by Salbaum et al. (1988) EMBO J. 7(9):2807 .
- fragment refers to a polypeptide or polynucleotide of at least about 9 amino acids or 27 base pairs, typically 50 to 75, or more amino acids or base pairs, wherein the polypeptide contains an amino acid core sequence. If desired, the fragment may be fused at either terminus to additional amino acids or base pairs, which may number from 1 to 20, typically 50 to 100, but up to 250 to 500 or more.
- a "functional fragment” means a polypeptide fragment possessing the biological property of that induce or enhance the production or the secretion of at least one secondary metabolite in plants or plant cells.
- nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e. 70% identity over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using sequence comparison algorithms or by manual alignment and visual inspection.
- identity exists over a region that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is 50-100 amino acids or nucleotides or even more in length.
- EXAMPLE 1 Identification of yeast multidrug resistance transporters specific for tropane (Tas) and nicotine-type alkaloids (NAs)
- a complex pleiotropic drug resistance (PDR) network of genes involved in multidrug resistance is composed of the transcriptional regulators Pdr1p and Pdr3p, which activate expression of the ATP-binding cassette (ABC) transporter-encoding genes PDR5, SNQ2, YOR1, as well as other not yet identified genes.
- Pdr1p and Pdr3p which activate expression of the ATP-binding cassette (ABC) transporter-encoding genes PDR5, SNQ2, YOR1, as well as other not yet identified genes.
- isogenic yeast strains deleted of the ABC transporters YOR1, SNQ2, PDR5, PDR10, PDR11 or YCF1 for tolerance to the toxic compounds hyoscyamine, scopolamine and nicotine.
- the isogenic yeast strains derived from the US50-18C genotype were constructed and described in Decottignies et al. (J. Biol. Chem. (1998) 273, 12612 ).
- the yeast strains derived from the BY4741 genotype are obtained from the EUROSCARF collection (Frankfurt, Germany). All strains are listed in Table 1.
- Alkaloid tolerance was assessed by controlling growth performance on rich medium (YPD) that contained different concentrations of TAs or NAs. To this end the different strains were grown to saturation (48h) in liquid YPD. Cultures were diluted 10-, 100-and 1000-fold, and volumes of about 3 ⁇ l were dropped with a stainless steel replicator on YPD plates containing 2% Bacto Agar with the toxic compounds. Rich medium contains 1% yeast extract, 2% Bacto Peptone and 2% glucose. Filter-sterilized water solutions of hyoscyamine, scopolamine and nicotine were added after autoclaving. Growth was evaluated after two days incubation at 28°C. We observed that wild type yeast (i.e.
- taxol and flavonoids were also shown to be substrates for Pdr5p mediated multidrug transport ( Kolaczkowski et al. (1996) J. Biol. Chem. 271, 31543 and Kolaczkowski et al. (1998) Microb. Drug Resist. 4, 143 ).
- EXAMPLE 2 Assessment of toxicity of TAs and NAs to tobacco BY-2 suspension cultured cells
- Suspension cultured tobacco cells Nicotiana tabacum L. cv Bright Yellow 2 were grown in the dark at 26°C on a rotary shaker (130 rpm) in MSST, a modified Murashige-Skoog basal medium supplemented with 1.5 mM KH 2 PO 4 , 3 ⁇ M thiamine, 0.55 mM inositol, 87 mM sucrose and 1 ⁇ M 2,4D. Cells are subcultured every 7 days by transferring 0.5 ml into 50 ml of fresh medium in 250-ml flasks. Toxicity of TAs and NAs to tobacco BY-2 cells was assessed in two ways.
- toxicity was evaluated by measuring cell death after incubation in the presence of increasing levels of alkaloids.
- Cell death was scored by the Evans blue method ( Turner and Novacky (1974) Phytopathol. 64, 885 ).
- a fresh BY-2 cell culture was started and after 3 days 5 ml of this culture was transferred to one well of a 6-well plate (Falcon 353046).
- 1 ml of fresh MSST was added and the desired toxic compound in a volume of 650 ⁇ l in 0.1 M potassium phosphate buffer at pH 5.8. Cells were then further incubated on the rotary shaker and 1-ml samples were taken after 0, 6 and 24 hours.
- the PDR5 gene was cloned by the PCR method with the Pful polymerase.
- oligonucleotides were designed with 5'-terminal att B sequences that amplify the entire open reading frame of the PDR5 gene (4536 nt) as a PCR product that is an efficient substrate for recombination with the Gateway TM system (InVitroGen).
- Gateway (Invitrogen) technology provides an alternative rapid method for cloning a sequence into a multiple expression system.
- the advantage of the Gateway cloning is that fragments present as Entry clones can be subcloned into different Destination vectors in a short time. This technology was used to construct a set of versatile vectors for Agrobacterium -based plant transformation.
- the Gateway-compatible binary vector pPZP200 is the backbone of our constructs ( Hajdukiewicz et al. Plant Molecular Biology 25, 989-994, 1994 ).
- This binary vector is relatively small in size, contains two origins of replication in E. coli or in Agrobacterum and posses streptomycin and/or spectinomycin for plasmid selection.
- Three plant selectable marker genes; kanamycin, hygromycin and bar (most frequently used markers in plant transformation) have been used for all constructs. All selectable markers are in a cassette containing nos (nopaline synthase) promoter and nos terminator. These genes were cloned toward the left border of the T-DNA. For construction of all Gateway clones we have used the rfA conversion cassette.
- the oligonucleotides used for PDR5 gene cloning are 5'-AAAAGCAGGCTACCATGCCCGAGGCCAAGCTTAACAATA-3' as the forward primer and 5'- AGAAAGCTGGGTCCATCTTGGTAAGTTTCTTTTCTTAACC-3' as the reverse primer, respectively.
- the T-DNA of the pK7WGD2 binary vector also bears the kanamycin resistance gene (NPTII) under the control of the pnos promoter as selectable marker for plant transformation and the gene encoding the green fluorescent protein (GFP) under the control of the proID promoter for visual selection of transgenic plant cell lines.
- NPTII kanamycin resistance gene
- GFP green fluorescent protein
- the resulting binary plasmids were designated pK7WGD2-ScPDR5-US50 or pK7WGD2-ScPDR5-W303 depending on the yeast genotype from which the gene is isolated.
- the GUS gene was introduced in the pK7WGD2 vector and the resulting binary vector pK7WGD2-GUS served as a control for the experiments described in the examples below.
- Plant cell transformations were carried out by applying the ternary vector system ( van der Fits et al. (2000) Plant Mol. Biol. 43, 495 ).
- the plasmid pBBR1 MCS-5.virGN54D is used as a ternary vector.
- the binary plasmid was introduced into Agrobacterium tumefaciens strain LBA4404 already bearing the ternary plasmid by electro-transformation.
- Agrobacterium tumefaciens strains were grown for three days at 28°C on solid LC medium containing 20 ⁇ g/ml rifampicin, 40 ⁇ g/ml geneticin, 100 ⁇ g/ml spectinomycin and 300 ⁇ g/ml streptomycin.
- LC medium contains 1 % Bacto Trypton, 0.5% Bacto yeast extract and 0.8% NaCl. From these bacteria a 5-ml liquid culture was grown in LC medium for 48 hours. N. tabacum BY-2 cells were grown in MSST medium as described in example 2. For transformation 3 days old cell cultures were used. For cocultivation 4 ml of BY-2 cells was transferred to the corner of a petridish ( ⁇ 80 mm) and 300 ⁇ l of the A. tumefaciens culture was added. Dishes were taped with respiratory tape and incubated for 3 days at 26°C in the dark.
- the cocultivation mixture was transferred into 20 ml of fresh MSST medium 50 ⁇ g/ml kanamycin-B, 500 ⁇ g/ml carbenicilin and 250 ⁇ g/ml vancomycin in 100-ml flasks and further incubated as described in example 2.
- this cell suspension culture was subcultured in 40 ml of fresh MSST medium with 10 ⁇ g/ml of the kanamycin analogue G-418 (geneticin), 500 ⁇ g/ml carbenicilin and 250 ⁇ g/ml vancomycin and grown further till it reached maximal density (similar to stationary, 1-week-old culture) which took two to three weeks, depending on the efficiency of the transformation event.
- BY-2 cell lines expressing the different yeast Pdr5 transporters displayed to varying extents an increased tolerance to both alkaloids as compared to the control GUS-expressing lines.
- Lines expressing the PDR5 transporter from yeast genotype W303 showed the highest alkaloid tolerance, in particular towards hyoscyamine.
- hyoscyamine was added to a final concentration of 30 mM.
- Transgene BY-2 cells expressing the Pdr5p from yeast strain W303 again showed the highest tolerance to this tropane alkaloid ( Fig. 2 ). Fold increase in cell death lowered with ca. 35% in the W303 lines whereas US50 lines had a 15% decrease in hyoscyamine induced cell death.
- BY-2 cell cultures (BY-2 transformed with pK7WGD2-ScPDR5-US50 or pK7WGD2-ScPDR5-W303 or pK7WGD2-GUS) were washed and diluted ten-fold with fresh hormone free MSST medium. After a recuperation period of 12 hours, the cultures were treated with methyl jasmonate (MeJA). MeJA was dissolved in dimethyl sulfoxide (DMSO) and added to the culture medium at a final concentration of 50 ⁇ M. As a control, cells treated with an equivalent amount of DMSO were included.
- DMSO dimethyl sulfoxide
- Alkaloids were extracted by vortexing with 2 ml of dichloromethane. After 30 min the samples were centrifuged (2000 rpm, 10 min) and the lower organic layer was separated and transferred into glass vials. After evaporation to dryness 25 ⁇ l of dichloromethane was added and the samples were silylated with N-methyl-N-(trimethylsilyl)trifluoroacetamide (Pierce, Rockford, USA) for 20 min at 120 °C prior to GC-MS analysis. For alkaloid determination in the medium, 20 ml of the filtered medium was made alkaline with ammonia (10% v/v) to reach pH 9. Internal standards were added (5- ⁇ -cholestane and cotinine).
- BY-2 suspension cultured cells are transformed as described in example 3.2 and 5 transgene calli of both ScNVacPDR5 or ScPDR5CVac transformed cells and highly expressing GFP are selected as described in example 3.3.
- Control of expression of recombinant PDR5 is performed as described in example 3.3 by northern and western blot analysis. Fractionation shows that in both types of transgene lines (NVac or CVac) the Pdr5 protein is targeted to the vacuolar membrane.
- the ABC protein super-family is the largest protein family known and most are membrane proteins active in the transport of a broad range of substances across the membranes. Also in Arabidopsis this superfamily is large and diverse (129 ORFs) and a complete inventory has been described by Sanchez-Fernandez et al. (J. Biol. Chem. (2001), 276, 30231 ).
- One of the subfamilies of full-length ABC transporters in Arabidopsis consists of the PDRs (13 ORFs) of which yeast PDR5 is the prototype. At least eight of the PDR5 -like ORFs in Arabidopsis are transcriptionally active and have been isolated as ESTs ( Sanchez-Fernandez et al. (2001), J. Biol.
- AtPDR1 gene Arabidopsis PDR5-orthologues
- AtPDR1 gene Arabidopsis PDR5-orthologues
- AtPDR1 gene Arabidopsis PDR5-orthologues
- a C DNA clone of the AtPDR1 gene is isolated as described for the yeast PDR5 gene in example 3.
- the following oligonucleotides were designed: 5'-AAAAAGCAGGCTACCATGGAGACGTTATCGAGAA-3' as the forward primer and 5'-AGAAAGCTGGGTCTATCGTTGTTGGAAGTTGAGC-3' as the reverse primer, respectively.
- cDNA prepared from Arabidopsis hypocotyls.
- tropane alkaloids such as hyoscyamine and scopolamine in plants of the Solanaceae
- the biosynthesis of tropane alkaloids such as hyoscyamine and scopolamine in plants of the Solanaceae is very tissue-specific and occurs only in the roots. Later on the alkaloids are transported to the aerial parts, especially the leaves, where they are finally accumulated. In hairy roots however this translocation cannot occur and part of the produced alkaloids are released in the medium. This release can be stimulated by the addition of millimolar amounts of CdCl 2 to the medium ( Furze et al. (1991) Plant Cell Rep. 10, 111 and Pitta-Alvarez et al. (2000) Enzyme. Microb. Technol. 26, 252 ).
- HmPDR1 A cDNA clone of a PDR-like gene is isolated from H. muticus and is designated HmPDR1.
- HmPDR1 A cDNA clone of a PDR-like gene is isolated from H. muticus and is designated HmPDR1.
- total RNA was prepared from hairy roots of the H. muticus KB7 line ( Jouhikainen et al. (1999) Planta 208, 545 ) treated for 30 hours with 1 mM CdCl 2 and was reverse transcribed with the Superscript RTII reverse transcriptase.
- a nested PCR was subsequently carried out with the Taq DNA polymerase using the DNA-RNA hybrid as the template and two sets of degenerate primers designed from highly conserved amino acid sequences in the nucleotide binding folds of known yeast and plant PDR proteins (see Table 3). This PCR yields two fragments derived from the two nucleotide-binding folds which are naturally present in the general tandem repeat structure of ABC proteins.
- 5'RACE and 3'RACE techniques we cloned a full-length C DNA clone, which is designated HmPDR1.
- the nucleotide sequence of the HmPDR1 C DNA clone is depicted in SEQ ID NO: 1, the amino acid sequence of the HmPDR1 protein is depicted in SEQ ID NO: 2.
- Table 3 Degenerate primers used for HmPDR1 cDNA cloning Primer Sequence ALGG39 5'-CCIRGYKCIGGIAARACNAC-3' ALGG40 5'-ACICKYTTYTTYTGNCCNCC-3' ALGG41 5'-TCNARNCC-3' ALGG42 5'-GGIGTIYTIACIGCNYTNATGGG-3' ALGG43 5'-TCNARCATCCAIGTIGCNGGRTT-3' ALGG44 5'-CKCCARTA-3' To confirm the postulated relationship between the expression of ABC transporter genes and the CdCl 2 induced release of alkaloids we performed an expression analysis of the HmPDR1 gene in CdCl 2 treated Hyoscyamus hairy roots ( Fig. 3 ). Quantitative
- the AtPDR1 gene was subcloned in a yeast expression vector (YCp50) between the 5' and 3' regulatory sequences of the yeast PDR5 gene. This plasmid was then introduced in the yeast AD3 strain (the pdr5 mutant, see example 1). To analyze the substrate specificity of this plant PDR gene we controlled growth performance of the transformed yeast strains on YPD plates containing the different TAs and NAs as described in example 1. We have shown that the PDR1 gene of A. thaliana was able to restore the growth of the pdr5 mutant strain on hyoscyamine and nicotine.
- the AtPDR1 gene was transferred to the binary vector pK7WGD2 as described in example 3.1.
- BY-2 suspension cultured cells were transformed as described in example 3.2.
- Control of expression of AtPDR1 is performed by northern blot analysis using a specific DNA probe.
- To assess tolerance to nicotine and hyoscyamine in transgenic cell lines the same assays as described in example 3.3 were performed in order to evaluate the functionality of AtPDR1p.
- Transgenic BY-2 cells showed enhanced tolerance to alkaloids as compared to the control GUS expressing line. However, not to the extent of the ScPDR5-W303 expressing line but comparable to the tolerance levels obtained in the ScPDR5-US50 line.
- nicotinic alkaloid accumulation 6-days old recombinant BY-2 cell cultures (pK7WGD2-AtPDR1 en pK7WGD2-GUS) are washed and diluted ten-fold with fresh hormone free MSST medium. After a recuperation period of 12 hours, the cells are treated with methyl jasmonate (MeJA). MeJA is dissolved in dimethyl sulfoxide (DMSO) and added to the culture medium at a final concentration of 50 ⁇ M. As a control, cells treated with an equivalent amount of DMSO are included. For alkaloid analysis the same process is followed as in example 3.4.
- DMSO dimethyl sulfoxide
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Mycology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Biophysics (AREA)
- Biomedical Technology (AREA)
- Microbiology (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Physics & Mathematics (AREA)
- Cell Biology (AREA)
- Plant Pathology (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
- The current invention relates to the field of secondary metabolite production in plants and plant cell cultures. More specifically, the invention relates to the use of ABC-to enhance the production and/or secretion of secondary metabolites in plants and plant cell cultures.
- Higher plants are able to produce a large number of small-molecular-weight compounds with very complex structures. These compounds, called secondary metabolites, play for example a role in the resistance against pests and diseases, attraction of pollinators and interaction with symbiotic microorganisms. Besides the importance for the plant itself, secondary metabolites are of great interest because they determine the quality of food (colour, taste, aroma) and ornamental plants (flower colour, smell). A number of secondary metabolites isolated from plants are commercially available as fine chemicals, for example, drugs, dyes, flavours, fragrances and even pesticides. In addition, various health improving effects and disease preventing activities of secondary metabolites have been discovered, such as anti-oxidative and anti-metastatic-lowering properties (e.g. vinblastine, taxol). Although about 100.000 plant secondary metabolites are already known, only a small percentage of all plants have been studied to some extent for the presence of secondary metabolites. It is expected that interest in such metabolites will continue to grow as e.g. plant sources of new and useful drugs are discovered. Some of these valuable phytochemicals are quite expensive because they are only produced at extremely low levels in plants. Very little is known about the biosynthesis of secondary metabolites in plants. However, some recently elucidated biosynthetic pathways of secondary metabolites are long and complicated requiring multiple enzymatic steps to produce the desired end product. Most often, the alternative of producing these secondary metabolites through chemical synthesis is complicated due to a large number of asymmetric carbons and in most cases chemical synthesis is not economically feasible.
- The recovery of valuable secondary metabolites is mostly achieved through extraction and purification (generally at low yields) of imported, sometimes exotic, plant biomasses, whose reproductive agriculture and secure long term supply are often very difficult, if not impossible to guarantee. The problems of obtaining useful metabolites from natural sources may potentially be circumvented by cell culture. The culture of plant cells has been explored since the 1960's as a viable alternative for the production of complex phytochemicals of industrial interest. Although plant cell cultures might be somewhat sensitive for shear forces, many cultures can be grown in large bioreactors without difficulty. For example, the use of large-scale plant cell cultures in bioreactors for the production of alkaloids has been extensively studied (Verpoorte et al. (1999) Biotechnol. Lett. 21, 467). Since it has been observed that undifferentiated cultures such as callus and cell suspension cultures produce only very low levels of secondary metabolites one tends to use differentiated plant cell cultures such as root- and hairy root-culture. For example, tropane alkaloids that are only scarcely synthesized in undifferentiated cells are produced at relatively high levels in cultured roots. Despite the promising features and developments, the production of plant-derived pharmaceuticals by plant cell cultures has not been fully commercially exploited. The main reasons for this reluctance shown by industry to produce secondary metabolites by means of cell cultures, compared to the conventional extraction of whole plant material, are economical ones based on the slow growth and the low production levels of secondary metabolites by such plant cell cultures. Important causes are the toxicity of such compounds to the plant cell, and the role of catabolism of the secondary metabolites. Another important problem is that secondary metabolites are mostly retained intracellularly complicating the downstream processing and purification. Indeed, often laborious extraction schemes have to be developed for each specific secondary metabolite of interest.
- It is an objective of the current invention to provide a solution to these problems. The invention aims primarily at using genes encoding ABC-transporters to enhance the production of secondary metabolites in plant cell cultures. ABC-transporters are well known in the field of cancer therapy as molecular 'pumps' in tumour-cell membranes that actively expel chemotherapy drugs from the interior of the cells. This allows tumour cells to avoid the toxic effects of the drug or molecular processes within the nucleus or the cytoplasm. The two pumps commonly found to confer chemoresistance in cancer are P-glycoprotein and the so-called multidrug resistance-associated protein (MRP). In addition, ABC-transporters have been used in plants as a selection marker (
) and for the protection of plants for the detrimental effects of certain exogenously added xenobiotics (WO 99/10514 , Muhitch J.M. et al. (2000) Plant Science, 157, 201). InWO 00/18886 US patent 6,166,290 it is shown that the use of ABC-transporters in plants can be used to stimulate remediation, to strengthen the disease response and to modulate plant pigmentation. It has however never been shown in the art that ABC-transporters can be used to enhance the level of secondary metabolites made in plant cell cultures neither has it been shown that ABC-transporters can be used to stimulate the secretion of endogenously synthesized secondary metabolites from the inside of plant cells to the extracellular space. -
-
Fig. 1 : Plasmid map of the pK7WGD2 binary vector. -
Fig. 2 : Hyoscyamine-induced cell death in transformed BY-2 cells.
Three-day old transformed BY-2 cell cultures were incubated in the absence (CON) or presence (HYO) of 30 mM hyoscyamin for 24 hours. Cell death was assayed at two timepoints (6 hours and 24 hours) by Evans blue staining and is indicated as the fold increase in optical density at OD600 relative to the value at the start of the experiment. Values are the mean of three independent experiments. GUS, US50, W303 and AT represent BY-2 cell lines transformed with pK7WGD2-GUS, pK7WGD2-ScPDR5-US50, pK7WGD2-ScPDR5-W303 and pK7WGD2-AtPDR1 respectively. -
Fig. 3 : HmPDR1 expression is induced by CdCl2.
Quantitative RT-PCR analysis of HmPDR1 in total RNA from H. muticus hairy roots treated with 1 mM CdCl2 or H2O as a control. Ethidium bromide-stained rRNA is used as a control. The fold increase in the ratio of HmPDR1 transcript to rRNA fluorescence, relative to the value at timepoint zero, is given below the panels. Time after elicitation is indicated in hours. - The human species has always been interested in plant secondary metabolites for flavourings for food, perfumes, pigments for artwork and clothing, and tools to achieve spiritual enlightenment. Furthermore, plant derived drugs are among the oldest drugs in medicine. Many plants belonging to, for example, the Solanaceae family have been used for centuries because of their active substances: hyoscyamine and scopolamine. Also other Solanaceae plants belonging to the genera Atropa, Datura, Duboisia and Scopolia produce these valuable alkaloids. In medicine they find important applications in ophthalmology, anaesthesia, and in the treatment of cardiac and gastrointestinal diseases. In addition to their peripheral anticholinergic effects they also act on the central nervous system and are used to relieve the symptoms of Parkinson's disease, and as antidotes for the anticholinesterases such as organophosphates. Cocaine, which has strong stimulant effects on the central nervous system and is used as a topical anaesthetic, is also a tropane alkaloid but is found outside Solanaceae in Erythroxylum coca. Although a lot of information is available on the pharmacological effects of tropane alkaloids, surprisingly little is known about how the plants synthesize these substances and almost nothing is known about how this synthesis is regulated. Progress in the elucidation of the biosynthetic pathways of plant secondary products has long been hampered by lack of good model systems. In the past two decades plant cell cultures have proven to be invaluable tools in the investigation of plant secondary metabolite biosynthetic pathways. Plant cell and tissue cultures have also been widely used in order to obtain alternative production systems of tropane alkaloids as described above. The main problem has usually been a lack of a sufficient amount of alkaloids and/or instability of the production. Many cultures have shown a decrease in productivity with time. Current approaches to resolve some of the above described problems comprise: (1) the optimisation of the growth conditions of plant cell cultures (
US 6,069,009 ), (2) the metabolic engineering of secondary metabolism by overexpression of regulatory genes (e.g. transcription factors) that induce the pathway ( ) and (3) the stimulation of secondary metabolism by the use of elicitors (WO 00/46383 US 5,552,307 ). In the present invention we have identified an important bottleneck for the production of secondary metabolites in plants and plant cell cultures. We have found that production of secondary metabolites in plants and plant cell cultures can be enhanced by the transformation of a gene encoding a transporter to the plants or plant cells producing the desired secondary metabolite. Sometimes the slow growth of plant cells producing secondary metabolites is due to the toxicity of the metabolites which are produced inside the plant cells. We have shown that the toxicity can to a large extent be reduced by the transformation of a gene encoding a transporter to the plant cells producing the desired secondary metabolite. Consequently, due to the reduction of the toxicity there is a higher growth rate of the transformed plant cell culture. - The present invention accordingly provides in one embodiment a method for inducing or enhancing the production or the secretion of at least one secondary metabolite in biological cells by transformation of said biological cells with an expression vector comprising an expression cassette that further comprises a gene coding for a transporter. With "at least one secondary metabolite" it is meant related structures of secondary metabolites and intermediates or precursors thereof. Said biological cells can be plant cells, fungal cells, bacteria cells, algae cells and/or animal cells. A "transporter" is a protein capable of interacting with at least one specific secondary metabolite and transporting said metabolite across a membrane wherein said membrane comprises the vacuolar membrane (tonoplast), or chloroplast membrane or plasmamembrane. Said transporter gene can be heterologous or homologous to the biological cell.
- "Expression cassettes", of the present invention are generally DNA constructs preferably including (5' to 3' in the direction of transcription): a promoter region, a gene encoding for a transporter operatively linked with the transcription initiation region, and a termination sequence including a stop signal for RNA polymerase and a polyadenylation signal. It is understood that all of these regions should be capable of operating in the biological cells to be transformed. The promoter region comprising the transcription initiation region, which preferably includes the RNA polymerase binding site, and the polyadenylation signal may be native to the biological cell to be transformed or may be derived from an alternative source, where the region is functional in the biological cell.
- The transporters of this invention may be expressed in for example a plant cell under the control of a promoter that directs constitutive expression or regulated expression.
- Regulated expression comprises temporally or spatially regulated expression and any other form of inducible or repressible expression. Temporally means that the expression is induced at a certain time point, for instance, when a certain growth rate of the plant cell culture is obtained (e.g. the promoter is induced only in the stationary phase or at a certain stage of development). Spatially means that the promoter is only active in specific organs, tissues, or cells (e.g. only in roots, leaves, epidermis, guard cells or the like. Other examples of regulated expression comprise promoters whose activity is induced or repressed by adding chemical or physical stimuli to the plant cell.
- In a preferred embodiment the expression of the transporters is under control of environmental, hormonal, chemical, and/or developmental signals, also can be used for expression of transporters in plant cells, including promoters regulated by (1) heat, (2) light, (3) hormones, such as abscisic acid and methyl jasmonate (4) wounding or (5) chemicals such as salicylic acid, chitosans or metals. Indeed, it is well known that the expression of secondary metabolites can be boosted by the addition of for example specific chemicals, jasmonate and elicitors. The co-expression of transporters, in combination with a stimulation of secondary metabolite synthesis is beneficial for an optimal and enhanced production of secondary metabolites. Alternatively, the transporters can be placed under the control of a constitutive promoter. A constitutive promoter directs expression in a wide range of cells under a wide range of conditions. Examples of constitutive plant promoters useful for expressing heterologous polypeptides in plant cells include, but are not limited to, the cauliflower mosaic virus (CaMV) 35S promoter, which confers constitutive, high-level expression in most plant tissues including monocots; the nopaline synthase promoter and the octopine synthase promoter.
- The expression cassette is usually provided in a DNA or RNA construct which is typically called an "expression vector" which is any genetic element, e.g., a plasmid, a chromosome, a virus, behaving either as an autonomous unit of polynucleotide replication within a cell (i.e. capable of replication under its own control) or being rendered capable of replication by insertion into a host cell chromosome, having attached to it another polynucleotide segment, so as to bring about the replication and/or expression of the attached segment. Suitable vectors include, but are not limited to, plasmids, bacteriophages, cosmids, plant viruses and artificial chromosomes. The expression cassette may be provided in a DNA construct which also has at least one replication system. In addition to the replication system, there will frequently be at least one marker present, which may be useful in one or more hosts, or different markers for individual hosts. The markers may a) code for protection against a biocide, such as antibiotics, toxins, heavy metals, certain sugars or the like; b) provide complementation, by imparting prototrophy to an auxotrophic host: or c) provide a visible phenotype through the production of a novel compound in the plant. Exemplary genes which may be employed include neomycin phosphotransferase (NPTII), hygromycin phosphotransferase (HPT), chloramphenicol acetyltransferase (CAT), nitrilase, and the gentamicin resistance gene. For plant host selection, nonlimiting examples of suitable markers are β-glucuronidase, providing indigo production, luciferase, providing visible light production, Green Fluorescent Protein and variants thereof, NPTII, providing kanamycin resistance or G418 resistance, HPT, providing hygromycin resistance, and the mutated aroA gene, providing glyphosate resistance.
- The term "promoter activity" refers to the extent of transcription of a gene that is operably linked to the promoter whose promoter activity is being measured. The promoter activity may be measured directly by measuring the amount of RNA transcript produced, for example by Northern blot or indirectly by measuring the product coded for by the RNA transcript, such as when a reporter gene is linked to the promoter. The term "operably linked" refers to linkage of a DNA segment to another DNA segment in such a way as to allow the segments to function in their intended manners. A DNA sequence encoding a gene product is operably linked to a regulatory sequence when it is ligated to the regulatory sequence, such as, for example a promoter, in a manner which allows modulation of transcription of the DNA sequence, directly or indirectly. For example, a DNA sequence is operably linked to a promoter when it is ligated to the promoter downstream with respect to the transcription initiation site of the promoter and allows transcription elongation to proceed through the DNA sequence. A DNA for a signal sequence is operably linked to DNA coding for a polypeptide if it is expressed as a pre-protein that participates in the transport of the polypeptide. Linkage of DNA sequences to regulatory sequences is typically accomplished by ligation at suitable restriction sites or adapters or linkers inserted in lieu thereof using restriction endonucleases known to one of skill in the art.
- The term "heterologous DNA" or "heterologous RNA" refers to DNA or RNA that does not occur naturally as part of the genome or DNA or RNA sequence in which it is present, or that is found in a cell or location in the genome or DNA or RNA sequence that differs from that which is found in nature. Heterologous DNA and RNA (in contrast to homologous DNA and RNA) are not endogenous to the cell into which it is introduced, but has been obtained from another cell or synthetically or recombinantly produced. An example is a human gene, encoding a human protein, operably linked to a non-human promoter. Another example is a gene isolated from one plant species operably linked to a promoter isolated from another plant species. Generally, though not necessarily, such DNA encodes RNA and proteins that are not normally produced by the cell in which the DNA is transcribed or expressed. Similarly exogenous RNA encodes for proteins not normally expressed in the cell in which the exogenous RNA is present. Heterologous DNA or RNA may also refer to as foreign DNA or RNA. Any DNA or RNA that one of skill in the art would recognize as heterologous or foreign to the cell in which it is expressed is herein encompassed by the term heterologous DNA or heterologous RNA. Examples of heterologous DNA include, but are not limited to, DNA that encodes proteins, polypeptides, receptors, reporter genes, transcriptional and translational regulatory sequences, selectable or traceable marker proteins, such as a protein that confers drug resistance, RNA including mRNA and antisense RNA and ribozymes.
- Generally, two basic types of metabolites are synthesised in cells, i.e. those referred to as primary metabolites and those referred to as secondary metabolites. A primary metabolite is any intermediate in, or product of the primary metabolism in cells. The primary metabolism in cells is the sum of metabolic activities that are common to most, if not all, living cells and are necessary for basal growth and maintenance of the cells. Primary metabolism thus includes pathways for generally modifying and synthesising certain carbohydrates, proteins, fats and nucleic acids, with the compounds involved in the pathways being designated primary metabolites. In contrast hereto, secondary metabolites usually do not appear to participate directly in growth and development. They are a group of chemically very diverse products that often have a restricted taxonomic distribution. Secondary metabolites normally exist as members of closely related chemical families, usually of a molecular weight of less than 1500 Dalton, although some bacterial toxins are considerably longer. Secondary plant metabolites include e.g. alkaloid compounds (e.g. terpenoid indole alkaloids, tropane alkaloids, steroid alkaloids, polyhydroxy alkaloids), phenolic compounds (e.g. quinines, lignans and flavonoids), terpenoid compounds (e.g. monoterpenoids, iridoids, sesquiterpenoids, diterpenoids and triterpenoids). In addition, secondary metabolites include small molecules (i.e. having a molecular weight of less than 600), such as substituted heterocyclic compounds which may be monocyclic or polycyclic, fused or bridged. Many plant secondary metabolites have value as pharmaceuticals. Plant pharmaceuticals include e.g. taxol, digoxin, colchicines, codeine, morphine, quinine, shikonin, ajmalicine and vinblastine. The definition of "Alkaloids", of which more than 12.000 structures have been described already, includes all nitrogen-containing natural products which are not otherwise classified as peptides, non-protein amino acids, amines, cyanogenic glycosides, glucosinolates, cofactors, phytohormones or primary metabolites (such as purine and pyrimidine bases). The "calystegins" constitute a unique subgroup of the tropane alkaloid class (Goldmann et al. (1990) Phytochemistry, 29, 2125). They are characterized by the absence of an N-methyl substituent and a high degree of hydroxylation. Trihydroxylated calystegins are summarized as the calystegin A-group, tetrahydroxylated calystegins as the B-group, and pentahydroxylated derivates form the C-group.Calystegins represent a novel structural class of polyhydroxy alkaloids possessing potent glycosidase inhibitory properties next to longer known classes of the monocyclic pyrrolidones (e.g. dihydroxymethyldihydroxy pyrrolidine) pyrrolines and piperidines (e.g. deoxynojirimycin), and the bicyclic pyrrolizidines (e.g. australine) and indolizidines (e.g. swainsonine and castanospermine). Glycosidase inhibitors are potentially useful as antidiabetic, antiviral, antimetastatic, and immunomodulatory agents.
- In another embodiment the invention provides a method for enhancing the production of at least one secondary metabolite in biological cells by transformation of said biological cells with an expression vector comprising an expression cassette further comprising a gene coding for an ABC transporter. Genes useful to be incorporated in an expression cassette for carrying out the present invention include those coding for ATP-binding cassette (ABC) transporters. Genes encoding ABC-transporters can be of any species or origin, including microorganisms, plant and animal (Higgins (1992) Ann. Rev. Cell Biol. 8, 67), but are preferably of plant or fungal origin. The ATP-binding cassette (ABC) transporters, also called the "traffic ATPases", comprise a superfamily of membrane proteins that mediate transport and channel functions in prokaryotes and eukaryotes (Higgins, C. F. (1992) Annu. Rev. Cell Biol. 8:67-113; Theodoulou F. (2000) Biochimica et Biophysica Acta 1465, 79). Typically, an ABC transporter contains two copies each of two structural units: a highly hydrophobic transmembrane domain (TMD), and a peripherally located ATP binding domain or nucleotide binding fold (NBF), which together are often necessary and sufficient to mediate transport. The TMD domains form the pathway via which the substrate crosses the membrane, and in some cases, have been shown to contribute to the substrate specificity. The NBFs are oriented towards the cytoplasmic side of the membrane and couple ATP hydrolysis to transport. Within the NBF is a conserved region of approximately 200 amino acids, consisting of the Walker A and B boxes separated by the ABC signature motif. It is this signature motif which distinguishes ABC transporters from other NTP binding proteins, such as the kinases, which also contain the Walker sequences. Sequence homology over the whole gene can be negligible between different ABC transporters, but in the conserved areas of the NBF it is typically 30-40% between family members, and this has proved useful in the isolation of ABC genes by approaches such as PCR and hybridisation with degenerate nucleotides (Dudler R. et al (1998) Methods Enzymol. 292, 162). A great variety of specific substrates is transported by members of this family of transport proteins, including drugs, anorganic ions, amino acids, proteins, sugars, and polysaccharides. Eukaryotic ABC proteins include: P-glycoproteins, also known as multidrug resistance (MDR) proteins, which are associated with resistance to a wide range of hydrophobic drugs (MDR1; Gottesman, M. M. & Pastan, I. (1993) Annu. Rev. Biochem. 62:385-427) or with phosphatidylcholine transport (MDR2; Ruetz, S. & Gros, P. (1994) Cell 77:1071-1081); CFTR, the cystic fibrosis transmembrane conductance regulator (Welsh, M. J. & Smith, A. E. (1993) Cell 73:1251-1254); TAP proteins, the transporters associated with antigen processing in mammalian cells (Androlewicz, M. J. et al. (1994) Proc. Natl. Acad. Sci. USA 91:12716-12720); cMOAT/cMRP1, which is associated with transport of glutathione, glucuronide, and sulfate conjugates across the canalicular membrane (Buchler, M. et al. (1996) J. Biol. Chem. 271:15091-15098); and STE6, which exports the a-factor mating pheromone of S. cerevisiae (Michaelis, S. (1993) Semin. Cell Biol. 4:17-27) and PDR5, the pleiotropic drug resistance protein of yeast. Prokaryotic ABC proteins include periplasmic nutrient permeases, such as those responsible for uptake of maltose (MalFGK) and histidine (HisMPQ) in gram-negative bacteria, and toxin exporters such as those required for export of hemolysin (HlyB) and colicin (COlV) from E. coli. Sequence comparisons between MRP1 and other ABC transporters reveal two major subgroups among these proteins (Szczypka et ak. (1994) J. Biol. Chem. 269, 22853). One subgroup comprises MRP1, the Saccharomyces cerevisiae cadmium factor (YCF1) gene, the Leishmania P-glycoprotein-related molecule (Lei/PgpA) and the CFTRs. The other subgroup comprises the multiple drug resistance proteins (MDRs), MHC transporters and STE6. Homologues of ABC-transporters have been identified in plant species. In Arabidopsis thaliana, the glutathione-conjugate transporter (MRP) is located in the vacuolar membrane and is responsible for sequestration of xenobiotics in the central vacuole. An MDR-like gene (atpgp1) has also been identified in A. thaliana, which encodes a putative P-glycoprotein homolog. This atpgp1 gene was found to share significant sequence homology and structural organization with human MDR genes. Other MDR homologues have been found in potato and barley. Genes encoding ABC-transporters used in the present invention may be operably linked with a promoter for expression in a plant species may be derived from a chromosomal gene, cDNA, a synthetic gene, or combinations thereof.
- In another embodiment of the invention DNA sequences encoding ABC-transporters are used to enhance the production of at least one secondary metabolite in plant cells comprising the transformation of said plant cells with an expression vector comprising an expression cassette further comprising a gene coding for an ABC-transporter.
- By the term "enhanced production" it is meant that the level of one or more metabolites may be enhanced by at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or at least 100% relative to the untransformed plant cell which was used to transform with an expression vector comprising an expression cassette further comprising a gene coding for a transporter or an ABC-transporter. An enhanced production of a secondary metabolite can result in a detection of a higher level of secondary metabolites in the extracellular medium of the plant cell culture. Alternatively, a higher level of secondary metabolites can be detected inside the plant cells, for example in the vacuole.
- The present invention can be practiced with any plant variety for which cells of the plant can be transformed with an expression cassette of the current invention and for which transformed cells can be cultured in vitro. Suspension culture, callus culture, hairy root culture, shoot culture or other conventional plant cell culture methods may be used (as described in: Drugs of Natural Origin, G. Samuelsson, 1999, ISBN 9186274813).
- By "plant cells" it is understood any cell which is derived from a plant and can be subsequently propagated as callus, plant cells in suspension, organized tissue and organs (e.g. hairy roots).
- Tissue cultures derived from the plant tissue of interest can be established. Methods for establishing and maintaining plant tissue cultures are well known in the art (see, e.g. Trigiano R.N. and Gray D.J. (1999), "Plant Tissue Culture Concepts and Laboratory Exercises", ISBN: 0-8493-2029-1; Herman E.B. (2000), "Regeneration and Micropropagation: Techniques, -Systems and Media 1997-1999", Agricell Report). Typically, the plant material is surface-sterilized prior to introducing it to the culture medium. Any conventional sterilization technique, such as chlorinated bleach treatment can be used. In addition, antimicrobial agents may be included in the growth medium. Under appropriate conditions plant tissue cells form callus tissue, which may be grown either as solid tissue on solidified medium or as a cell suspension in a liquid medium.
- A number of suitable culture media for callus induction and subsequent growth on aqueous or solidified media are known. Exemplary media include standard growth media, many of which are commercially available (e.g., Sigma Chemical Co., St. Louis, Mo.). Examples include Schenk-Hildebrandt (SH) medium, Linsmaier-Skoog (LS) medium, Murashige and Skoog (MS) medium, Gamborg's B5 medium, Nitsch & Nitsch medium, White's medium, and other variations and supplements well known to those of skill in the art (see, e.g., Plant Cell Culture, Dixon, ed. IRL Press, Ltd. Oxford (1985) and George et al., Plant Culture Media, )). For the growth of conifer cells, particularly suitable media include 1/2 MS, 1/2 L.P., DCR, Woody Plant Medium (WPM), Gamborg's B5 and its modifications, DV (Durzan and Ventimiglia, In Vitro Cell Dev. Biol. 30:219-227 (1994)), SH, and White's medium.
- When secondary metabolites are produced in plant cell culture systems they usually have to be extracted and purified from the isolated plant cell mass which is an expensive process. It is known that plants can be made by means of genetic manipulation to store proteins in seed endosperm, from where they can be more easily extracted. It has also been described that some plant cells can secrete secondary metabolites can be secreted and that said secretion can be enhanced by for example the addition of elicitors (Kneer et al. (1999) J. Exp. Bot. 50, 1553) or by the addition of specific chemicals (Lee et al. (1998) Phytochemistry 49, 2342). It has however never been described that the secretion of secondary metabolites by plant cells can be induced or enhanced by the transformation of at least one specific gene into a plant cell. The present invention provides a solution for this problem by transformation of plant cells, producing secondary metabolites, with an expression cassette comprising a gene encoding an ABC-transporter. Therefore, in another embodiment of the invention a DNA sequence encoding an ABC-transporter can be used to induce or enhance the secretion of at least one secondary metabolite produced in plant cell cultures comprising transforming said plant cells that are producing secondary metabolites, with an expression vector comprising an expression cassette further comprising a gene coding for an ABC-transporter, and selecting transformed plant cells with an induced or enhanced secretion of at least one secondary metabolite. Such transformed plant cells can be subsequently propagated using methods described herein before.
- An "enhanced secretion of at least one secondary metabolite" means that there exists already a detectable secretion of the secondary metabolite(s) in the extracellular medium of the plant cell culture and that an increase of the secondary metabolite(s) can be measured by at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more than 90% compared to basal secretion by the untransformed plant cell culture. An enhanced secretion' does not necessarily mean that there is a higher production, it can also mean that there is exists the same level of production but that the secretion is enhanced. An "induced secretion of at least one secondary metabolite" means that there is no detectable secretion of the secondary metabolite(s) in the extracellular medium of the untransformed plant cell culture but that the detection becomes possible upon carrying out the transformation according to the invention.
- Generally secondary metabolites can be measured, intracellularly or in the extracellular space, by methods known in the art. Such methods comprise analysis by thin-layer chromatography, high pressure liquid chromatography, capillary chromatography, (gas chromatographic) mass spectrometric detection, radioimmunoassay (RIA) and enzyme immuno-assay (ELISA).
- In order to make clear what is meant by the word "secretion" in the current invention one has to make a clear distinction between the secretion of proteins which is mediated by an amino-terminal signal peptide and the secretion of secondary metabolites which is independent of an amino-terminal leader sequence. As the term is used herein, secretion means secretion of a secondary metabolite across the plasma membrane or secretion across both the plasma membrane and the cell wall of a plant cell. It should be noted that, in the scientific literature the term "secretion" often is used to indicate secretion into the apoplastic space, i.e., secretion across the plasma membrane but not across the cell wall.
- In one aspect of the invention there is no secretion of (a) secondary metabolite(s) into the growth medium. Then, the secretion can be induced by several possibilities: (1) by the transformation of the plant cell with a heterologous gene encoding an ABC-transporter or (2) by the overexpression of a homologous ABC-transporter which expressing is rate-limiting in the plant cell or (3) by the relocalisation of a homologous or heterologous ABC-transporter from a vacuolar localisation towards a membrane localisation. In plants, proteins destined for the vacuole are sorted away from proteins destined for secretion at the trans-Golgi netwerk, a process that requires the presence of positive sorting signals on the vacuolar proteins. Three types of sorting signals have been described for soluble vacuolar proteins in plants (Matsuoka and Neuhaus (1999) J. Exp. Botany 50, 165). Some proteins contain a cleavable amino-terminal propeptide that functions as a sorting signal while others contain a cleavable carboxy-terminal propeptide. Finally, a minor amount of plant proteins contains an internal vacuolar targeting determinant. According to the invention a homologous or heterologous ABC-transporter that is normally localized in the vacuolar membrane can be engineered by clipping off its vacuolar localisation signal (carboxy-terminal or amino-terminal propeptide) or by deleting its internal vacuolar targeting determinant. If necessary a heterologous or homologous amino-terminal leader sequence is spliced to the gene encoding the homologous or heterologous ABC-transporter in order to provide entry into the secretion system. As a result said engineered ABC-transporter is not directed anymore in the secretion pathway towards its normal vacuolar localisation but is deviated towards the extracellular space. However, due to the hydrophobic transmembrane signal present in ABC-transporters, the ABC-transporter is not secreted into the extracellular medium but remains sequestered into the plasmamembrane of the plant cell. We show in the present invention that the novel intracellular localisation of the ABC-transporter (from the vacuole to the plasma membrane) results in a secretion of the produced secondary metabolites into the medium of the plant cell culture.
- In another aspect of the invention there is already an existing but a low level of secretion of (a) secondary metabolite(s) by the plant cell and then the secretion can be enhanced by (1) by the transformation of the plant cell with a heterologous gene encoding an ABC-transporter or (2) by the overexpression of a homologous ABC-transporter which expressing is rate-limiting in the plant cell or (3) by the relocalisation of a homologous or heterologous ABC-transporter from a normal vacuolar localisation towards a membrane localisation.
- In yet another aspect of the invention an intermediary product of the secondary metabolite, which causes negative feedback inhibition on an enzymatic reaction step involved in the biosynthesis of said secondary metabolite, can be secreted by (1) by the transformation of the plant cell with a heterologous gene encoding an ABC-transporter or (2) by the overexpression of a homologous ABC-transporter which expressing is rate-limiting in the plant cell or (3) by the relocalisation of a homologous or heterologous ABC-transporter from a vacuolar localisation towards a membrane localisation. The secretion of said intermediary product or an amount produced thereof reduces the negative feedback inhibition and consequently enhances the production of the secondary metabolite in the plant cell. The enhanced production of said secondary metabolite can be made secreted by the plant cell by the transformation of the already transformed plant cell, with a second expression cassette comprising a gene encoding an ABC transporter, according to the method described above. In this case of secretion, the directed secondary metabolites can be easily isolated from the surrounding medium since they are directed into the extracellular space. Consequently, the breaking up of the cells that is necessary in the case of intracellular production can be omitted.
- In another embodiment of the invention the production of secondary metabolites can be enhanced by stimulating the transport of secondary metabolites into the vacuole. In plants, the targeting of proteins and compounds into the vacuole is of particular interest (especially from the point of view of application) because the vacuole is the largest storage compartment in the cell for reserve substances, detoxification products and defence substances. The most important storage takes place in vacuoles in plant organs such as tubers, bulbs, roots and stems. Similar considerations also apply to substances that can be used in the control of pests or diseases, especially when those substances prove to be toxic to the plant itself. Indeed, in certain cases the vacuole also serves as a detoxification organel by, for example, storing the detoxification products synthesised by the plant. According to the present invention secondary metabolites can also be made secreted into the vacuole (1) by the transformation of a plant cell with a heterologous gene encoding an ABC-transporter or (2) by the overexpression of a homologous ABC-transporter which expressing is rate-limiting in the plant cell or (3) by the relocalisation of a homologous or heterologous ABC-transporter from a normally localised plasmamembrane localisation towards a vacuolar localisation. To perform said relocalisation it is necessary to modify the gene encoding an ABC-transporter by genetically fusing it to an amino-terminal or carboxy-terminal vacuolar localisation signal or by the genetic modification through the introduction of an existing internal vacuolar localisation signal.
US patent 6,054,637 provides detailed information of genetic modification of genes through the addition or clipping off plant vacuolar localisation signals. We observe that the secretion or targeting of the produced secondary metabolites into the vacuole reduces the toxicity to the plant cell. - In yet another embodiment of the invention an intermediary product of the secondary metabolite, which causes negative feedback inhibition on an enzymatic reaction step involved in the biosynthesis of said secondary metabolite, can be made sequestered into the vacuole by (1) the transformation of the plant cell with a heterologous gene encoding an ABC-transporter or by (2) the overexpression of a homologous ABC-transporter which expressing is rate-limiting in the plant cell or (3) by the relocalisation of a homologous or heterologous ABC-transporter from a normal membrane localisation towards a vacuolar localisation. The import of said intermediary product, or an amount produced thereof, into the vacuole reduces the negative feedback inhibition of the enzymatic reaction which occurs outside the vacuole and consequently enhances the production of the secondary metabolite in the plant cell.
- In another embodiment the current invention can be combined with other known methods to enhance the production and/or the secretion of secondary metabolites in plant cell cultures such as (1) by improvement of the plant cell culture conditions, (2) by the transformation of the plant cells with a transcription factor capable of upregulating genes involved in the pathway of secondary metabolite formation, (3) by the addition of specific elicitors to the plant cell culture, and 4) by the induction of organogenesis.
- In another embodiment of the invention DNA sequences encoding ABC-transporters are used to enhance the production of at least one secondary metabolite in plants comprising the transformation of said plants with an expression vector comprising an expression cassette further comprising a gene coding for an ABC-transporter.
- By the term "to enhance the production" it is meant that the level of one or more metabolites may be enhanced by at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or at least 100% relative to the untransformed plant which was used to transform with an expression vector comprising an expression cassette further comprising a gene coding for a transporter or an ABC-transporter. An enhanced production of a secondary metabolite can result in a detection of a higher level of secondary metabolites in the plant, for example in the vacuole. In another embodiment the enhanced production of at least one secondary metabolite leads to an enhanced secretion. In yet another embodiment the same production of at least one secondary metabolite occurs in the transformed plant but an enhanced secretion of at least one secondary metabolite occurs by said transformed plant. Secondary metabolites can for example be efficiently produced by continuous secretion from the roots of hydroponically grown plants. This process of secretion is also been termed 'rhizosecretion'.
- The term "plant" as used herein refers to vascular plants (e.g. gymnosperms and angiosperms). The method comprises transforming a plant cell with an expression cassette of the present invention and regenerating such plant cell into a transgenic plant. Such plants can be propagated vegetatively or reproductively. The transforming step may be carried out by any suitable means, including by Agrobacterium-mediated transformation and non-Agrobacterium-mediated transformation, as discussed in detail below. Plants can be regenerated from the transformed cell (or cells) by techniques known to those skilled in the art. Where chimeric plants are produced by the process, plants in which all cells are transformed may be regenerated from chimeric plants having transformed germ cells, as is known in the art. Methods that can be used to transform plant cells or tissue with expression vectors of the present invention include both Agrobacterium and non-Agrobacterium vectors. Agrobacterium-mediated gene transfer exploits the natural ability of Agrobacterium tumefaciens to transfer DNA into plant chromosomes and is described in detail in Gheysen, G., Angenon, G. and Van Montagu, M. 1998. Agrobacterium-mediated plant transformation: a scientifically intriguing story with significant applications. In K. Lindsey (Ed.), Transgenic Plant Research. Harwood Academic Publishers, Amsterdam, pp. 1-33 and in Stafford, H.A. (2000) Botanical Review 66: 99-118. A second group of transformation methods is the non-Agrobacterium mediated transformation and these methods are known as direct gene transfer methods. An overview is brought by Barcelo, P. and Lazzeri, P.A. (1998) Direct gene transfer: chemical, electrical and physical methods. In K. Lindsey (Ed.), Transgenic Plant Research, Harwood Academic Publishers, Amsterdam, pp.35-55. Hairy root cultures can be obtained by transformation with virulent strains of Agrobacterium rhizogenes, and they can produce high contents of secondary metabolites characteristic to the mother plant. Protocols used for establishing of hairy root cultures vary, as well as the susceptibility of plant species to infection by Agrobacterium (Toivunen L. (1993) Biotechnol. Prog. 9, 12; Vanhala L. et al. (1995) Plant Cell Rep. 14, 236). It is known that the Agrobacterium strain used for transformation has a great influence on root morphology and the degree of secondary metabolite accumulation in hairy root cultures. It is possible that by systematic clone selection e.g. via protoplasts, to find high yielding, stable, and from single cell derived-hairy root clones. This is possible because the hairy root cultures possess a great somaclonal variation. Another possibility of transformation is the use of viral vectors (Turpen TH (1999) Philos Trans R Soc Lond B Biol Sci 354(1383): 665-73).
- Any plant tissue or plant cells capable of subsequent clonal propagation, whether by organogenesis or embryogenesis, may be transformed with an expression vector of the present invention. The term 'organogenesis' means a process by which shoots and roots are developed sequentially from meristematic centers; the term embryogenesis' means a process by which shoots and roots develop together in a concerted fashion (not sequentially), whether from somatic cells or gametes. The particular tissue chosen will vary depending on the clonal propagation systems available for, and best suited to, the particular species being transformed. Exemplary tissue targets include protoplasts, leaf disks, pollen, embryos, cotyledons, hypocotyls, megagametophytes, callus tissue, existing meristematic tissue (e.g. apical meristems, axillary buds, and root meristems), and induced meristem tissue (e.g., cotyledon meristem and hypocotyls meristem).
- These plants may include, but not limited to, plants or plant cells of agronomically important crops, such as tomato, diverse herbs such as oregano, basilicum and mint. It may also be applied to plants that produce valuable compounds, e.g. useful as for instance pharmaceuticals, as ajmalicine, vinblastine, vincristine, ajmaline, rserpine, rescinnamine, camptothecine, ellipticine, quinine, and quinidien, taxol, morphine, scopolamine, atropine, cocaine, sanguinarine, codeine, genistein, daidzein, digoxin, colchicines, calystegins or as food additives such as anthocyanins, vanillin; including but not limited to the classes of compounds mentioned above. Examples of such plants include, but not limited to, Papaver spp., Rauvolfia spp., Taxus spp., Cinchona spp., Eschscholtzia califomica, Camptotheca acuminata, Hyoscyamus spp., Berberis spp., Coptis spp., Datura spp., Atropa spp., Thalictrum spp., Peganum spp.
- The present invention also describes an isolated polypeptide selected from the groups consisting of (a) an isolated polypeptide encoded by a polynucleotide comprising the sequence of SEQ ID NO: 1; (b) an isolated polypeptide comprising a polypeptide sequence having a least 83 % identity to the polypeptide sequence of SEQ ID NO: 2; (c) fragments and variants of such polypeptides in (a) to (b) that induce or enhance the production or the secretion of at least one secondary metabolite in plants or plant cells.
- The invention also describes an isolated polynucleotide selected from the groups consisting of (a) an isolated polynucleotide comprising a polynucleotide sequence of SEQ ID NO: 1; (b) an isolated polynucleotide comprising a polynucleotide sequence having at least 91% identity to SEQ ID NO: 1; (c) fragments and variants of such polynucleotides in (a) to (b) that induce or enhance the production or the secretion of at least one secondary metabolite in plants or plant cells.
- As used herein, the words "polynucleotide" may be interpreted to mean the DNA and cDNA sequence as detailed by Yoshikai et al. (1990) Gene 87:257, with or without a promoter DNA sequence as described by Salbaum et al. (1988) EMBO J. 7(9):2807.
- As used herein, "fragment" refers to a polypeptide or polynucleotide of at least about 9 amino acids or 27 base pairs, typically 50 to 75, or more amino acids or base pairs, wherein the polypeptide contains an amino acid core sequence. If desired, the fragment may be fused at either terminus to additional amino acids or base pairs, which may number from 1 to 20, typically 50 to 100, but up to 250 to 500 or more. A "functional fragment" means a polypeptide fragment possessing the biological property of that induce or enhance the production or the secretion of at least one secondary metabolite in plants or plant cells. The terms 'identical' or percent 'identity' in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e. 70% identity over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using sequence comparison algorithms or by manual alignment and visual inspection. Preferably, the identity exists over a region that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is 50-100 amino acids or nucleotides or even more in length. Examples of useful algorithms are PILEUP (Higgins & Sharp, CABIOS 5:151 (1989), BLAST and BLAST 2.0 (Altschul et al. J. Mol. Biol. 215: 403 (1990). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www/ncbi.nlm.nih.gov/).
- The recombinant DNA and molecular cloning techniques applied in the below examples are all standard methods well known in the art and are e.g. described by Sambrook et al. (1989) Molecular cloning: A laboratory manual, second edition, Cold Spring Harbor Laboratory Press. Methods for yeast culture and manipulation applied in the below examples are all standard methods well known in the art and are described e.g. in Guthrie and Fink (1991) Guide to yeast genetics and molecular biology, academic Press, Inc., New York. Methods for tobacco cell culture and manipulation applied in the below examples are methods described in or derived from methods described in Nagata et al. (1992) Int. Rev. Cytol. 132,1;
- In the yeast Saccharomyces cerevisiae, a complex pleiotropic drug resistance (PDR) network of genes involved in multidrug resistance is composed of the transcriptional regulators Pdr1p and Pdr3p, which activate expression of the ATP-binding cassette (ABC) transporter-encoding genes PDR5, SNQ2, YOR1, as well as other not yet identified genes. To assess yeast sensitivity towards tropane alkaloids (Tas) and nicotine alkaloids (Nas) and identify yeast ABC transporters with specificity for TAs and NAs, we have screened isogenic yeast strains deleted of the ABC transporters YOR1, SNQ2, PDR5, PDR10, PDR11 or YCF1 for tolerance to the toxic compounds hyoscyamine, scopolamine and nicotine. The isogenic yeast strains derived from the US50-18C genotype were constructed and described in Decottignies et al. (J. Biol. Chem. (1998) 273, 12612). The yeast strains derived from the BY4741 genotype are obtained from the EUROSCARF collection (Frankfurt, Germany). All strains are listed
in Table 1. Table 1. Yeast strains used Strain Genotype US50-18C Matα pdr1-3 ura3 his1 AD1 US50-18C yor1::hisG AD2 US50-18C snq2::hisG AD3 US50-18C pdr5::hisG AD4 US50-18C pdr10::hisG AD5 US50-18C pdr11 ::h/ sG BY4741 1 Mata his3Δ1 leu2Δ0 met15,Δ0 ura3Δ0 Y02409 BY4741 pdr5::kanMX4 Y03951 BY4741 snq2::kanMX4 Y04069 BY4741 ycf1::kanMX4 Y05933 BY4741 yor1::kanMX4 - Alkaloid tolerance was assessed by controlling growth performance on rich medium (YPD) that contained different concentrations of TAs or NAs. To this end the different strains were grown to saturation (48h) in liquid YPD. Cultures were diluted 10-, 100-and 1000-fold, and volumes of about 3 µl were dropped with a stainless steel replicator on YPD plates containing 2% Bacto Agar with the toxic compounds. Rich medium contains 1% yeast extract, 2% Bacto Peptone and 2% glucose. Filter-sterilized water solutions of hyoscyamine, scopolamine and nicotine were added after autoclaving. Growth was evaluated after two days incubation at 28°C. We observed that wild type yeast (i.e. not deleted for one of the ABC transporters) can tolerate hyoscyamine, scopolamine and nicotine to levels of 50 mM, 100 mM, and 15 mM respectively. Gradually increasing alkaloid levels in the medium caused growth retardation and was finally lethal. All isogenic strains except the pdr5 mutant strain showed identical alkaloid sensitivity. The above-mentioned alkaloid concentrations were lethal for the strain deleted for the PDR5 gene. This indicates that Pdr5p shows substrate specificity for TAs and NAs and is the only known ABC transporter involved in TA or NA transport in yeast cells. Previously other plant secondary metabolites such as indole alkaloids (e.g. vinblastine and vincristine), taxol and flavonoids were also shown to be substrates for Pdr5p mediated multidrug transport (Kolaczkowski et al. (1996) J. Biol. Chem. 271, 31543 and Kolaczkowski et al. (1998) Microb. Drug Resist. 4, 143).
- Suspension cultured tobacco cells, Nicotiana tabacum L.
cv Bright Yellow 2 were grown in the dark at 26°C on a rotary shaker (130 rpm) in MSST, a modified Murashige-Skoog basal medium supplemented with 1.5 mM KH2PO4, 3 µM thiamine, 0.55 mM inositol, 87 mM sucrose and 1µM 2,4D. Cells are subcultured every 7 days by transferring 0.5 ml into 50 ml of fresh medium in 250-ml flasks.
Toxicity of TAs and NAs to tobacco BY-2 cells was assessed in two ways. In the first method growth performance on MSST medium containing different concentrations of TAs or NAs was controlled. To this end a fresh BY-2 cell culture was started and after 3 days culture volumes of about 300 µl were dropped on MSST plates containing 0.65% Bacto Agar and the toxic alkaloids. Filter-sterilised water solutions of hyoscyamine and nicotine were added after autoclaving. Growth was evaluated after 15 days incubation at 26°C. Wildtype BY-2 cells (i.e. not transgenic) can tolerate hyoscyamine and nicotine without severe growth problems to levels of 30 mM and 3 mM respectively. Gradually increasing alkaloid levels in the medium caused growth retardation and finally was lethal. In the second method toxicity was evaluated by measuring cell death after incubation in the presence of increasing levels of alkaloids. Cell death was scored by the Evans blue method (Turner and Novacky (1974) Phytopathol. 64, 885). To this end a fresh BY-2 cell culture was started and after 3 days 5 ml of this culture was transferred to one well of a 6-well plate (Falcon 353046). 1 ml of fresh MSST was added and the desired toxic compound in a volume of 650 µl in 0.1 M potassium phosphate buffer at pH 5.8. Cells were then further incubated on the rotary shaker and 1-ml samples were taken after 0, 6 and 24 hours. We spinned the cells down at 6000 rpm for 3 minutes, _removed the supernatant, added 1 ml of 0.1 % Evans blue in MSST medium and incubated for 15 minutes at room temperature on a rotary wheel. Afterwards we spinned the cells down again and washed 5 times with fresh MSST medium till all the blue color was gone from the supernatant. Dye bound to dead cells was solubilised by incubation in 1 ml of 50% methanol, 1 % SDS for 30 minutes at 50°C. We spinned the cells down again (now at 14000 rpm for three minutes) and quantified cell death by measuring OD600 of the supernatant. Cell death is expressed as fold increase in Evans blue staining compared to the control cells. In this assay tobacco BY-2 cells are found sensitive to all the compounds tested. Hyoscyamine and nicotine cause the death of all suspension cultured tobacco cells within 24 hours of incubation at levels of 50 mM and 20 mM respectively. This indicates that the metabolites that plants produce inside the cells can be toxic for themselves and also that this toxicity can result in slow growth of plant cells producing secondary metabolites. Furthermore these results provided us with useful assay systems for evaluating the activity of ABC transporters from different organisms such as yeast, plants and animals in tobacco cell suspension cultures. - The PDR5 gene was cloned by the PCR method with the Pful polymerase. To this end oligonucleotides were designed with 5'-terminal attB sequences that amplify the entire open reading frame of the PDR5 gene (4536 nt) as a PCR product that is an efficient substrate for recombination with the Gateway™ system (InVitroGen). Gateway (Invitrogen) technology provides an alternative rapid method for cloning a sequence into a multiple expression system. The advantage of the Gateway cloning is that fragments present as Entry clones can be subcloned into different Destination vectors in a short time. This technology was used to construct a set of versatile vectors for Agrobacterium -based plant transformation. Our intention was to develop vectors for wide range plant gene analysis. The Gateway-compatible binary vector pPZP200 is the backbone of our constructs (Hajdukiewicz et al. Plant Molecular Biology 25, 989-994, 1994). This binary vector is relatively small in size, contains two origins of replication in E. coli or in Agrobacterum and posses streptomycin and/or spectinomycin for plasmid selection. Three plant selectable marker genes; kanamycin, hygromycin and bar (most frequently used markers in plant transformation) have been used for all constructs. All selectable markers are in a cassette containing nos (nopaline synthase) promoter and nos terminator. These genes were cloned toward the left border of the T-DNA. For construction of all Gateway clones we have used the rfA conversion cassette.
- The oligonucleotides used for PDR5 gene cloning, are 5'-AAAAGCAGGCTACCATGCCCGAGGCCAAGCTTAACAATA-3' as the forward primer and 5'- AGAAAGCTGGGTCCATCTTGGTAAGTTTCTTTTCTTAACC-3' as the reverse primer, respectively. As a template genomic DNA prepared from the yeast strains US50-18C or W303 was used. First the PCR fragments were introduced in the Donor Vector pDONR201 (InVitroGen) via the BP reaction to generate the Entry Clone. Then the PDR5 gene was transferred to the Destination Vector pK7WGD2 (
Fig. 1 ) via the LR reaction, where the gene is under control of the CaMV 35S promoter. The T-DNA of the pK7WGD2 binary vector also bears the kanamycin resistance gene (NPTII) under the control of the pnos promoter as selectable marker for plant transformation and the gene encoding the green fluorescent protein (GFP) under the control of the proID promoter for visual selection of transgenic plant cell lines. The resulting binary plasmids were designated pK7WGD2-ScPDR5-US50 or pK7WGD2-ScPDR5-W303 depending on the yeast genotype from which the gene is isolated. Also the GUS gene was introduced in the pK7WGD2 vector and the resulting binary vector pK7WGD2-GUS served as a control for the experiments described in the examples below. - Plant cell transformations were carried out by applying the ternary vector system (van der Fits et al. (2000) Plant Mol. Biol. 43, 495). The plasmid pBBR1 MCS-5.virGN54D is used as a ternary vector. The binary plasmid was introduced into Agrobacterium tumefaciens strain LBA4404 already bearing the ternary plasmid by electro-transformation.
Agrobacterium tumefaciens strains were grown for three days at 28°C on solid LC medium containing 20 µg/ml rifampicin, 40 µg/ml geneticin, 100 µg/ml spectinomycin and 300 µg/ml streptomycin. LC medium contains 1 % Bacto Trypton, 0.5% Bacto yeast extract and 0.8% NaCl. From these bacteria a 5-ml liquid culture was grown in LC medium for 48 hours. N. tabacum BY-2 cells were grown in MSST medium as described in example 2. Fortransformation 3 days old cell cultures were used. Forcocultivation 4 ml of BY-2 cells was transferred to the corner of a petridish (Ø 80 mm) and 300 µl of the A. tumefaciens culture was added. Dishes were taped with respiratory tape and incubated for 3 days at 26°C in the dark. After 3 days the cocultivation mixture was transferred into 20 ml of fresh MSST medium 50 µg/ml kanamycin-B, 500µg/ml carbenicilin and 250 µg/ml vancomycin in 100-ml flasks and further incubated as described in example 2. After oneweek 4 ml of this cell suspension culture was subcultured in 40 ml of fresh MSST medium with 10 µg/ml of the kanamycin analogue G-418 (geneticin), 500µg/ml carbenicilin and 250 µg/ml vancomycin and grown further till it reached maximal density (similar to stationary, 1-week-old culture) which took two to three weeks, depending on the efficiency of the transformation event. After two additional 1 ml transfer cycles in medium containing 50 µg/ml kanamycin-B, 500µg/ml carbenicilin and 250 µg/ml vancomycin cells were further propagated in an antibiotic-free MSST medium as described in example 2. Elimination of agrobacteria was verified and efficient transgene expression was scored in vivo by observing GFP fluorescence with a fluorescence microscope equipped with HQ-GFP band-pass filters for an excitation at 470 and emission at 525 nm. - In recombinant BY-2 cells transformed with the PDR5 expression cassettes (from both yeast genotypes), correct PDR5 expression is tested by northern blot analysis using a PDR5 specific DNA probe and by western blot analysis using a rabbit polyclonal anti-Pdr5p antibody (Decottignies et al. (1999) J. Biol. Chem. 274, 37139). In both lines PDR5 is efficiently expressed both on the RNA and protein level. Fractionation also shows that the Pdr5 protein is correctly targeted to the plasma membrane. Tolerance of the transformed BY-2 suspension cultures to hyoscyamine and nicotine was assessed by the two assays described in example 2. As can be deduced from the growth performance assay, BY-2 cell lines expressing the different yeast Pdr5 transporters displayed to varying extents an increased tolerance to both alkaloids as compared to the control GUS-expressing lines. Lines expressing the PDR5 transporter from yeast genotype W303 showed the highest alkaloid tolerance, in particular towards hyoscyamine. In the cell death experiment hyoscyamine was added to a final concentration of 30 mM. Transgene BY-2 cells expressing the Pdr5p from yeast strain W303 again showed the highest tolerance to this tropane alkaloid (
Fig. 2 ). Fold increase in cell death lowered with ca. 35% in the W303 lines whereas US50 lines had a 15% decrease in hyoscyamine induced cell death. - For the analysis of nicotinic alkaloid accumulation 6-days old recombinant BY-2 cell cultures (BY-2 transformed with pK7WGD2-ScPDR5-US50 or pK7WGD2-ScPDR5-W303 or pK7WGD2-GUS) were washed and diluted ten-fold with fresh hormone free MSST medium. After a recuperation period of 12 hours, the cultures were treated with methyl jasmonate (MeJA). MeJA was dissolved in dimethyl sulfoxide (DMSO) and added to the culture medium at a final concentration of 50 µM. As a control, cells treated with an equivalent amount of DMSO were included. For alkaloid analysis, three replicate shake flasks with a volume of 20 ml were processed. After vacuum-filtering through Miracloth, cells and medium were separated from each other for intracellular and extracellular alkaloid analysis respectively. The filtered cell mass was transferred to a test tube, frozen and lyophilized (50 mbar, approx. 48 hours). Lyophilised cell samples were extracted for GC-MS analysis by a modified method described by Furuya et al. (1971, Phytochemistry, 10, 1529). Cells were weighed and 25 µg 5-α-cholestane was added as internal standard. The samples are made alkaline with ammonia (10 % (v/v), 1 ml) and water (2 ml) is added. Alkaloids were extracted by vortexing with 2 ml of dichloromethane. After 30 min the samples were centrifuged (2000 rpm, 10 min) and the lower organic layer was separated and transferred into glass vials. After evaporation to dryness 25 µl of dichloromethane was added and the samples were silylated with N-methyl-N-(trimethylsilyl)trifluoroacetamide (Pierce, Rockford, USA) for 20 min at 120 °C prior to GC-MS analysis. For alkaloid determination in the medium, 20 ml of the filtered medium was made alkaline with ammonia (10% v/v) to reach pH 9. Internal standards were added (5-α-cholestane and cotinine). Subsequently this solution was extracted twice with dichloromethane (1:1) and evaporated to dryness. The column was rinsed twice with 1 ml of dichloromethane and the extract was transferred into glass vials. We further proceeded as described above for the cell extract.
Table 2. Alkaloid accumulation in transformed BY-2 cellsa BY-2 Strain Nicotineb Anatabineb Medium Cells Medium Cells % in medium GUS 0 2.00 0.18 157 0.1 ScPDR5-US50 0 0.88 7.40 207 3.6 ScPDR5- W303 0 2.03 5.12 74 6.9 a Measured 72 hours after elicitation with 50 µM methyl jasmonate. Results are the mean of three independent experiments
b Indicated in µg/flask, with 20-ml BY-2 culture per flask - In jasmonate elicited BY-2 cells the alkaloids detected after 72 hours are nicotine, anabasine, anatabine and anatalline. No alkaloids are detected in DMSO-treated samples, neither in the cells nor in the medium. The results for nicotine and anatabine are shown in Table 2. Of all alkaloids that are produced by elicited BY-2 cells only anatabine is found in the medium. Although only trace amounts of anatabine can be detected extracellularly, comparison of anatabine levels in the different BY-2 cell lines after 72 hours of MeJA treatment clearly shows an enhancement of anatabine export in cell lines transformed with the PDR5 genes.
- To target the yeast PDR5 protein to plant vacuolar membranes two strategies are followed. In the first the N-terminal signal peptide and pro-peptide from sweet potato (MKAFTLALFLALSLYLLPNPAHSRFNPIRLPTTHEPA, Matsuoka and Nakamura (1991) Proc. Natl. Acad. Sci. USA 88, 834) are fused at the N-terminus of the Pdr5 protein. The resulting recombinant open reading frame is designated ScNVacPDR5. In the second approach the C-terminal amino acids of the tobacco chitinase A (DLLGNGLLVDTM, Neuhaus et al. (1991) Proc. Natl. Acad. Sci. USA 88, 10362) are added at the C-terminus of the Pdr5 protein. The resulting recombinant open reading frame is designated ScPDR5CVac. Both recombinant genes are put under the control of the CaMV35S promoter and cloned in the binary vector bearing the HYG and GFP genes as described in example 3.1. The resulting binary plasmids are designated pH-ScNVacPDR5-GFP and pH-ScPDR5CVac-GFP, respectively.
- BY-2 suspension cultured cells are transformed as described in example 3.2 and 5 transgene calli of both ScNVacPDR5 or ScPDR5CVac transformed cells and highly expressing GFP are selected as described in example 3.3. Control of expression of recombinant PDR5 is performed as described in example 3.3 by northern and western blot analysis. Fractionation shows that in both types of transgene lines (NVac or CVac) the Pdr5 protein is targeted to the vacuolar membrane.
- To assess tolerance to nicotine and hyoscyamine in transgenic cell lines the same assays as described in example 3.3 are used here to evaluate the functionality of vacuole targeted Pdr5p. The effect of the vacuolar expression of PDR5 on nicotine production in BY-2 cells is evaluated as described in example 3.4.
- The ABC protein super-family is the largest protein family known and most are membrane proteins active in the transport of a broad range of substances across the membranes. Also in Arabidopsis this superfamily is large and diverse (129 ORFs) and a complete inventory has been described by Sanchez-Fernandez et al. (J. Biol. Chem. (2001), 276, 30231). One of the subfamilies of full-length ABC transporters in Arabidopsis consists of the PDRs (13 ORFs) of which yeast PDR5 is the prototype. At least eight of the PDR5-like ORFs in Arabidopsis are transcriptionally active and have been isolated as ESTs (Sanchez-Fernandez et al. (2001), J. Biol. Chem., 276, 30231). Amongst these is one of the closest Arabidopsis PDR5-orthologues, namely the AtPDR1 gene (At3g16340). A CDNA clone of the AtPDR1 gene is isolated as described for the yeast PDR5 gene in example 3. To this end the following oligonucleotides were designed: 5'-AAAAAGCAGGCTACCATGGAGACGTTATCGAGAA-3' as the forward primer and 5'-AGAAAGCTGGGTCTATCGTTGTTGGAAGTTGAGC-3' as the reverse primer, respectively. As a template we used cDNA prepared from Arabidopsis hypocotyls.
- The biosynthesis of tropane alkaloids such as hyoscyamine and scopolamine in plants of the Solanaceae is very tissue-specific and occurs only in the roots. Later on the alkaloids are transported to the aerial parts, especially the leaves, where they are finally accumulated. In hairy roots however this translocation cannot occur and part of the produced alkaloids are released in the medium. This release can be stimulated by the addition of millimolar amounts of CdCl2 to the medium (Furze et al. (1991) Plant Cell Rep. 10, 111 and Pitta-Alvarez et al. (2000) Enzyme. Microb. Technol. 26, 252). This indicates the existence of active detoxifying mechanisms against cadmium in which also the tropane alkaloids would be involved. We applied this knowledge to isolate an alkaloid specific PDR-like gene from Hyoscyamus muticus hairy roots.
A cDNA clone of a PDR-like gene is isolated from H. muticus and is designated HmPDR1. To this end total RNA was prepared from hairy roots of the H. muticus KB7 line (Jouhikainen et al. (1999) Planta 208, 545) treated for 30 hours with 1 mM CdCl2 and was reverse transcribed with the Superscript RTII reverse transcriptase. A nested PCR was subsequently carried out with the Taq DNA polymerase using the DNA-RNA hybrid as the template and two sets of degenerate primers designed from highly conserved amino acid sequences in the nucleotide binding folds of known yeast and plant PDR proteins (see Table 3). This PCR yields two fragments derived from the two nucleotide-binding folds which are naturally present in the general tandem repeat structure of ABC proteins. Using specific primers and RT-PCR, 5'RACE and 3'RACE techniques we cloned a full-length CDNA clone, which is designated HmPDR1. The nucleotide sequence of the HmPDR1 CDNA clone is depicted in SEQ ID NO: 1, the amino acid sequence of the HmPDR1 protein is depicted in SEQ ID NO: 2. To confirm the postulated relationship between the expression of ABC transporter genes and the CdCl2 induced release of alkaloids we performed an expression analysis of the HmPDR1 gene in CdCl2 treated Hyoscyamus hairy roots (Table 3. Degenerate primers used for HmPDR1 cDNA cloning Primer Sequence ALGG39 5'-CCIRGYKCIGGIAARACNAC-3' ALGG40 5'-ACICKYTTYTTYTGNCCNCC-3' ALGG41 5'-TCNARNCC-3' ALGG42 5'-GGIGTIYTIACIGCNYTNATGGG-3' ALGG43 5'-TCNARCATCCAIGTIGCNGGRTT-3' ALGG44 5'-CKCCARTA-3' Fig. 3 ). Quantitative RT-PCR clearly showed that HmPDR1 is upregulated by CdCl2 elicitation. - The AtPDR1 gene was subcloned in a yeast expression vector (YCp50) between the 5' and 3' regulatory sequences of the yeast PDR5 gene. This plasmid was then introduced in the yeast AD3 strain (the pdr5 mutant, see example 1). To analyze the substrate specificity of this plant PDR gene we controlled growth performance of the transformed yeast strains on YPD plates containing the different TAs and NAs as described in example 1. We have shown that the PDR1 gene of A. thaliana was able to restore the growth of the pdr5 mutant strain on hyoscyamine and nicotine.
- The AtPDR1 gene was transferred to the binary vector pK7WGD2 as described in example 3.1. BY-2 suspension cultured cells were transformed as described in example 3.2. Control of expression of AtPDR1 is performed by northern blot analysis using a specific DNA probe. To assess tolerance to nicotine and hyoscyamine in transgenic cell lines the same assays as described in example 3.3 were performed in order to evaluate the functionality of AtPDR1p. Transgenic BY-2 cells showed enhanced tolerance to alkaloids as compared to the control GUS expressing line. However, not to the extent of the ScPDR5-W303 expressing line but comparable to the tolerance levels obtained in the ScPDR5-US50 line.
- For the analysis of nicotinic alkaloid accumulation 6-days old recombinant BY-2 cell cultures (pK7WGD2-AtPDR1 en pK7WGD2-GUS) are washed and diluted ten-fold with fresh hormone free MSST medium. After a recuperation period of 12 hours, the cells are treated with methyl jasmonate (MeJA). MeJA is dissolved in dimethyl sulfoxide (DMSO) and added to the culture medium at a final concentration of 50 µM. As a control, cells treated with an equivalent amount of DMSO are included. For alkaloid analysis the same process is followed as in example 3.4.
-
- <110> VLAAMS INTERUNIVERSITAIR INSTITUUT VOOR BIOTECHNOLOGIE VZW
- <120> THE USE OF GENES ENCODING MEMBRANE TRANSPORTER PUMPS TO STIMULATE THE PRO DUCTION OF SECONDARY METABOLITES IN BIOLOGICAL CELLS
- <130> DI/ABC/V082
- <150>
EP01201407.2
<151> 2001-04-18 - <160> 15
- <170> PatentIn version 3.1
- <210> 1
<211> 4571
<212> DNA
<213> Hyoscyamus muticus - <220>
<221> CDS
<222> (133)..(4407)
<223> - <400> 1
- <210> 2
<211> 1425
<212> PRT
<213> Hyoscyamus muticus - <400> 2
- <210> 3
<211> 40
<212> DNA
<213> Artificial Sequence - <220>
<223> forward primer in example 3.1 - <400> 3
aaaaagcagg ctaccatgcc cgaggccaag cttaacaata 40 - <210> 4
<211> 40
<212> DNA
<213> Artificial Sequence - <220>
<223> reverse primer of example 3.1 - <400> 4
agaaagctgg gtccatcttg gtaagtttct tttcttaacc 40 - <210> 5
<211> 37
<212> PRT
<213> Ipomoea batatas - <300>
<301> Matsuoka and Nakamura
<302> Propeptide of a precursor to a plant vacuolar protein required for vacuol ar targeting
<303> Proc. Natl. Acad. Sci. USA
<304> 88
<305> 3
<306> 834-8
<307> 1991-02-01
<308> PMID: 1992474
<309> 1991-02-01
<313> (1) .. (37) - <400> 5
- <210> 6
<211> 12
<212> PRT
<213> Nicotiana tabacum - <300>
<301> Neuhaus, J.M.; Sticher, L.; Meins, F. and Boller, T.
<302> A short C-terminal sequence is necessary and sufficient for the targeting of chitinases to the plant vacuole
<303> Proc. Natl. Acad. Sci. USA
<304> 88
<305> 22
<306> 10362-10366
<307> 1991-11-15
<308> PMID: 1946457
<309> 1991-11-25
<313> (318)..(329) - <400> 6
- <210> 7
<211> 34
<212> DNA
<213> Artificial Sequence - <220>
<223> forward primer in example 5.1 - <400> 7
aaaaagcagg ctaccatgga gacgttatcg agaa 434
<210> 8
<211> 34
<212> DNA
<213> Artificial Sequence - <220>
<223> reverse primer in example 5.1 - <400> 8
agaaagctgg gtctatcgtt gttggaagtt gagc 434 - <210> 9
<211> 12789
<212> DNA
<213> Artificial Sequence - <220>
<223> vector pK7WG2D - <220>
<221> misc feature
<222> (4772)..(4772)
<223> n can be any base - <400> 9
- <210> 10
<211> 20
<212> DNA
<213> Artificial Sequence - <220>
<223> degenerate primer ALGG39 - <220>
<221> mise feature
<222> (3)..(3)
<223> Inosine - <220>
<221> mise feature
<222> (9). (9)
<223> Inosine - <220>
<221> misc feature
<222> (11)..(11)
<223> Inosine - <220>
<221> misc_feature
<222> (15)..(15)
<223> g or a - <220>
<221> misc feature
<222> (18)..(18)
<223> any base - <400> 10
ccargykcag gaaaracnac 20 - <210> 11
<211> 20
<212> DNA
<213> Artificial Sequence - <220>
<223> degenerate primer ALGG40 - <220>
<221> misc feature
<222> (3)..(3)
<223> Inosine - <220>
<221> misc_feature
<222> (15)..(15)
<223> any base - <220>
<221> misc_feature
<222> (18)..(18)
<223> any base - <400> 11
acackyttyt tytgnccncc 20 - <210> 12
<211> 8
<212> DNA
<213> Artificial Sequence - <220>
<223> degenerate primer ALGG41 - <220>
<221> misc_feature
<222> (6)..(6)
<223> any base - <220>
<221> misc_feature
<222> (5)..(5)
<223> g or a - <220>
<221> misc_feature
<222> (3)..(3)
<223> any base - <400> 12
tcnarncc 8 - <210> 13
<211> 23
<212> DNA
<213> Artificial Sequence - <220>
<223> degenerate primer ALGG42 - <220>
<221> misc feature
<222> (3)..(3)
<223> Inosine - <220>
<221> misc_feature
<222> (6)..(6)
<223> Inosine - <220>
<221> misc_feature
<222> (9). (9)
<223> Inosine - <220>
<221> misc_feature
<222> (12)..(12)
<223> Inosine - <220>
<221> misc_feature
<222> (15)..(15)
<223> any base - <220>
<221> misc_feature
<222> (18)..(18)
<223> any base - <400> 13
ggagtaytaa cagcnytnat ggg 23 - <210> 14
<211> 23
<212> DNA
<213> Artificial Sequence - <220>
<223> degenerate primer ALGG43 - <220>
<221> misc_feature
<222> (3)..(3)
<223> any base - <220>
<221> misc_feature
<222> (18)..(18)
<223> any base - <220>
<221> misc_feature
<222> (5)..(5)
<223> g or a - <220>
<221> misc_feature
<222> (21)..(21)
<223> g or a - <220>
<221> misc_feature
<222> (12)..(12)
<223> Inosine - <220>
<221> misc_feature
<222> (15) .. (15)
<223> Inosine - <400> 14
tcnarcatcc aagtagcngg rtt 23 - <210> 15
<211> 8
<212> DNA
<213> Artificial Sequence - <220>
<223> degenerate primer ALGG44 - <220>
<221> misc_feature
<222> (6)..(6)
<223> g or a - - <400> 15
ckccarta 8
Claims (8)
- Use of an expression cassette comprising a pleiotropic drug resistance (PDR) gene encoding an ATP-binding cassette (ABC) transporter to induce, stimulate or to enhance the production or the secretion of at least one secondary metabolite produced in plant cells comprising:- transforming said plant cells with an expression vector comprising said expression cassette,- selecting transformed plant cells with an induced or enhanced production or secretion of at least one secondary metabolite, and- propagating such selected transformed cells.
- Use of an expression cassette according to claim 1 wherein the induction or enhancement of the production of at least one secondary metabolite by plant cells results from enhancing the transport of said metabolite into the vacuole.
- Use according to claims 1-2 wherein said secondary metabolites are alkaloids.
- Use according to claims 1-2 wherein said PDR gene is derived from plants, fungal or mammalian cells.
- A transgenic plant, the cells, seeds and progeny thereof transformed with an expression vector comprising an expression cassette according to claim 1 and-which have an enhanced production or secretion of an at least one secondary metabolite produced by said plant or the cells, seeds or progeny thereof.
- A transgenic plant according to claim 5 further characterized in having an increased vacuolar localisation of said secondary metabolite.
- A transgenic plant cell culture comprising the cells according to claim 5.
- A transgenic plant cell culture according to claim 7 further characterized in (1) having an increased vacuolar localisation of said secondary metabolite, or (2) having a secretion or an increased secretion of said secondary metabolite.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP02730178A EP1379668B1 (en) | 2001-04-18 | 2002-04-18 | The use of genes encoding abc transporters to stimulate the production of secondary metabolites in biological cells |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP01201407 | 2001-04-18 | ||
| EP01201407 | 2001-04-18 | ||
| PCT/EP2002/004322 WO2002083888A2 (en) | 2001-04-18 | 2002-04-18 | The use of genes encoding abc transporters to stimulate the production of secondary metabolites in biological cells |
| EP02730178A EP1379668B1 (en) | 2001-04-18 | 2002-04-18 | The use of genes encoding abc transporters to stimulate the production of secondary metabolites in biological cells |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| EP1379668A2 EP1379668A2 (en) | 2004-01-14 |
| EP1379668B1 true EP1379668B1 (en) | 2009-08-19 |
Family
ID=8180171
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP02730178A Expired - Lifetime EP1379668B1 (en) | 2001-04-18 | 2002-04-18 | The use of genes encoding abc transporters to stimulate the production of secondary metabolites in biological cells |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US7622634B2 (en) |
| EP (1) | EP1379668B1 (en) |
| JP (1) | JP2004529645A (en) |
| AT (1) | ATE440144T1 (en) |
| AU (1) | AU2002302547B2 (en) |
| CA (1) | CA2444482A1 (en) |
| DE (1) | DE60233395D1 (en) |
| WO (1) | WO2002083888A2 (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102754594A (en) * | 2011-04-28 | 2012-10-31 | 张宗申 | Preparation and cultivation method of hairy roots of tongkat ali |
| CN102754595A (en) * | 2011-04-28 | 2012-10-31 | 张宗申 | Huperzia serrata hairy root system preparation and cultivation method |
Families Citing this family (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IL155588A0 (en) * | 2003-04-27 | 2003-11-23 | Metabogal Ltd | Methods for expression of enzymatically active recombinant lysosomal enzymes in transgenic plant root cells and vectors used thereby |
| US20050032211A1 (en) * | 1996-09-26 | 2005-02-10 | Metabogal Ltd. | Cell/tissue culturing device, system and method |
| DE60233395D1 (en) | 2001-04-18 | 2009-10-01 | Valtion Teknillinen | THE USE OF ABC TRANSPORTER ENCODING GENES TO STIMULATE THE PREPARATION OF SECONDARY METABOLITES IN BIOLOGICAL CELLS |
| US7951557B2 (en) | 2003-04-27 | 2011-05-31 | Protalix Ltd. | Human lysosomal proteins from plant cell culture |
| NZ542933A (en) * | 2003-05-05 | 2009-08-28 | Dow Agrosciences Llc | Stable immunoprophylactic and therapeutic compositions derived from transgenic plant cells and methods for production |
| WO2005014826A1 (en) * | 2003-07-24 | 2005-02-17 | Universite Catholique De Louvain | Use of npabc1 transporter and promoter thereof |
| DE102006004829A1 (en) * | 2006-01-31 | 2007-08-09 | Institut für Gemüse- und Zierpflanzenbau e.V. | Obtaining Glucosinolates from Capparales Exudates |
| EP2086322B1 (en) * | 2006-10-12 | 2010-12-01 | Vib Vzw | Non-steroidal brassinosteroid mimetic |
| EP2150608B1 (en) | 2007-05-07 | 2017-11-29 | Protalix Ltd. | Large scale disposable bioreactor |
| GB0807619D0 (en) | 2008-04-28 | 2008-06-04 | Whitton Peter A | Production of bio fuels from plant tissue culture sources |
| US9550815B2 (en) | 2012-01-23 | 2017-01-24 | University Of British Columbia | ABC terpenoid transporters and methods of using the same |
| US20150173319A1 (en) * | 2013-12-06 | 2015-06-25 | Altria Client Services Inc. | Tobacco plants having altered amounts of one or more alkaloids in leaf and methods of using such plants |
| US9518304B2 (en) * | 2014-05-28 | 2016-12-13 | Tyton Biosciences, Llc | Nicotine resistant microorganisms |
| BR112021024125A2 (en) | 2019-06-24 | 2022-03-22 | Philip Morris Products Sa | Compositions and methods for parasite control |
Family Cites Families (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5552307A (en) | 1988-08-24 | 1996-09-03 | Bar-Ilan University | Method of using an elicitor to increase production of metabolites in biological cells |
| ES2235150T3 (en) | 1990-06-15 | 2005-07-01 | Syngenta Participations Ag | NEW SIGNAL SEQUENCES. |
| US5239044A (en) | 1990-06-26 | 1993-08-24 | Imperial Chemical Industries, Plc | Preparation of polyarylenesulfone from bis(chloroaryl) sulfone, dihydric phenol and difluorodiphenylsulfone |
| US5599977A (en) | 1995-06-02 | 1997-02-04 | Kiely; Donald E. | Oxidation process |
| FR2742755B1 (en) | 1995-12-21 | 1998-02-20 | Roquette Freres | IMPROVED SUGAR OXIDATION PROCESS |
| JP2001504700A (en) * | 1996-11-18 | 2001-04-10 | ザ・トラステイーズ・オブ・ザ・ユニバーシテイ・オブ・ペンシルベニア | Glutathione-S-conjugate transport in plants |
| EP0973869B1 (en) | 1997-02-19 | 2004-01-28 | Phytobiotech Inc. | Method for increasing the growth of plant cell cultures |
| AU8919098A (en) | 1997-08-26 | 1999-03-16 | North Carolina State University | Fumonosin resistance |
| WO2000018886A1 (en) | 1998-09-25 | 2000-04-06 | Wisconsin Alumni Research Foundation | Xenobiotic detoxification gene from plants |
| US6049004A (en) | 1998-12-11 | 2000-04-11 | Kiely; Donald E. | Nitric acid removal from oxidation products |
| NZ513356A (en) | 1999-02-05 | 2004-01-30 | Univ Leiden | Method of modulating metabolite biosynthesis in recombinant cells using an AP2-domain transcription factor that is involved in the response of a plant cell to a jasmonate |
| DE19934719A1 (en) * | 1999-07-23 | 2001-01-25 | Inst Genomic Res Tigr Rockvill | New DNA encoding ABC transporters, useful e.g. for promoting growth of plants, particularly legumes on soil polluted with xenobiotics which are normally harmful to the plants |
| DE60233395D1 (en) | 2001-04-18 | 2009-10-01 | Valtion Teknillinen | THE USE OF ABC TRANSPORTER ENCODING GENES TO STIMULATE THE PREPARATION OF SECONDARY METABOLITES IN BIOLOGICAL CELLS |
-
2002
- 2002-04-18 DE DE60233395T patent/DE60233395D1/en not_active Expired - Lifetime
- 2002-04-18 AT AT02730178T patent/ATE440144T1/en not_active IP Right Cessation
- 2002-04-18 EP EP02730178A patent/EP1379668B1/en not_active Expired - Lifetime
- 2002-04-18 CA CA002444482A patent/CA2444482A1/en not_active Abandoned
- 2002-04-18 WO PCT/EP2002/004322 patent/WO2002083888A2/en not_active Ceased
- 2002-04-18 AU AU2002302547A patent/AU2002302547B2/en not_active Ceased
- 2002-04-18 JP JP2002582227A patent/JP2004529645A/en active Pending
-
2003
- 2003-09-18 US US10/666,778 patent/US7622634B2/en not_active Expired - Fee Related
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102754594A (en) * | 2011-04-28 | 2012-10-31 | 张宗申 | Preparation and cultivation method of hairy roots of tongkat ali |
| CN102754595A (en) * | 2011-04-28 | 2012-10-31 | 张宗申 | Huperzia serrata hairy root system preparation and cultivation method |
| CN102754594B (en) * | 2011-04-28 | 2014-06-18 | 大连工业大学 | Preparation and cultivation method of hairy roots of tongkat ali |
Also Published As
| Publication number | Publication date |
|---|---|
| US7622634B2 (en) | 2009-11-24 |
| AU2002302547B2 (en) | 2006-04-06 |
| WO2002083888A3 (en) | 2003-03-27 |
| DE60233395D1 (en) | 2009-10-01 |
| WO2002083888A2 (en) | 2002-10-24 |
| EP1379668A2 (en) | 2004-01-14 |
| US20040064849A1 (en) | 2004-04-01 |
| ATE440144T1 (en) | 2009-09-15 |
| JP2004529645A (en) | 2004-09-30 |
| CA2444482A1 (en) | 2002-10-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2002302547B2 (en) | The use of genes encoding abc transporters to stimulate the production of secondary metabolites in biological cells | |
| CN102171344B (en) | Nucleic acid sequences encoding transcription factors regulating alkaloid synthesis and their use in improving plant metabolism | |
| AU2002302547A1 (en) | The use of genes encoding abc transporters to stimulate the production of secondary metabolites in biological cells | |
| EP1539968B1 (en) | Plastid genetic engineering via somatic embryogenesis | |
| US6455672B1 (en) | Scarecrow gene, promoter and uses thereof | |
| JP2002535993A (en) | Methods for modulating biosynthesis of metabolites in recombinant cells | |
| US20210238620A1 (en) | Tonoplast proton/sugar antiporter proteins and the use thereof to increase the saccharose concentration in a saccharose storage organ of plants | |
| Mathew et al. | SUPER STARCHY1/ONAC025 participates in rice grain filling | |
| CN1912125B (en) | Stress-inducible promoter from rice | |
| CA2668651C (en) | Activation of the arabidopsis hypertall (hyt1/yucca6) locus affects several auxin mediated responses | |
| EP1506300A2 (en) | Genes and uses thereof to modulate secondary metabolite biosynthesis | |
| US20100170010A1 (en) | Use of genes encoding membrane transporter pumps to stimulate the production of secondary metabolites in biological cells | |
| US20100113273A1 (en) | Antidesiccant | |
| CN105585624A (en) | Artemisia annua L. PDR sub-family transport protein and functional verification method and application thereof | |
| WO2024047057A1 (en) | Means and methods to produce triterpene saponins in eukaryotic cells | |
| KODIERENDEN et al. | SECONDARY METABOLITES IN BIOLOGICAL CELLS | |
| JP7304559B2 (en) | Transgenic plant with enhanced growth and method for producing the same | |
| US7393946B1 (en) | Method of modulating metabolite biosynthesis in recombinant cells | |
| CN110438148A (en) | A method of content of artemisinin in sweet wormwood is improved using AaSPL2 gene | |
| KR101360542B1 (en) | RICE OsSERK1 GENE AND TRANSGENIC RICE TRANSFORMED WITH THE SAME | |
| KR100628023B1 (en) | Recombinant surface antigen protein of spore body of coccidium protozoa and coccidial vaccine comprising the same | |
| Mmereke et al. | Preference of Agrobacterium rhizogenes Mediated Transformation of Angiosperms | |
| Ovadis et al. | Transformation of tobacco and aspen plants with the ita locus of an IncQ plasmid confers resistance to Agrobacterium tumefaciens infection | |
| WO2005106001A1 (en) | Methods and compositions for plant transformation | |
| Häkkinen | A functional genomics approach to the study of alkaloid biosynthesis and metabolism in Nicotiana tabacum and Hyoscyamus muticus cell cultures |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20030903 |
|
| AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE TR |
|
| AX | Request for extension of the european patent |
Extension state: AL LT LV MK RO SI |
|
| RAP1 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: VTT BIOTECHNOLOGY Owner name: VLAAMS INTERUNIVERSITAIR INSTITUUT VOOR BIOTECHNOL |
|
| 17Q | First examination report despatched |
Effective date: 20050228 |
|
| RIN1 | Information on inventor provided before grant (corrected) |
Inventor name: LAAKSO, INTO, JOHANNES Inventor name: OKSMAN-CALDENTEY, KIRSI-MARJA Inventor name: INZE, DIRK, GUSTAAF Inventor name: GOOSSENS, ALAIN |
|
| RAP1 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: VTT TECHNICAL RESEARCH CENTRE OF FINLAND Owner name: VLAAMS INTERUNIVERSITAIR INSTITUUT VOORBIOTECHNOLO |
|
| 17Q | First examination report despatched |
Effective date: 20050228 |
|
| 17Q | First examination report despatched |
Effective date: 20050228 |
|
| RAP1 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: VALTION TEKNILLINEN TUTKIMUSKESKUS Owner name: VLAAMS INTERUNIVERSITAIR INSTITUUT VOOR BIOTECHNOL |
|
| GRAP | Despatch of communication of intention to grant a patent |
Free format text: ORIGINAL CODE: EPIDOSNIGR1 |
|
| GRAS | Grant fee paid |
Free format text: ORIGINAL CODE: EPIDOSNIGR3 |
|
| GRAA | (expected) grant |
Free format text: ORIGINAL CODE: 0009210 |
|
| AK | Designated contracting states |
Kind code of ref document: B1 Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE TR |
|
| REG | Reference to a national code |
Ref country code: GB Ref legal event code: FG4D |
|
| REG | Reference to a national code |
Ref country code: CH Ref legal event code: EP |
|
| REG | Reference to a national code |
Ref country code: IE Ref legal event code: FG4D |
|
| REF | Corresponds to: |
Ref document number: 60233395 Country of ref document: DE Date of ref document: 20091001 Kind code of ref document: P |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: SE Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20090819 Ref country code: AT Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20090819 Ref country code: ES Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20091130 Ref country code: FI Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20090819 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: CY Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20090819 Ref country code: PT Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20091221 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: DK Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20090819 |
|
| PLBE | No opposition filed within time limit |
Free format text: ORIGINAL CODE: 0009261 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: NO OPPOSITION FILED WITHIN TIME LIMIT |
|
| 26N | No opposition filed |
Effective date: 20100520 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: GR Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20091120 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: MC Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20100430 |
|
| REG | Reference to a national code |
Ref country code: CH Ref legal event code: PL |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: LI Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20100430 Ref country code: CH Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20100430 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: IT Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20090819 |
|
| PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: LU Payment date: 20110429 Year of fee payment: 10 |
|
| PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: FR Payment date: 20110510 Year of fee payment: 10 Ref country code: IE Payment date: 20110426 Year of fee payment: 10 Ref country code: DE Payment date: 20110421 Year of fee payment: 10 |
|
| PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: GB Payment date: 20110421 Year of fee payment: 10 Ref country code: BE Payment date: 20110414 Year of fee payment: 10 Ref country code: NL Payment date: 20110426 Year of fee payment: 10 |
|
| BERE | Be: lapsed |
Owner name: VLAAMS INTERUNIVERSITAIR INSTITUUT VOOR BIOTECHNO Effective date: 20120430 Owner name: VALTION TEKNILLINEN TUTKIMUSKESKUS Effective date: 20120430 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: TR Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20090819 |
|
| REG | Reference to a national code |
Ref country code: NL Ref legal event code: V1 Effective date: 20121101 |
|
| GBPC | Gb: european patent ceased through non-payment of renewal fee |
Effective date: 20120418 |
|
| REG | Reference to a national code |
Ref country code: IE Ref legal event code: MM4A |
|
| REG | Reference to a national code |
Ref country code: FR Ref legal event code: ST Effective date: 20121228 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: BE Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120430 Ref country code: GB Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120418 Ref country code: IE Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120418 |
|
| REG | Reference to a national code |
Ref country code: DE Ref legal event code: R119 Ref document number: 60233395 Country of ref document: DE Effective date: 20121101 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: FR Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120430 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: NL Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20121101 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: LU Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20120418 |
|
| PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: DE Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20121101 |




















