THERAPEUTIC POLYPEPTIDES, NUCLEIC ACIDS ENCODING SAME, AND METHODS OF USE
FIELD OF THE INVENTION
The present invention relates to novel polypeptides having properties related to stimulation of biochemical or physiological responses in a cell, a tissue, an organ or an organism. More particularly, the novel polypeptides are gene products of novel genes, or are specified biologically active fragments or derivatives thereof. Methods of use encompass diagnostic and prognostic assay procedures as well as methods of treating diverse pathological conditions.
BACKGROUND OF THE INVENTION
Eukaryotic cells are characterized by biochemical and physiological processes, which under normal conditions are exquisitely balanced to achieve the preservation and propagation of the cells. When such cells are components of multicellular organisms such as vertebrates or, more particularly, organisms such as mammals, the regulation of the biochemical and physiological processes involves intricate signaling pathways. Frequently, such signaling pathways include constituted of extracellular signaling proteins, cellular receptors that bind the signaling proteins and signal transducing components located within the cells.
Signaling proteins may be classified as endocrine effectors, paracrine effectors or autocrine effectors. Endocrine effectors are signaling molecules secreted by a given organ into the circulatory system, which are then transported to a distant target organ or tissue. The target cells include the receptors for the endocrine effector, and when the endocrine effector binds, a signaling cascade is induced. Paracrine effectors involve secreting cells and receptor cells in close proximity to each other, such as two different classes of cells in the same tissue or organ. One class of cells secretes the paracrine effector, which then reaches the second class of cells, for example by diffusion through the extracellular fluid. The second class of cells contains the receptors for the paracrine effector; binding of the effector results in induction of the signaling cascade that elicits the corresponding biochemical or physiological effect. Autocrine effectors are highly analogous to paracrine effectors, except that the same cell type that secretes the autocrine effector also contains the receptor. Thus the autocrine
effector binds to receptors on the same cell, or on identical neighboring cells. The binding process then elicits the characteristic biochemical or physiological effect.
Signaling processes may elicit a variety of effects on cells and tissues including by way of nonlimiting example, induction of cell or tissue proliferation, suppression of growth or proliferation, induction of differentiation or maturation of a cell or tissue, and suppression of differentiation or maturation of a cell or tissue.
Many pathological conditions involve dysregulation of expression of important effector proteins. In certain classes of pathologies the dysregulation is manifested as diminished or suppressed level of synthesis and secretion of protein effectors. In a clinical setting a subject may be suspected of suffering from a condition brought on by diminished or suppressed levels of a protein effector of interest. Therefore there is a need to assay for the level of the protein effector of interest in a biological sample from such a subject, and to compare the level with that characteristic of a nonpathological condition. There also is a need to provide the protein effector as a product of manufacture. Administration of the effector to a subject in need thereof is useful in treatment of the pathological condition. Accordingly, there is a need for a method of treatment of a pathological condition brought on by a diminished or suppressed levels of the protein effector of interest.
SUMMARY OF THE INVENTION The invention is based in part upon the discovery of isolated polypeptides including amino acid sequences selected from mature forms of the amino acid sequences selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86. The invention also is based in part upon variants of a mature form of the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86, wherein any amino acid in the mature form is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence of the mature form are so changed. In another embodiment, the invention includes the amino acid sequences selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86. In another embodiment, the invention also comprises variants of the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86 wherein any amino acid specified in the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence are so changed. The invention also involves fragments of any of the mature forms of the amino acid sequences selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer
between 1 and 86, or any other amino acid sequence selected from this group. The invention also comprises fragments from these groups in which up to 15% of the residues are changed.
In another embodiment, the invention encompasses polypeptides that are naturally occurring allelic variants of the sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86. These allelic variants include amino acid sequences that are the translations of nucleic acid sequences differing by a single nucleotide from nucleic acid sequences selected from the group consisting of SEQ ID NOS: 2n-l, wherein n is an integer between 1 and 86. The variant polypeptide where any amino acid changed in the chosen sequence is changed to provide a conservative substitution. In another embodiment, the invention comprises a pharmaceutical composition involving a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86 and a pharmaceutically acceptable carrier. In another embodiment, the invention involves a kit, including, in one or more containers, this pharmaceutical composition. In another embodiment, the invention includes the use of a therapeutic in the manufacture of a medicament for treating a syndrome associated with a human disease, the disease being selected from a pathology associated with a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86 wherein said therapeutic is the polypeptide selected from this group. In another embodiment, the invention comprises a method for determining the presence or amount of a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86 in a sample, the method involving providing the sample; introducing the sample to an antibody that binds immunospecifically to the polypeptide; and determining the presence or amount of antibody bound to the polypeptide, thereby determining the presence or amount of polypeptide in the sample.
In another embodiment, the invention includes a method for determining the presence of or predisposition to a disease associated with altered levels of a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86 in a first mammalian subject, the method involving measuring the level of expression of the polypeptide in a sample from the first mammalian subject; and comparing the amount of the polypeptide in this sample to the amount of the polypeptide present in a control sample from a second mammalian subject known not to have, or not to be predisposed to, the disease, wherein an alteration in the expression level of the polypeptide in the first
subject as compared to the control sample indicates the presence of or predisposition to the disease.
In another embodiment, the invention involves a method of identifying an agent that binds to a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86, the method including introducing the polypeptide to the agent; and determining whether the agent binds to the polypeptide. The agent could be a cellular receptor or a downstream effector.
In another embodiment, the invention involves a method for identifying a potential therapeutic agent for use in treatment of a pathology, wherein the pathology is related to aberrant expression or aberrant physiological interactions of a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86, the method including providing a cell expressing the polypeptide of the invention and having a property or function ascribable to the polypeptide; contacting the cell with a composition comprising a candidate substance; and determining whether the substance alters the property or function ascribable to the polypeptide; whereby, if an alteration observed in the presence of the substance is not observed when the cell is contacted with a composition devoid of the substance, the substance is identified as a potential therapeutic agent.
In another embodiment, the invention involves a method for screening for a modulator of activity or of latency or predisposition to a pathology associated with a polypeptide having an amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86, the method including administering a test compound to a test animal at increased risk for a pathology associated with the polypeptide of the invention, wherein the test animal recombinantly expresses the polypeptide of the invention; measuring the activity of the polypeptide in the test animal after administering the test compound; and comparing the activity of the protein in the test animal with the activity of the polypeptide in a control animal not administered the polypeptide, wherein a change in the activity of the polypeptide in the test animal relative to the control animal indicates the test compound is a modulator of latency of, or predisposition to, a pathology associated with the polypeptide of the invention. The recombinant test animal could express a test protein transgene or express the transgene under the control of a promoter at an increased level relative to a wild-type test animal The promoter may or may not b the native gene promoter of the transgene.
In another embodiment, the invention involves a method for modulating the activity of a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86, the method including introducing a cell sample
expressing the polypeptide with a compound that binds to the polypeptide in an amount sufficient to modulate the activity of the polypeptide.
In another embodiment, the invention involves a method of treating or preventing a pathology associated with a polypeptide with an amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86, the method including administering the polypeptide to a subject in which such treatment or prevention is desired in an amount sufficient to treat or prevent the pathology in the subject. The subject could be human.
In another embodiment, the invention involves a method of treating a pathological state in a mammal, the method including administering to the mammal a polypeptide in an amount that is sufficient to alleviate the pathological state, wherein the polypeptide is a polypeptide having an amino acid sequence at least 95% identical to a polypeptide having the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86 or a biologically active fragment thereof. In another embodiment, the invention involves an isolated nucleic acid molecule comprising a nucleic acid sequence encoding a polypeptide having an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO: 2n, wherein n is an integer between 1 and 86; a variant of a mature form of the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86 wherein any amino acid in the mature form of the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence of the mature form are so changed; the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86; a variant of the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86, in which any amino acid specified in the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence are so changed; a nucleic acid fragment encoding at least a portion of a polypeptide comprising the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86 or any variant of the polypeptide wherein any amino acid of the chosen sequence is changed to a different amino acid, provided that no more than 10% of the amino acid residues in the sequence are so changed; and the complement of any of the nucleic acid molecules.
In another embodiment, the invention comprises an isolated nucleic acid molecule having a nucleic acid sequence encoding a polypeptide comprising an amino acid sequence
selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO: 2n, wherein n is an integer between 1 and 86, wherein the nucleic acid molecule comprises the nucleotide sequence of a naturally occurring allelic nucleic acid variant. In another embodiment, the invention involves an isolated nucleic acid molecule including a nucleic acid sequence encoding a polypeptide having an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO: 2n, wherein n is an integer between 1 and 86 that encodes a variant polypeptide, wherein the variant polypeptide has the polypeptide sequence of a naturally occurring polypeptide variant. In another embodiment, the invention comprises an isolated nucleic acid molecule having a nucleic acid sequence encoding a polypeptide comprising an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO: 2n, wherein n is an integer between 1 and 86, wherein the nucleic acid molecule differs by a single nucleotide from a nucleic acid sequence selected from the group consisting of SEQ ID NOS: 2n-l , wherein n is an integer between 1 and 86.
In another embodiment, the invention includes an isolated nucleic acid molecule having a nucleic acid sequence encoding a polypeptide including an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO: 2n, wherein n is an integer between 1 and 86, wherein the nucleic acid molecule comprises a nucleotide sequence selected from the group consisting of the nucleotide sequence selected from the group consisting of SEQ ID NO: 2n-l, wherein n is an integer between 1 and 86; a nucleotide sequence wherein one or more nucleotides in the nucleotide sequence selected from the group consisting of SEQ ID NO: 2n-l, wherein n is an integer between 1 and 86 is changed from that selected from the group consisting of the chosen sequence to a different nucleotide provided that no more than 15% of the nucleotides are so changed; a nucleic acid fragment of the sequence selected from the group consisting of SEQ ID NO: 2n-l, wherein n is an integer between 1 and 86; and a nucleic acid fragment wherein one or more nucleotides in the nucleotide sequence selected from the group consisting of SEQ ID NO: 2n-l, wherein n is an integer between 1 and 86 is changed from that selected from the group consisting of the chosen sequence to a different nucleotide provided that no more than 15% of the nucleotides are so changed.
In another embodiment, the invention includes an isolated nucleic acid molecule having a nucleic acid sequence encoding a polypeptide including an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID
NO: 2n, wherein n is an integer between 1 and 86, wherein the nucleic acid molecule hybridizes under stringent conditions to the nucleotide sequence selected from the group consisting of SEQ ID NO: 2n-l, wherein n is an integer between 1 and 86, or a complement of the nucleotide sequence. In another embodiment, the invention includes an isolated nucleic acid molecule having a nucleic acid sequence encoding a polypeptide including an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO: 2n, wherein n is an integer between 1 and 86, wherein the nucleic acid molecule has a nucleotide sequence in which any nucleotide specified in the coding sequence of the chosen nucleotide sequence is changed from that selected from the group consisting of the chosen sequence to a different nucleotide provided that no more than 15% of the nucleotides in the chosen coding sequence are so changed, an isolated second polynucleotide that is a complement of the first polynucleotide, or a fragment of any of them.
In another embodiment, the invention includes a vector involving the nucleic acid molecule having a nucleic acid sequence encoding a polypeptide including an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO: 2n, wherein n is an integer between 1 and 86. This vector can have a promoter operably linked to the nucleic acid molecule. This vector can be located within a cell. In another embodiment, the invention involves a method for determining the presence or amount of a nucleic acid molecule having a nucleic acid sequence encoding a polypeptide including an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO: 2n, wherein n is an integer between 1 and 86 in a sample, the method including providing the sample; introducing the sample to a probe that binds to the nucleic acid molecule; and determining the presence or amount of the probe bound to the nucleic acid molecule, thereby determining the presence or amount of the nucleic acid molecule in the sample. The presence or amount of the nucleic acid molecule is used as a marker for cell or tissue type. The cell type can be cancerous.
In another embodiment, the invention involves a method for determining the presence of or predisposition for a disease associated with altered levels of a nucleic acid molecule having a nucleic acid sequence encoding a polypeptide including an amino acid sequence selected from the group consisting of a mature form of the amino acid sequence given SEQ ID NO: 2n, wherein n is an integer between 1 and 86 in a first mammalian subject, the method including measuring the amount of the nucleic acid in a sample from the first mammalian
subject; and comparing the amount of the nucleic acid in the sample of step (a) to the amount of the nucleic acid present in a control sample from a second mammalian subject known not to have or not be predisposed to, the disease; wherein an alteration in the level of the nucleic acid in the first subject as compared to the control sample indicates the presence of or predisposition to the disease.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In the case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
Other features and advantages of the invention will be apparent from the following detailed description and claims.
DETAILED DESCRIPTION OF THE INVENTION
The present invention provides novel nucleotides and polypeptides encoded thereby. Included in the invention are the novel nucleic acid sequences, their encoded polypeptides, antibodies, and other related compounds. The sequences are collectively referred to herein as "NOVX nucleic acids" or "NOVX polynucleotides" and the corresponding encoded polypeptides are referred to as "NOVX polypeptides" or "NOVX proteins." Unless indicated otherwise, "NOVX" is meant to refer to any of the novel sequences disclosed herein. Table 1 provides a summary of the NOVX nucleic acids and their encoded polypeptides.
TABLE 1. Sequences and Corresponding SEQ ID Numbers
Table 1 indicates homology of NOVX nucleic acids to known protein families. Thus, the nucleic acids and polypeptides, antibodies and related compounds according to the invention corresponding to a NOVX as identified in column 1 of Table 1 will be useful in therapeutic and diagnostic applications implicated in, for example, pathologies and disorders associated with the known protein families identified in column 5 of Table 1.
NOVX nucleic acids and their encoded polypeptides are useful in a variety of applications and contexts. The various NOVX nucleic acids and polypeptides according to the invention are useful as novel members of the protein families according to the presence of domains and sequence relatedness to previously described proteins. Additionally, NOVX nucleic acids and polypeptides can also be used to identify proteins that are members of the family to which the NOVX polypeptides belong.
Consistent with other known members of the family of proteins, identified in column 5 of Table 1, the NOVX polypeptides of the present invention show homology to, and contain domains that are characteristic of, other members of such protein families. Details of the sequence relatedness and domain analysis for each NOVX are presented in Examples 1-44.
The NOVX nucleic acids and polypeptides can also be used to screen for molecules, which inhibit or enhance NOVX activity or function. Specifically, the nucleic acids and polypeptides according to the invention may be used as targets for the identification of small molecules that modulate or inhibit diseases associated with the protein families listed in Table 1.
The NOVX nucleic acids and polypeptides are also useful for detecting specific cell types. Details of the expression analysis for each NOVX are presented in Example 47. Accordingly, the NOVX nucleic acids, polypeptides, antibodies and related compounds
according to the invention will have diagnostic and therapeutic applications in the detection of a variety of diseases with differential expression in normal vs. diseased tissues, e.g.a variety of cancers.
Additional utilities for NOVX nucleic acids and polypeptides according to the invention are disclosed herein.
NOVX clones
NOVX nucleic acids and their encoded polypeptides are useful in a variety of applications and contexts. The various NOVX nucleic acids and polypeptides according to the invention are useful as novel members of the protein families according to the presence of domains and sequence relatedness to previously described proteins. Additionally, NOVX nucleic acids and polypeptides can also be used to identify proteins that are members of the family to which the NOVX polypeptides belong.
The NOVX genes and their corresponding encoded proteins are useful for preventing, treating or ameliorating medical conditions, e.g., by protein or gene therapy. Pathological conditions can be diagnosed by determining the amount of the new protein in a sample or by determining the presence of mutations in the new genes. Specific uses are described for each of the NOVX genes, based on the tissues in which they are most highly expressed. Uses include developing products for the diagnosis or treatment of a variety of diseases and disorders. The NOVX nucleic acids and proteins of the invention are useful in potential diagnostic and therapeutic applications and as a research tool. These include serving as a specific or selective nucleic acid or protein diagnostic and/or prognostic marker, wherein the presence or amount of the nucleic acid or the protein are to be assessed, as well as potential therapeutic applications such as the following: (i) a protein therapeutic, (ii) a small molecule drug target, (iii) an antibody target (therapeutic, diagnostic, drug' targeting/cyto toxic antibody), (iv) a nucleic acid useful in gene therapy (gene delivery/gene ablation), and (v) a composition promoting tissue regeneration in vitro and in vivo (vi) biological defense weapon.
In one specific embodiment, the invention includes an isolated polypeptide comprising an amino acid sequence selected from the group consisting of: (a) a mature form of the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86; (b) a variant of a mature form of the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86, wherein any amino acid in the mature form is changed to a different amino acid, provided that no more
than 15% of the amino acid residues in the sequence of the mature form are so changed; (c) an amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86; (d) a variant of the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86 wherein any amino acid specified in the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence are so changed; and (e) a fragment of any of (a) through (d).
In another specific embodiment, the invention includes an isolated nucleic acid molecule comprising a nucleic acid sequence encoding a polypeptide comprising an amino acid sequence selected from the group consisting of: (a) a mature form of the amino acid sequence given SEQ ID NO: 2n, wherein n is an integer between 1 and 86; (b) a variant of a mature form of the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86 wherein any amino acid in the mature form of the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence of the mature form are so changed; (c) the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86; (d) a variant of the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86, in which any amino acid specified in the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence are so changed; (e) a nucleic acid fragment encoding at least a portion of a polypeptide comprising the amino acid sequence selected from the group consisting of SEQ ID NO: 2n, wherein n is an integer between 1 and 86 or any variant of said polypeptide wherein any amino acid of the chosen sequence is changed to a different amino acid, provided that no more than 10% of the amino acid residues in the sequence are so changed; and (f) the complement of any of said nucleic acid molecules. In yet another specific embodiment, the invention includes an isolated nucleic acid molecule, wherein said nucleic acid molecule comprises a nucleotide sequence selected from the group consisting of: (a) the nucleotide sequence selected from the group consisting of SEQ ID NO: 2n-l, wherein n is an integer between 1 and 86; (b) a nucleotide sequence wherein one or more nucleotides in the nucleotide sequence selected from the group consisting of SEQ ID NO: 2n-l, wherein n is an integer between 1 and 86 is changed from that selected from the group consisting of the chosen sequence to a different nucleotide provided that no more than 15% of the nucleotides are so changed; (c) a nucleic acid fragment of the sequence selected from the group consisting of SEQ ID NO: 2n-l, wherein n is an integer between 1
and 86; and (d) a nucleic acid fragment wherein one or more nucleotides in the nucleotide sequence selected from the group consisting of SEQ ID NO: 2n-l, wherein n is an integer between 1 and 86 is changed from that selected from the group consisting of the chosen sequence to a different nucleotide provided that no more than 15% of the nucleotides are so changed.
NOVX Nucleic Acids and Polypeptides
One aspect of the invention pertains to isolated nucleic acid molecules that encode NOVX polypeptides or biologically active portions thereof. Also included in the invention are nucleic acid fragments sufficient for use as hybridization probes to identify NOVX-encoding nucleic acids (e.g., NOVX mRNAs) and fragments for use as PCR primers for the amplification and/or mutation of NOVX nucleic acid molecules. As used herein, the term "nucleic acid molecule" is intended to include DNA molecules (e.g., cDNA or genomic DNA), RNA molecules (e.g., mRNA), analogs of the DNA or RNA generated using nucleotide analogs, and derivatives, fragments and homologs thereof. The nucleic acid molecule may be single-stranded or double-stranded, but preferably is comprised double- stranded DNA.
A NOVX nucleic acid can encode a mature NOVX polypeptide. As used herein, a "mature" form of a polypeptide or protein disclosed in the present invention is the product of a naturally occurring polypeptide, precursor form, or proprotein. The naturally occurring polypeptide, precursor or proprotein includes, by way of nonlimiting example, the full-length gene product encoded by the corresponding gene. Alternatively, it may be defined as the polypeptide, precursor or proprotein encoded by an ORF described herein. The product "mature" form arises, by way of nonlimiting example, as a result of one or more naturally occurring processing steps that may take place within the cell (host cell) in which the gene product arises. Examples of such processing steps leading to a "mature" form of a polypeptide or protein include the cleavage of the N-terminal methionine residue encoded by the initiation codon of an ORF or the proteolytic cleavage of a signal peptide or leader sequence. Thus a mature form arising from a precursor polypeptide or protein that has residues 1 to N, where residue 1 is the N-terminal methionine, would have residues 2 through N remaining after removal of the N-terminal methionine. Alternatively, a mature form arising from a precursor polypeptide or protein having residues 1 to N, in which an N-terminal signal sequence from residue 1 to residue M is cleaved, would have the residues from residue M+l to residue N remaining. Further as used herein, a "mature" form of a polypeptide or protein may arise from
a post-translational modification other than a proteolytic cleavage event. Such additional processes include, by way of non-limiting example, glycosylation, myristoylation or phosphorylation. In general, a mature polypeptide or protein may result from the operation of only one of these processes, or a combination of any of them. The term "probe", as utilized herein, refers to nucleic acid sequences of variable length, preferably between at least about 10 nucleotides (nt), and 100 nt, or as many as approximately, e.g., 6,000 nt, depending upon the specific use. Probes are used in the detection of identical, similar, or complementary nucleic acid sequences. Longer length probes are generally obtained from a natural or recombinant source, are highly specific, and much slower to hybridize than shorter-length oligomer probes. Probes may be single- or double-stranded and designed to have specificity in PCR, membrane-based hybridization technologies, or ELISA-like technologies.
The term "isolated" nucleic acid molecule, as used herein, is a nucleic acid which is separated from other nucleic acid molecules which are present in the natural source of the nucleic acid. Preferably, an "isolated" nucleic acid is free of sequences which naturally flank the nucleic acid (i.e., sequences located at the 5'- and 3'-termini of the nucleic acid) in the genomic DNA of the organism from which the nucleic acid is derived. For example, in various embodiments, the isolated NOVX nucleic acid molecules can contain less than about 5 kb, 4 kb, 3 kb, 2 kb, 1 kb, 0.5 kb, 0.1 kb, or less of nucleotide sequences which naturally flank the nucleic acid molecule in genomic DNA of the cell/tissue from which the nucleic acid is derived (e.g., brain, heart, liver, spleen, etc.). Moreover, an "isolated" nucleic acid molecule, such as a cDNA molecule, can be substantially free of other cellular material, culture medium, or of chemical precursors or other chemicals.
A nucleic acid molecule of the invention, e.g., a nucleic acid molecule having the nucleotide sequence SEQ ID NOS: 2n-l, wherein n is an integer between 1 and 86, or a complement of this nucleotide sequence, can be isolated using standard molecular biology techniques and the sequence information provided herein. Using all or a portion of the nucleic acid sequence of SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, as a hybridization probe, NOVX molecules can be isolated using standard hybridization and cloning techniques (e.g., as described in Sambrook, et al., (eds.), MOLECULAR CLONING: A LABORATORY MANUAL 2nd Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989; and Ausubel, et al., (eds.), CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, New York, NY, 1993).
A nucleic acid of the invention can be amplified using cDNA, mRNA or, alternatively, genomic DNA as a template with appropriate oligonucleotide primers according to standard PCR amplification techniques. The nucleic acid so amplified can be cloned into an appropriate vector and characterized by DNA sequence analysis. Furthermore, oligonucleotides corresponding to NOVX nucleotide sequences can be prepared by standard synthetic techniques, e.g., using an automated DNA synthesizer.
As used herein, the term "oligonucleotide" refers to a series of linked nucleotide residues. A short oligonucleotide sequence may be based on, or designed from, a genomic or cDNA sequence and is used to amplify, confirm, or reveal the presence of an identical, similar or complementary DNA or RNA in a particular cell or tissue. Oligonucleotides comprise a nucleic acid sequence having about 10 nt, 50 nt, or 100 nt in length, preferably about 15 nt to 30 nt in length. In one embodiment of the invention, an oligonucleotide comprising a nucleic acid molecule less than 100 nt in length would further comprise at least 6 contiguous nucleotides of SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, or a complement thereof. Oligonucleotides may be chemically synthesized and may also be used as probes.
In another embodiment, an isolated nucleic acid molecule of the invention comprises a nucleic acid molecule that is a complement of the nucleotide sequence shown in SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, or a portion of this nucleotide sequence (e.g., a fragment that can be used as a probe or primer or a fragment encoding a biologically- active portion of A NOVX polypeptide). A nucleic acid molecule that is complementary to the nucleotide sequence shown SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86,is one that is sufficiently complementary to the nucleotide sequence shown SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86,that it can hydrogen bond with few or no mismatches to the nucleotide sequence shown SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, thereby forming a stable duplex.
As used herein, the term "complementary" refers to Watson-Crick or Hoogsteen base pairing between nucleotides units of a nucleic acid molecule, and the term "binding" means the physical or chemical interaction between two polypeptides or compounds or associated polypeptides or compounds or combinations thereof. Binding includes ionic, non-ionic, van der Waals, hydrophobic interactions, and the like. A physical interaction can be either direct or indirect. Indirect interactions may be through or due to the effects of another polypeptide or compound. Direct binding refers to interactions that do not take place through, or due to, the effect of another polypeptide or compound, but instead are without other substantial chemical intermediates.
"Fragments" provided herein are defined as sequences of at least 6 (contiguous) nucleic acids or at least 4 (contiguous) amino acids, a length sufficient to allow for specific hybridization in the case of nucleic acids or for specific recognition of an epitope in the case of amino acids, and are at most some portion less than a full length sequence. Fragments may be derived from any contiguous portion of a nucleic acid or amino acid sequence of choice.
A full-length NOVX clone is identified as containing an ATG translation start codon and an in-frame stop codon. Any disclosed NOVX nucleotide sequence lacking an ATG start codon therefore encodes a truncated C-terminal fragment of the respective NOVX polypeptide, and requires that the corresponding full-length cDNA extend in the 5' direction of the disclosed sequence. Any disclosed NOVX nucleotide sequence lacking an in-frame stop codon similarly encodes a truncated N-terminal fragment of the respective NOVX polypeptide, and requires that the corresponding full-length cDNA extend in the 3' direction of the disclosed sequence.
"Derivatives" are nucleic acid sequences or amino acid sequences formed from the native compounds either directly, by modification, or by partial substitution. "Analogs" are nucleic acid sequences or amino acid sequences that have a structure similar to, but not identical to, the native compound, e.g. they differ from it in respect to certain components or side chains. Analogs may be synthetic or derived from a different evolutionary origin and may have a similar or opposite metabolic activity compared to wild type. Homologs are nucleic acid sequences or amino acid sequences of a particular gene that are derived from different species.
Derivatives and analogs may be full length or other than full length. Derivatives or analogs of the nucleic acids or proteins of the invention include, but are not limited to, molecules comprising regions that are substantially homologous to the nucleic acids or proteins of the invention, in various embodiments, by at least about 70%, 80%, or 95% identity (with a preferred identity of 80-95%) over a nucleic acid or amino acid sequence of identical size or when compared to an aligned sequence in which the alignment is done by a computer homology program known in the art, or whose encoding nucleic acid is capable of hybridizing to the complement of a sequence encoding the proteins of the invention under stringent, moderately stringent, or low stringent conditions. See e.g. Ausubel, et al., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, New York, NY, 1993, and below.
A "homologous nucleic acid sequence" or "homologous amino acid sequence," or variations thereof, refer to sequences characterized by a homology at the nucleotide level or amino acid level as discussed above. Homologous nucleotide sequences include those
sequences coding for isoforms of NOVX polypeptides. Isoforms can be expressed in different tissues of the same organism as a result of, for example, alternative splicing of RNA. Alternatively, isoforms can be encoded by different genes. In the invention, homologous nucleotide sequences include nucleotide sequences encoding for A NOVX polypeptide of species other than humans, including, but not limited to vertebrates, and thus can include, e.g., frog, mouse, rat, rabbit, dog, cat, cow, horse, and other organisms. Homologous nucleotide sequences also include, but are not limited to, naturally occurring allelic variations and mutations of the nucleotide sequences set forth herein. A homologous nucleotide sequence does not, however, include the exact nucleotide sequence encoding a human NOVX protein. Homologous nucleic acid sequences include those nucleic acid sequences that encode conservative amino acid substitutions (see below) in SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, as well as a polypeptide possessing NOVX biological activity. Various biological activities of the NOVX proteins are described below.
A NOVX polypeptide is encoded by the open reading frame ("ORF") of a NOVX nucleic acid. An ORF corresponds to a nucleotide sequence that could potentially be translated into a polypeptide. A stretch of nucleic acids comprising an ORF is uninterrupted by a stop codon. An ORF that represents the coding sequence for a full protein begins with an ATG "start" codon and terminates with one of the three "stop" codons, namely, TAA, TAG, or TGA. For the purposes of this invention, an ORF may be any part of a coding sequence, with or without a start codon, a stop codon, or both. For an ORF to be considered as a good candidate for coding for a bonafide cellular protein, a minimum size requirement is often set, e.g., a stretch of DNA that would encode a protein of 50 amino acids or more.
The nucleotide sequences determined from the cloning of the human NOVX genes allows for the generation of probes and primers designed for use in identifying and/or cloning NOVX homologues in other cell types, e.g. from other tissues, as well as NOVX homologues from other vertebrates. The probe/primer typically comprises a substantially purified oligonucleotide. The oligonucleotide typically comprises a region of nucleotide sequence that hybridizes under stringent conditions to at least about 12, 25, 50, 100, 150, 200, 250, 300, 350 or 400 consecutive sense strand nucleotide sequence of SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86; or an anti-sense strand nucleotide sequence of SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86; or of a naturally occurring mutant of SEQ ID
NOS:2n-l, wherein n is an integer between 1 and 86.
Probes based on the human NOVX nucleotide sequences can be used to detect transcripts or genomic sequences encoding the same or homologous proteins. In various
embodiments, the probe has a detectable label attached, e.g. the label can be a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor. Such probes can be used as a part of a diagnostic test kit for identifying cells or tissues which mis-express A NOVX protein, such as by measuring a level of A NOVX-encoding nucleic acid in a sample of cells from a subject e.g. , detecting NOVX mRNA levels or determining whether a genomic NOVX gene has been mutated or deleted.
"A polypeptide having a biologically-active portion of A NOVX polypeptide" refers to polypeptides exhibiting activity similar, but not necessarily identical, an activity of a polypeptide of the invention, including mature forms, as measured in a particular biological assay, with or without dose dependency. A nucleic acid fragment encoding a "biologically- active portion of NOVX" can be prepared by isolating a portion SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, that encodes a polypeptide having A NOVX biological activity (the biological activities of the NOVX proteins are described below), expressing the encoded portion of NOVX protein (e.g., by recombinant expression in vitro) and assessing the activity of the encoded portion of NOVX.
NOVX Nucleic Acid and Polypeptide Variants
The invention further encompasses nucleic acid molecules that differ from the nucleotide sequences shown in SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, due to degeneracy of the genetic code and thus encode the same NOVX proteins as that encoded by the nucleotide sequences shown in SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86. In another embodiment, an isolated nucleic acid molecule of the invention has a nucleotide sequence encoding a protein having an amino acid sequence shown in SEQ ID NOS:2n, wherein n is an integer between 1 and 86. In addition to the human NOVX nucleotide sequences shown in SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, it will be appreciated by those skilled in the art that DNA sequence polymorphisms that lead to changes in the amino acid sequences of the NOVX polypeptides may exist within a population (e.g., the human population). Such genetic polymorphism in the NOVX genes may exist among individuals within a population due to natural allelic variation. As used herein, the terms "gene" and "recombinant gene" refer to nucleic acid molecules comprising an open reading frame (ORF) encoding A NOVX protein, preferably a vertebrate NOVX protein. Such natural allelic variations can typically result in
1-5% variance in the nucleotide sequence of the NOVX genes. Any and all such nucleotide variations and resulting amino acid polymorphisms in the NOVX polypeptides, which are the
result of natural allelic variation and that do not alter the functional activity of the NOVX polypeptides, are intended to be within the scope of the invention.
Moreover, nucleic acid molecules encoding NOVX proteins from other species, and thus that have a nucleotide sequence that differs from the human SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, are intended to be within the scope of the invention. Nucleic acid molecules corresponding to natural allelic variants and homologues of the NOVX cDNAs of the invention can be isolated based on their homology to the human NOVX nucleic acids disclosed herein using the human cDNAs, or a portion thereof, as a hybridization probe according to standard hybridization techniques under stringent hybridization conditions. Accordingly, in another embodiment, an isolated nucleic acid molecule of the invention is at least 6 nucleotides in length and hybridizes under stringent conditions to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86. In another embodiment, the nucleic acid is at least 10, 25, 50, 100, 250, 500, 750, 1000, 1500, 2000 or more nucleotides in length. In yet another embodiment, an isolated nucleic acid molecule of the invention hybridizes to the coding region. As used herein, the term "hybridizes under stringent conditions" is intended to describe conditions for hybridization and washing under which nucleotide sequences at least about 65% homologous to each other typically remain hybridized to each other.
Homologs (i.e., nucleic acids encoding NOVX proteins derived from species other than human) or other related sequences (e.g., paralogs) can be obtained by low, moderate or high stringency hybridization with all or a portion of the particular human sequence as a probe using methods well known in the art for nucleic acid hybridization and cloning.
As used herein, the phrase "stringent hybridization conditions" refers to conditions under which a probe, primer or oligonucleotide will hybridize to its target sequence, but to no other sequences. Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures than shorter sequences. Generally, stringent conditions are selected to be about 5 °C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength, pH and nucleic acid concentration) at which 50% of the probes complementary to the target sequence hybridize to the target sequence at equilibrium. Since the target sequences are generally present at excess at Tm,
50% of the probes are occupied at equilibrium. Typically, stringent conditions will be those in which the salt concentration is less than about 1.0 M sodium ion, typically about 0.01 to 1.0 M sodium ion (or other salts) at
pH 7.0 to 8.3 and the temperature is at least about 30 °C for short probes, primers or oligonucleotides (e.g., 10 nt to 50 nt) and at least about 60 °C for longer probes, primers and oligonucleotides. Stringent conditions may also be achieved with the addition of destabilizing agents, such as formamide. Stringent conditions are known to those skilled in the art and can be found in Ausubel, et al., (eds.), CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6. Preferably, the conditions are such that sequences at least about 65%, 70%, 75%, 85%, 90%, 95%, 98%, or 99% homologous to each other typically remain hybridized to each other. A non-limiting example of stringent hybridization conditions are hybridization in a high salt buffer comprising 6X SSC, 50 mM Tris-HCl (pH 7.5), 1 mM
EDTA, 0.02% PVP, 0.02% Ficoll, 0.02% BSA, and 500 mg/ml denatured salmon sperm DNA at 65 °C, followed by one or more washes in 0.2X SSC, 0.01% BSA at 50 °C. An isolated nucleic acid molecule of the invention that hybridizes under stringent conditions to the sequences SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, corresponds to a naturally-occurring nucleic acid molecule. As used herein, a "naturally-occurring" nucleic acid molecule refers to an RNA or DNA molecule having a nucleotide sequence that occurs in nature (e.g., encodes a natural protein).
In a second embodiment, a nucleic acid sequence that is hybridizable to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NOS:2n-l , wherein n is an integer between 1 and 86, or fragments, analogs or derivatives thereof, under conditions of moderate stringency is provided. A non-limiting example of moderate stringency hybridization conditions are hybridization in 6X SSC, 5X Denhardt's solution, 0.5% SDS and 100 mg/ml denatured salmon sperm DNA at 55 °C, followed by one or more washes in IX SSC, 0.1% SDS at 37 °C. Other conditions of moderate stringency that may be used are well-known within the art. See, e.g., Ausubel, et al. (eds.), 1993, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, NY, and Kriegler, 1990; GENE TRANSFER AND EXPRESSION, A LABORATORY MANUAL, Stockton Press, NY.
In a third embodiment, a nucleic acid that is hybridizable to the nucleic acid molecule comprising the nucleotide sequences SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, or fragments, analogs or derivatives thereof, under conditions of low stringency, is provided. A non-limiting example of low stringency hybridization conditions are hybridization in 35% formamide, 5X SSC, 50 mM Tris-HCl (pH 7.5), 5 mM EDTA, 0.02% PVP, 0.02% Ficoll, 0.2% BSA, 100 mg/ml denatured salmon sperm DNA, 10% (wt/vol) dextran sulfate at 40 °C, followed by one or more washes in 2X SSC, 25 mM Tris-HCl (pH
7.4), 5 mM EDTA, and 0.1% SDS at 50 °C. Other conditions of low stringency that may be used are well known in the art (e.g., as employed for cross-species hybridizations). See, e.g., Ausubel, et al. (eds.), 1993, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, NY, and Kriegler, 1990, GENE TRANSFER AND EXPRESSION, A LABORATORY MANUAL, Stockton Press, NY; Shilo and Weinberg, 1981. Proc Natl Acad Sci USA 78: 6789-6792.
Conservative Mutations
In addition to naturally-occurring allelic variants of NOVX sequences that may exist in the population, the skilled artisan will further appreciate that changes can be introduced by mutation into the nucleotide sequences SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, thereby leading to changes in the amino acid sequences of the encoded NOVX proteins, without altering the functional ability of the NOVX proteins. For example, nucleotide substitutions leading to amino acid substitutions at "non-essential" amino acid residues can be made in the sequence SEQ ID NOS:2n, wherein n is an integer between 1 and 86. A "non-essential" amino acid residue is a residue that can be altered from the wild-type sequences of the NOVX proteins without altering their biological activity, whereas an "essential" amino acid residue is required for such biological activity. For example, amino acid residues that are conserved among the NOVX proteins of the invention are predicted to be particularly non-amenable to alteration. Amino acids for which conservative substitutions can be made are well known within the art.
Another aspect of the invention pertains to nucleic acid molecules encoding NOVX proteins that contain changes in amino acid residues that are not essential for activity. Such NOVX proteins differ in amino acid sequence from SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, yet retain biological activity. In one embodiment, the isolated nucleic acid molecule comprises a nucleotide sequence encoding a protein, wherein the protein comprises an amino acid sequence at least about 45% homologous to the amino acid sequences SEQ ID NOS:2n, wherein n is an integer between 1 and 86. Preferably, the protein encoded by the nucleic acid molecule is at least about 60% homologous to SEQ ID NOS:2n, wherein n is an integer between 1 and 86; more preferably at least about 70% homologous SEQ ID NOS:2n, wherein n is an integer between 1 and 86; still more preferably at least about
80% homologous to SEQ ID NOS:2n, wherein n is an integer between 1 and 86; even more preferably at least about 90% homologous to SEQ ID NOS:2n, wherein n is an integer between 1 and 86; and most preferably at least about 95% homologous to SEQ ID NOS:2n, wherein n is an integer between 1 and 86.
An isolated nucleic acid molecule encoding A NOVX protein homologous to the protein of SEQ ID NOS:2n, wherein n is an integer between 1 and 86, can be created by introducing one or more nucleotide substitutions, additions or deletions into the nucleotide sequence of SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, such that one or more amino acid substitutions, additions or deletions are introduced into the encoded protein. Mutations can be introduced into SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis. Preferably, conservative amino acid substitutions are made at one or more predicted, non-essential amino acid residues. A "conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined within the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, a predicted non-essential amino acid residue in the NOVX protein is replaced with another amino acid residue from the same side chain family. Alternatively, in another embodiment, mutations can be introduced randomly along all or part of A NOVX coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for NOVX biological activity to identify mutants that retain activity. Following mutagenesis SEQ ID NOS:2n-l , wherein n is an integer between 1 and 86, the encoded protein can be expressed by any recombinant technology known in the art and the activity of the protein can be determined. The relatedness of amino acid families may also be determined based on side chain interactions. Substituted amino acids may be fully conserved "strong" residues or fully conserved "weak" residues. The "strong" group of conserved amino acid residues may be any one of the following groups: STA, NEQK, NHQK, NDEQ, QHRK, MILV, MILF, HY, FYW, wherein the single letter amino acid codes are grouped by those amino acids that may be substituted for each other. Likewise, the "weak" group of conserved residues may be any one of the following: CSA, ATV, SAG, STNK, STPA, SGND, SNDEQK, NDEQHK, NEQHRK,
HFY, wherein the letters within each group represent the single letter amino acid code.
In one embodiment, a mutant NOVX protein can be assayed for (/) the ability to form proteimprotein interactions with other NOVX proteins, other cell-surface proteins, or
biologically-active portions thereof, (ii) complex formation between a mutant NOVX protein and A NOVX ligand; or (iii) the ability of a mutant NOVX protein to bind to an intraceliular target protein or biologically-active portion thereof; (e.g. avidin proteins).
In yet another embodiment, a mutant NOVX protein can be assayed for the ability to regulate a specific biological function (e.g., regulation of insulin release).
Antisense Nucleic Acids
Another aspect of the invention pertains to isolated antisense nucleic acid molecules that are hybridizable to or complementary to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO S:2n-1, wherein n is an integer between 1 and 86, or fragments, analogs or derivatives thereof. An "antisense" nucleic acid comprises a nucleotide sequence that is complementary to a "sense" nucleic acid encoding a protein (e.g., complementary to the coding strand of a double-stranded cDNA molecule or complementary to an mRNA sequence). In specific aspects, antisense nucleic acid molecules are provided that comprise a sequence complementary to at least about 10, 25, 50, 100, 250 or 500 nucleotides or an entire NOVX coding strand, or to only a portion thereof. Nucleic acid molecules encoding fragments, homologs, derivatives and analogs of A NOVX protein of SEQ ID NOS:2n, wherein n is an integer between 1 and 86, or antisense nucleic acids complementary to A NOVX nucleic acid sequence of SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, are additionally provided.
In one embodiment, an antisense nucleic acid molecule is antisense to a "coding region" of the coding strand of a nucleotide sequence encoding A NOVX protein. The term "coding region" refers to the region of the nucleotide sequence comprising codons, which are translated into amino acid residues. In another embodiment, the antisense nucleic acid molecule is antisense to a "noncoding region" of the coding strand of a nucleotide sequence encoding the NOVX protein. The term "noncoding region" refers to 5' and 3' sequences, which flank the coding region that are not translated into amino acids (i.e., also referred to as 5' and 3' untranslated regions).
Given the coding strand sequences encoding the NOVX protein disclosed herein, antisense nucleic acids of the invention can be designed according to the rules of Watson and
Crick or Hoogsteen base pairing. The antisense nucleic acid molecule can be complementary to the entire coding region of NOVX mRNA, but more preferably is an oligonucleotide that is antisense to only a portion of the coding or noncoding region of NOVX mRNA. For example, the antisense oligonucleotide can be complementary to the region surrounding the translation
start site of NOVX mRNA. An antisense oligonucleotide can be, for example, about 5, 10, 15, 20, 25, 30, 35, 40, 45 or 50 nucleotides in length. An antisense nucleic acid of the invention can be constructed using chemical synthesis or enzymatic ligation reactions using procedures known in the art. For example, an antisense nucleic acid (e.g., an antisense oligonucleotide) can be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed between the antisense and sense nucleic acids (e.g., phosphorothioate derivatives and acridine substituted nucleotides can be used).
Examples of modified nucleotides that can be used to generate the antisense nucleic acid include: 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl) uracil, 5-carboxymethylaminomethyl- 2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D-mannosylqueosine, 5'-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6-isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5-oxyacetic acid methylester, uracil-5-oxyacetic acid (v), 5-methyl-2-thiouracil, 3-(3-amino-3-N-2 -carboxypropyl) uracil, (acp3)w, and 2,6-diaminopurine. Alternatively, the antisense nucleic acid can be produced biologically using an expression vector into which a nucleic acid has been subcloned in an antisense orientation (i.e., RNA transcribed from the inserted nucleic acid will be of an antisense orientation to a target nucleic acid of interest, described further in the following subsection). The antisense nucleic acid molecules of the invention are typically administered to a subject or generated in situ such that they hybridize with or bind to cellular mRNA and/or genomic DNA encoding A NOVX protein to thereby inhibit expression of the protein (e.g., by inhibiting transcription and/or translation). The hybridization can be by conventional nucleotide complementarity to form a stable duplex, or, for example, in the case of an antisense nucleic acid molecule that binds to DNA duplexes, through specific interactions in the major groove of the double helix. An example of a route of administration of antisense nucleic acid molecules of the invention includes direct injection at a tissue site. Alternatively, antisense nucleic acid molecules can be modified to target selected cells and then administered systemically. For example, for systemic administration, antisense molecules can be modified
such that they specifically bind to receptors or antigens expressed on a selected cell surface (e.g., by linking the antisense nucleic acid molecules to peptides or antibodies that bind to cell surface receptors or antigens). The antisense nucleic acid molecules can also be delivered to cells using the vectors described herein. To achieve sufficient nucleic acid molecules, vector constructs in which the antisense nucleic acid molecule is placed under the control of a strong pol II or pol III promoter are preferred.
In yet another embodiment, the antisense nucleic acid molecule of the invention is an oc-anomeric nucleic acid molecule. A α-anomeric nucleic acid molecule forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual β-units, the strands run parallel to each other. See, e.g., Gaultier, et al., 1987. Nucl. Acids Res. 15: 6625-6641. The antisense nucleic acid molecule can also comprise a 2'-o-methylribonucleotide (See, e.g., Inoue, et al. 1987. Nucl. Acids Res. 15: 6131-6148) or a chimeric RNA-DNA analogue (See, e.g., Inoue, et al, 1987. FEBSLett. 215: 327-330.
Ribozymes and PNA Moieties
Nucleic acid modifications include, by way of non-limiting example, modified bases, and nucleic acids whose sugar phosphate backbones are modified or derivatized. These modifications are carried out at least in part to enhance the chemical stability of the modified nucleic acid, such that they may be used, for example, as antisense binding nucleic acids in therapeutic applications in a subject.
In one embodiment, an antisense nucleic acid of the invention is a ribozyme. Ribozymes are catalytic RNA molecules with ribonuclease activity that are capable of cleaving a single-stranded nucleic acid, such as an mRNA, to which they have a complementary region. Thus, ribozymes (e.g., hammerhead ribozymes as described in Haselhoff and Gerlach 1988. Nature 334: 585-591) can be used to catalytically cleave NOVX mRNA transcripts to thereby inhibit translation of NOVX mRNA. A ribozyme having specificity for a NOVX-encoding nucleic acid can be designed based upon the nucleotide sequence of A NOVX cDNA disclosed herein (i.e., SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86). For example, a derivative of a Tetrahymena L-19 IVS RNA can be constructed in which the nucleotide sequence of the active site is complementary to the nucleotide sequence to be cleaved in a NOVX-encoding mRNA. See, e.g., U.S. Patent 4,987,071 to Cech, et al. and U.S. Patent 5,116,742 to Cech, et al. NOVX mRNA can also be
used to select a catalytic RNA having a specific ribonuclease activity from a pool of RNA molecules. See, e.g., Bartel et al., (1993) Science 261: 1411-1418.
Alternatively, NOVX gene expression can be inhibited by targeting nucleotide sequences complementary to the regulatory region of the NOVX nucleic acid (e.g., the NOVX promoter and/or enhancers) to form triple helical structures that prevent transcription of the NOVX gene in target cells. See, e.g., Helene, 1991. Anticancer Drug Des. 6: 569-84; Helene, et al. 1992. Ann. N Y. Acad. Sci. 660: 27-36; Maher, 1992. Bioassays 14: 807-15.
In various embodiments, the NOVX nucleic acids can be modified at the base moiety, sugar moiety or phosphate backbone to improve, e.g., the stability, hybridization, or solubility of the molecule. For example, the deoxyribose phosphate backbone of the nucleic acids can be modified to generate peptide nucleic acids. See, e.g., Hyrup, et al., 1996. Bioorg Med Chem 4: 5-23. As used herein, the terms "peptide nucleic acids" or "PNAs" refer to nucleic acid mimics (e.g., DNA mimics) in which the deoxyribose phosphate backbone is replaced by a pseudopeptide backbone and only the four natural nucleobases are retained. The neutral backbone of PNAs has been shown to allow for specific hybridization to DNA and RNA under conditions of low ionic strength. The synthesis of PNA oligomers can be performed using standard solid phase peptide synthesis protocols as described in Hyrup, et al, 1996. supra; Perry-O'Keefe, et al, 1996. Proc. Natl Acad. Sci. USA 93: 14670-14675.
PNAs of NOVX can be used in therapeutic and diagnostic applications. For example, PNAs can be used as antisense or antigene agents for sequence-specific modulation of gene expression by, e.g., inducing transcription or translation arrest or inhibiting replication. PNAs of NOVX can also be used, for example, in the analysis of single base pair mutations in a gene (e.g., PNA directed PCR clamping; as artificial restriction enzymes when used in combination with other enzymes, e.g., Si nucleases (See, Hyrup, et al, 1996. supra); or as probes or primers for DNA sequence and hybridization (See, Hyrup, et al, 1996, supra; Perry-O'Keefe, et al, 1996. supra).
In another embodiment, PNAs of NOVX can be modified, e.g., to enhance their stability or cellular uptake, by attaching lipophilic or other helper groups to PNA, by the formation of PNA-DNA chimeras, or by the use of liposomes or other techniques of drug delivery known in the art. For example, PNA-DNA chimeras of NOVX can be generated that may combine the advantageous properties of PNA and DNA. Such chimeras allow DNA recognition enzymes (e.g., RNase H and DNA polymerases) to interact with the DNA portion while the PNA portion would provide high binding affinity and specificity. PNA-DNA chimeras can be linked using linkers of appropriate lengths selected in terms of base stacking,
number of bonds between the nucleobases, and orientation (see, Hyrup, et al, 1996. supra). The synthesis of PNA-DNA chimeras can be performed as described in Hyrup, et al, 1996. supra and Finn, et al, 1996. Nucl Acids Res 24: 3357-3363. For example, a DNA chain can be synthesized on a solid support using standard phosphoramidite coupling chemistry, and modified nucleoside analogs, e.g., 5'-(4-methoxytrityl)amino-5'-deoxy-thymidine phosphoramidite, can be used between the PNA and the 5' end of DNA. See, e.g., Mag, et al, 1989. Nucl Acid Res 17: 5973-5988. PNA monomers are then coupled in a stepwise manner to produce a chimeric molecule with a 5' PNA segment and a 3' DNA segment. See, e.g., Finn, et al, 1996. supra. Alternatively, chimeric molecules can be synthesized with a 5' DNA segment and a 3' PNA segment. See, e.g., Petersen, et al, 1975. Bioorg. Med. Chem. Lett. 5: 1119-11124.
In other embodiments, the oligonucleotide may include other appended groups such as peptides (e.g., for targeting host cell receptors in vivo), or agents facilitating transport across the cell membrane (see, e.g, Letsinger, et al., 1989. Proc. Natl. Acad. Sci. U.S.A. 86: 6553-6556; Lemairre, et al, 1987. Proc. Natl. Acad. Sci. 84: 648-652; PCT Publication No. WO88/09810) or the blood-brain barrier (see, e.g., PCT Publication No. WO 89/10134). In addition, oligonucleotides can be modified with hybridization triggered cleavage agents (see, e.g., Krol, et al, 1988. BioTechniques 6:958-976) or intercalating agents (see, e.g., Zon, 1988. Pharm. Res. 5: 539-549). To this end, the oligonucleotide may be conjugated to another molecule, e.g., a peptide, a hybridization triggered cross-linking agent, a transport agent, a hybridization-triggered cleavage agent, and the like.
NOVX Polypeptides
A polypeptide according to the invention includes a polypeptide including the amino acid sequence of NOVX polypeptides whose sequences are provided in SEQ ID NOS:2n, wherein n is an integer between 1 and 86. The invention also includes a mutant or variant protein any of whose residues may be changed from the corresponding residues shown in SEQ
ID NOS:2n, wherein n is an integer between 1 and 86, while still encoding a protein that maintains its NOVX activities and physiological functions, or a functional fragment thereof. In general, A NOVX variant that preserves NOVX-like function includes any variant in which residues at a particular position in the sequence have been substituted by other amino acids, and further include the possibility of inserting an additional residue or residues between two residues of the parent protein as well as the possibility of deleting one or more residues from the parent sequence. Any amino acid substitution, insertion, or deletion is encompassed
by the invention. In favorable circumstances, the substitution is a conservative substitution as defined above.
One aspect of the invention pertains to isolated NOVX proteins, and biologically- active portions thereof, or derivatives, fragments, analogs or homologs thereof. Also provided are polypeptide fragments suitable for use as immunogens to raise anti-NOVX antibodies. In one embodiment, native NOVX proteins can be isolated from cells or tissue sources by an appropriate purification scheme using standard protein purification techniques. In another embodiment, NOVX proteins are produced by recombinant DNA techniques. Alternative to recombinant expression, A NOVX protein or polypeptide can be synthesized chemically using standard peptide synthesis techniques.
An "isolated" or "purified" polypeptide or protein or biologically-active portion thereof is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the NOVX protein is derived, or substantially free from chemical precursors or other chemicals when chemically synthesized. The language "substantially free of cellular material" includes preparations of NOVX proteins in which the protein is separated from cellular components of the cells from which it is isolated or recombinantly-produced. In one embodiment, the language "substantially free of cellular material" includes preparations of NOVX proteins having less than about 30% (by dry weight) of non-NOVX proteins (also referred to herein as a "contaminating protein"), more preferably less than about 20% of non-NOVX proteins, still more preferably less than about 10% of non-NOVX proteins, and most preferably less than about 5% of non-NOVX proteins. When the NOVX protein or biologically-active portion thereof is recombinantly-produced, it is also preferably substantially free of culture medium, i.e., culture medium represents less than about 20%, more preferably less than about 10%, and most preferably less than about 5% of the volume of the NOVX protein preparation.
The language "substantially free of chemical precursors or other chemicals" includes preparations of NOVX proteins in which the protein is separated from chemical precursors or other chemicals that are involved in the synthesis of the protein. In one embodiment, the language "substantially free of chemical precursors or other chemicals" includes preparations of NOVX proteins having less than about 30% (by dry weight) of chemical precursors or non-NOVX chemicals, more preferably less than about 20% chemical precursors or non-NOVX chemicals, still more preferably less than about 10% chemical precursors or non-NOVX chemicals, and most preferably less than about 5% chemical precursors or non-NOVX chemicals.
Biologically-active portions of NOVX proteins include peptides comprising amino acid sequences sufficiently homologous to or derived from the amino acid sequences of the NOVX proteins (e.g., the amino acid sequence shown in SEQ ID NOS:2n, wherein n is an integer between 1 and 86) that include fewer amino acids than the full-length NOVX proteins, and exhibit at least one activity of A NOVX protein. Typically, biologically-active portions comprise a domain or motif with at least one activity of the NOVX protein. A biologically- active portion of A NOVX protein can be a polypeptide which is, for example, 10, 25, 50, 100 or more amino acid residues in length.
Moreover, other biologically-active portions, in which other regions of the protein are deleted, can be prepared by recombinant techniques and evaluated for one or more of the functional activities of a native NOVX protein.
In an embodiment, the NOVX protein has an amino acid sequence shown SEQ ID NOS:2n, wherein n is an integer between 1 and 86. In other embodiments, the NOVX protein is substantially homologous to SEQ ID NOS:2n, wherein n is an integer between 1 and 86, and retains the functional activity of the protein of SEQ ID NOS:2n, wherein n is an integer between 1 and 86, yet differs in amino acid sequence due to natural allelic variation or mutagenesis, as described in detail, below. Accordingly, in another embodiment, the NOVX protein is a protein that comprises an amino acid sequence at least about 45% homologous to the amino acid sequence SEQ ID NOS:2n, wherein n is an integer between 1 and 86, and retains the functional activity of the NOVX proteins of SEQ ID NOS:2n, wherein n is an integer between 1 and 86.
DETERMINING HOMOLOGY BETWEEN TWO OR MORE SEQUENCES
To determine the percent homology of two amino acid sequences or of two nucleic acids, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino or nucleic acid sequence). The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are homologous at that position (i.e., as used herein amino acid or nucleic acid "homology" is equivalent to amino acid or nucleic acid "identity").
The nucleic acid sequence homology may be determined as the degree of identity between two sequences. The homology may be determined using computer programs known
in the art, such as GAP software provided in the GCG program package. See, Needleman and Wunsch, 1970. JMol Biol 48: 443-453. Using GCG GAP software with the following settings for nucleic acid sequence comparison: GAP creation penalty of 5.0 and GAP extension penalty of 0.3, the coding region of the analogous nucleic acid sequences referred to above exhibits a degree of identity preferably of at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99%, with the CDS (encoding) part of the DNA sequence shown in SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86.
The term "sequence identity" refers to the degree to which two polynucleotide or polypeptide sequences are identical on a residue-by-residue basis over a particular region of comparison. The term "percentage of sequence identity" is calculated by comparing two optimally aligned sequences over that region of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, U, or I, in the case of nucleic acids) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the region of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity. The term "substantial identity" as used herein denotes a characteristic of a polynucleotide sequence, wherein the polynucleotide comprises a sequence that has at least 80 percent sequence identity, preferably at least 85 percent identity and often 90 to 95 percent sequence identity, more usually at least 99 percent sequence identity as compared to a reference sequence over a comparison region.
CHIMERIC AND FUSION PROTEINS
The invention also provides NOVX chimeric or fusion proteins. As used herein, A NOVX "chimeric protein" or "fusion protein" comprises A NOVX polypeptide operatively- linked to a non-NOVX polypeptide. An "NOVX polypeptide" refers to a polypeptide having an amino acid sequence corresponding to A NOVX protein SEQ ID NOS:2n, wherein n is an integer between 1 and 86, whereas a "non-NOVX polypeptide" refers to a polypeptide having an amino acid sequence corresponding to a protein that is not substantially homologous to the NOVX protein, e.g., a protein that is different from the NOVX protein and that is derived from the same or a different organism. Within A NOVX fusion protein the NOVX polypeptide can correspond to all or a portion of A NOVX protein. In one embodiment, A NOVX fusion protein comprises at least one biologically active portion of A NOVX protein. In another embodiment, A NOVX fusion protein comprises at least two biologically active portions of A
NOVX protein. In yet another embodiment, A NOVX fusion protein comprises at least three
biologically active portions of A NOVX protein. Within the fusion protein, the term "operatively-linked" is intended to indicate that the NOVX polypeptide and the non-NOVX polypeptide are fused in-frame with one another. The non-NOVX polypeptide can be fused to the N-terminus or C-terminus of the NOVX polypeptide. In one embodiment, the fusion protein is a GST-NO VX fusion protein in which the
NOVX sequences are fused to the C-terminus of the GST (glutathione S-transferase) sequences. Such fusion proteins can facilitate the purification of recombinant NOVX polypeptides.
In another embodiment, the fusion protein is A NOVX protein containing a heterologous signal sequence at its N-terminus. In certain host cells (e.g., mammalian host cells), expression and or secretion of NOVX can be increased through use of a heterologous signal sequence.
In yet another embodiment, the fusion protein is a NOVX-immunoglobulin fusion protein in which the NOVX sequences are fused to sequences derived from a member of the immunoglobulin protein family. The NOVX-immunoglobulin fusion proteins of the invention can be incorporated into pharmaceutical compositions and administered to a subject to inhibit an interaction between A NOVX ligand and A NOVX protein on the surface of a cell, to thereby suppress NOVX-mediated signal transduction in vivo. The NOVX-immunoglobulin fusion proteins can be used to affect the bioavailability of A NOVX cognate ligand. Inhibition of the NOVX ligand/NOVX interaction may be useful therapeutically for both the treatment of proliferative and differentiative disorders, as well as modulating (e.g. promoting or inhibiting) cell survival. Moreover, the NOVX-immunoglobulin fusion proteins of the invention can be used as immunogens to produce anti-NOVX antibodies in a subject, to purify NOVX ligands, and in screening assays to identify molecules that inhibit the interaction of NOVX with A NOVX ligand.
A NOVX chimeric or fusion protein of the invention can be produced by standard recombinant DNA techniques. For example, DNA fragments coding for the different polypeptide sequences are ligated together in-frame in accordance with conventional techniques, e.g., by employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation. In another embodiment, the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers. Alternatively, PCR amplification of gene fragments can be carried out using anchor primers that give rise to complementary overhangs between two
consecutive gene fragments that can subsequently be annealed and reamplified to generate a chimeric gene sequence (see, e.g., Ausubel, et al. (eds.) CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, 1992). Moreover, many expression vectors are commercially available that already encode a fusion moiety (e.g., a GST polypeptide). A NOVX-encoding nucleic acid can be cloned into such an expression vector such that the fusion moiety is linked in-frame to the NOVX protein.
NOVX AGONISTS AND ANTAGONISTS
The invention also pertains to variants of the NOVX proteins that function as either NOVX agonists (i.e., mimetics) or as NOVX antagonists. Variants of the NOVX protein can be generated by mutagenesis (e.g., discrete point mutation or truncation of the NOVX protein). An agonist of the NOVX protein can retain substantially the same, or a subset of, the biological activities of the naturally occurring form of the NOVX protein. An antagonist of the NOVX protein can inhibit one or more of the activities of the naturally occurring form of the NOVX protein by, for example, competitively binding to a downstream or upstream member of a cellular signaling cascade, which includes the NOVX protein. Thus, specific biological effects can be elicited by treatment with a variant of limited function. In one embodiment, treatment of a subject with a variant having a subset of the biological activities of the naturally occurring form of the protein has fewer side effects in a subject relative to treatment with the naturally occurring form of the NOVX proteins.
Variants of the NOVX proteins that function as either NOVX agonists (i.e., mimetics) or as NOVX antagonists can be identified by screening combinatorial libraries of mutants (e.g., truncation mutants) of the NOVX proteins for NOVX protein agonist or antagonist activity. In one embodiment, a variegated library of NOVX variants is generated by combinatorial mutagenesis at the nucleic acid level and is encoded by a variegated gene library. A variegated library of NOVX variants can be produced by, for example, enzymatically ligating a mixture of synthetic oligonucleotides into gene sequences such that a degenerate set of potential NOVX sequences is expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display) containing the set of NOVX sequences therein. There are a variety of methods, which can be used to produce libraries of potential NOVX variants from a degenerate oligonucleotide sequence. Chemical synthesis of a degenerate gene sequence can be performed in an automatic DNA synthesizer, and the synthetic gene then ligated into an appropriate expression vector. Use of a degenerate set of genes allows for the provision, in one mixture, of all of the sequences encoding the
desired set of potential NOVX sequences. Methods for synthesizing degenerate oligonucleotides are well known within the art. See, e.g., Narang, 1983. Tetrahedron 39: 3; Itakura, et al, 1984. Annu. Rev. Biochem. 53: 323; Itakura, et al, 1984. Science 198: 1056; Ike, et al, 1983. Nucl Acids Res. 11: 477.
POLYPEPTIDE LIBRARIES
In addition, libraries of fragments of the NOVX protein coding sequences can be used to generate a variegated population of NOVX fragments for screening and subsequent selection of variants of A NOVX protein. In one embodiment, a library of coding sequence fragments can be generated by treating a double stranded PCR fragment of A NOVX coding sequence with a nuclease under conditions wherein nicking occurs only about once per molecule, denaturing the double stranded DNA, renaturing the DNA to form double-stranded DNA that can include sense/antisense pairs from different nicked products, removing single stranded portions from reformed duplexes by treatment with Si nuclease, and ligating the resulting fragment library into an expression vector. By this method, expression libraries can be derived which encodes N-terminal and internal fragments of various sizes of the NOVX proteins.
Various techniques are known in the art for screening gene products of combinatorial libraries made by point mutations or truncation, and for screening cDNA libraries for gene products having a selected property. Such techniques are adaptable for rapid screening of the gene libraries generated by the combinatorial mutagenesis of NOVX proteins. The most widely used techniques, which are amenable to high throughput analysis, for screening large gene libraries typically include cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates isolation of the vector encoding the gene whose product was detected. Recursive ensemble mutagenesis (REM), a new technique that enhances the frequency of functional mutants in the libraries, can be used in combination with the screening assays to identify NOVX variants. See, e.g., Arkin and Yourvan, 1992. Proc. Natl. Acad. Sci. USA 89: 7811-7815; Delgrave, et al, 1993. Protein Engineering 6:327-331.
NOVX Antibodies
The term "antibody" as used herein refers to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e., molecules that
contain an antigen-binding site that specifically binds (immunoreacts with) an antigen. Such antibodies include, but are not limited to, polyclonal, monoclonal, chimeric, single chain, Fab, Fab- and F(ab')2 fragments, and an Fab expression library. In general, antibody molecules obtained from humans relates to any of the classes IgG, IgM, IgA, IgE and IgD, which differ from one another by the nature of the heavy chain present in the molecule. Certain classes have subclasses as well, such as IgGi, IgG2, and others. Furthermore, in humans, the light chain may be a kappa chain or a lambda chain. Reference herein to antibodies includes a reference to all such classes, subclasses and types of human antibody species.
An isolated protein of the invention intended to serve as an antigen, or a portion or fragment thereof, can be used as an immunogen to generate antibodies that immunospecifically bind the antigen, using standard techniques for polyclonal and monoclonal antibody preparation. The full-length protein can be used or, alternatively, the invention provides antigenic peptide fragments of the antigen for use as immunogens. An antigenic peptide fragment comprises at least 6 amino acid residues of the amino acid sequence of the full length protein, such as an amino acid sequence shown in SEQ ID NOs: 2n, wherein n is an integer between 1 and 86, and encompasses an epitope thereof such that an antibody raised against the peptide forms a specific immune complex with the full length protein or with any fragment that contains the epitope. Preferably, the antigenic peptide comprises at least 10 amino acid residues, or at least 15 amino acid residues, or at least 20 amino acid residues, or at least 30 amino acid residues. Preferred epitopes encompassed by the antigenic peptide are regions of the protein that are located on its surface; commonly these are hydrophilic regions.
In certain embodiments of the invention, at least one epitope encompassed by the antigenic peptide is a region of NOVX that is located on the surface of the protein, e.g., a hydrophilic region. A hydrophobicity analysis of the human NOVX protein sequence will indicate which regions of a NOVX polypeptide are particularly hydrophilic and, therefore, are likely to encode surface residues useful for targeting antibody production. As a means for targeting antibody production, hydropathy plots showing regions of hydrophilicity and hydrophobicity may be generated by any method well known in the art, including, for example, the Kyte Doolittle or the Hopp Woods methods, either with or without Fourier transformation. See, e.g., Hopp and Woods, 1981, Proc. Nat. Acad. Sci. USA 78: 3824-3828; Kyte and Doolittle 1982, J. Mol Biol 157: 105-142, each incorporated herein by reference in their entirety. Antibodies that are specific for one or more domains within an antigenic protein, or derivatives, fragments, analogs or homologs thereof, are also provided herein.
A protein of the invention, or a derivative, fragment, analog, homolog or ortholog thereof, may be utilized as an immunogen in the generation of antibodies that immunospecifically bind these protein components.
Various procedures known within the art may be used for the production of polyclonal or monoclonal antibodies directed against a protein of the invention, or against derivatives, fragments, analogs homologs or orthologs thereof (see, for example, Antibodies: A Laboratory Manual, Harlow E, and Lane D, 1988, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, incorporated herein by reference). Some of these antibodies are discussed below.
Polyclonal Antibodies
For the production of polyclonal antibodies, various suitable host animals (e.g., rabbit, goat, mouse or other mammal) may be immunized by one or more injections with the native protein, a synthetic variant thereof, or a derivative of the foregoing. An appropriate immunogenic preparation can contain, for example, the naturally occurring immunogenic protein, a chemically synthesized polypeptide representing the immunogenic protein, or a recombinantly expressed immunogenic protein. Furthermore, the protein may be conjugated to a second protein known to be immunogenic in the mammal being immunized. Examples of such immunogenic proteins include but are not limited to keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, and soybean trypsin inhibitor. The preparation can further include an adjuvant. Various adjuvants used to increase the immunological response include, but are not limited to, Freund's (complete and incomplete), mineral gels (e.g., aluminum hydroxide), surface active substances (e.g., lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, dinitrophenol, etc.), adjuvants usable in humans such as Bacille Calmette-Guerin and Corynebacterium parvum, or similar immunostimulatory agents. Additional examples of adjuvants which can be employed include MPL-TDM adjuvant (monophosphoryl Lipid A, synthetic trehalose dicorynomycolate).
The polyclonal antibody molecules directed against the immunogenic protein can be isolated from the mammal (e.g., from the blood) and further purified by well known techniques, such as affinity chromatography using protein A or protein G, which provide primarily the IgG fraction of immune serum. Subsequently, or alternatively, the specific antigen which is the target of the immunoglobulin sought, or an epitope thereof, may be immobilized on a column to purify the immune specific antibody by immunoaffinity chromatography. Purification of immunoglobulins is discussed, for example, by D. Wilkinson
(The Scientist, published by The Scientist, Inc., Philadelphia PA, Vol. 14, No. 8 (April 17, 2000), pp. 25-28).
Monoclonal Antibodies The term "monoclonal antibody" (MAb) or "monoclonal antibody composition", as used herein, refers to a population of antibody molecules that contain only one molecular species of antibody molecule consisting of a unique light chain gene product and a unique heavy chain gene product. In particular, the complementarity determining regions (CDRs) of the monoclonal antibody are identical in all the molecules of the population. MAbs thus contain an antigen binding site capable of immunoreacting with a particular epitope of the antigen characterized by a unique binding affinity for it.
Monoclonal antibodies can be prepared using hybridoma methods, such as those described by Kohler and Milstein, Nature, 256:495 (1975). In a hybridoma method, a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent. Alternatively, the lymphocytes can be immunized in vitro.
The immunizing agent will typically include the protein antigen, a fragment thereof or a fusion protein thereof. Generally, either peripheral blood lymphocytes are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired. The lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell [Goding, Monoclonal Antibodies: Principles and Practice, Academic Press, (1986) pp. 59- 103]. Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin. Usually, rat or mouse myeloma cell lines are employed. The hybridoma cells can be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells. For example, if the parental cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine ("HAT medium"), which substances prevent the growth of HGPRT-deficient cells.
Preferred immortalized cell lines are those that fuse efficiently, support stable high level expression of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. More preferred immortalized cell lines are murine myeloma lines, which can be obtained, for instance, from the Salk Institute Cell Distribution Center, San
Diego, California and the American Type Culture Collection, Manassas, Virginia. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies [Kozbor, J. Immunol.. 133:3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications. Marcel Dekker, Inc., New York, (1987) pp. 51-63].
The culture medium in which the hybridoma cells are cultured can then be assayed for the presence of monoclonal antibodies directed against the antigen. Preferably, the binding specificity of monoclonal antibodies produced by the hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA). Such techniques and assays are known in the art. The binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson and Pollard, Anal. Biochem., 107:220 (1980). It is an objective, especially important in therapeutic applications of monoclonal antibodies, to identify antibodies having a high degree of specificity and a high binding affinity for the target antigen.
After the desired hybridoma cells are identified, the clones can be subcloned by limiting dilution procedures and grown by standard methods (Goding,l 986). Suitable culture media for this purpose include, for example, Dulbecco's Modified Eagle's Medium and RPMI- 1640 medium. Alternatively, the hybridoma cells can be grown in vivo as ascites in a mammal.
The monoclonal antibodies secreted by the subclones can be isolated or purified from the culture medium or ascites fluid by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography. The monoclonal antibodies can also be made by recombinant DNA methods, such as those described in U.S. Patent No. 4,816,567. DNA encoding the monoclonal antibodies of the invention can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies). The hybridoma cells of the invention serve as a preferred source of such DNA. Once isolated, the DNA can be placed into expression vectors, which are then transfected into host cells such as simian COS cells, Chinese hamster ovary
(CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. The DNA also can be modified, for example, by substituting the coding sequence for human heavy and light
chain constant domains in place of the homologous murine sequences (U.S. Patent No. 4,816,567; Morrison, Nature 368. 812-13 (1994)) or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. Such a non-immunoglobulin polypeptide can be substituted for the constant domains of an antibody of the invention, or can be substituted for the variable domains of one antigen-combining site of an antibody of the invention to create a chimeric bivalent antibody.
Humanized Antibodies
The antibodies directed against the protein antigens of the invention can further comprise humanized antibodies or human antibodies. These antibodies are suitable for administration to humans without engendering an immune response by the human against the administered immunoglobulin. Humanized forms of antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab')2 or other antigen- binding subsequences of antibodies) that are principally comprised of the sequence of a human immunoglobulin, and contain minimal sequence derived from a non-human immunoglobulin. Humanization can be performed following the method of Winter and co-workers (Jones et al., Nature. 321:522-525 (1986); Riechmann et al., Nature. 332:323-327 (1988); Verhoeyen et al., Science. 239:1534-1536 (1988)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. (See also U.S. Patent No. 5,225,539.) In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies can also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin (Jones et al., 1986; Riechmann et al., 1988; and Presta, Curr. Op. Struct. Biol.. 2:593-596 (1992)).
Human Antibodies
Fully human antibodies essentially relate to antibody molecules in which the entire sequence of both the light chain and the heavy chain, including the CDRs, arise from human genes. Such antibodies are termed "human antibodies", or "fully human antibodies" herein.
Human monoclonal antibodies can be prepared by the trioma technique; the human B-cell hybridoma technique (see Kozbor, et al., 1983 Immunol Today 4: 72) and the EBV hybridoma technique to produce human monoclonal antibodies (see Cole, et al., 1985 In: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc., pp. 77-96). Human monoclonal antibodies may be utilized in the practice of the present invention and may be produced by using human hybridomas (see Cote, et al., 1983. Proc Natl Acad Sci USA 80: 2026-2030) or by transforming human B-cells with Epstein Barr Virus in vitro (see Cole, et al., 1985 In: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc., pp. 77-96).
In addition, human antibodies can also be produced using additional techniques, including phage display libraries (Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol.. 222:581 (1991)). Similarly, human antibodies can be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Patent Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,661,016, and in Marks et al. (Bio/Technology 10. 779-783 (1992)); Lonberg et al. (Nature 368 856-859 (1994)); Morrison ( Nature 368, 812-13 (1994)); Fishwild et al,( Nature Biotechnology 14, 845-51 (1996)); Neuberger (Nature Biotechnology 14, 826 (1996)); and Lonberg and Huszar Qntern. Rev. Immunol. 13 65-93 (1995)).
Human antibodies may additionally be produced using transgenic nonhuman animals which are modified so as to produce fully human antibodies rather than the animal's endogenous antibodies in response to challenge by an antigen. (See PCT publication WO94/02602). The endogenous genes encoding the heavy and light immunoglobulin chains in the nonhuman host have been incapacitated, and active loci encoding human heavy and light chain immunoglobulins are inserted into the host's genome. The human genes are incorporated, for example, using yeast artificial chromosomes containing the requisite human DNA segments. An animal which provides all the desired modifications is then obtained as progeny by crossbreeding intermediate transgenic animals containing fewer than the full complement of the modifications. The preferred embodiment of such a nonhuman animal is a mouse, and is termed the Xenomouse™ as disclosed in PCT publications WO 96/33735 and
WO 96/34096. This animal produces B cells which secrete fully human immunoglobulins.
The antibodies can be obtained directly from the animal after immunization with an immunogen of interest, as, for example, a preparation of a polyclonal antibody, or alternatively
from immortalized B cells derived from the animal, such as hybridomas producing monoclonal antibodies. Additionally, the genes encoding the immunoglobulins with human variable regions can be recovered and expressed to obtain the antibodies directly, or can be further modified to obtain analogs of antibodies such as, for example, single chain Fv molecules.
An example of a method of producing a nonhuman host, exemplified as a mouse, lacking expression of an endogenous immunoglobulin heavy chain is disclosed in U.S. Patent No. 5,939,598. It can be obtained by a method including deleting the J segment genes from at least one endogenous heavy chain locus in an embryonic stem cell to prevent rearrangement of the locus and to prevent formation of a transcript of a rearranged immunoglobulin heavy chain locus, the deletion being effected by a targeting vector containing a gene encoding a selectable marker; and producing from the embryonic stem cell a transgenic mouse whose somatic and germ cells contain the gene encoding the selectable marker.
A method for producing an antibody of interest, such as a human antibody, is disclosed in U.S. Patent No. 5,916,771. It includes introducing an expression vector that contains a nucleotide sequence encoding a heavy chain into one mammalian host cell in culture, introducing an expression vector containing a nucleotide sequence encoding a light chain into another mammalian host cell, and fusing the two cells to form a hybrid cell. The hybrid cell expresses an antibody containing the heavy chain and the light chain. In a further improvement on this procedure, a method for identifying a clinically relevant epitope on an immunogen, and a correlative method for selecting an antibody that binds immunospecifically to the relevant epitope with high affinity, are disclosed in PCT publication WO 99/53049.
Fab Fragments and Single Chain Antibodies
According to the invention, techniques can be adapted for the production of single-chain antibodies specific to an antigenic protein of the invention (see e.g., U.S. Patent
No. 4,946,778). In addition, methods can be adapted for the construction of Fab expression libraries (see e.g., Huse, et al., 1989 Science 246: 1275-1281) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for a protein or derivatives, fragments, analogs or homologs thereof. Antibody fragments that contain the idiotypes to a protein antigen may be produced by techniques known in the art including, but not limited to: (i) an F(ab')2 fragment produced by pepsin digestion of an antibody molecule; (ii) an Fab fragment generated by reducing the disulfide bridges of an F(ab')2 fragment; (iii) an Fab
fragment generated by the treatment of the antibody molecule with papain and a reducing agent and (iv) Fv fragments.
Bispecific Antibodies Bispecific antibodies are monoclonal, preferably human or humanized, antibodies that have binding specificities for at least two different antigens. In the present case, one of the binding specificities is for an antigenic protein of the invention. The second binding target is any other antigen, and advantageously is a cell-surface protein or receptor or receptor subunit. Methods for making bispecific antibodies are known in the art. Traditionally, the recombinant production of bispecific antibodies is based on the co-expression of two immunoglobulin heavy-chain/light-chain pairs, where the two heavy chains have different specificities (Milstein and Cuello, Nature, 305:537-539 (1983)). Because of the random assortment of immunoglobulin heavy and light chains, these hybridomas (quadromas) produce a potential mixture often different antibody molecules, of which only one has the correct bispecific structure. The purification of the correct molecule is usually accomplished by affinity chromatography steps. Similar procedures are disclosed in WO 93/08829, published 13 May 1993, and in Traunecker et al., EMBO J..10:3655-3659 (1991).
Antibody variable domains with the desired binding specificities (antibody-antigen combining sites) can be fused to immunoglobulin constant domain sequences. The fusion preferably is with an immunoglobulin heavy-chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. It is preferred to have the first heavy-chain constant region (CHI) containing the site necessary for light-chain binding present in at least one of the fusions. DNAs encoding the immunoglobulin heavy-chain fusions and, if desired, the immunoglobulin light chain, are inserted into separate expression vectors, and are co- transfected into a suitable host organism. For further details of generating bispecific antibodies see, for example, Suresh et al., Methods in Enzvmology.121:210 (1986).
According to another approach described in WO 96/27011, the interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers which are recovered from recombinant cell culture. The preferred interface comprises at least a part of the CH3 region of an antibody constant domain. In this method, one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e.g. tyrosine or tryptophan). Compensatory "cavities" of identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine). This provides a
mechanism for increasing the yield of the heterodimer over other unwanted end-products such as homodimers.
Bispecific antibodies can be prepared as full length antibodies or antibody fragments (e.g. F(ab')2 bispecific antibodies). Techniques for generating bispecific antibodies from antibody fragments have been described in the literature. For example, bispecific antibodies can be prepared using chemical linkage. Brennan et al., Science 229:81 (1985) describe a procedure wherein intact antibodies are proteolytically cleaved to generate F(ab')2 fragments. These fragments are reduced in the presence of the dithiol complexing agent sodium arsenite to stabilize vicinal dithiols and prevent intermolecular disulfide formation. The Fab' fragments generated are then converted to thionitrobenzoate (TNB) derivatives. One of the Fab'-TNB derivatives is then reconverted to the Fab'-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab'-TNB derivative to form the bispecific antibody. The bispecific antibodies produced can be used as agents for the selective immobilization of enzymes. Additionally, Fab' fragments can be directly recovered from E. coli and chemically coupled to form bispecific antibodies. Shalaby et al., J. Exp. Med. 175:217-225 (1992) describe the production of a fully humanized bispecific antibody F(ab')2 molecule. Each Fab' fragment was separately secreted from E. coli and subjected to directed chemical coupling in vitro to form the bispecific antibody. The bispecific antibody thus formed was able to bind to cells overexpressing the ErbB2 receptor and normal human T cells, as well as trigger the lytic activity of human cytotoxic lymphocytes against human breast tumor targets.
Various techniques for making and isolating bispecific antibody fragments directly from recombinant cell culture have also been described. For example, bispecific antibodies have been produced using leucine zippers. Kostelny et al., J. Immunol. 148(5): 1547-1553 (1992). The leucine zipper peptides from the Fos and Jun proteins were linked to the Fab' portions of two different antibodies by gene fusion. The antibody homodimers were reduced at the hinge region to form monomers and then re-oxidized to form the antibody heterodimers. This method can also be utilized for the production of antibody homodimers. The "diabody" technology described by Hollinger et al., Proc. Natl. Acad. Sci. USA 90:6444-6448 (1993) has provided an alternative mechanism for making bispecific antibody fragments. The fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) by a linker which is too short to allow pairing between the two domains on the same chain.
Accordingly, the VH and VL domains of one fragment are forced to pair with the complementary VL and VH domains of another fragment, thereby forming two antigen-binding
sites. Another strategy for making bispecific antibody fragments by the use of single-chain Fv (sFv) dimers has also been reported. See, Gruber et al., J. Immunol. 152:5368 (1994).
Antibodies with more than two valencies are contemplated. For example, trispecific antibodies can be prepared. Tutt et al., J. Immunol. 147:60 (1991). Exemplary bispecific antibodies can bind to two different epitopes, at least one of which originates in the protein antigen of the invention. Alternatively, an anti-antigenic arm of an immunoglobulin molecule can be combined with an arm which binds to a triggering molecule on a leukocyte such as a T-cell receptor molecule (e.g. CD2, CD3, CD28, or B7), or Fc receptors for IgG (FcγR), such as FcγRI (CD64), FcγRII (CD32) and FcγRIII (CD 16) so as to focus cellular defense mechanisms to the cell expressing the particular antigen. Bispecific antibodies can also be used to direct cytotoxic agents to cells which express a particular antigen. These antibodies possess an antigen-binding arm and an arm which binds a cytotoxic agent or a radionuclide chelator, such as EOTUBE, DPTA, DOTA, or TETA. Another bispecific antibody of interest binds the protein antigen described herein and further binds tissue factor (TF).
Heteroconjugate Antibodies
Heteroconjugate antibodies are also within the scope of the present invention.
Heteroconjugate antibodies are composed of two covalently joined antibodies. Such antibodies have, for example, been proposed to target immune system cells to unwanted cells
(U.S. Patent No. 4,676,980), and for treatment of HIV infection (WO 91/00360; WO
92/200373; EP 03089). It is contemplated that the antibodies can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents.
For example, immunotoxins can be constructed using a disulfide exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate and those disclosed, for example, in U.S. Patent No.
4,676,980.
Effector Function Engineering It can be desirable to modify the antibody of the invention with respect to effector function, so as to enhance, e.g., the effectiveness of the antibody in treating cancer. For example, cysteine residue(s) can be introduced into the Fc region, thereby allowing interchain disulfide bond formation in this region. The homodimeric antibody thus generated can have improved internalization capability and/or increased complement-mediated cell killing and
antibody-dependent cellular cytotoxicity (ADCC). See Caron et al., J. Exp Med., 176: 1191- 1195 (1992) and Shopes, J. Immunol.. 148: 2918-2922 (1992). Homodimeric antibodies with enhanced anti-tumor activity can also be prepared using heterobifunctional cross-linkers as described in Wolff et al. Cancer Research, 53: 2560-2565 (1993). Alternatively, an antibody can be engineered that has dual Fc regions and can thereby have enhanced complement lysis and ADCC capabilities. See Stevenson et al., Anti-Cancer Drug Design. 3: 219-230 (1989).
Immunoconjugates
The invention also pertains to immunoconjugates comprising an antibody conjugated to a cytotoxic agent such as a chemotherapeutic agent, toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
Chemotherapeutic agents useful in the generation of such immunoconjugates have been described above. Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes. A variety of radionuclides are available for the production of radioconjugated antibodies. Examples include 212Bi, 1311, 131In, 90Y, and ,86Re.
Conjugates of the antibody and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis- diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as tolyene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro- 2,4-dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta et al., Science. 238: 1098 (1987). Carbon- 14-labeled l-isothiocyanatobenzyl-3- methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See W094/11026.
In another embodiment, the antibody can be conjugated to a "receptor" (such strep tavidin) for utilization in tumor pretargeting wherein the antibody-receptor conjugate is
administered to the patient, followed by removal of unbound conjugate from the circulation using a clearing agent and then administration of a "ligand" (e.g., avidin) that is in turn conjugated to a cytotoxic agent.
Immunoliposomes
The antibodies disclosed herein can also be formulated as immunoliposomes. Liposomes containing the antibody are prepared by methods known in the art, such as described in Epstein et al., Proc. Natl. Acad. Sci. USA. 82: 3688 (1985); Hwang et al., Proc. Natl Acad. Sci. USA. 77: 4030 (1980); and U.S. Pat. Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Patent No. 5,013,556. Particularly useful liposomes can be generated by the reverse-phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG- derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter. Fab' fragments of the antibody of the present invention can be conjugated to the liposomes as described in Martin et al .,_ Biol. Chem.. 257: 286-288 (1982) via a disulfide-interchange reaction. A chemotherapeutic agent (such as Doxorubicin) is optionally contained within the liposome. See Gabizon et al., National Cancer Inst. 81(19): 1484 (1989).
Diagnostic Applications of Antibodies Directed Against the Proteins of the
Invention
Antibodies directed against a protein of the invention may be used in methods known within the art relating to the localization and/or quantitation of the protein (e.g., for use in measuring levels of the protein within appropriate physiological samples, for use in diagnostic methods, for use in imaging the protein, and the like). In a given embodiment, antibodies against the proteins, or derivatives, fragments, analogs or homologs thereof, that contain the antigen binding domain, are utilized as pharmacologically-active compounds (see below).
An antibody specific for a protein of the invention can be used to isolate the protein by standard techniques, such as immunoaffinity chromatography or immunoprecipitation. Such an antibody can facilitate the purification of the natural protein antigen from cells and of recombinantly produced antigen expressed in host cells. Moreover, such an antibody can be used to detect the antigenic protein (e.g., in a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression of the antigenic protein. Antibodies directed against the protein can be used diagnostically to monitor protein levels in tissue as part of a
clinical testing procedure, e.g., to, for example, determine the efficacy of a given treatment regimen. Detection can be facilitated by coupling (i.e., physically linking) the antibody to a detectable substance. Examples of detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, β-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferase, luciferin, and aequoπn, and examples of suitable radioactive mateπal include I,
Antibody Therapeutics Antibodies of the invention, including polyclonal, monoclonal, humanized and fully human antibodies, may used as therapeutic agents. Such agents will generally be employed to treat or prevent a disease or pathology in a subject. An antibody preparation, preferably one having high specificity and high affinity for its target antigen, is administered to the subject and will generally have an effect due to its binding with the target. Such an effect may be one of two kinds, depending on the specific nature of the interaction between the given antibody molecule and the target antigen in question. In the first instance, administration of the antibody may abrogate or inhibit the binding of the target with an endogenous ligand to which it naturally binds. In this case, the antibody binds to the target and masks a binding site of the naturally occurring ligand, wherein the ligand serves as an effector molecule. Thus the receptor mediates a signal transduction pathway for which ligand is responsible.
Alternatively, the effect may be one in which the antibody elicits a physiological result by virtue of binding to an effector binding site on the target molecule. In this case the target, a receptor having an endogenous ligand which may be absent or defective in the disease or pathology, binds the antibody as a surrogate effector ligand, initiating a receptor-based signal transduction event by the receptor.
A therapeutically effective amount of an antibody of the invention relates generally to the amount needed to achieve a therapeutic objective. As noted above, this may be a binding interaction between the antibody and its target antigen that, in certain cases, interferes with the functioning of the target, and in other cases, promotes a physiological response. The amount
required to be administered will furthermore depend on the binding affinity of the antibody for its specific antigen, and will also depend on the rate at which an administered antibody is depleted from the free volume other subject to which it is administered. Common ranges for therapeutically effective dosing of an antibody or antibody fragment of the invention may be, by way of nonlimiting example, from about 0.1 mg/kg body weight to about 50 mg/kg body weight. Common dosing frequencies may range, for example, from twice daily to once a week.
Pharmaceutical Compositions of Antibodies Antibodies specifically binding a protein of the invention, as well as other molecules identified by the screening assays disclosed herein, can be administered for the treatment of various disorders in the form of pharmaceutical compositions. Principles and considerations involved in preparing such compositions, as well as guidance in the choice of components are provided, for example, in Remington : The Science And Practice Of Pharmacy 19th ed. (Alfonso R. Gennaro, et al., editors) Mack Pub. Co., Easton, Pa. : 1995; Drug Absorption Enhancement : Concepts, Possibilities, Limitations, And Trends, Harwood Academic Publishers, Langhorne, Pa., 1994; and Peptide And Protein Drug Delivery (Advances In Parenteral Sciences, Vol. 4), 1991, M. Dekker, New York.
If the antigenic protein is intraceliular and whole antibodies are used as inhibitors, internalizing antibodies are preferred. However, liposomes can also be used to deliver the antibody, or an antibody fragment, into cells. Where antibody fragments are used, the smallest inhibitory fragment that specifically binds to the binding domain of the target protein is preferred. For example, based upon the variable-region sequences of an antibody, peptide molecules can be designed that retain the ability to bind the target protein sequence. Such peptides can be synthesized chemically and/or produced by recombinant DNA technology.
See, e.g., Marasco et al., Proc. Natl. Acad. Sci. USA, 90: 7889-7893 (1993). The formulation herein can also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other. Alternatively, or in addition, the composition can comprise an agent that enhances its function, such as, for example, a cytotoxic agent, cytokine, chemotherapeutic agent, or growth-inhibitory agent. Such molecules are suitably present in combination in amounts that are effective for the purpose intended.
The active ingredients can also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example,
hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacrylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles, and nanocapsules) or in macroemulsions. The formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes.
Sustained-release preparations can be prepared. Suitable examples of sustained- release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and γ ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT ™ (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-(-)-3-hydroxybutyric acid. While polymers such as ethylene- vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods.
ELISA Assay An agent for detecting an analyte protein is an antibody capable of binding to an analyte protein, preferably an antibody with a detectable label. Antibodies can be polyclonal, or more preferably, monoclonal. An intact antibody, or a fragment thereof (e.g., Fab or F(ab)2) can be used. The term "labeled", with regard to the probe or antibody, is intended to encompass direct labeling of the probe or antibody by coupling (i.e., physically linking) a detectable substance to the probe or antibody, as well as indirect labeling of the probe or antibody by reactivity with another reagent that is directly labeled. Examples of indirect labeling include detection of a primary antibody using a fluorescently-labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently-labeled streptavidin. The term "biological sample" is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject. Included within the usage of the term "biological sample", therefore, is blood and a fraction or component of blood including blood serum, blood plasma, or lymph.
That is, the detection method of the invention can be used to detect an analyte mRNA, protein, or genomic DNA in a biological sample in vitro as well as in vivo. For example, in vitro
techniques for detection of an analyte mRNA include Northern hybridizations and in situ hybridizations. In vitro techniques for detection of an analyte protein include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations, and immunofluorescence. In vitro techniques for detection of an analyte genomic DNA include Southern hybridizations. Procedures for conducting immunoassays are described, for example in "ELISA: Theory and Practice: Methods in Molecular Biology", Vol. 42, J. R. Crowther (Ed.) Human Press, Totowa, NJ, 1995; "Immunoassay", E. Diamandis and T. Christopoulus, Academic Press, Inc., San Diego, CA, 1996; and "Practice and Thory of Enzyme Immunoassays", P. Tijssen, Elsevier Science Publishers, Amsterdam, 1985. Furthermore, in vivo techniques for detection of an analyte protein include introducing into a subject a labeled anti-an analyte protein antibody. For example, the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
NOVX Recombinant Expression Vectors and Host Cells
Another aspect of the invention pertains to vectors, preferably expression vectors, containing a nucleic acid encoding A NOVX protein, or derivatives, fragments, analogs or homologs thereof. As used herein, the term "vector" refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a "plasmid", which refers to a circular double stranded DNA loop into which additional DNA segments can be ligated. Another type of vector is a viral vector, wherein additional DNA segments can be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively-linked. Such vectors are referred to herein as "expression vectors". In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, "plasmid" and "vector" can be used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
The recombinant expression vectors of the invention comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory sequences, selected on the basis of the host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed. Within a recombinant expression vector, "operably-linked" is intended to mean that the nucleotide sequence of interest is linked to the regulatory sequence(s) in a manner that allows for expression of the nucleotide sequence (e.g., in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell). The term "regulatory sequence" is intended to includes promoters, enhancers and other expression control elements (e.g., polyadenylation signals). Such regulatory sequences are described, for example, in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g. , tissue-specific regulatory sequences). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc. The expression vectors of the invention can be introduced into host cells to thereby produce proteins or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., NOVX proteins, mutant forms of NOVX proteins, fusion proteins, etc.).
The recombinant expression vectors of the invention can be designed for expression of NOVX proteins in prokaryotic or eukaryotic cells. For example, NOVX proteins can be expressed in bacterial cells such as Escherichia coli, insect cells (using baculovirus expression vectors) yeast cells or mammalian cells. Suitable host cells are discussed further in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Alternatively, the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.
Expression of proteins in prokaryotes is most often carried out in Escherichia coli with vectors containing constitutive or inducible promoters directing the expression of either fusion or non-fusion proteins. Fusion vectors add a number of amino acids to a protein encoded therein, usually to the amino terminus of the recombinant protein. Such fusion vectors typically serve three purposes: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (iii) to aid in the purification of the
recombinant protein by acting as a ligand in affinity purification. Often, in fusion expression vectors, a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein. Such enzymes, and their cognate recognition sequences, include Factor Xa, thrombin and enterokinase. Typical fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith and Johnson, 1988. Gene 67: 31-40), pMAL (New England Biolabs, Beverly, Mass.) and pRIT5 (Pharmacia, Piscataway, N.J.) that fuse glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the target recombinant protein. Examples of suitable inducible non-fusion E. coli expression vectors include pTrc
(Amrann et al, (1988) Gene 69:301-315) and pET lid (Srudier et al, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 60-89).
One strategy to maximize recombinant protein expression in E. coli is to express the protein in a host bacteria with an impaired capacity to proteolytically cleave the recombinant protein. See, e.g., Gottesman, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 119-128. Another strategy is to alter the nucleic acid sequence of the nucleic acid to be inserted into an expression vector so that the individual codons for each amino acid are those preferentially utilized in E. coli (see, e.g., Wada, et al, 1992. Nucl. Acids Res. 20: 2111-2118). Such alteration of nucleic acid sequences of the invention can be carried out by standard DNA synthesis techniques.
In another embodiment, the NOVX expression vector is a yeast expression vector. Examples of vectors for expression in yeast Saccharomyces cerivisae include pYepSecl (Baldari, et al, 1987. EMBOJ. 6: 229-234), pMFa (Kurjan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et al, 1987. Gene 54: 113-123), pYES2 (Invifrogen Corporation, San Diego, Calif), and picZ (InVitrogen Corp, San Diego, Calif.).
Alternatively, NOVX can be expressed in insect cells using baculovirus expression vectors. Baculovirus vectors available for expression of proteins in cultured insect cells (e.g., SF9 cells) include the pAc series (Smith, et al, 1983. Mol. Cell Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).
In yet another embodiment, a nucleic acid of the invention is expressed in mammalian cells using a mammalian expression vector. Examples of mammalian expression vectors include pCDM8 (Seed, 1987. Nature 329: 840) and pMT2PC (Kaufman, et al, 1987. EMBO
J. 6: 187-195). When used in mammalian cells, the expression vector's control functions are
often provided by viral regulatory elements. For example, commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, and simian virus 40. For other suitable expression systems for both prokaryotic and eukaryotic cells see, e.g., Chapters 16 and 17 of Sambrook, et al, MOLECULAR CLONING: A LABORATORY MANUAL. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989. In another embodiment, the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid). Tissue-specific regulatory elements are known in the art. Non-limiting examples of suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, et al, 1987. Genes Dev. 1 : 268-277), lymphoid-specific promoters (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), in particular promoters of T cell receptors (Winoto and Baltimore, 1989. EMBO J. 8: 729-733) and immunoglobulins (Banerji, et al, 1983. Cell 33: 729-740; Queen and Baltimore, 1983. Cell 33: 741-748), neuron-specific promoters (e.g., the neurofilament promoter; Byrne and Ruddle, 1989. Proc. Natl. Acad. Sci. USA 86: 5473-5477), pancreas-specific promoters (Edlund, et al, 1985. Science 230: 912-916), and mammary gland-specific promoters (e.g., milk whey promoter; U.S. Pat. No. 4,873,316 and European Application Publication No. 264,166). Developmentally-regulated promoters are also encompassed, e.g., the murine hox promoters (Kessel and Grass, 1990. Science 249: 374-379) and the α-fetoprotein promoter (Campes and Tilghman, 1989. Genes Dev. 3: 537-546).
The invention further provides a recombinant expression vector comprising a DNA molecule of the invention cloned into the expression vector in an antisense orientation. That is, the DNA molecule is operatively-linked to a regulatory sequence in a manner that allows for expression (by transcription of the DNA molecule) of an RNA molecule that is antisense to NOVX mRNA. Regulatory sequences operatively linked to a nucleic acid cloned in the antisense orientation can be chosen that direct the continuous expression of the antisense RNA molecule in a variety of cell types, for instance viral promoters and/or enhancers, or regulatory sequences can be chosen that direct constitutive, tissue specific or cell type specific expression of antisense RNA. The antisense expression vector can be in the form of a recombinant plasmid, phagemid or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced. For a discussion of the regulation of gene expression using antisense genes see, e.g., Weintraub, et al, "Antisense RNA as a molecular tool for genetic analysis," Reviews-Trends in Genetics, Vol. 1(1) 1986.
Another aspect of the invention pertains to host cells into which a recombinant expression vector of the invention has been introduced. The terms "host cell" and "recombinant host cell" are used interchangeably herein. It is understood that such terms refer not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
A host cell can be any prokaryotic or eukaryotic cell. For example, NOVX protein can be expressed in bacterial cells such as E. coli, insect cells, yeast or mammalian cells (such as Chinese hamster ovary cells (CHO) or COS cells). Other suitable host cells are known to those skilled in the art.
Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. As used herein, the terms "transformation" and "transfection" are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g. , DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, or electroporation. Suitable methods for transforming or transfecting host cells can be found in Sambrook, et al. (MOLECULAR CLONING: A LABORATORY MANUAL. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989), and other laboratory manuals.
For stable transfection of mammalian cells, it is known that, depending upon the expression vector and transfection technique used, only a small fraction of cells may integrate the foreign DNA into their genome. In order to identify and select these integrants, a gene that encodes a selectable marker (e.g., resistance to antibiotics) is generally introduced into the host cells along with the gene of interest. Various selectable markers include those that confer resistance to drugs, such as G418, hygromycin and methotrexate. Nucleic acid encoding a selectable marker can be introduced into a host cell on the same vector as that encoding NOVX or can be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die).
A host cell of the invention, such as a prokaryotic or eukaryotic host cell in culture, can be used to produce (i.e., express) NOVX protein. Accordingly, the invention further provides methods for producing NOVX protein using the host cells of the invention. In one embodiment, the method comprises culturing the host cell of invention (into which a
recombinant expression vector encoding NOVX protein has been introduced) in a suitable medium such that NOVX protein is produced. In another embodiment, the method further comprises isolating NOVX protein from the medium or the host cell.
Transgenic NOVX Animals
The host cells of the invention can also be used to produce non-human transgenic animals. For example, in one embodiment, a host cell of the invention is a fertilized oocyte or an embryonic stem cell into which NOVX protein-coding sequences have been introduced. Such host cells can then be used to create non-human transgenic animals in which exogenous NOVX sequences have been introduced into their genome or homologous recombinant animals in which endogenous NOVX sequences have been altered. Such animals are useful for studying the function and/or activity of NOVX protein and for identifying and/or evaluating modulators of NOVX protein activity. As used herein, a "transgenic animal" is a non-human animal, preferably a mammal, more preferably a rodent such as a rat or mouse, in which one or more of the cells of the animal includes a transgene. Other examples of transgenic animals include non-human primates, sheep, dogs, cows, goats, chickens, amphibians, etc. A transgene is exogenous DNA that is integrated into the genome of a cell from which a transgenic animal develops and that remains in the genome of the mature animal, thereby directing the expression of an encoded gene product in one or more cell types or tissues of the transgenic animal. As used herein, a "homologous recombinant animal" is a non-human animal, preferably a mammal, more preferably a mouse, in which an endogenous NOVX gene has been altered by homologous recombination between the endogenous gene and an exogenous DNA molecule introduced into a cell of the animal, e.g., an embryonic cell of the animal, prior to development of the animal. A transgenic animal of the invention can be created by introducing NOVX-encoding nucleic acid into the male pronuclei of a fertilized oocyte (e.g., by microinjection, retroviral infection) and allowing the oocyte to develop in a pseudopregnant female foster animal. The human NOVX cDNA sequences SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, can be introduced as a transgene into the genome of a non-human animal. Alternatively, a non-human homologue of the human NOVX gene, such as a mouse NOVX gene, can be isolated based on hybridization to the human NOVX cDNA (described further supra) and used as a transgene. Intronic sequences and polyadenylation signals can also be included in the transgene to increase the efficiency of expression of the transgene. A tissue-specific regulatory sequence(s) can be operably-linked to the NOVX transgene to direct expression of
NOVX protein to particular cells. Methods for generating transgenic animals via embryo manipulation and microinjection, particularly animals such as mice, have become conventional in the art and are described, for example, in U.S. Patent Nos. 4,736,866; 4,870,009; and 4,873,191; and Hogan, 1986. In: MANIPULATING THE MOUSE EMBRYO, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. Similar methods are used for production of other transgenic animals. A transgenic founder animal can be identified based upon the presence of the NOVX transgene in its genome and/or expression of NOVX mRNA in tissues or cells of the animals. A transgenic founder animal can then be used to breed additional animals carrying the transgene. Moreover, transgenic animals carrying a transgene- encoding NOVX protein can further be bred to other transgenic animals carrying other transgenes.
To create a homologous recombinant animal, a vector is prepared which contains at least a portion of A NOVX gene into which a deletion, addition or substitution has been introduced to thereby alter, e.g., functionally disrupt, the NOVX gene. The NOVX gene can be a human gene (e.g. , the cDNA of SEQ ID NOS:2n-l , wherein n is an integer between 1 and 86), but more preferably, is a non-human homologue of a human NOVX gene. For example, a mouse homologue of human NOVX gene of SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, can be used to construct a homologous recombination vector suitable for altering an endogenous NOVX gene in the mouse genome. In one embodiment, the vector is designed such that, upon homologous recombination, the endogenous NOVX gene is functionally disrupted (i.e., no longer encodes a functional protein; also referred to as a "knock out" vector).
Alternatively, the vector can be designed such that, upon homologous recombination, the endogenous NOVX gene is mutated or otherwise altered but still encodes functional protein (e.g., the upstream regulatory region can be altered to thereby alter the expression of the endogenous NOVX protein). In the homologous recombination vector, the altered portion of the NOVX gene is flanked at its 5'- and 3'-termini by additional nucleic acid of the NOVX gene to allow for homologous recombination to occur between the exogenous NOVX gene carried by the vector and an endogenous NOVX gene in an embryonic stem cell. The additional flanking NOVX nucleic acid is of sufficient length for successful homologous recombination with the endogenous gene. Typically, several kilobases of flanking DNA (both at the 5'- and 3'-termini) are included in the vector. See, e.g., Thomas, et al, 1987. Cell 51:
503 for a description of homologous recombination vectors. The vector is ten introduced into an embryonic stem cell line (e.g., by electroporation) and cells in which the introduced NOVX
gene has homologously-recombined with the endogenous NOVX gene are selected. See, e.g., Li, et al, 1992. Cell 69: 915.
The selected cells are then injected into a blastocyst of an animal (e.g., a mouse) to form aggregation chimeras. See, e.g., Bradley, 1987. In: TERATOCARCINOMAS AND EMBRYONIC STEM CELLS: A PRACTICAL APPROACH, Robertson, ed. IRL, Oxford, pp. 113-152. A chimeric embryo can then be implanted into a suitable pseudopregnant female foster animal and the embryo brought to term. Progeny harboring the homologously-recombined DNA in their germ cells can be used to breed animals in which all cells of the animal contain the homologously-recombined DNA by germline transmission of the transgene. Methods for constructing homologous recombination vectors and homologous recombinant animals are described further in Bradley, 1991. Curr. Opin. Biotechnol 2: 823-829; PCT International Publication Nos.: WO 90/11354; WO 91/01140; WO 92/0968; and WO 93/04169.
In another embodiment, transgenic non-humans animals can be produced that contain selected systems that allow for regulated expression of the transgene. One example of such a system is the cre/loxP recombinase system of bacteriophage PI . For a description of the cre/loxP recombinase system, See, e.g., Lakso, et al., 1992. Proc. Natl. Acad. Sci. USA 89: 6232-6236. Another example of a recombinase system is the FLP recombinase system of Saccharomyces cerevisiae. See, O'Gorman, et al, 1991. Science 251 : 1351-1355. If a cre/loxP recombinase system is used to regulate expression of the transgene, animals containing transgenes encoding both the Cre recombinase and a selected protein are required. Such animals can be provided through the construction of "double" transgenic animals, e.g., by mating two transgenic animals, one containing a transgene encoding a selected protein and the other containing a transgene encoding a recombinase.
Clones of the non-human transgenic animals described herein can also be produced according to the methods described in Wilmut, et al, 1997. Nature 385: 810-813. In brief, a cell (e.g., a somatic cell) from the transgenic animal can be isolated and induced to exit the growth cycle and enter Go phase. The quiescent cell can then be fused, e.g., through the use of electrical pulses, to an enucleated oocyte from an animal of the same species from which the quiescent cell is isolated. The reconstructed oocyte is then cultured such that it develops to morula or blastocyte and then transferred to pseudopregnant female foster animal. The offspring borne of this female foster animal will be a clone of the animal from which the cell (e.g., the somatic cell) is isolated.
Pharmaceutical Compositions
The NOVX nucleic acid molecules, NOVX proteins, and anti-NOVX antibodies (also referred to herein as "active compounds") of the invention, and derivatives, fragments, analogs and homologs thereof, can be incorporated into pharmaceutical compositions suitable for administration. Such compositions typically comprise the nucleic acid molecule, protein, or antibody and a pharmaceutically acceptable carrier. As used herein, "pharmaceutically acceptable carrier" is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Suitable carriers are described in the most recent edition of Remington's Pharmaceutical Sciences, a standard reference text in the field, which is incorporated herein by reference. Preferred examples of such carriers or diluents include, but are not limited to, water, saline, finger's solutions, dextrose solution, and 5% human serum albumin. Liposomes and non-aqueous vehicles such as fixed oils may also be used. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
A pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration. Examples of routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (i.e., topical), transmucosal, and rectal administration. Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and agents for the adjustment of tonicity such as sodium chloride or dextrose. The pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
Pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. For intravenous administration,
suitable carriers include physiological saline, bacteriostatic water, Cremophor EL (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringeability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as manitol, sorbitol, sodium chloride in the composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
Sterile injectable solutions can be prepared by incorporating the active compound (e.g., A NOVX protein or anti-NOVX antibody) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the purpose of oral therapeutic administration, the active compound can be incorporated with excipients and used in the form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition. The tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient
such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring. For administration by inhalation, the compounds are delivered in the form of an aerosol spray from pressured container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
Systemic administration can also be by transmucosal or transdermal means. For transmucosal or transdermal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives. Transmucosal administration can be accomplished through the use of nasal sprays or suppositories. For transdermal administration, the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art. The compounds can also be prepared in the form of suppositories (e.g. , with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
In one embodiment, the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art. The materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Inc. Liposomal suspensions (including liposomes targeted to infected cells with monoclonal antibodies to viral antigens) can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Patent No. 4,522,811.
It is especially advantageous to formulate oral or parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent
on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.
The nucleic acid molecules of the invention can be inserted into vectors and used as gene therapy vectors. Gene therapy vectors can be delivered to a subject by, for example, intravenous injection, local administration (see, e.g., U.S. Patent No. 5,328,470) or by stereotactic injection (see, e.g., Chen, et al, 1994. Proc. Natl. Acad. Sci. USA 91: 3054-3057). The pharmaceutical preparation of the gene therapy vector can include the gene therapy vector in an acceptable diluent, or can comprise a slow release matrix in which the gene delivery vehicle is imbedded. Alternatively, where the complete gene delivery vector can be produced intact from recombinant cells, e.g. , retroviral vectors, the pharmaceutical preparation can include one or more cells that produce the gene delivery system.
The pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration.
Screening and Detection Methods
The isolated nucleic acid molecules of the invention can be used to express NOVX protein (e.g., via a recombinant expression vector in a host cell in gene therapy applications), to detect NOVX mRNA (e.g., in a biological sample) or a genetic lesion in A NOVX gene, and to modulate NOVX activity, as described further, below. In addition, the NOVX proteins can be used to screen drugs or compounds that modulate the NOVX protein activity or expression as well as to treat disorders characterized by insufficient or excessive production of NOVX protein or production of NOVX protein forms that have decreased or aberrant activity compared to NOVX wild-type protein (e.g.; diabetes (regulates insulin release); obesity (binds and transport lipids); metabolic disturbances associated with obesity, the metabolic syndrome X as well as anorexia and wasting disorders associated with chronic diseases and various cancers, and infectious disease(possesses anti-microbial activity) and the various dyslipidemias. In addition, the anti-NOVX antibodies of the invention can be used to detect and isolate NOVX proteins and modulate NOVX activity. In yet a further aspect, the invention can be used in methods to influence appetite, absorption of nutrients and the disposition of metabolic substrates in both a positive and negative fashion.
The invention further pertains to novel agents identified by the screening assays described herein and uses thereof for treatments as described, supra.
Screening Assays
The invention provides a method (also referred to herein as a "screening assay") for identifying modulators, i.e., candidate or test compounds or agents (e.g., peptides, peptidomimetics, small molecules or other drugs) that bind to NOVX proteins or have a stimulatory or inhibitory effect on, e.g., NOVX protein expression or NOVX protein activity. The invention also includes compounds identified in the screening assays described herein.
In one embodiment, the invention provides assays for screening candidate or test compounds which bind to or modulate the activity of the membrane-bound form of A NOVX protein or polypeptide or biologically-active portion thereof. The test compounds of the invention can be obtained using any of the numerous approaches in combinatorial library methods known in the art, including: biological libraries; spatially addressable parallel solid phase or solution phase libraries; synthetic library methods requiring deconvolution; the "one-bead one-compound" library method; and synthetic library methods using affinity chromatography selection. The biological library approach is limited to peptide libraries, while the other four approaches are applicable to peptide, non-peptide oligomer or small molecule libraries of compounds. See, e.g., Lam, 1997 '. Anticancer Drug Design 12: 145.
A "small molecule" as used herein, is meant to refer to a composition that has a molecular weight of less than about 5 kD and most preferably less than about 4 kD. Small molecules can be, e.g., nucleic acids, peptides, polypeptides, peptidomimetics, carbohydrates, lipids or other organic or inorganic molecules. Libraries of chemical and/or biological mixtures, such as fungal, bacterial, or algal extracts, are known in the art and can be screened with any of the assays of the invention.
Examples of methods for the synthesis of molecular libraries can be found in the art, for example in: DeWitt, et al, 1993. Proc. Natl. Acad. Sci. U.S.A. 90: 6909; Erb, et al, 1994. Proc. Natl. Acad. Sci. U.S.A. 91 : 11422; Zuckermann, et al, 1994. J Med. Chem. 37: 2678; Cho, et al, 1993. Science 261 : 1303; Carrell, et al, 1994. Angew. Chem. Int. Ed. Eng 33: 2059; Carell, et al, 1994. Angew. Chem. Int. Ed. Eng 33: 2061; and Gallop, et al, 1994. J. Med. Chem. 37: 1233.
Libraries of compounds may be presented in solution (e.g., Houghten, 1992. Biotechniques 13: 412-421), or on beads (Lam, 1991. Nature 354: 82-84), on chips (Fodor, 1993. Nature 364: 555-556), bacteria (Ladner, U.S. Patent No. 5,223,409), spores (Ladner, U.S. Patent 5,233,409), plasmids (Cull, et al, 1992. Proc. Natl. Acad. Sci. USA 89: 1865-1869) or on phage (Scott and Smith, 1990. Science 249: 386-390; Devlin, 1990. Science
249: 404-406; Cwirla, et al, 1990. Proc. Natl. Acad. Sci. U.S.A. 87: 6378-6382; Felici, 1991. J Mol. Biol. 222: 301-310; Ladner, U.S. Patent No. 5,233,409.).
In one embodiment, an assay is a cell-based assay in which a cell which expresses a membrane-bound form of NOVX protein, or a biologically-active portion thereof, on the cell surface is contacted with a test compound and the ability of the test compound to bind to A NOVX protein determined. The cell, for example, can of mammalian origin or a yeast cell. Determining the ability of the test compound to bind to the NOVX protein can be accomplished, for example, by coupling the test compound with a radioisotope or enzymatic label such that binding of the test compound to the NOVX protein or biologically-active portion thereof can be determined by detecting the labeled compound in a complex. For example, test compounds can be labeled with 1251, 35S, 14C, or 3H, either directly or indirectly, and the radioisotope detected by direct counting of radioemission or by scintillation counting. Alternatively, test compounds can be enzymatically-labeled with, for example, horseradish peroxidase, alkaline phosphatase, or luciferase, and the enzymatic label detected by determination of conversion of an appropriate substrate to product. In one embodiment, the assay comprises contacting a cell which expresses a membrane-bound form of NOVX protein, or a biologically-active portion thereof, on the cell surface with a known compound which binds NOVX to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with A NOVX protein, wherein determining the ability of the test compound to interact with A NOVX protein comprises determining the ability of the test compound to preferentially bind to NOVX protein or a biologically-active portion thereof as compared to the known compound.
In another embodiment, an assay is a cell-based assay comprising contacting a cell expressing a membrane-bound form of NOVX protein, or a biologically-active portion thereof, on the cell surface with a test compound and determining the ability of the test compound to modulate (e.g., stimulate or inhibit) the activity of the NOVX protein or biologically-active portion thereof. Determining the ability of the test compound to modulate the activity of NOVX or a biologically-active portion thereof can be accomplished, for example, by determining the ability of the NOVX protein to bind to or interact with A NOVX target molecule. As used herein, a "target molecule" is a molecule with which A NOVX protein binds or interacts in nature, for example, a molecule on the surface of a cell which expresses A
NOVX interacting protein, a molecule on the surface of a second cell, a molecule in the extracellular milieu, a molecule associated with the internal surface of a cell membrane or a cytoplasmic molecule. A NOVX target molecule can be a non-NOVX molecule or A NOVX
protein or polypeptide of the invention. In one embodiment, A NOVX target molecule is a component of a signal transduction pathway that facilitates transduction of an extracellular signal (e.g. a signal generated by binding of a compound to a membrane-bound NOVX molecule) through the cell membrane and into the cell. The target, for example, can be a second intercellular protein that has catalytic activity or a protein that facilitates the association of downstream signaling molecules with NOVX.
Determining the ability of the NOVX protein to bind to or interact with A NOVX target molecule can be accomplished by one of the methods described above for determining direct binding. In one embodiment, determining the ability of the NOVX protein to bind to or interact with A NOVX target molecule can be accomplished by determining the activity of the target molecule. For example, the activity of the target molecule can be determined by detecting induction of a cellular second messenger of the target (t.e. intraceliular Ca2+, diacylglycerol, IP3, etc.), detecting catalytic/enzymatic activity of the target an appropriate substrate, detecting the induction of a reporter gene (comprising A NOVX-responsive regulatory element operatively linked to a nucleic acid encoding a detectable marker, e.g., luciferase), or detecting a cellular response, for example, cell survival, cellular differentiation, or cell proliferation.
In yet another embodiment, an assay of the invention is a cell-free assay comprising contacting A NOVX protein or biologically-active portion thereof with a test compound and determining the ability of the test compound to bind to the NOVX protein or biologically- active portion thereof. Binding of the test compound to the NOVX protein can be determined either directly or indirectly as described above. In one such embodiment, the assay comprises contacting the NOVX protein or biologically-active portion thereof with a known compound which binds NOVX to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with A NOVX protein, wherein determining the ability of the test compound to interact with A NOVX protein comprises determining the ability of the test compound to preferentially bind to NOVX or biologically-active portion thereof as compared to the known compound.
In still another embodiment, an assay is a cell-free assay comprising contacting NOVX protein or biologically-active portion thereof with a test compound and determining the ability of the test compound to modulate (e.g. stimulate or inhibit) the activity of the NOVX protein or biologically-active portion thereof. Determining the ability of the test compound to modulate the activity of NOVX can be accomplished, for example, by determining the ability of the NOVX protein to bind to A NOVX target molecule by one of the methods described
above for determining direct binding. In an alternative embodiment, determining the ability of the test compound to modulate the activity of NOVX protein can be accomplished by determining the ability of the NOVX protein further modulate A NOVX target molecule. For example, the catalytic/enzymatic activity of the target molecule on an appropriate substrate can be determined as described, supra.
In yet another embodiment, the cell-free assay comprises contacting the NOVX protein or biologically-active portion thereof with a known compound which binds NOVX protein to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with A NOVX protein, wherein determining the ability of the test compound to interact with A NOVX protein comprises determining the ability of the NOVX protein to preferentially bind to or modulate the activity of A NOVX target molecule.
The cell-free assays of the invention are amenable to use of both the soluble form or the membrane-bound form of NOVX protein. In the case of cell-free assays comprising the membrane-bound form of NOVX protein, it may be desirable to utilize a solubilizing agent such that the membrane-bound form of NOVX protein is maintained in solution. Examples of such solubilizing agents include non-ionic detergents such as n-octylglucoside, n-dodecylglucoside, n-dodecylmaltoside, octanoyl-N-methylglucamide, decanoyl-N-methylglucamide, Triton® X-100, Triton® X-l 14, Thesit®, Isotridecypoly(ethylene glycol ether),,, N-dodecyl~N,N-dimethyl-3 -ammonio- 1 -propane sulfonate, 3-(3-cholamidopropyl) dimethylamminiol-1 -propane sulfonate (CHAPS), or 3-(3-cholamidopropyl)dimethylamminiol-2-hydroxy-l-propane sulfonate (CHAPSO).
In more than one embodiment of the above assay methods of the invention, it may be desirable to immobilize either NOVX protein or its target molecule to facilitate separation of complexed from uncomplexed forms of one or both of the proteins, as well as to accommodate automation of the assay. Binding of a test compound to NOVX protein, or interaction of NOVX protein with a target molecule in the presence and absence of a candidate compound, can be accomplished in any vessel suitable for containing the reactants. Examples of such vessels include microtiter plates, test tubes, and micro-centrifuge tubes. In one embodiment, a fusion protein can be provided that adds a domain that allows one or both of the proteins to be bound to a matrix. For example, GST-NO VX fusion proteins or GST-target fusion proteins can be adsorbed onto glutathione sepharose beads (Sigma Chemical, St. Louis, MO) or glutathione derivatized microtiter plates, that are then combined with the test compound or the test compound and either the non-adsorbed target protein or NOVX protein, and the mixture is
incubated under conditions conducive to complex formation (e.g., at physiological conditions for salt and pH). Following incubation, the beads or microtiter plate wells are washed to remove any unbound components, the matrix immobilized in the case of beads, complex determined either directly or indirectly, for example, as described, supra. Alternatively, the complexes can be dissociated from the matrix, and the level of NOVX protein binding or activity determined using standard techniques.
Other techniques for immobilizing proteins on matrices can also be used in the screening assays of the invention. For example, either the NOVX protein or its target molecule can be immobilized utilizing conjugation of biotin and streptavidin. Biotinylated NOVX protein or target molecules can be prepared from biotin-NHS
(N-hydroxy-succinimide) using techniques well-known within the art (e.g., biotinylation kit, Pierce Chemicals, Rockford, 111.), and immobilized in the wells of streptavidin-coated 96 well plates (Pierce Chemical). Alternatively, antibodies reactive with NOVX protein or target molecules, but which do not interfere with binding of the NOVX protein to its target molecule, can be derivatized to the wells of the plate, and unbound target or NOVX protein trapped in the wells by antibody conjugation. Methods for detecting such complexes, in addition to those described above for the GST-immobilized complexes, include immunodetection of complexes using antibodies reactive with the NOVX protein or target molecule, as well as enzyme-linked assays that rely on detecting an enzymatic activity associated with the NOVX protein or target molecule.
In another embodiment, modulators of NOVX protein expression are identified in a method wherein a cell is contacted with a candidate compound and the expression of NOVX mRNA or protein in the cell is determined. The level of expression of NOVX mRNA or protein in the presence of the candidate compound is compared to the level of expression of NOVX mRNA or protein in the absence of the candidate compound. The candidate compound can then be identified as a modulator of NOVX mRNA or protein expression based upon this comparison. For example, when expression of NOVX mRNA or protein is greater (i.e., statistically significantly greater) in the presence of the candidate compound than in its absence, the candidate compound is identified as a stimulator of NOVX mRNA or protein expression. Alternatively, when expression of NOVX mRNA or protein is less (statistically significantly less) in the presence of the candidate compound than in its absence, the candidate compound is identified as an inhibitor of NOVX mRNA or protein expression. The level of
NOVX mRNA or protein expression in the cells can be determined by methods described herein for detecting NOVX mRNA or protein.
In yet another aspect of the invention, the NOVX proteins can be used as "bait proteins" in a two-hybrid assay or three hybrid assay (see, e.g. , U.S. Patent No. 5,283,317; Zervos, et al, 1993. Ce// 72: 223-232; Madura, et al, 1993. J Biol. Chem. 268: 12046-12054; Barrel, et al, 1993. Biotechniques 14: 920-924; Iwabuchi, et al, 1993. Oncogene 8: 1693- 1696; and Brent WO 94/10300), to identify other proteins that bind to or interact with NOVX ("NOVX-binding proteins" or "NOVX-bp") and modulate NOVX activity. Such NOVX-binding proteins are also likely to be involved in the propagation of signals by the NOVX proteins as, for example, upstream or downstream elements of the NOVX pathway. The two-hybrid system is based on the modular nature of most transcription factors, which consist of separable DNA-binding and activation domains. Briefly, the assay utilizes two different DNA constructs. In one construct, the gene that codes for NOVX is fused to a gene encoding the DNA binding domain of a known transcription factor (e.g., GAL-4). In the other construct, a DNA sequence, from a library of DNA sequences, that encodes an unidentified protein ("prey" or "sample") is fused to a gene that codes for the activation domain of the known transcription factor. If the "bait" and the "prey" proteins are able to interact, in vivo, forming A NOVX-dependent complex, the DNA-binding and activation domains of the transcription factor are brought into close proximity. This proximity allows transcription of a reporter gene (e.g., LacZ) that is operably linked to a transcriptional regulatory site responsive to the transcription factor. Expression of the reporter gene can be detected and cell colonies containing the functional transcription factor can be isolated and used to obtain the cloned gene that encodes the protein which interacts with NOVX.
The invention further pertains to novel agents identified by the aforementioned screening assays and uses thereof for treatments as described herein.
Detection Assays
Portions or fragments of the cDNA sequences identified herein (and the corresponding complete gene sequences) can be used in numerous ways as polynucleotide reagents. By way of example, and not of limitation, these sequences can be used to: (i) map their respective genes on a chromosome; and, thus, locate gene regions associated with genetic disease; (ii) identify an individual from a minute biological sample (tissue typing); and (iii) aid in forensic identification of a biological sample. Some of these applications are described in the subsections, below.
Chromosome Mapping
Once the sequence (or a portion of the sequence) of a gene has been isolated, this sequence can be used to map the location of the gene on a chromosome. This process is called chromosome mapping. Accordingly, portions or fragments of the NOVX sequences, SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, or fragments or derivatives thereof, can be used to map the location of the NOVX genes, respectively, on a chromosome. The mapping of the NOVX sequences to chromosomes is an important first step in correlating these sequences with genes associated with disease. Briefly, NOVX genes can be mapped to chromosomes by preparing PCR primers
(preferably 15-25 bp in length) from the NOVX sequences. Computer analysis of the NOVX, sequences can be used to rapidly select primers that do not span more than one exon in the genomic DNA, thus complicating the amplification process. These primers can then be used for PCR screening of somatic cell hybrids containing individual human chromosomes. Only those hybrids containing the human gene corresponding to the NOVX sequences will yield an amplified fragment.
Somatic cell hybrids are prepared by fusing somatic cells from different mammals (e.g., human and mouse cells). As hybrids of human and mouse cells grow and divide, they gradually lose human chromosomes in random order, but retain the mouse chromosomes. By using media in which mouse cells cannot grow, because they lack a particular enzyme, but in which human cells can, the one human chromosome that contains the gene encoding the needed enzyme will be retained. By using various media, panels of hybrid cell lines can be established. Each cell line in a panel contains either a single human chromosome or a small number of human chromosomes, and a full set of mouse chromosomes, allowing easy mapping of individual genes to specific human chromosomes. See, e.g., D'Eustachio, et al, 1983. Science 220: 919-924. Somatic cell hybrids containing only fragments of human chromosomes can also be produced by using human chromosomes with translocations and deletions.
PCR mapping of somatic cell hybrids is a rapid procedure for assigning a particular sequence to a particular chromosome. Three or more sequences can be assigned per day using a single thermal cycler. Using the NOVX sequences to design oligonucleotide primers, sub- localization can be achieved with panels of fragments from specific chromosomes. Fluorescence in situ hybridization (FISH) of a DNA sequence to a metaphase chromosomal spread can further be used to provide a precise chromosomal location in one
step. Chromosome spreads can be made using cells whose division has been blocked in metaphase by a chemical like colcemid that disrupts the mitotic spindle. The chromosomes can be treated briefly with trypsin, and then stained with Giemsa. A pattern of light and dark bands develops on each chromosome, so that the chromosomes can be identified individually. The FISH technique can be used with a DNA sequence as short as 500 or 600 bases. However, clones larger than 1,000 bases have a higher likelihood of binding to a unique chromosomal location with sufficient signal intensity for simple detection. Preferably 1,000 bases, and more preferably 2,000 bases, will suffice to get good results at a reasonable amount of time. For a review of this technique, see, Verma, et al, HUMAN CHROMOSOMES: A MANUAL OF BASIC TECHNIQUES (Pergamon Press, New York 1988).
Reagents for chromosome mapping can be used individually to mark a single chromosome or a single site on that chromosome, or panels of reagents can be used for marking multiple sites and/or multiple chromosomes. Reagents corresponding to noncoding regions of the genes actually are preferred for mapping purposes. Coding sequences are more likely to be conserved within gene families, thus increasing the chance of cross hybridizations during chromosomal mapping.
Once a sequence has been mapped to a precise chromosomal location, the physical position of the sequence on the chromosome can be correlated with genetic map data. Such data are found, e.g., in McKusick, MENDELIAN INHERITANCE IN MAN, available on-line through Johns Hopkins University Welch Medical Library). The relationship between genes and disease, mapped to the same chromosomal region, can then be identified through linkage analysis (co-inheritance of physically adjacent genes), described in, e.g., Egeland, et al, 1987. Nature, 325: 783-787.
Moreover, differences in the DNA sequences between individuals affected and unaffected with a disease associated with the NOVX gene, can be determined. If a mutation is observed in some or all of the affected individuals but not in any unaffected individuals, then the mutation is likely to be the causative agent of the particular disease. Comparison of affected and unaffected individuals generally involves first looking for structural alterations in the chromosomes, such as deletions or translocations that are visible from chromosome spreads or detectable using PCR based on that DNA sequence. Ultimately, complete sequencing of genes from several individuals can be performed to confirm the presence of a mutation and to distinguish mutations from polymorphisms.
Tissue Typing
The NOVX sequences of the invention can also be used to identify individuals from minute biological samples. In this technique, an individual's genomic DNA is digested with one or more restriction enzymes, and probed on a Southern blot to yield unique bands for identification. The sequences of the invention are useful as additional DNA markers for RFLP ("restriction fragment length polymorphisms," described in U.S. Patent No. 5,272,057). Furthermore, the sequences of the invention can be used to provide an alternative technique that determines the actual base-by-base DNA sequence of selected portions of an individual's genome. Thus, the NOVX sequences described herein can be used to prepare two PCR primers from the 5'- and 3'-termini of the sequences. These primers can then be used to amplify an individual's DNA and subsequently sequence it.
Panels of corresponding DNA sequences from individuals, prepared in this manner, can provide unique individual identifications, as each individual will have a unique set of such DNA sequences due to allelic differences. The sequences of the invention can be used to obtain such identification sequences from individuals and from tissue. The NOVX sequences of the invention uniquely represent portions of the human genome. Allelic variation occurs to some degree in the coding regions of these sequences, and to a greater degree in the noncoding regions. It is estimated that allelic variation between individual humans occurs with a frequency of about once per each 500 bases. Much of the allelic variation is due to single nucleotide polymorphisms (SNPs), which include restriction fragment length polymorphisms (RFLPs).
Each of the sequences described herein can, to some degree, be used as a standard against which DNA from an individual can be compared for identification purposes. Because greater numbers of polymorphisms occur in the noncoding regions, fewer sequences are necessary to differentiate individuals. The noncoding sequences can comfortably provide positive individual identification with a panel of perhaps 10 to 1,000 primers that each yield a noncoding amplified sequence of 100 bases. If predicted coding sequences, such as those in SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, are used, a more appropriate number of primers for positive individual identification would be 500-2,000.
Predictive Medicine
The invention also pertains to the field of predictive medicine in which diagnostic assays, prognostic assays, pharmacogenomics, and monitoring clinical trials are used for
prognostic (predictive) purposes to thereby treat an individual prophylactically. Accordingly, one aspect of the invention relates to diagnostic assays for determining NOVX protein and/or nucleic acid expression as well as NOVX activity, in the context of a biological sample (e.g., blood, serum, cells, tissue) to thereby determine whether an individual is afflicted with a disease or disorder, or is at risk of developing a disorder, associated with aberrant NOVX expression or activity. The disorders include metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer-associated cachexia, cancer, neurodegenerative disorders, Alzheimer's Disease, Parkinson's Disorder, immune disorders, and hematopoietic disorders, and the various dyslipidemias, metabolic disturbances associated with obesity, the metabolic syndrome X and wasting disorders associated with chronic diseases and various cancers. The invention also provides for prognostic (or predictive) assays for determining whether an individual is at risk of developing a disorder associated with NOVX protein, nucleic acid expression or activity. For example, mutations in A NOVX gene can be assayed in a biological sample. Such assays can be used for prognostic or predictive purpose to thereby prophylactically treat an individual prior to the onset of a disorder characterized by or associated with NOVX protein, nucleic acid expression, or biological activity.
Another aspect of the invention provides methods for determining NOVX protein, nucleic acid expression or activity in an individual to thereby select appropriate therapeutic or prophylactic agents for that individual (referred to herein as "pharmacogenomics"). Pharmacogenomics allows for the selection of agents (e.g., drugs) for therapeutic or prophylactic treatment of an individual based on the genotype of the individual (e.g., the genotype of the individual examined to determine the ability of the individual to respond to a particular agent.)
Yet another aspect of the invention pertains to monitoring the influence of agents (e.g., drugs, compounds) on the expression or activity of NOVX in clinical trials.
These and other agents are described in further detail in the following sections.
DIAGNOSTIC ASSAYS
An exemplary method for detecting the presence or absence of NOVX in a biological sample involves obtaining a biological sample from a test subject and contacting the biological sample with a compound or an agent capable of detecting NOVX protein or nucleic acid (e.g., mRNA, genomic DNA) that encodes NOVX protein such that the presence of NOVX is detected in the biological sample. An agent for detecting NOVX mRNA or genomic DNA is a labeled nucleic acid probe capable of hybridizing to NOVX mRNA or genomic DNA. The
nucleic acid probe can be, for example, a full-length NOVX nucleic acid, such as the nucleic acid of SEQ ID NOS:2n-l, wherein n is an integer between 1 and 86, or a portion thereof, such as an oligonucleotide of at least 15, 30, 50, 100, 250 or 500 nucleotides in length and sufficient to specifically hybridize under stringent conditions to NOVX mRNA or genomic DNA. Other suitable probes for use in the diagnostic assays of the invention are described herein.
An agent for detecting NOVX protein is an antibody capable of binding to NOVX protein, preferably an antibody with a detectable label. Antibodies can be polyclonal, or more preferably, monoclonal. An intact antibody, or a fragment thereof (e.g., Fab or F(ab')2) can be used. The term "labeled", with regard to the probe or antibody, is intended to encompass direct labeling of the probe or antibody by coupling (i.e., physically linking) a detectable substance to the probe or antibody, as well as indirect labeling of the probe or antibody by reactivity with another reagent that is directly labeled. Examples of indirect labeling include detection of a primary antibody using a fluorescently-labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently- labeled streptavidin. The term "biological sample" is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject. That is, the detection method of the invention can be used to detect NOVX mRNA, protein, or genomic DNA in a biological sample in vitro as well as in vivo. For example, in vitro techniques for detection of NOVX mRNA include Northern hybridizations and in situ hybridizations. In vitro techniques for detection of NOVX protein include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations, and immunofluorescence. In vitro techniques for detection of NOVX genomic DNA include Southern hybridizations. Furthermore, in vivo techniques for detection of NOVX protein include introducing into a subject a labeled anti-NOVX antibody. For example, the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
In one embodiment, the biological sample contains protein molecules from the test subject. Alternatively, the biological sample can contain mRNA molecules from the test subject or genomic DNA molecules from the test subject. A preferred biological sample is a peripheral blood leukocyte sample isolated by conventional means from a subject.
In another embodiment, the methods further involve obtaining a control biological sample from a control subject, contacting the control sample with a compound or agent capable of detecting NOVX protein, mRNA, or genomic DNA, such that the presence of
NOVX protein, mRNA or genomic DNA is detected in the biological sample, and comparing the presence of NOVX protein, mRNA or genomic DNA in the control sample with the presence of NOVX protein, mRNA or genomic DNA in the test sample.
The invention also encompasses kits for detecting the presence of NOVX in a biological sample. For example, the kit can comprise: a labeled compound or agent capable of detecting NOVX protein or mRNA in a biological sample; means for determining the amount of NOVX in the sample; and means for comparing the amount of NOVX in the sample with a standard. The compound or agent can be packaged in a suitable container. The kit can further comprise instructions for using the kit to detect NOVX protein or nucleic acid.
PROGNOSTIC ASSAYS
The diagnostic methods described herein can furthermore be utilized to identify subjects having or at risk of developing a disease or disorder associated with aberrant NOVX expression or activity. For example, the assays described herein, such as the preceding diagnostic assays or the following assays, can be utilized to identify a subject having or at risk of developing a disorder associated with NOVX protein, nucleic acid expression or activity. Alternatively, the prognostic assays can be utilized to identify a subject having or at risk for developing a disease or disorder. Thus, the invention provides a method for identifying a disease or disorder associated with aberrant NOVX expression or activity in which a test sample is obtained from a subject and NOVX protein or nucleic acid (e.g. , mRNA, genomic DNA) is detected, wherein the presence of NOVX protein or nucleic acid is diagnostic for a subject having or at risk of developing a disease or disorder associated with aberrant NOVX expression or activity. As used herein, a "test sample" refers to a biological sample obtained from a subject of interest. For example, a test sample can be a biological fluid (e.g., serum), cell sample, or tissue.
Furthermore, the prognostic assays described herein can be used to determine whether a subject can be administered an agent (e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate) to treat a disease or disorder associated with aberrant NOVX expression or activity. For example, such methods can be used to determine whether a subject can be effectively treated with an agent for a disorder.
Thus, the invention provides methods for determining whether a subject can be effectively treated with an agent for a disorder associated with aberrant NOVX expression or activity in which a test sample is obtained and NOVX protein or nucleic acid is detected (e.g., wherein the presence of NOVX protein or nucleic acid is diagnostic for a subject that can be
administered the agent to treat a disorder associated with aberrant NOVX expression or activity).
The methods of the invention can also be used to detect genetic lesions in A NOVX gene, thereby determining if a subject with the lesioned gene is at risk for a disorder characterized by aberrant cell proliferation and/or differentiation. In various embodiments, the methods include detecting, in a sample of cells from the subject, the presence or absence of a genetic lesion characterized by at least one of an alteration affecting the integrity of a gene encoding A NOVX-protein, or the misexpression of the NOVX gene. For example, such genetic lesions can be detected by ascertaining the existence of at least one of: (i) a deletion of one or more nucleotides from A NOVX gene; (ii) an addition of one or more nucleotides to A NOVX gene; (iii) a substitution of one or more nucleotides of A NOVX gene, (iv) a chromosomal rearrangement of A NOVX gene; (v) an alteration in the level of a messenger RNA transcript of A NOVX gene, (vt) aberrant modification of A NOVX gene, such as of the methylation pattern of the genomic DNA, (vii) the presence of a non- wild-type splicing pattern of a messenger RNA transcript of A NOVX gene, (viii) a non- wild-type level of A NOVX protein, (ix) allelic loss of A NOVX gene, and (x) inappropriate post-translational modification of A NOVX protein. As described herein, there are a large number of assay techniques known in the art which can be used for detecting lesions in A NOVX gene. A preferred biological sample is a peripheral blood leukocyte sample isolated by conventional means from a subject. However, any biological sample containing nucleated cells may be used, including, for example, buccal mucosal cells.
In certain embodiments, detection of the lesion involves the use of a probe/primer in a polymerase chain reaction (PCR) (see, e.g., U.S. Patent Nos. 4,683,195 and 4,683,202), such as anchor PCR or RACE PCR, or, alternatively, in a ligation chain reaction (LCR) (see, e.g. , Landegran, et al, 1988. Science 241 : 1077-1080; and Nakazawa, et al, 1994. Proc. Natl
Acad. Sci. USA 91 : 360-364), the latter of which can be particularly useful for detecting point mutations in the NOVX-gene (see, Abravaya, et al, 1995. Nucl. Acids Res. 23: 675-682). This method can include the steps of collecting a sample of cells from a patient, isolating nucleic acid (e.g., genomic, mRNA or both) from the cells of the sample, contacting the nucleic acid sample with one or more primers that specifically hybridize to A NOVX gene under conditions such that hybridization and amplification of the NOVX gene (if present) occurs, and detecting the presence or absence of an amplification product, or detecting the size of the amplification product and comparing the length to a control sample. It is anticipated
that PCR and/or LCR may be desirable to use as a preliminary amplification step in conjunction with any of the techniques used for detecting mutations described herein.
Alternative amplification methods include: self sustained sequence replication (see, Guatelli, et al, 1990. Proc. Natl. Acad. Sci. USA 87: 1874-1878), transcriptional amplification system (see, Kwoh, et al, 1989. Proc. Natl. Acad. Sci. USA 86: 1173-1177); Qβ Replicase (see, Lizardi, et al, 1988. BioTechnology 6: 1197), or any other nucleic acid amplification method, followed by the detection of the amplified molecules using techniques well known to those of skill in the art. These detection schemes are especially useful for the detection of nucleic acid molecules if such molecules are present in very low numbers. In an alternative embodiment, mutations in A NOVX gene from a sample cell can be identified by alterations in restriction enzyme cleavage patterns. For example, sample and control DNA is isolated, amplified (optionally), digested with one or more restriction endonucleases, and fragment length sizes are determined by gel electrophoresis and compared. Differences in fragment length sizes between sample and control DNA indicates mutations in the sample DNA. Moreover, the use of sequence specific ribozymes (see, e.g., U.S. Patent No. 5,493,531) can be used to score for the presence of specific mutations by development or loss of a ribozyme cleavage site.
In other embodiments, genetic mutations in NOVX can be identified by hybridizing a sample and control nucleic acids, e.g., DNA or RNA, to high-density arrays containing hundreds or thousands of oligonucleotides probes. See, e.g., Cronin, et al, 1996. Human Mutation 7: 244-255; Kozal, et al, 1996. Nat. Med. 2: 753-759. For example, genetic mutations in NOVX can be identified in two dimensional arrays containing light-generated DNA probes as described in Cronin, et al, supra. Briefly, a first hybridization array of probes can be used to scan through long stretches of DNA in a sample and control to identify base changes between the sequences by making linear arrays of sequential overlapping probes. This step allows the identification of point mutations. This is followed by a second hybridization array that allows the characterization of specific mutations by using smaller, specialized probe arrays complementary to all variants or mutations detected. Each mutation array is composed of parallel probe sets, one complementary to the wild-type gene and the other complementary to the mutant gene.
In yet another embodiment, any of a variety of sequencing reactions known in the art can be used to directly sequence the NOVX gene and detect mutations by comparing the sequence of the sample NOVX with the corresponding wild-type (control) sequence.
Examples of sequencing reactions include those based on techniques developed by Maxim and
Gilbert, 1977. Proc. Natl. Acad. Sci. USA 74: 560 or Sanger, 1977. Proc. Natl. Acad. Sci. USA 74: 5463. It is also contemplated that any of a variety of automated sequencing procedures can be utilized when performing the diagnostic assays (see, e.g., Naeve, et al, 1995. Biotechniques 19: 448), including sequencing by mass spectrometiy (see, e.g., PCT International Publication No. WO 94/16101; Cohen, et al, 1996. Adv. Chromatography 36: 127-162; and Griffin, et al, 1993. Appl Biochem. Biotechnol 38: 147-159).
Other methods for detecting mutations in the NOVX gene include methods in which protection from cleavage agents is used to detect mismatched bases in RNA/RNA or RNA/DNA heteroduplexes. See, e.g., Myers, et al, 1985. Science 230: 1242. In general, the art technique of "mismatch cleavage" starts by providing heteroduplexes of formed by hybridizing (labeled) RNA or DNA containing the wild-type NOVX sequence with potentially mutant RNA or DNA obtained from a tissue sample. The double-stranded duplexes are treated with an agent that cleaves single-stranded regions of the duplex such as which will exist due to basepair mismatches between the control and sample strands. For instance, RNA DNA duplexes can be treated with RNase and DNA/DNA hybrids treated with Si nuclease to enzymatically digesting the mismatched regions. In other embodiments, either DNA/DNA or RNA/DNA duplexes can be treated with hydroxylamine or osmium tetroxide and with piperidine in order to digest mismatched regions. After digestion of the mismatched regions, the resulting material is then separated by size on denaturing polyacrylamide gels to determine the site of mutation. See, e.g., Cotton, et al, 1988. Proc. Natl. Acad. Sci. USA 85: 4397; Saleeba, et al, 1992. Methods Enzymol 217: 286-295. In an embodiment, the control DNA or RNA can be labeled for detection.
In still another embodiment, the mismatch cleavage reaction employs one or more proteins that recognize mismatched base pairs in double-stranded DNA (so called "DNA mismatch repair" enzymes) in defined systems for detecting and mapping point mutations in NOVX cDNAs obtained from samples of cells. For example, the mutY enzyme of E. coli cleaves A at G/A mismatches and the thymidine DNA glycosylase from HeLa cells cleaves T at G/T mismatches. See, e.g., Hsu, et al, 1994. Carcinogenesis 15: 1657-1662. According to an exemplary embodiment, a probe based on A NOVX sequence, e.g., a wild-type NOVX sequence, is hybridized to a cDNA or other DNA product from a test cell(s). The duplex is treated with a DNA mismatch repair enzyme, and the cleavage products, if any, can be detected from electrophoresis protocols or the like. See, e.g., U.S. Patent No. 5,459,039.
In other embodiments, alterations in electrophoretic mobility will be used to identify mutations in NOVX genes. For example, single strand conformation polymorphism (SSCP)
may be used to detect differences in electrophoretic mobility between mutant and wild type nucleic acids. See, e.g., Orita, et al, 1989. Proc. Natl. Acad. Sci. USA: 86: 2766; Cotton, 1993. Mutat. Res. 285: 125-144; Hayashi, 1992. Genet. Anal Tech. Appl 9: 73-79. Single-stranded DNA fragments of sample and control NOVX nucleic acids will be denatured and allowed to renature. The secondary structure of single-stranded nucleic acids varies according to sequence, the resulting alteration in electrophoretic mobility enables the detection of even a single base change. The DNA fragments may be labeled or detected with labeled probes. The sensitivity of the assay may be enhanced by using RNA (rather than DNA), in which the secondary structure is more sensitive to a change in sequence. In one embodiment, the subject method utilizes heteroduplex analysis to separate double stranded heteroduplex molecules on the basis of changes in electrophoretic mobility. See, e.g., Keen, et al, 1991. Trends Genet. 7: 5.
In yet another embodiment, the movement of mutant or wild-type fragments in polyacrylamide gels containing a gradient of denaturant is assayed using denaturing gradient gel electrophoresis (DGGE). See, e.g., Myers, et al, 1985. Nature 313: 495. When DGGE is used as the method of analysis, DNA will be modified to insure that it does not completely denature, for example by adding a GC clamp of approximately 40 bp of high-melting GC-rich DNA by PCR. In a further embodiment, a temperature gradient is used in place of a denaturing gradient to identify differences in the mobility of control and sample DNA. See, e.g., Rosenbaum and Reissner, 1987. Biophys. Chem. 265: 12753.
Examples of other techniques for detecting point mutations include, but are not limited to, selective oligonucleotide hybridization, selective amplification, or selective primer extension. For example, oligonucleotide primers may be prepared in which the known mutation is placed centrally and then hybridized to target DNA under conditions that permit hybridization only if a perfect match is found. See, e.g., Saiki, et al, 1986. Nature 324: 163; Saiki, et al, 1989. Proc. Natl. Acad. Sci. USA 86: 6230. Such allele specific oligonucleotides are hybridized to PCR amplified target DNA or a number of different mutations when the oligonucleotides are attached to the hybridizing membrane and hybridized with labeled target DNA. Alternatively, allele specific amplification technology that depends on selective PCR amplification may be used in conjunction with the instant invention. Oligonucleotides used as primers for specific amplification may carry the mutation of interest in the center of the molecule (so that amplification depends on differential hybridization; see, e.g., Gibbs, et al,
1989. Nucl. Acids Res. 17: 2437-2448) or at the extreme 3'-terminus of one primer where,
under appropriate conditions, mismatch can prevent, or reduce polymerase extension (see, e.g., Prossner, 1993. Tibtech. 11: 238). In addition it may be desirable to introduce a novel restriction site in the region of the mutation to create cleavage-based detection. See, e.g., Gasparini, et al, 1992. Mol. Cell Probes 6: 1. It is anticipated that in certain embodiments amplification may also be performed using Taq ligase for amplification. See, e.g., Barany, 1991. Proc. Natl. Acad. Sci. USA 88: 189. In such cases, ligation will occur only if there is a perfect match at the 3'-terminus of the 5' sequence, making it possible to detect the presence of a known mutation at a specific site by looking for the presence or absence of amplification. The methods described herein may be performed, for example, by utilizing pre-packaged diagnostic kits comprising at least one probe nucleic acid or antibody reagent described herein, which may be conveniently used, e.g., in clinical settings to diagnose patients exhibiting symptoms or family history of a disease or illness involving A NOVX gene.
Furthermore, any cell type or tissue, preferably peripheral blood leukocytes, in which NOVX is expressed may be utilized in the prognostic assays described herein. However, any biological sample containing nucleated cells may be used, including, for example, buccal mucosal cells.
PHARMACOGENOMICS Agents, or modulators that have a stimulatory or inhibitory effect on NOVX activity
(e.g., NOVX gene expression), as identified by a screening assay described herein can be administered to individuals to treat (prophylactically or therapeutically) disorders (The disorders include metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer- associated cachexia, cancer, neurodegenerative disorders, Alzheimer's Disease, Parkinson's Disorder, immune disorders, and hematopoietic disorders, and the various dyslipidemias, metabolic disturbances associated with obesity, the metabolic syndrome X and wasting disorders associated with chronic diseases and various cancers.) In conjunction with such treatment, the pharmacogenomics (t.e., the study of the relationship between an individual's genotype and that individual's response to a foreign compound or drug) of the individual may be considered. Differences in metabolism of therapeutics can lead to severe toxicity or therapeutic failure by altering the relation between dose and blood concentration of the pharmacologically active drug. Thus, the pharmacogenomics of the individual permits the selection of effective agents (e.g., drugs) for prophylactic or therapeutic treatments based on a consideration of the individual's genotype. Such pharmacogenomics can further be used to
determine appropriate dosages and therapeutic regimens. Accordingly, the activity of NOVX protein, expression of NOVX nucleic acid, or mutation content of NOVX genes in an individual can be determined to thereby select appropriate agent(s) for therapeutic or prophylactic treatment of the individual. Pharmacogenomics deals with clinically significant hereditary variations in the response to drags due to altered drug disposition and abnormal action in affected persons. See e.g., Eichelbaum, 1996. Clin. Exp. Pharmacol. Physiol, 23: 983-985; Linder, 1997. Clin. Chem., 43: 254-266. In general, two types of pharmacogenetic conditions can be differentiated. Genetic conditions transmitted as a single factor altering the way drugs act on the body (altered drug action) or genetic conditions transmitted as single factors altering the way the body acts on drugs (altered drug metabolism). These pharmacogenetic conditions can occur either as rare defects or as polymorphisms. For example, glucose-6-phosphate dehydrogenase (G6PD) deficiency is a common inherited enzymopathy in which the main clinical complication is hemolysis after ingestion of oxidant drugs (anti-malarials, sulfonamides, analgesics, nitrofurans) and consumption of fava beans.
As an illustrative embodiment, the activity of drug metabolizing enzymes is a major determinant of both the intensity and duration of drug action. The discovery of genetic polymorphisms of drug metabolizing enzymes (e.g., N-acetyltransferase 2 (NAT 2) and cytochrome Pregnancy Zone Protein Precursor enzymes CYP2D6 and CYP2C19) has provided an explanation as to why some patients do not obtain the expected drug effects or show exaggerated drug response and serious toxicity after taking the standard and safe dose of a drug. These polymorphisms are expressed in two phenotypes in the population, the extensive metabolizer (EM) and poor metabolizer (PM). The prevalence of PM is different among different populations. For example, the gene coding for CYP2D6 is highly polymorphic and several mutations have been identified in PM, which all lead to the absence of functional CYP2D6. Poor metabolizers of CYP2D6 and CYP2C 19 quite frequently experience exaggerated drug response and side effects when they receive standard doses. If a metabolite is the active therapeutic moiety, PM show no therapeutic response, as demonstrated for the analgesic effect of codeine mediated by its CYP2D6-formed metabolite morphine. At the other extreme are the so called ultra-rapid metabolizers who do not respond to standard doses. Recently, the molecular basis of ultra-rapid metabolism has been identified to be due to
CYP2D6 gene amplification.
Thus, the activity of NOVX protein, expression of NOVX nucleic acid, or mutation content of NOVX genes in an individual can be determined to thereby select appropriate
agent(s) for therapeutic or prophylactic treatment of the individual. In addition, pharmacogenetic studies can be used to apply genotyping of polymorphic alleles encoding drug-metabolizing enzymes to the identification of an individual's drug responsiveness phenotype. This knowledge, when applied to dosing or drug selection, can avoid adverse reactions or therapeutic failure and thus enhance therapeutic or prophylactic efficiency when treating a subject with A NOVX modulator, such as a modulator identified by one of the exemplary screening assays described herein.
MONITORING OF EFFECTS DURING CLINICAL TRIALS Monitoring the influence of agents (e.g., drugs, compounds) on the expression or activity of NOVX (e.g., the ability to modulate aberrant cell proliferation and/or differentiation) can be applied not only in basic drug screening, but also in clinical trials. For example, the effectiveness of an agent determined by a screening assay as described herein to increase NOVX gene expression, protein levels, or upregulate NOVX activity, can be monitored in clinical trails of subjects exhibiting decreased NOVX gene expression, protein levels, or downregulated NOVX activity. Alternatively, the effectiveness of an agent determined by a screening assay to decrease NOVX gene expression, protein levels, or downregulate NOVX activity, can be monitored in clinical trails of subjects exhibiting increased NOVX gene expression, protein levels, or upregulated NOVX activity. In such clinical trials, the expression or activity of NOVX and, preferably, other genes that have been implicated in, for example, a cellular proliferation or immune disorder can be used as a "read out" or markers of the immune responsiveness of a particular cell.
By way of example, and not of limitation, genes, including NOVX, that are modulated in cells by treatment with an agent (e.g., compound, drug or small molecule) that modulates NOVX activity (e.g., identified in a screening assay as described herein) can be identified.
Thus, to study the effect of agents on cellular proliferation disorders, for example, in a clinical trial, cells can be isolated and RNA prepared and analyzed for the levels of expression of NOVX and other genes implicated in the disorder. The levels of gene expression (t.e., a gene expression pattern) can be quantified by Northern blot analysis or RT-PCR, as described herein, or alternatively by measuring the amount of protein produced, by one of the methods as described herein, or by measuring the levels of activity of NOVX or other genes. In this manner, the gene expression pattern can serve as a marker, indicative of the physiological response of the cells to the agent. Accordingly, this response state may be determined before, and at various points during, treatment of the individual with the agent.
In one embodiment, the invention provides a method for monitoring the effectiveness of treatment of a subject with an agent (e.g., an agonist, antagonist, protein, peptide, peptidomimetic, nucleic acid, small molecule, or other drug candidate identified by the screening assays described herein) comprising the steps of (i) obtaining a pre-administration sample from a subject prior to administration of the agent; (ii) detecting the level of expression of A NOVX protein, mRNA, or genomic DNA in the preadministration sample; (iii) obtaining one or more post-administration samples from the subject; (iv) detecting the level of expression or activity of the NOVX protein, mRNA, or genomic DNA in the post-administration samples; (v) comparing the level of expression or activity of the NOVX protein, mRNA, or genomic DNA in the pre-administration sample with the NOVX protein, mRNA, or genomic DNA in the post administration sample or samples; and (vi) altering the administration of the agent to the subject accordingly. For example, increased administration of the agent may be desirable to increase the expression or activity of NOVX to higher levels than detected, i.e., to increase the effectiveness of the agent. Alternatively, decreased administration of the agent may be desirable to decrease expression or activity of NOVX to lower levels than detected, i.e., to decrease the effectiveness of the agent.
Methods of Treatment
The invention provides for both prophylactic and therapeutic methods of treating a subject at risk of (or susceptible to) a disorder or having a disorder associated with aberrant NOVX expression or activity. The disorders include cardiomyopathy, atherosclerosis, hypertension, congenital heart defects, aortic stenosis, atrial septal defect (ASD), atrioventricular (A-V) canal defect, ductus arteriosus, pulmonary stenosis, subaortic stenosis, ventricular septal defect (VSD), valve diseases, tuberous sclerosis, scleroderma, obesity, transplantation, adrenoleukodystrophy, congenital adrenal hyperplasia, prostate cancer, neoplasm; adenocarcinoma, lymphoma, uterus cancer, fertility, hemophilia, hypercoagulation, idiopathic thrombocytopenic purpura, immunodeficiencies, graft versus host disease, AIDS, bronchial asthma, Crohn's disease; multiple sclerosis, treatment of Albright Hereditary Ostoeodystrophy, and other diseases, disorders and conditions of the like. These methods of treatment will be discussed more fully, below.
DISEASE AND DISORDERS
Diseases and disorders that are characterized by increased (relative to a subject not suffering from the disease or disorder) levels or biological activity may be treated with
Therapeutics that antagonize (i.e., reduce or inhibit) activity. Therapeutics that antagonize activity may be administered in a therapeutic or prophylactic manner. Therapeutics that may be utilized include, but are not limited to: (i) an aforementioned peptide, or analogs, derivatives, fragments or homologs thereof; (ii) antibodies to an aforementioned peptide; (iii) nucleic acids encoding an aforementioned peptide; (tv) administration of antisense nucleic acid and nucleic acids that are "dysfunctional" (i.e., due to a heterologous insertion within the coding sequences of coding sequences to an aforementioned peptide) that are utilized to "knockout" endogenous function of an aforementioned peptide by homologous recombination (see, e.g., Capecchi, 1989. Science 244: 1288-1292); or (v) modulators ( i.e., inhibitors, agonists and antagonists, including additional peptide mimetic of the invention or antibodies specific to a peptide of the invention) that alter the interaction between an aforementioned peptide and its binding partner.
Diseases and disorders that are characterized by decreased (relative to a subject not suffering from the disease or disorder) levels or biological activity may be treated with Therapeutics that increase (i.e., are agonists to) activity. Therapeutics that upregulate activity may be administered in a therapeutic or prophylactic manner. Therapeutics that may be utilized include, but are not limited to, an aforementioned peptide, or analogs, derivatives, fragments or homologs thereof; or an agonist that increases bioavailability.
Increased or decreased levels can be readily detected by quantifying peptide and/or RNA, by obtaining a patient tissue sample (e.g., from biopsy tissue) and assaying it in vitro for RNA or peptide levels, structure and/or activity of the expressed peptides (or mRNAs of an aforementioned peptide). Methods that are well-known within the art include, but are not limited to, immunoassays (e.g., by Western blot analysis, immunoprecipitation followed by sodium dodecyl sulfate (SDS) polyacrylamide gel electrophoresis, immunocytochemistry, etc.) and/or hybridization assays to detect expression of mRNAs (e.g., Northern assays, dot blots, in situ hybridization, and the like).
PROPHYLACTIC METHODS
In one aspect, the invention provides a method for preventing, in a subject, a disease or condition associated with an aberrant NOVX expression or activity, by administering to the subject an agent that modulates NOVX expression or at least one NOVX activity. Subjects at risk for a disease that is caused or contributed to by aberrant NOVX expression or activity can be identified by, for example, any or a combination of diagnostic or prognostic assays as described herein. Administration of a prophylactic agent can occur prior to the manifestation
of symptoms characteristic of the NOVX aberrancy, such that a disease or disorder is prevented or, alternatively, delayed in its progression. Depending upon the type of NOVX aberrancy, for example, A NOVX agonist or NOVX antagonist agent can be used for treating the subject. The appropriate agent can be determined based on screening assays described herein. The prophylactic methods of the invention are further discussed in the following subsections.
Therapeutic Methods
Another aspect of the invention pertains to methods of modulating NOVX expression or activity for therapeutic purposes. The modulatory method of the invention involves contacting a cell with an agent that modulates one or more of the activities of NOVX protein activity associated with the cell. An agent that modulates NOVX protein activity can be an agent as described herein, such as a nucleic acid or a protein, a naturally-occurring cognate ligand of A NOVX protein, a peptide, A NOVX peptidomimetic, or other small molecule. In one embodiment, the agent stimulates one or more NOVX protein activity. Examples of such stimulatory agents include active NOVX protein and a nucleic acid molecule encoding NOVX that has been introduced into the cell. In another embodiment, the agent inhibits one or more NOVX protein activity. Examples of such inhibitory agents include antisense NOVX nucleic acid molecules and anti-NOVX antibodies. These modulatory methods can be performed in vitro (e.g., by culturing the cell with the agent) or, alternatively, in vivo (e.g., by administering the agent to a subject). As such, the invention provides methods of treating an individual afflicted with a disease or disorder characterized by aberrant expression or activity of A NOVX protein or nucleic acid molecule. In one embodiment, the method involves administering an agent (e.g., an agent identified by a screening assay described herein), or combination of agents that modulates (e.g., up-regulates or down-regulates) NOVX expression or activity. In another embodiment, the method involves administering A NOVX protein or nucleic acid molecule as therapy to compensate for reduced or aberrant NOVX expression or activity.
Stimulation of NOVX activity is desirable in situations in which NOVX is abnormally downregulated and/or in which increased NOVX activity is likely to have a beneficial effect. One example of such a situation is where a subject has a disorder characterized by aberrant cell proliferation and/or differentiation (e.g., cancer or immune associated disorders). Another example of such a situation is where the subject has a gestational disease (e.g., preclampsia).
Determination of the Biological Effect of the Therapeutic
In various embodiments of the invention, suitable in vitro or in vivo assays are performed to determine the effect of a specific Therapeutic and whether its administration is indicated for treatment of the affected tissue.
In various specific embodiments, in vitro assays may be performed with representative cells of the type(s) involved in the patient's disorder, to determine if a given Therapeutic exerts the desired effect upon the cell type(s). Compounds for use in therapy may be tested in suitable animal model systems including, but not limited to rats, mice, chicken, cows, monkeys, rabbits, and the like, prior to testing in human subjects. Similarly, for in vivo testing, any of the animal model system known in the art may be used prior to administration to human subjects.
Prophylactic and Therapeutic Uses of the Compositions of the Invention The NOVX nucleic acids and proteins of the invention are useful in potential prophylactic and therapeutic applications implicated in a variety of disorders including, but not limited to: metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer- associated cancer, neurodegenerative disorders, Alzheimer's Disease, Parkinson's Disorder, immune disorders, hematopoietic disorders, and the various dyslipidemias, metabolic disturbances associated with obesity, the metabolic syndrome X and wasting disorders associated with chronic diseases and various cancers.
As an example, a cDNA encoding the NOVX protein of the invention may be useful in gene therapy, and the protein may be useful when administered to a subject in need thereof. By way of non-limiting example, the compositions of the invention will have efficacy for treatment of patients suffering from: metabolic disorders, diabetes, obesity, infectious disease, anorexia, cancer-associated cachexia, cancer, neurodegenerative disorders, Alzheimer's Disease, Parkinson's Disorder, immune disorders, hematopoietic disorders, and the various dyslipidemias.
Both the novel nucleic acid encoding the NOVX protein, and the NOVX protein of the invention, or fragments thereof, may also be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed. A further use could be as an anti-bacterial molecule (i.e., some peptides have been found to possess anti-bacterial properties). These materials are further useful in the generation of antibodies, which
immunospecifically-bind to the novel substances of the invention for use in therapeutic or diagnostic methods.
The invention will be further described in the following examples, which do not limit the scope of the invention described in the claims.
Examples
EXAMPLE 1.
The NOVl clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 1A.
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table IB.
Further analysis of the NOVla protein yielded the following properties shown in Table lC
Table 1C. Protein Sequence Properties NOVla
PSort 0.5297 probability located in microbody (peroxisome); 0.3000 probability analysis: located in nucleus; 0.1000 probability located in mitochondrial matrix space; 0.1000 probability located in lysosome (lumen)
SignalP No Known Signal Sequence Predicted analysis:
A search of the NOVla protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table ID.
In a BLAST search of public sequence databases, the NOVla protein was found to have homology to the proteins shown in the BLASTP data in Table IE.
PFam analysis predicts that the NOVla protein contains the domains shown in the Table IF.
Table IF. Domain Analysis of NOVla
Identities/
Pfam Domain NOVla Match Region Similarities Expect Value for the Matched Region
No Significant Matches Found
EXAMPLE 2.
The NOV2 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 2A.
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 2B.
Further analysis of the NOV2a protein yielded the following properties shown in Table
2C.
Table 2C. Protein Sequence Properties NOV2a
PSort 10.7666 probability located in outside; 0.1900 probability located in lysosome analysis: (lumen); 0.1000 probability located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen)
SignalP Likely cleavage site between residues 23 and 24 analysis: A search of the NOV2a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 2D.
In a BLAST search of public sequence databases, the NOV2a protein was found to have homology to the proteins shown in the BLASTP data in Table 2E.
PFam analysis predicts that the NOV2a protein contains the domains shown in the Table 2F.
Table 2F. Domain Analysis of NOV2a
Identities/
Pfam Domain NOV2a Match Region Similarities Expect Value for the Matched Region
No Significant Matches Found
EXAMPLE 3.
The NOV3 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 3A.
Further analysis of the NOV3a protein yielded the following properties shown in Table
3B.
Table 3B. Protein Sequence Properties NOV3a
PSort 0.6881 probability located in mitochondrial inner membrane; 0.6500 probability analysis: located in plasma membrane; 0.3773 probability located in mitochondrial intermembrane space; 0.3157 probability located in mitochondrial matrix space
SignalP No Known Signal Sequence Predicted analysis:
A search of the NOV3a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 3C
In a BLAST search of public sequence databases, the NOV3a protein was found to have homology to the proteins shown in the BLASTP data in Table 3D.
PFam analysis predicts that the NOV3a protein contains the domains shown in the Table 3E.
EXAMPLE 4.
The NOV4 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 4A.
Sequence
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 4B.
Table 4B. Comparison of NOV4a against NOV4b and NO 4c.
NOV4a Residues/ Identities/
Protein Sequence Match Residues Similarities for the Matched Region
NOV4b 24..151 128/128 (100%) 3..130 128/128 (100%)
Further analysis of the NOV4a protein yielded the following properties shown in Table
4C
Table 4C. Protein Sequence Properties NOV4a
PSort 0.5231 probability located in outside; 0.1317 probability located in microbody analysis: (peroxisome); 0.1000 probability located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen)
SignalP Likely cleavage site between residues 24 and 25 analysis: A search of the NOV4a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 4D.
In a BLAST search of public sequence databases, the NOV4a protein was found to have homology to the proteins shown in the BLASTP data in Table 4E.
PFam analysis predicts that the NOV4a protein contains the domains shown in the Table 4F.
EXAMPLE 5.
The NOV5 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 5A.
Further analysis of the NOV5a protein yielded the following properties shown in Table
5B.
Table 5B. Protein Sequence Properties NOV5a
PSort 0.8200 probability located in outside; 0.1000 probability located in endoplasmic analysis: reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen); 0.1000 probability located in lysosome (lumen)
SignalP Likely cleavage site between residues 24 and 25 analysis:
A search of the NOV5a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 5C
Table 5C. Geneseq Results for NOV5a
NOV5a
Identities/
Geneseq Protein/Organism/Length Residues/ Expect Identifier Similarities for the [Patent #, Date] Match Value
Matched Region Residues
No Significant Matches Found
In a BLAST search of public sequence databases, the NOV5a protein was found to have homology to the proteins shown in the BLASTP data in Table 5D.
Table 5D. Public BLASTP Results for NOV5a
PFam analysis predicts that the NOV5a protein contains the domains shown in the Table 5E.
Table 5E. Domain Analysis of NOV5a
Identities/
Pfam Domain NOV5a Match Region Similarities Expect Value for the Matched Region
No Significant Matches Found
EXAMPLE 6.
The NOV6 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 6A.
Further analysis of the NOV6a protein yielded the following properties shown in Table
6B.
Table 6B. Protein Sequence Properties NOVόa
PSort 0.4991 probability located in lysosome (lumen); 0.3700 probability located in analysis: 1 outside; 0.1000 probability located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen)
SignalP Likely cleavage site between residues 21 and 22 analysis:
A search of the NOV6a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 6C
In a BLAST search of public sequence databases, the NOVόa protein was found to have homology to the proteins shown in the BLASTP data in Table 6D.
PFam analysis predicts that the NOVόa protein contains the domains shown in the Table 6E.
Table 6E. Domain Analysis of NOVόa
Identities/
Pfam Domain NOVόa Match Region Similarities Expect Value for the Matched Region
No Significant Matches Found
EXAMPLE 7.
The NOV7 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 7A.
Further analysis of the NOV7a protein yielded the following properties shown in Table
7B.
Table 7B. Protein Sequence Properties NOV7a
PSort 0.8200 probability located in outside; 0.1000 probability located in endoplasmic analysis: reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen); 0.1000 probability located in microbody (peroxisome)
SignalP Likely cleavage site between residues 21 and 22 analysis:
A search of the NOV7a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 7C
In a BLAST search of public sequence databases, the NOV7a protein was found to have homology to the proteins shown in the BLASTP data in Table 7D.
PFam analysis predicts that the N0V7a protein contains the domains shown in the Table 7E.
EXAMPLE 8.
The NOV8 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 8A.
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 8B.
Table 8B. Comparison of NOV8a against NO 8b and NOV8c.
NOV8a Residues/
Protein Sequence Identities/ Match Residues Similarities for the Matched Region
NOV8b 21..103 82/83 (98%) 2..84 83/83 (99%)
Further analysis of the NOV8a protein yielded the following properties shown in Table
8C.
Table 8C. Protein Sequence Properties NOV8a
PSort 0.6377 probability located in outside; 0.1821 probability located in microbody analysis: (peroxisome); 0.1000 probability located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen)
SignalP Likely cleavage site between residues 22 and 23 analysis:
A search of the NOV8a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 8D.
Table 8D. Geneseq Results for NOV8a
NOV8a
Identities/
Geneseq Protein/Organism/Length Residues/ Expect
Similarities for the Identifler [Patent #, Date] Match Value
Matched Region Residues
No Significant Matches Found
In a BLAST search of public sequence databases, the NOV8a protein was found to have homology to the proteins shown in the BLASTP data in Table 8E.
PFam analysis predicts that the NOV8a protein contains the domains shown in the Table 8F.
Table 8F. Domain Analysis of NOV8a
Pfam Domain NOV8a Match Region Expect Value
EXAMPLE 9.
The NOV9 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 9A.
Further analysis of the NOV9a protein yielded the following properties shown in Table
9B.
Table 9B. Protein Sequence Properties NOV9a
PSort 0.8276 probability located in lysosome (lumen); 0.4500 probability located in analysis: cytoplasm; 0.4128 probability located in microbody (peroxisome); 0.1000 probability located in mitochondrial matrix space
SignalP No Known Signal Sequence Predicted analysis:
A search of the NOV9a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 9C
Table 9C. Geneseq Results for NOV9a
Geneseq Protein/Organism/Length [Patent NOV9a Identities/ Expect Identifler #, Date] Value
In a BLAST search of public sequence databases, the NOV9a protein was found to have homology to the proteins shown in the BLASTP data in Table 9D.
PFam analysis predicts that the NOV9a protein contains the domains shown in the Table 9E.
Table 9E. Domain Analysis of NOV9a
EXAMPLE 10.
The NOV10 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 10 A.
YVFSDGYLINYDLTFLTMKTRLPRPPTRRPSGAHAPPKPVKPNEASRP
Further analysis of the NOVlOa protein yielded the following properties shown in Table 10B.
Table 10B. Protein Sequence Properties NOVlOa
PSort 0.3700 probability located in outside; 0.1900 probability located in lysosome analysis: (lumen); 0.1800 probability located in nucleus; 0.1000 probability located in endoplasmic reticulum (membrane)
SignalP No Known Signal Sequence Predicted analysis:
A search of the NOVlOa protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table IOC
In a BLAST search of public sequence databases, the NOVlOa protein was found to have homology to the proteins shown in the BLASTP data in Table 10D.
PFam analysis predicts that the NOVlOa protein contains the domains shown in the Table 10E.
EXAMPLE 11.
The NOVl 1 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 11 A.
Table 11 A. NOV11 Sequence Analysis
SEQ ID NO: 35 1134 bp
NOVl la, GCAGAAGAATAGGCTACTTTATTTTCTGAAAAGGAGGGAGTTCCTGCCACCCATTGCA
CG57572-01 DNA GGGAGGTCGCCATCAGGACAGTGAAGATGGTGACCCTGCGGAAGAGGACCCTGAAAGT
GCTCACCTTCCTCGTGCTCTTCATCTTCCTCACCTCCTTCCTGAACTACTCCCACGCC Sequence ATGGTGGCCACCACCTGGTTCCCCAAGAAGATGGCCCTGGAGCTCTTGGAGAACCTGA AGAGACTGATCAAGCACAGGCCCTGCACTTGCACCCACTGCATCAGGCAGCATGGGCT CTCAGCCTGGTTCGATGAGAGGTTCAACCAGATAGTGCAGCTGCTGCTGACTGCCCAG AACGCGCTCTTGGAGGACAACACCTACCAATGGTGGCTGAGGCTCCAGCAGGAGAAGA AGCCCAATATCATCAACAATACCATCAAGGAATTCAGAGCAGTACCTGGGAATGTGGA CCCAATGCTGGAGAAGAGGTCGGTGGGCTGCTGGCACTGTGCTGTCGTGGGCAACTCG GGCAACCTGAGGCAATTGTCATATCACAATTTTATGCTCAGGATGAACAAGGCACCCA CGGCAGGGTTTGAAGCTGCTGCCGGGAGCAAAACCGCCCACCATCTGGTGTACCCTGA GAGCTTCCGGGAGCTGGGGGACAATGTCAGCATGGTCCTGGTGCCCTTAAAGACCATG AACTTGGAGTGGGTGGTGAGCACCACCACCACGGGTGCCATTTCCCACACCTACACCC
Further analysis of the NOVl la protein yielded the following properties shown in Table 1 IB.
Table 11B. Protein Sequence Properties NOVl la
PSort 0.8200 probability located in outside; 0.5054 probability located in lysosome analysis: (lumen); 0.1565 probability located in microbody (peroxisome); 0.1000 probability located in endoplasmic reticulum (membrane)
SignalP Likely cleavage site between residues 31 and 32 analysis:
A search of the NOVl la protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 1 lC
In a BLAST search of public sequence databases, the NOVl la protein was found to have homology to the proteins shown in the BLASTP data in Table 1 ID.
PFam analysis predicts that the NOVl la protein contains the domains shown in the Table HE.
I l l
EXAMPLE 12.
The NOVl 2 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 12A.
Table 12A. NOV12 Sequence Analysis
SEQ ID NO: 37 4295 bp
NOV12a, TCTTCGTCGCCGCTCTCTCTCTCACCTCTCAGGGAAAGGGGGGGACATAGGGGCGTCG
CG57518-01 DNA CGGGGCCCCGGCGAATGCGCCCCCCGCCGCCTCTCGGGCTGCGCCGCCTCGCGGGGAT GAAGCACCGGCCGTGAAGATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCT
Sequence TCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTGCATGCGGG CCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAG GGGGACACCCTCATGCTGCAGTGCCTTGTAACAGGGCACCCTCGACCCCAGGTACGGT GGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAACGA GACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCT GAGAACGGCGTGGGGGTGCCGGCCATCAAGTCCATCCGCGTGGACGTGCAGTACCTGG ATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCA GGAGAAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATC TGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAGGACAATGGGGTTGACATCTATG AGCCCCTCTACACTCAGGGGGAGACCAAGGTCCTGAAGCTGAAGAACCTGCGGCCCCA GGACTATGCCAGCTACACCTGCCAGGTGTCTGTGCGTAACGTGTGCGGCATCCCAGAC AAGGCCATCACCTTCCGGCTCACCAACACCACGGCACCACCAGCCCTGAAGCTGTCTG TGAACGAAACTCTGGTGGTGAACCCTGGGGAGAATGTGACGGTGCAGTGTCTGCTGAC AGGCGGTGATCCCCTCCCCCAGCTGCAGTGGTCCCATGGGCCTGGCCCACTGCCCCTG GGTGCTCTGGCCCAGGGTGGCACCCTCAGCATCCCTTCAGTGCAGGCCCGGGACTCTG GCTACTACAACTGCACAGCCACCAACAATGTGGGCAACCCTGCCAAGAAGACTGTCAA CCTGCTGGTGCGATCCATGAAGAACGCTACATTCCAGATCACTCCTGACGTGATCAAA GAGAGTGAGAACATCCAGCTGGGCCAGGACCTGAAGCTATCGTGCCACGTGGATGCAG TGCCCCAGGAGAAGGTGACCTACCAGTGGTTCAAGAATGGCAAGCCGGCACGCATGTC CAAGCGGCTGCTGGTGACCCGCAATGATCCTGAGCTGCCCGCAGTCACCAGCAGCCTA GAGCTCATTGACCTGCACTTCAGTGACTATGGCACCTACCTGTGCATGGCTTCTTTCC CAGGGGCACCCGTGCCCGACCTCAGCGTCGAGGTCAACATCTCCTCTGAGACAGTGCC GCCCACCATCAGTGTGCCCAAGGGTAGGGCCGTGGTGACCGTGCGCGAGGGATCGCCT GCCGAGCTGCAATGCGAGGTGCGGGGCAAGCCGCGGCCGCCAGTGCTCTGGTCCCGCG TGGACAAGGAGGCTGCACTGCTGCCCTCGGGGCTGCCCCTGGAGGAGACTCCGGACGG GAAGCTGCGGCTGGAGCGAGTGAGCCGAGACATGAGCGGGACCTACCGCTGCCAGACG GCCCGCTATAATGGCTTCAACGTGCGCCCCCGTGAGGCCCAGGTGCAGCTGAACGTGC AGTTCCCGCCGGAGGTGGAGCCCAGTTCCCAGGACGTGCGCCAGGCGCTGGGCCGGCC CGTGCTCCTGCGCTGCTCGCTGCTGCGAGGCAGCCCCCAGCGCATCGCCTCGGCTGTG TGGCGTTTCAAAGGGCAGCTGCTGCCGCCGCCGCCTGTTGTTCCCGCCGCCGCCGAGG CGCCGGATCACGCGGAGCTGCGCCTCGACGCCGTAACTCGCGACAGCAGCGGCAGCTA CGAGTGCAGCGTCTCCAACGATGTGGGCTCGGCTGCCTGCCTCTTCCAGGTCTCCGCC AAAGCCTACAGCCCGGAGTATTACTTCGACACCCCCAACCCCACCCGCAGCCACAAGC TGTCCAAGAACTACTCCTACGTGCTGCAGTGGACTCAGAGGGAGCCCGACGCTGTCGA
CCCTGTGCTCAACTACAGACTCAGCATCCGCCAGTTGAACCAGCACAATGCGGTGGTC AAGGCCATCCCGGTCCGGCGTGTGGAGAAGGGGCAGCTGCTGGAGTACATCCTGACCG ATCTCCGTGTGCCCCACAGCTATGAGGTCCGCCTCACACCCTATACCACCTTCGGGGC TGGTGACATGGCCTCCCGCATCATCCACTACACAGAGCGCCAGATCCGCTGGCCCCCA GTCCTGGCTCTGAGGACCCTGTCCTCTGGTCCCAAGCAGGGTATCCTCTGCAGAGCCC CACACCTCAGTTCTGACTTGGTTTCCCCGCTTGCTTTCTCAGCCATCAACTCTCCGAA CCTTTCAGACAACACCTGCCACTTTGAGGATGAGAAGATCTGTGGCTATACCCAGGAC CTGACAGACAACTTTGACTGGACGCGGCAGAATGCCCTCACCCAGAACCCCAAACGCT CCCCCAACACTGGTCCCCCCACCGACATAAGTGGCACCCCTGAGGGCTACTACATGTT CATCGAGACATCGAGGCCTCGGGAGCTGGGGGACCGTGCAAGGTTAGTGAGTCCCCTC TACAATGCCAGCGCCAAGTTCTACTGTGTCTCCTTCTTCTACCACATGTACGGGAAAC ACATCGGCTCCCTCAACCTCCTGGTGCGGTCCCGGAACAAAGGGGCTCTGGACACGCA CGCCTGGTCTCTCAGTGGCAATAAGGGCAATGTGTGGCAGCAGGCCCATGTGCCCATC AGCCCCAGTGGGCCCTTCCAGATTATTTTTGAGGGGGTTCGAGGCCCGGGCTACCTGG GGGATATTGCCATAGATGACGTCACACTGAAGAAGGGGGAGTGTCCCCGGAAGCAGAC GGATCCCAATAAAGGTGCAAGACGGGAAGGAGCTGCCTGCGATGGCCTGAAATTCCAC CTTTCATCCCCTATGGATGACGGAGAGCTTACAGATGACCCTATTGAATGCAAGCACC TTTGGATCCATAGAGTGGACAGTAAAGGTGCTCAGTACATGTTGGCTGAGCTGAACTG CATACATGTGGCCCCCAGGTTCCTGGTCTTTATGGACGAAGGGCACAAGGTTGGTGAA AAGGACTCCGGGGGCCAGCCCTTCCAAGTTTACACTGATTTCTCCTTTTACCCTCATG CTATCCCTGAGAAGATGTCAATAATGCCCACGTTACAGGTGGGAAAACTGAGGCTTAG AGAGGAGGAGGAATCTGCCTACGGTCACACAGCTGCAAAGGCTAGAGCTGGGACCAGG AGCTGGTCTCTTAACCGACCACCTGAGCTCAAGAGCTTTTCTCTCTGGACCAACATGA CCCAAAGTGTGCGCGAGCCTATCACAGGTCCCCTGCAATGCCAAACATACACGCACAG CAATACACAACACCTGGGGACATGGATGAAGCTGGAAACCATCATTCTCAGCAAACTG ACACAAGAACAGAAAACCAAACACCACATGTTCTCACTCACCACCCAGTCTGCCCCGC CCTCTCTCTTCTCACCTGAACTTCCCCTCTCCTCAAACTCTCGAGGCCACGCCTCTAT GTCCTTGGATGATGATGATGACGACGACGACGATGATGATGATGATGATGACGACGAT GACAATGATGATGATGATGGAAGGAAGACCTACAGAATCCCTCCAGGCTCTGACCTCA GTGCTTGTGGGTGGGTGAATGACCACATGTCGCAGGGAGACTCCACAGGTCCTCCCGA TGAGAAGCACTCTTATGCCAAAGAGGAGACTCAGGCCAAACTGACAGGACCAGGAATT AGCTACCCTGGTAAACCCAGCTATCGACTGCACCCGAGCGGCTACACACCACTGGAGC AGTTCAGGGAGAAAGCCACCGGCATGCTCACCCCGTATGTCTCTGGCTCTGTTTCCTC TTTCTGCTTCCCCTTCCCCACCTCTGAGTCTCTGTGTTCTGCTCATGCCAATTCCCCT TCTGCCTGTCTCTGCCCGCTTCTCTCTCTGGGCTGGTCTCTCCGAGACTCTGTTCCCT TGGCTGGCATGCCCTCCACCTCCCCTGATGCTGGAGCAGTTCAGGGAGAAAGCCACCG
GCATGCTCACCGTATGTCTCTGGCTCTGTTTCCTCTTTCTGCTTCCCCTTCCCCACCT
TGA
ORF Start: ATG at 135 ORF Stop: TGA at 4293
SEQ ID NO: 38 1386 aa MW at l53195.2kD
NOV12a, MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACWKEDNISERVYTIREGDTLML
CG57518-01 Protein QCLVTGHPRPQVRWTKTAGSASDKFQETSVFNETLRIERIARTQGGRYYCKAENGVGV PAIKSIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIW RGSD
Sequence TLSHSQDNGVDIYEPLYTQGETKVLKLKNLRPQDYASYTCQVSVRNVCGIPDKAITFR LTNTTAPPALKLSVNETLVWPGEj TVQCLLTGGDPLPQLQWSHGPGPLPLGALAQG GTLSIPSVQARDSGYYNCTATNNVGNPAKKTVNLLVRSMKNATFQITPDVIKESENIQ LGQDLKLSCHVDAVPQEKWYQWFK GKPARMSKRLLVTRNDPELPAVTSSLELIDLH FSDYGTYLCMASFPGAPVPDLSVEV ISSETVPPTISVPKGRAWTVREGSPAELQCE VRGKPRPPVL SRVDKEAALLPSGLPLEETPDGKLRLERVSRDMSGTYRCQTARYNGF NVRPREAQVQLNVQFPPEVEPSSQDVRQALGRPVLLRCSLLRGSPQRIASAVWRFKGQ LLPPPPWPAAAEAPDHAELRLDAVTRDSSGSYECSVSNDVGSAACLFQVSAKAYSPE IYFDTPNPTRSHKLSKNYSYVLQWTQREPDAVDPVLNYRLSIRQLNQHNAVVKAIPVR RVEKGQLLEYILTDLRVPHSYEVRLTPYTTFGAGDMASRIIHYTERQIR PPVLALRT LSSGPKQGILCRAPHLSSDLVSPLAFSAINSPNLSDNTCHFEDEKICGYTQDLTDNFD WTRQNALTQNPKRSPNTGPPTDISGTPEGYYMFIETSRPRELGDRARLVSPLYNASAK FYCVSFFYHMYGKHIGSLNLLVRSRNKGALDTHA SLSGNKG VWQQAHVPISPSGPF QIIFEGVRGPGYLGDIAIDDVTLKKGECPRKQTDPNKGARREGAACDGLKFHLSSPMD DGELTDDPIECKHL IHRVDSKGAQYMLAELNCIHVAPRFLVFMDEGHKVGEKDSGGQ PFQVYTDFSFYPHAIPEKMSIMPTLQVGKLRLREEEESAYGHTAA ARAGTRSWSLNR
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 12B.
Further analysis of the NOVl 2a protein yielded the following properties shown in Table 12C.
Table 12C. Protein Sequence Properties NOV12a
PSort 0.3700 probability located in outside; 0.1900 probability located in lysosome analysis: (lumen); 0.1000 probability located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen)
SignalP Likely cleavage site between residues 19 and 20 analysis:
A search of the NOVl 2a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 12D.
In a BLAST search of public sequence databases, the NOVl 2a protein was found to have homology to the proteins shown in the BLASTP data in Table 12E.
Table 12E. Public BLASTP Results for NOV12a
NOV12a Identities/
Protein
Residues/ Similarities for Expect
Accession Protein/Organism/Length
Match the Matched Value
Number
Residues Portion
PFam analysis predicts that the NOVl 2a protein contains the domains shown in the Table 12F.
EXAMPLE 13.
The NOVl 3 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 13 A.
Table 13A. NOV13 Sequence Analysis
SEQ ID NO: 51 4169 bp
NOVl 3a, TCTTCGTCGCCGCTCTCTCTCTCACCTCTCAGGGAAAGGGGGGGACATAGGGGCGTCG CG57409-03 DNA CGGGGCCCCGGCGAATGCGCCCCCCGCCGCCTCTCGGGCTGCGCCGCCTCGCGGGGAT
GAAGCACCGGCCGTGAAGATGGAGGTGACCTGCCTTCTACTTCTGGCGCTGATCCCCT Sequence TCCACTGCCGGGGACAAGGAGTCTACGCTCCAGCCCAGGCGCAGATCGTGCATGCGGG CCAGGCATGTGTGGTGAAAGAGGACAATATCAGCGAGCGTGTCTACACCATCCGGGAG GGGGACACCCTCATGCTGCAGTGCCTTGTAACAGGGCACCCTCGACCCCAGGTACGGT GGACCAAGACGGCAGGTAGCGCCTCGGACAAGTTCCAGGAGACATCGGTGTTCAACGA GACGCTGCGCATCGAGCGTATTGCACGCACGCAGGGCGGCCGCTACTACTGCAAGGCT GAGAACGGCGTGGGGGTGCCGGCCATCAAGTCCATCCGCGTGGACGTGCAGTACCTGG ATGAGCCAATGCTGACGGTGCACCAGACGGTGAGCGATGTGCGAGGCAACTTCTACCA GGAGAAGACGGTGTTCCTGCGCTGTACTGTCAACTCCAACCCGCCTGCCCGCTTCATC TGGAAGCGGGGTTCCGATACCCTATCCCACAGCCAGGACAATGGGGTTGACATCTATG AGCCCCTCTACACTCAGGGGGAGACCAAGGTCCTGAAGCTGAAGAACCTGCGGCCCCA GGACTATGCCAGCTACACCTGCCAGGTGTCTGTGCGTAACGTGTGCGGCATCCCAGAC AAGGCCATCACCTTCCGGCTCACCAACACCACGGCACCACCAGCCCTGAAGCTGTCTG TGAACGAAACTCTGGTGGTGAACCCTGGGGAGAATGTGACGGTGCAGTGTCTGCTGAC AGGCGGTGATCCCCTCCCCCAGCTGCAGTGGTCCCATGGGCCTGGCCCACTGCCCCTG GGTGCTCTGGCCCAGGGTGGCACCCTCAGCATCCCTTCAGTGCAGGCCCGGGACTCTG GCTACTACAACTGCACAGCCACCAACAATGTGGGCAACCCTGCCAAGAAGACTGTCAA CCTGCTGGTGCGATCCATGAAGAACGCTACATTCCAGATCACTCCTGACGTGATCAAA GAGAGTGAGAACATCCAGCTGGGCCAGGACCTGAAGCTATCGTGCCACGTGGATGCAG TGCCCCAGGAGAAGGTGACCTACCAGTGGTTCAAGAATGGCAAGCCGGCACGCATGTC CAAGCGGCTGCTGGTGACCCGCAATGATCCTGAGCTGCCCGCAGTCACCAGCAGCCTA GAGCTCATTGACCTGCACTTCAGTGACTATGGCACCTACCTGTGCATGGCTTCTTTCC CAGGGGCACCCGTGCCCGACCTCAGCGTCGAGGTCAACATCTCCTCTGAGACAGTGCC GCCCACCATCAGTGTGCCCAAGGGTAGGGCCGTGGTGACCGTGCGCGAGGGATCGCCT GCCGAGCTGCAATGCGAGGTGCGGGGCAAGCCGCGGCCGCCAGTGCTCTGGTCCCGCG TGGACAAGGAGGCTGCACTGCTGCCCTCGGGGCTGCCCCTGGAGGAGACTCCGGACGG GAAGCTGCGGCTGGAGCGAGTGAGCCGAGACATGAGCGGGACCTACCGCTGCCAGACG GCCCGCTATAATGGCTTCAACGTGCGCCCCCGTGAGGCCCAGGTGCAGCTGAACGTGC AGTTCCCGCCGGAGGTGGAGCCCAGTTCCCAGGACGTGCGCCAGGCGCTGGGCCGGCC CGTGCTCCTGCGCTGCTCGCTGCTGCGAGGCAGCCCCCAGCGCATCGCCTCGGCTGTG TGGCGTTTCAAAGGGCAGCTGCTGCCGCCGCCGCCTGTTGTTCCCGCCGCCGCCGAGG CGCCGGATCACGCGGAGCTGCGCCTCGACGCCGTAACTCGCGACAGCAGCGGCAGCTA CGAGTGCAGCGTCTCCAACGATGTGGGCTCGGCTGCCTGCCTCTTCCAGGTCTCCGCC AAAGCCTACAGCCCGGAGTTTTACTTCGACACCCCCAACCCCACCCGCAGCCACAAGC TGTCCAAGAACTACTCCTACGTGCTGCAGTGGACTCAGAGGGAGCCCGACGCTGTCGA; CCCTGTGCTCAACTACAGACTCAGCATCCGCCAGTTGAACCAGCACAATGCGGTGGTC AAGGCCATCCCGGTCCGGCGTGTGGAGAAGGGGCAGCTGCTGGAGTACATCCTGACCG ATCTCCGTGTGCCCCACAGCTATGAGGTCCGCCTCACACCCTATACCACCTTCGGGGC TGGTGACATGGCCTCCCGCATCATCCACTACACAGAGCCCATCAACTCTCCGAACCTT TCAGACAACACCTGCCACTTTGAGGATGAGAAGATCTGTGGCTATACCCAGGACCTGA CAGACAACTTTGACTGGACGCGGCAGAATGCCCTCACCCAGAACCCCAAACGCTCCCC CAACACTGGTCCCCCCACCGACATAAGTGGCACCCCTGAGGGCTACTACATGTTCATC GAGACATCGAGGCCTCGGGAGCTGGGGGACCGTGCAAGGTTAGTGAGTCCCCTCTACA ATGCCAGCGCCAAGTTCTACTGTGTCTCCTTCTTCTACCACATGTACGGGAAACACAT CGGCTCCCTCAACCTCCTGGTGCGGTCCCGGAACAAAGGGGCTCTGGACACGCACGCC TGGTCTCTCAGTGGCAATAAGGGCAATGTGTGGCAGCAGGCCCATGTGCCCATCAGCC
CCAGTGGGCCCTTCCAGATTATTTTTGAGGGGGTTCGAGGCCCGGGCTACCTGGGGGA TATTGCCATAGATGACGTCACACTGAAGAAGGGGGAGTGTCCCCGGAAGCAGACGGAT CCCAATAAAGGTGCAAGACGGGAAGGAGCTGCCTGCGATGGCCTGAAATTCCACCTTT CATCCCCTATGGATGACGGAGAGCTTACAGATGACCCTATTGAATGCAAGCACCTTTG GATCCATAGAGTGGACAGTAAAGGTGCTCAGTACATGTTGGCTGAGCTGAACTGCATA CATGTGGCCCCCAGGTTCCTGGTCTTTATGGACGAAGGGCACAAGGTTGGTGAAAAGG ACTCCGGGGGCCAGCCCTTCCAAGTTTACACTGATTTCTCCTTTTACCCTCATGCTAT CCCTGAGAAGATGTCAATAATGCCCACGTTACAGGTGGGAAAACTGAGGCTTAGAGAG GAGGAGGAATCTGCCTACGGTCACACAGCTGCAAAGGCTAGAGCTGGGACCAGGAGCT GGTCTCTTAACCGACCACCTGAGCTCAAGAGCTTTTCTCTCTGGACCAACATGACCCA AAGTGTGCGCGAGCCTATCACAGGTCCCCTGCAATGCCAAACATACACGCACAGCAAT ACACAACACCTGGGGACATGGATGAAGCTGGAAACCATCATTCTCAGCAAACTGACAC AAGAACAGAAAACCAAACACCACATGTTCTCACTCACCACCCAGTCTGCCCCGCCCTC TCTCTTCTCACCTGAACTTCCCCTCTCCTCAAACTCTCGAGGCCACGCCTCTATGTCC TTGGATGATGATGATGACGACGACGACGATGATGATGATGATGATGACGACGATGACA ATGATGATGATGATGGAAGGAAGACCTACAGAATCCCTCCAGGCTCTGACCTCAGTGC TTGTGGGTGGGTGAATGACCACATGTCGCAGGGAGACTCCACAGGTCCTCCCGATGAG AAGCACTCTTATGCCAAAGAGGAGACTCAGGCCAAACTGACAGGACCAGGAATTAGCT ACCCTGGTAAACCCAGCTATCGACTGCACCCGAGCGGCTACACACCACTGGAGCAGTT CAGGGAGAAAGCCACCGGCATGCTCACCCCGTATGTCTCTGGCTCTGTTTCCTCTTTC TGCTTCCCCTTCCCCACCTCTGAGTCTCTGTGTTCTGCTCATGCCAATTCCCCTTCTG CCTGTCTCTGCCCGCTTCTCTCTGGGCTGGTCTCTCCGAGACTCTGTTCCCTTGGCTG GCATGCCCTCCACCTCCCCTGATGGTTCAGCAGAGATGAAGCCGGCCTGGCTCATGGG
TGTGGGTAATGTACTAGTGCAGGAGAGTGGTGGGGCCCAGTCTGGGTGCAG
ORF Start: ATG at 135 ORF Stop: TGA at 4080
SEQ ID NO: 52 1315 aa MW at 145782.9kD
NOVl 3a, MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACWKEDNISERVYTIREGDTLML
CG57409-03 Protein QCLVTGHPRPQVRWTKTAGSASDKFQETSVFNETLRIERIARTQGGRYYCKAENGVGV PAIKSIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFI KRGSD Sequence TLSHSQDNGVDIYEPLYTQGETKVLKLKNLRPQDYASYTCQVSVRNVCGIPDKAITFR LTNTTAPPALKLSWETLVWPGENVTVQCLLTGGDPLPQLQWSHGPGPLPLGALAQG GTLSIPSVQARDSGYYNCTATNNVGNPAKKTVNLLVRSMKNATFQITPDVIKESENIQ LGQDLKLSCHVDAVPQEKVTYQ FKNGKPARMSKRLLVTRNDPELPAVTSSLELIDLH FSDYGTYLCMASFPGAPVPDLSVEVNISSETVPPTISVPKGRAWTVREGSPAELQCE VRGKPRPPVLWSRVDKEAALLPSGLPLEETPDGKLRLERVSRDMSGTYRCQTARYNGF NWPREAQVQLNVQFPPEVEPSSQDVRQALGRPVLLRCSLLRGSPQRIASAVWRFKGQ LLPPPPWPAAAEAPDHAELRLDAVTRDSSGSYECSVSNDVGSAACLFQVSAKAYSPE FYFDTPNPTRSHKLSKNYSYVLQWTQREPDAVDPVLNYRLSIRQLNQHNAWKAIPVR RVEKGQLLEYILTDLRVPHSYEVRLTPYTTFGAGDMASRIIHYTEPINSPNLSDNTCH FEDEKICGYTQDLTDNFD TRQNALTQNPKRSPNTGPPTDISGTPEGYYMFIETSRPR ELGDRARLVSPLYNASAKFYCVSFFYHMYGKHIGSLNLLVRSRNKGALDTHAWSLSGN KGNVWQQAHVPISPSGPFQIIFEGVRGPGYLGDIAIDDVTLKKGECPRKQTDPNKGAR REGAACDGLKFHLSSPMDDGELTDDPIECKHLWIHRVDSKGAQYMLAELNCIHVAPRF LVFMDEGHKVGEKDSGGQPFQVYTDFSFYPHAIPEKMSIMPTLQVGKLRLREEEESAY GHTAAKARAGTRSWSLNRPPELKSFSLWTNMTQSVREPITGPLQCQTYTHSNTQHLGT WMKLETIILSKLTQEQKTKHHMFSLTTQSAPPSLFSPELPLSSNSRGHASMSLDDDDD DDDDDDDDDDDDDNDDDDGRKTYRIPPGSDLSACG VNDHMSQGDSTGPPDEKHSYAK EETQAKLTGPGISYPGKPSYRLHPSGYTPLEQFREKATGMLTPYVSGSVSSFCFPFPT SESLCSAHANSPSACLCPLLSGLVSPRLCSLG HALHLP
SEQ ID NO: 53 1500 bp
NOVl 3b, TGAGCCGAGACATGAGCGGGACCTACCGCTGCCAGACGGCCCGCTATAATGGCTTCAA CG57409-05 DNA CGTGCGCCCCCGTGAGGCCCAGGTGCAGCTGAACGTGCAGTTCCCGCCGGAGGTGGAG CCCAGTTCCCAGGACGTGCGCCAGGCGCTGGGCCGGCCCGTGCTCCTGCGCTGCTCGC Sequence TGCTGCGAGGCAGCCCCCAGCGCATCGCCTCGGCTGTGTGGCGTTTCAAAGGGCAGCT GCTGCCGCCGCCGCCTGTTGTTCCCGCCGCCGCCGAGGCGCCGGATCACGCGGAGCTG CGCCTCGACGCCGTAACTCGCGACAGCAGCGGCAGCTACGAGTGCAGCGTCTCCAACG ATGTGGGCTCGGCTGCCTGCCTCTTCCAGGTCTCCGCCAAAGCCTACAGCCCGGAGTT TTACTTCGACACCCCCAACCCCACCCGCAGCCACAAGCTGTCCAAGAACTACTCCTAC
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 13B.
Further analysis of the NOVl 3a protein yielded the following properties shown in Table 13C.
Table 13C. Protein Sequence Properties NOV13a
PSort 0.3700 probability located in outside; 0.1900 probability located in lysosome analysis: (lumen); 0.1000 probability located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen)
SignalP Likely cleavage site between residues 19 and 20 analysis: A search of the NOVl 3a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 13D.
Table 13D. Geneseq Results for NOV13a
NOV13a Identities/
Geneseq Protein/Organism/Length [Patent #, Residues/ Similarities for Expect Identifler Date] Match the Matched Value Residues Region
In a BLAST search of public sequence databases, the NOV13a protein was found to have homology to the proteins shown in the BLASTP data in Table 13E.
PFam analysis predicts that the NOVl 3a protein contains the domains shown in the Table 13F.
EXAMPLE 14.
The NOVl 4 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 14A.
NOV14a, MAMDTMIRIFHRYSGKARKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQDLDA
CG59262-01 Protein NKDNEVDFNEFWMVAALTVACNDYFVEQLKKKGK Sequence
Further analysis of the NOVl 4a protein yielded the following properties shown in Table 14B.
Table 14B. Protein Sequence Properties NOV14a
PSort 0.7000 probability located in plasma membrane; 0.5337 probability located in analysis: mitochondrial inner membrane; 0.3627 probability located in mitochondrial intermembrane space; 0.2997 probability located in mitochondrial matrix space
SignalP No Known Signal Sequence Predicted analysis:
A search of the NOV14a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 14C
In a BLAST search of public sequence databases, the NOVl 4a protein was found to have homology to the proteins shown in the BLASTP data in Table 14D.
PFam analysis predicts that the NOVl 4a protein contains the domains shown in the Table 14E.
EXAMPLE 15.
The NOVl 5 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 15 A.
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 15B.
Table 15B. Comparison of NOV15a against NOV15b through NOV15c.
NOV15a Residues/
Protein Sequence Identities/ Match Residues Similarities for the Matched Region
NOVl 5b 1..248 217/248 (87%) 1..248 217/248 (87%)
NOVl 5c 1..248 191/248 (77%) 1..214 191/248 (77%)
Further analysis of the NOVl 5a protein yielded the following properties shown in Table 15C.
Table 15C. Protein Sequence Properties NOV15a
PSort 0.6000 probability located in plasma membrane; 0.4000 probability located in analysis: Golgi body; 0.3000 probability located in endoplasmic reticulum (membrane); 0.0300 probability located in mitochondrial inner membrane
SignalP Likely cleavage site between residues 17 and 18 analysis: A search of the NOVl 5a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 15D.
In a BLAST search of public sequence databases, the NOVl 5a protein was found to have homology to the proteins shown in the BLASTP data in Table 15E.
PFam analysis predicts that the NOVl 5a protein contains the domains shown in the Table 15F.
EXAMPLE 16.
The NOVl 6 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 16A.
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 16B.
Table 16B. Comparison of NOVlόa against NOVlόb through NOVlόc.
NOVlόa Residues/ Identities/
Protein Sequence Match Residues Similarities for the Matched Region
NOVlόb 143-531 351/391 (89%) 2..391 353/391 (89%)
NOVlόc 143-531 350/391 (89%) 2..391 352/391 (89%)
Further analysis of the NOVlόa protein yielded the following properties shown in Table 16C.
Table 16C. Protein Sequence Properties NOVlόa
PSort 0.4500 probability located in cytoplasm; 0.3000 probability located in microbody analysis: (peroxisome); 0.2864 probability located in lysosome (lumen); 0.1000 probability located in mitochondrial matrix space
SignalP No Known Signal Sequence Predicted analysis: A search of the NOVl 6a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 16D.
In a BLAST search of public sequence databases, the NOVlόa protein was found to have homology to the proteins shown in the BLASTP data in Table 16E.
PFam analysis predicts that the NOVlόa protein contains the domains shown in the Table 16F.
Table 16F. Domain Analysis of NOVlόa
Identities/
Pfam Domain NOVlόa Match Region Similarities Expect Value for the Matched Region
No Significant Matches Found
EXAMPLE 17.
The NOVl 7 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 17A.
Further analysis of the NOVl 7a protein yielded the following properties shown in Table 17B.
Table 17B. Protein Sequence Properties NOV17a
PSort 0.8134 probability located in mitochondrial intermembrane space; 0.5255 analysis: probability located in mitochondrial matrix space; 0.2672 probability located in lysosome (lumen); 0.2537 probability located in mitochondrial inner membrane
SignalP Likely cleavage site between residues 20 and 21 analysis:
A search of the NOVl 7a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 17C
In a BLAST search of public sequence databases, the NOVl 7a protein was found to have homology to the proteins shown in the BLASTP data in Table 17D.
Table 17D. Public BLASTP Results for NOV17a
PFam analysis predicts that the NOVl 7a protein contains the domains shown in the Table 17E.
Table 17E. Domain Analysis of NOVl 7a
Identities/
Pfam Domain NOV17a Match Region Similarities Expect Value for the Matched Region
No Significant Matches Found
EXAMPLE 18.
The NOVl 8 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 18A.
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 18B.
Table 18B. Comparison of NOV18a against NOV18b through NOV18d.
Further analysis of the NOVl 8a protein yielded the following properties shown in Table 18C.
Table 18C. Protein Sequence Properties NOV18a
PSort 0.3000 probability located in microbody (peroxisome); 0.3000 probability analysis: located in nucleus; 0.1000 probability located in mitochondrial matrix space; 0.1000 probability located in lysosome (lumen)
SignalP No Known Signal Sequence Predicted analysis:
A search of the NOVl 8a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 18D.
In a BLAST search of public sequence databases, the NOVl 8a protein was found to have homology to the proteins shown in the BLASTP data in Table 18E.
PFam analysis predicts that the NOVl 8a protein contains the domains shown in the Table 18F.
EXAMPLE 19.
The NOVl 9 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 19A.
Further analysis of the NOVl 9a protein yielded the following properties shown in Table 19B.
Table 19B. Protein Sequence Properties NOV19a
PSort 0.4500 probability located in cytoplasm; 0.3600 probability located in analysis: mitochondrial matrix space; 0.1000 probability located in lysosome (lumen); 0.0000 probability located in endoplasmic reticulum (membrane)
SignalP No Known Signal Sequence Predicted analysis:
A search of the NOVl 9a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 19C
Table 19C. Geneseq Results for NOV19a
NOV19a Identities/
Geneseq Protein/Organism/Length [Patent #, Residues/ Similarities for Expect Identifler Date] Match the Matched Value Residues Region
In a BLAST search of public sequence databases, the NOVl 9a protein was found to have homology to the proteins shown in the BLASTP data in Table 19D.
PFam analysis predicts that the NOVl 9a protein contains the domains shown in the Table 19E.
Table 19E. Domain Analysis of NOV19a
Identities/
Pfam Domain NOV19a Match Region Similarities Expect Value for the Matched Region
No Significant Matches Found
EXAMPLE 20.
The NOV20 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 20A.
Further analysis of the NOV20a protein yielded the following properties shown in Table 20B.
Table 20B. Protein Sequence Properties NOV20a
PSort 0.6238 probability located in microbody (peroxisome); 0.6000 probability analysis: located in nucleus; 0.3600 probability located in mitochondrial matrix space; 0.1830 probability located in lysosome (lumen)
SignalP No Known Signal Sequence Predicted analysis:
A search of the NOV20a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 20C
Table 20C. Geneseq Results for NOV20a
Identities/
NOV20a
Similarities
Geneseq Protein/Organism/Length [Patent #, Residues/ Expect for the Identifier Date] Match Value
Matched Residues
Region
In a BLAST search of public sequence databases, the NOV20a protein was found to have homology to the proteins shown in the BLASTP data in Table 20D.
PFam analysis predicts that the NOV20a protein contains the domains shown in the Table 20E.
Table 20E. Domain Analysis of NOV20a
Identities/
Pfam Domain NOV20a Match Region Similarities Expect Value for the Matched Region
No Significant Matches Found
EXAMPLE 21.
The NOV21 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 21 A.
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 2 IB.
Further analysis of the NOV21a protein yielded the following properties shown in Table 21C.
Table 21C. Protein Sequence Properties NOV21a
PSort 30.6138 probability located in outside; 0.4772 probability located in lysosome analysis: (lumen); 0.1000 probability located in endoplasmic reticulum (membrane); 10.1000 probability located in endoplasmic reticulum (lumen)
SignalP Likely cleavage site between residues 25 and 26 analysis:
A search of the NOV21a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 2 ID.
In a BLAST search of public sequence databases, the NOV21a protein was found to have homology to the proteins shown in the BLASTP data in Table 2 IE.
PFam analysis predicts that the NOV2 la protein contains the domains shown in the Table 21F.
Table 21F. Domain Analysis of NOV21a
Identities/
Pfam Domain NOV21a Match Region Similarities Expect Value for the Matched Region
No Significant Matches Found
EXAMPLE 22.
The NOV22 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 22A.
GCCGTGCACCCGAGGGAGATTTTCAAGCAGAAGGAGAGGGCCATGTCCACCACCTCCA TCTCCAGTCCTCAGCCTGGCAAGCTGAGGAGCCCCTTCCTGCAGAAGCAGCTCACCCA ACCAGAGACCCACTTTGGCAGAGAGCCAGCTGCTGCCATCTCAAGGCCCAGGGCAGAT CTCCCTGCTGAGGAGCCGGCGCCCAGCACTCCTCCATGTCTGGTGCAGGCAGAAGAGG AGGCTGTGTATGAGGAACCTCCAGAGCAGGAGACCTTCTACGAGCAGCCCCCACTGGT GCAGCAGCAAGGTGCTGGCTCTGAGCACATTGACCACCACATTCAGGGCCAGGGGCTC AGTGGGCAAGGGCTCTGTGCCCGTGCCCTGTACGACTACCAGGCAGCCGACGACACAG AGATCTCCTTTGACCCCGAGAACCTCATCACGGGCATCGAGGTGATCGACGAAGGCTG GTGGCGTGGCTATGGGCCGGATGGCCATTTTGCATGTTCCCTGCCAACTACGTGGAGC TCATTGAGTGAGGCTGAGGGCACATCTTGCCCTTCCCCTCTCAGACATGGCTTCCTTA TTGCTGGAAGAGGAGGCCTGGGAGTTGACATTCAGCACTCTTCCAGGAATAGGACCCC CAGTGAGGATGAGGCCTCAGGGCTCCCTCCGGCTTGGCAGACTCAGCCTGTCACCCCA AATGCAGCAATGGCCTGGTGATTCCCACACATCCTTCCTGCATCCCCCGACCCTCCCA
GACAGCTTGGCTCTTGCCCCTGACAGGATACTGAGCCAAGCCCTGCCTGTGGCCAAGC
CCTGAGTGGCCACTGCCAAGCTGCGGGGAAGGGTCCTGAGCAGGGGCATCTGGGAGGC
TCTGGCTGCCTTCTGCATTTATTTGCCTTTTTTCTTTTTCTCTTGCTTCTAAGGGGTG
GTGGCCACCACTGTTTAGAATGACCCTTGGGAACAGTGAACGTAGAGAATNGTTTTTA
GCAGAGTTGTGACCAAAGTCAGAGTGGATCATGGTGGTTTGGCAGCAGGGAATCTGTC
TTGTTGGAGCCTGCTCTGTGCTCCCCACTCCATTTCTCTGTCCCTCTGCCTGGGCTAT
GGGAAGTGGGGATGCAGATGGCAAGCTCCCACCCTGGGTATTCAAAAA
ORF Start: ATG at 10 ORF Stop: TGA at 1585
SEQ ID NO: 114 525 aa MW at 58507.2kD
NOV22a, MKAHDKPPDLWRLKAESLYRCCGAEEFANYSRSCPALQEAYVRWTEKSPTDWALFTY
CG59375-01 Protein EGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVND VRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRF Sequence QDVGPQAPWSGSVYQKTNAVSEIKRVGKDSF AKAEDPETLSERNKREREEEAQRQL EQERRERELREAARREQRYQEQR RGQSRT EQQQEWSRNRNEQGSTCASLQESAVH PREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGREPAAAISRPRADLPA EEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPLVQQQGAGSEHIDHHIQGQGLSGQ GLCARALYDYQAADDTEISFDPENLITGIEVIDEG RGYGPDGHFACSLPTTWSSLS EAEGTSCPSPLRHGFLIAGRGGLGVDIQHSSRNRTPSEDEASGLPPAWQTQPVTPNAA MAW
Further analysis of the NOV22a protein yielded the following properties shown in Table 22B.
Table 22B. Protein Sequence Properties NOV22a
PSort 0.6500 probability located in cytoplasm; 0.1000 probability located in analysis: mitochondrial matrix space; 0.1000 probability located in lysosome (lumen); 0.0000 probability located in endoplasmic reticulum (membrane)
SignalP No Known Signal Sequence Predicted analysis:
A search of the NOV22a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 22C
Table 22C. Geneseq Results for NOV22a
NOV22a Identities/
Geneseq Protein/Organism/Length [Patent #, Expect Residues/ Similarities for Identifier Date] Value
In a BLAST search of public sequence databases, the NOV22a protein was found to have homology to the proteins shown in the BLASTP data in Table 22D.
PFam analysis predicts that the NOV22a protein contains the domains shown in the Table 22E.
EXAMPLE 23.
The NOV23 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 23A.
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 23B.
Table 23B. Comparison of NOV23a against NOV23b and NOV23c.
NOV23a Residues/ Identities/
Protein Sequence Match Residues Similarities for the Matched Region
NOV23b 27..444 357/419 (85%) 27-426 361/419 (85%)
Further analysis of the NOV23a protein yielded the following properties shown in Table 23C
Table 23C. Protein Sequence Properties NOV23a
PSort 0.8411 probability located in mitochondrial inner membrane; 0.7000 probability analysis: located in plasma membrane; 0.3000 probability located in microbody (peroxisome); 0.2057 probability located in mitochondrial matrix space
SignalP No Known Signal Sequence Predicted analysis:
A search of the NOV23a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 23D.
In a BLAST search of public sequence databases, the NOV23a protein was found to have homology to the proteins shown in the BLASTP data in Table 23E.
PFam analysis predicts that the NOV23a protein contains the domains shown in the Table 23F.
EXAMPLE 24.
The NOV24 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 24A.
CCATTATACCCAGATGGTGTGGGCATCCTCCAATCGGCTGGGCTGTGCCATCCACACC TGTAGTAGCATCAGTGTCTGGGGCAACACCTGGCATCGGGCGGCATACCTGGTCTGCA ACTATGCCATTAAGGGCAACTGGATTGGCGAGTCCCCGTACAAGATGGGAAAGCCGTG CTCCTCCTGTCCCCCCAGTTATCAAGGCAGCTGCAATAGCAACATGTGCTTCAAGGGG CTGAAATCCAACAAGTTCACGTGGTTCTGAATTTTCTCTGGGCTTTGGTGCGCCTCCA
GCTGGGCCTGACCCTCCATGTCCTGCCCTCAAAAAACTGGGTGGAGAAATAATTGTTT
CTTTAAAGGATATGAGTTAGAATCACCC
ORF Start: ATG at 23 ORF Stop: TGA at 782
SEQ ID NO: 120 253 aa MW at 28604.6kD
NOV24a, MPLLPSTVGLAGLLFWAGQAVNALIMPNATPAPAQPESTAMRLLSGLEVPRYRRKRHI
CG59591-01 Protein SVRDMNALLDYHNHIRASVYPPAANMEYMV DKRLARAAEA ATQCI AHGPSQLMRY VGQNLSIHSGQYRSWDLMKSWSEEKWHYLFPAPRDCNPHCPWRCDGPTCSHYTQMVW Sequence ASSNRLGCAIHTCSSISVWGNTWHRAAYLVCNYAIKGNWIGESPYKMGKPCSSCPPSY QGSCNSNMCFKGLKSNKFT F
Further analysis of the NOV24a protein yielded the following properties shown in Table 24B.
Table 24B. Protein Sequence Properties NOV24a
PSort 0.4400 probability located in lysosome (lumen); 0.3798 probability located in analysis: outside; 0.1000 probability located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen)
SignalP Likely cleavage site between residues 24 and 25 analysis:
A search of the NOV24a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 24C
In a BLAST search of public sequence databases, the NOV24a protein was found to have homology to the proteins shown in the BLASTP data in Table 24D.
PFam analysis predicts that the NOV24a protein contains the domains shown in the Table 24E.
EXAMPLE 25.
The NOV25 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 25A.
CG59588-01 DNA GCCGGATCATGCCCGGAGCCGTGCGCCTGCGTGGACAAGTACGCTCACCAGTTCGCGG Sequence ACTGCGCTTACAAAGAGTTGCGTGAGGTGCCGGAAGGACTGCCTGCCAACGTGACGAC GCTTAGTCTGTCCGCGAACAAGATCACTGTGCTGCGGCGCGGGGCCTTCGCCGACGTC ACACAGGTCACGTCGCTGTGGCTGGCGCACAATGAGGTGCGCACCGTGGAGCCAGGCG CACTGGCCGTGCTGAGTCAGCTCAAGAACCTCGATCTGAGCCACAACTTCATATCCAG CTTTCCGTGGAGCGACCTGCGCAACCTGAGCGCGCTGCAGCTGCTCAAAATGAACCAC AACCGCCTGGGCTCTCTGCCCCGGGACGCACTCGGTGCGCTACCCGACCTGCGTTCCC TGCGCATCAACAACAACCGGCTGCGTACGCTGGCGCCTGGCACCTTCGACGCGCTTAG CGCGCTGTCACACTTGCAACTCTATCACAATCCCTTCCACTGCGGCTGCGGCCTTGTG TGGCTGCAGGCCTGGGCCGCGAGCACCCGGGTGTCCTTACCCGAGCCCGACTCCATTG CTTGTGCCTCGCCTCCCGCGCTGCAGGGGGTGCCGGTGTACCGCCTGCCCGCCCTGCC CTGTGCACCGCCCAGCGTGCATCTGAGTGCCGAGCCACCGCTTGAAGCACCCGGCACC CCACTGCGCGCAGGACTGGCGTTCGTGTTACACTGCATCGCCGACGGCCACCCTACGC CTCGCCTGCAATGGCAACTTCAGATCCCCGGTGGCACCGTAGTCTTAGAGCCACCGGT TCTGAGCGGGGAGGACGACGGGGTTGGGGCGGAGGAAGGAGAGGGAGAAGGAGATGGG GATTTGCTGACGCAGACCCAAGCCCAAACGCCGACTCCAGCACCCGCTTGGCCGGCGC CCCCAGCCACACCGCGCTTCCTGGCCCTCGCAAATGGCTCCCTGTTGGTGCCCCTCCT GAGTGCCAAGGAGGCGGGCGTCTACACTTGCCGTGCACACAATGAGCTGGGCGCCAAC TCTACGTCAATACGCGTGGCGGTGGCAGCAACCGGGCCCCCAAAACACGCGCCTGGCG CCGGGGGAGAACCCGACGGACAGGCCCCGACCTCTGAGCGCAAGTCCACAGCCAAGGG CCGGGGCAACAGCGTCCTGCCTTCCAAACCCGAGGGCAAAATCAAAGGCCAAGGCCTG GCCAAGGTCAGCATTCTCGGGGAGACCGAGACGGAGCCGGAGGAGGACACAAGTGAGG GAGAGGAGGCCGAAGACCAGATCCTCGCGGACCCGGCGGAGGAGCAGCGCTGTGGCAA CGGGGACCCCTCTCGGTACGTTTCTAACCACGCGTTCAACCAGAGCGCAGAGCTCAAG CCGCACGTCTTCGAGCTGGGCGTCATCGCGCTGGATGTGGCGGAGCGCGAGGCGCGGG TGCAGCTGACTCCGCTGGCTGCGCGCTGGGGCCCTGGGCCCGGCGGGGCTGGCGGAGC CCCGCGACCCGGGCGGCGACCCCTGCGCCTACTCTATCTGTGTCCAGCGGGGGGCGGC GCGGCAGTGCAGTGGTCCCGCGTAGAGGAAGGCGTCAACGCCTACTGGTTCCGCGGCC TGCGGCCGGGTACCAACTACTCCGTGTGCCTGGCGCTGGCGGGCGAAGCCTGCCACGT GCAAGTGGTGTTTTCCACCAAGAAGGAGCTCCCATCGCTGCTGGTCATAGTGGCAGTG AGCGTATTCCTCCTGGTGCTGGCCACAGTGCCCCTTCTGGGCGCCGCCTGCTGCCATC TGCTGGCTAAACACCCGGGCAAGCCCTACCGTCTGATCCTGCGGCCTCAGGCCCCTGA CCCTATGGAGAAGCGCATCGCCGCAGACTTCGACCCGCGTGCTTCGTACCTCGAGTCC GAGAAAAGCTACCCGGCAGGCGGCGAGGCGGGCGGCGAGGAGCCAGAGGACGTGCAGG GGGAGGGCCTTGATGAAGACGCGGAGCAGGGAGACCCAAGTGGGGACCTGCAGAGAGA GGAGAGCCTGGCGGCCTGCTCACTGGTGGAGTCCCAGTCCAAGGCCAACCAAGAGGAG TTCGAGGCGGGCTCTGAGTACAGCGATCGGCTGCCCCTGGGCGCCGAGGCGGTCAACA TCGCCCAGGAGATTAATGGCAACTACAGGCAGACGGCAGGCTGAACCTCCGCCCGTCC GGCCCGCCCATTCCCGACCTCCACCTAGGGTGCCTGGGAGCAGCAGTCTAGGGCTGGC AGGACTTATGTCCCCCGTCCCCAAC
ORF Start: ATG at 11 ORF Stop: TGA at 2246
SEQ ID NO: 122 2345 aa MW at 78989.2 kD
NOV25a, MFPLRALWLVWALLGVAGSCPEPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSL
CG59588-01 Protein SANKITVLRRGAFADVTQVTSL LAHNEVRTVEPGALAVLSQLKNLDLSHNFISSFPW SDLRNLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLAPGTFDALSALS Sequence HLQLYHNPFHCGCGLVWLQA AASTRVSLPEPDSIACASPPALQGVPVYRLPALPCAP PSVHLSAEPPLEAPGTPLRAGLAFVLHCIADGHPTPRLQ QLQIPGGTWLEPPVLSG EDDGVGAEEGEGEGDGDLLTQTQAQTPTPAPA PAPPATPRFLALANGSLLVPLLSAK EAGVYTCRAHNELGANSTSIRVAVAATGPPKHAPGAGGEPDGQAPTSERKSTAKGRGN SVLPSKPEGKIKGQGLAKVSILGETETEPEEDTSEGEEAEDQILADPAEEQRCGNGDP SRYVSNHAFNQSAELKPHVFELGVIALDVAEREARVQLTPLAARWGPGPGGAGGAPRP GRRPLRLLYLCPAGGGAAVQWSRVEEGVNAY FRGLRPGTNYSVCLALAGEACHVQW FSTKKELPSLLVIVAVSVFLLVLATVPLLGAACCHLLAKHPGKPYRLILRPQAPDPME KRIAADFDPRASYLESEKSYPAGGEAGGEEPEDVQGEGLDEDAEQGDPSGDLQREESL AACSLVESQSKANQEEFEAGSEYSDRLPLGAEAV IAQEINGNYRQTAG
Further analysis of the NOV25a protein yielded the following properties shown in
Table 25B.
Table 25B. Protein Sequence Properties NOV25a
PSort 0.4600 probability located in plasma membrane; 0.1000 probability located in analysis: endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen); 0.1000 probability located in outside
SignalP Likely cleavage site between residues 19 and 20 analysis:
A search of the NOV25a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 25C
In a BLAST search of public sequence databases, the NOV25a protein was found to have homology to the proteins shown in the BLASTP data in Table 25D.
PFam analysis predicts that the NOV25a protein contains the domains shown in the Table 25E.
EXAMPLE 26.
The NOV26 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 26A.
CG59584-01 DNA GGGGTTATAGGTGTGAGCCACTGTGCCTGGCTATTCTTTTATTACAGTATGTTCTGCT Sequence GATTCCTTCTGTTCTACAAGAAGGCTCTTTGGATAAAGCTTGTGCCCAGCTTTTTAAT CTCACTGAATCTGTTGTTTTGACGGTCTCCCTCAACTATGGTGAGGTCCAGACCAAAA TATTTGAAGAAAATGTTACTGGAGAAAATTTCTTCAAATGCATCAGCTTTGAGGTTCC TCAGGCCAGATCTGACCCACTGGCATTTATTACATTTTCTGCTAAAGGAGCCACTCTC AACCTGGAAGAGAGGAGATCTGTGGCAATCAGATCCAGAGAGAATGTGGTCTTTGTAC AGACTGATAAACCCACCTACAAGCCTGGACAGTATAATAAAAAGCCGATCAGTCACAT AATGCCAGTGATAGCAGTCACTGAACAGGATCCAGAAGGCAATCGAATACAACAGTGG GTGAATGAGGAGTCTGTGGGAGGGATTCTACAACTCTCCTTCCAGTTAATCTCAGAGC CCATCCTCGGATGGTATGAAATCACCGTGGAGATGCTCAATGAGAAGAAAACATATCA CTCCTTCTCTGTGGAAGAATATGTGTTACCCAAATTTCAAATGACTGTGGATGCACCA GAAAATATCTTAGTTGTGGACTCTGAATTCAAAGTGAATGTCTGTGCCTTGTATACCT ATGGTGAACCTGTGGACGGGAAGGTCCAACTTAGTGTGTGCAGAGAATCTACGGCTTA TCATTCATGTGCTCATCTTATCAGTTCACTCTGTAAAAATTTTACCTTGGGGAAAGAT GGCTGTGTCTCCAAGTTTATTAACACAGATGCTTTTGAGTTAAATCGGGAAGGATACT GGAGTTTCCTCAAAGTGCATGCTCTTGTTACAGAGCTTACAGGCTCCAAGTACGTATA CATAGACTCATCAGTGGTGAAGATTAGTTTTGAGAATATGGATATGTCCTACAAACAG GGACTCCCTTATTTTGGCCAGATTAAATTGCTTAATCCAGACAACTCTCCAATCCCAA ATGAAGTTGTTCAGTTGCATCTGAAGGACAAAATCGTGGGAAACTACACCACAGATGT AAATGGCATCGCTCAGTTTTTCTTGGACACATATACGTTTACATACCCAAATATCACT TTGAAAGCAGCCTACAAGGCCAATGAAAATTGCCAGGCTCATGGCTGGGTGTTGCCTC AATACCCTCAGCCCGAGTACTTTGCATATCGATTTTACTCCAAGATGAATAGCTTCCT AAAGATTGTCCAAGAGATGGAAGAACTGAGATGCAACCAGCAGAAGAGGGTGCTAGTG CACTGCATTCTCAATATGGAAGACTTTGAAGACAAAACCTACACAGCAGACTTCAATT ATTTGGTGATTTCAAAAGGTGTAATCATTCTTCATGGGCAACAGAAAATTGAGATCAA CGAAAATGGGAGGAAGGGCATATTTTCCATTTCTATAGACATTAACCCTGAATTAGCG CCCTCAGTACATATGCTTGTCTATAGCTTGCATCCTGGAGGAGAAATGGTCACTGATA GCACCCAATTCCAATTGAGAAATGTTAACATAAAGTTCTCTAACGAGCAGGGCTTACC TGGTTCCAATGCTAGTCTCTGTCTTCAAGCGGCGCCTGTCTTATTCTGTGCCCTCAGG GCTGTGGATAGGAATGTCCTTCTACTGAAATCTGAACAACAGCTGTCAGCTGAAAGTG TGTATAACATGGTTCCAAGTATAGAGCCGTATGGTTATTTCTACCATGGCCTCAATCT TGATGATGGCAAGGAAGACCCTTGCATTCCTCAGAGGGATATGTTCTACAATGGTTTA TATTACACACCTGTAAGCAACTATGGGGATGGAGATATCTATAATATTGTCAGGAACA TGGGTCTAAAAGTCTTTACCAATCTCCATTACCGAAAACCAGAAGTATGTGTGATGGA GAGAAGGCTGCCACTCCCTAAGCCGCTTTATCTGGAAACAGAAAATTATGGTCCAATG CGTAGTGTTCCGTCTAGAATTGCATCTAGTGGAATCAGAGGGGAGAATGCTGACTATG TAGAACAGGCTATAATTCAAACAGTAAGAACAAACTTCCCAGAGACATGGATGTGGGA CCTCGTCAGTGTCGATTCCTCAGGCTCTGCCAATCTTTCGTTCCTCATTCCTGATACG ATAACCCAATGGGAGGCAAGTGGCTTTTGTGTGAATGGTGACGTTGGATTTGGCATTT CCTCTACAACCACTCTAGAAGTCTCCCAACCTTTCTTTATTGAGATTGCCTCACCCTT TTCGGTTGTTCAAAATGAACAATTTGATTTGATTGTCAATGTCTTCAGCTACCGGAAT ACATGTGTAGAGATTTCTGTTCAAGTGGAGGAGTCTCAGAATTATGAAGCAAATATTC ATACCTTGAAAATCAATGGCAGTGAGGTTATTCAAGCTGGAGGGAGGAAAACAAACGT CTGGACTATTATACCTAAGAAATTGGGCAAAGTGAATATCACTGTAGTTGCTGAGTCC AAACAAAGCAGTGCTTGCCCAAATGAAGGAATGGAGCAGCAAAAGCTAAACTGGAAAG ACACTGTGGTCCAAAGCTTCTTAGTAGAGCCTGAAGGTATTGAAAAGGAAAGGACCCA GAGTTTCCTTATCTGTACAGAAGGTGCCAAAGCCTCCAAGCAGGGAGTTTTGGACTTG CCAAACGATGTAGTAGAAGGGTCAGCCAGAGGCTTTTTCACTGTTGTGGGGGATATTC TAGGACTTGCCTTGCAGAATCTGGTTGTTCTCCAAATGCCCTATGGAAGTGGAGAGCA GAATGCTGCCCTACTAGCATCTGATACTTATGTTCTGGACTATCTGAAATCTACTGAG CAACTGACAGAGGAAGTTCAATCTAAGGCTTTCTTTCTCTTATCTAATGGTTATCAAA GGCAATTATCTTTCAAAAACTCTGATGGTTCCTATAGTGTGTTTTGGCAGCAGAGTCA GAAAGGAAGCATATGGCTCAGTGCTCTTACTTTTAAGACATTGGAGAGAATGAAAAAA TATGTATTCATTGATGAAAATGTTCAAAAACAGACCTTAATCTGGCTTTCAAGCCAAC AGAAAACAAGCGGCTGCTTTAAGAATGATGGCCAGCTTTTCAACCACGCCTGGCAGGG TGGAGATGAAGAGGACATTTCACTCACTGCGTATGTTGTTGGGATGTTCTTTGAAGCT GGGGCGGCATTGGACAGTGGTGTCACTAATGGCTATAATCATGCAATTCTAGCTTATG CTTTTGCCTTAGCTGGAAAAGAGAAGCAAGTGGAATCTTTACTCCAAACCCTGGATCA ATCTGCCCCAAAACTAAATAATGTCATCTACTGGGAAAGAGAAAGGAAACCCAAGACA GAAGAATTTCCATCCTTTATTCCCTGGGCACCTTCTGCTCAGACTGAGAAGAGTTGCT ACGTGCTGTTGGCTGTCATTTCCCGGAAAATTCCTGACCTCACCTATGCTAGTAAGAT
CTCTACCGTTCGGGATTGTTCATGACATTTCATGTCGCTGTAATTGTTACAGAATCTG GGACAGTTATGCAGATCAGCGAGAAGACCTCAGTTTTTATCACTCAATTGCTTGGAAC TGTAAACTTTGAGAACATGGATACATTCTATAGAAGAGGGATTTCTTATTTTGGAACT CTTAAATTTTCGGATCCCAATAATGTACCTATGGTGAACAAGTTGTTGCAACTGGAGC TCAATGATGAATTTATAGGAAATTACACTACGGATGAGAATGGCGAAGCTCAATTTTC CATTGACACTTCAGACATATTTGATCCAGAGTTCAACCTAAAAGCCACATATGTTCGA CCTGAGAGCTGCTATCTTCCCAGCTGGTTGACGCCTCAGTACTTGGATGCTCACTTCT TAGTCTCACGCTTTTACTCCCGAACCAACAGCTTCCTGAAGATTGTTCCAGAACCAAA GCAGCTTGAATGTAATCAACAGAAGGTTGTTACTGTGCATTACTCCCTAAACAGTGAA GCATATGAGGATGATTCCAATGTAAAGTTCTTCTATTTGATGATGGTAAAAGGAGCTA TCTTACTCAGTGGACAAAAGGAAATCAGAAACAAAGCCTGGAATGGAAACTTCTCGTT CCCAATCAGCATCAGTGCTGATCTGGCTCCTGCAGCCGTCCTGTTTGTCTATACCCTT CACCCCAGTGGGGAAATTGTGGCTGACAGTGTCAGATTCCAGGTTGACAAGTGCTTTA AACACAAGGTTAACATAAAGTTCTCTAACGAGCAGGGCTTACCTGGTTCCAATGCTAG TCTCTGTCTTCAAGCGGCGCCTGTCTTATTCTGTGCCCTCAGGGCTGTGGATAGGAAT GTCCTTCTACTGAAATCTGAACAACAGCTGTCAGCTGAAAGTGTGTATAACATGGTTC CAAGTATAGAGCCGTATGGTTATTTCTACCATGGCCTCAATCTTGATGATGGCAAGGA AGACCCTTGCATTCCTCAGAGGGATATGTTCTACAATGGTTTATATTACACACCTGTA AGCAACTATGGGGATGGAGATATCTATAATATTGTCAGGAACATGGGTCTAAAAGTCT TTACCAATCTCCATTACCGAAAACCAGAAAAAATTATGGTCCAATGCGTAGTGTTCCG TCTAGAATTGCATGTAGCTAGTGGAATCAGAGGGGAGAATGCTGACTATGTAGAACAG GCTATAATTCAAACAGTAAGAACAAACTTCCCAGAGACATGGATGTGGGACCTCGTCA GTGTCGATTCCTCAGGCTCTGCCAATCTTTCGTTCCTCATTCCTGATACGATAACCCA ATGGGAGGCAAGTGGCTTTTGTGTGAATGGTGACGTTGGATTTGGCATTTCCTCTACA ACCACTCTAGAAGTCTCCCAACCTTTCTTTATTGAGATTGCCTCACCCTTTTCGGTTG TTCAAAATGAACAATTTGATTTGATTGTCAATGTCTTCAGCTACCGGAATACATGTGT AGAGATTTCTGTTCAAGTGGAGGAGTCTCAGAATTATGAAGCAAATATTCATACCTTG AAAATCAATGGCAGTGAGGTTATTCAAGCTGGAGGGAGGAAAACAAACGTCTGGACTA TTATACCTAAGAAATTGGGTAAAGTGAATATCACTGTAGTTGCTGAGTCCAAACAAAG CAGTGCTTGCCCAAATGAAGGAATGGAGCAGCAAAAGCTAAACTGGAAAGACACTGTG GTCCAAAGCTTCTTAGTAGAGCCTGAAGGTATTGAAAAGGAAAGGACCCAGAGTTTCC TTATCTGTACAGAAGGTGCCAAAGCCTCCAAGCAGGGAGTTTTGGACTTGCCAAACGA TGTAGTAGAAGGGTCAGCCAGAGGCTTTTTCACTGTTGTGGGGGATATTCTAGGACTT GCCTTGCAGAATCTGGTTGTTCTCCAAATGCCCTATGGAAGTGGAGAGCAGAATGCTG CCCTACTAGCATCTGATACTTATGTTCTGGACTATCTGAAATCTACTGAGCAACTGAC AGAGGAAGTTCAATCTAAGGCTTTCTTTCTCTTATCTAATGGTTATCAAAGGCAATTA TCTTTCAAAAACTCTGATGGTTCCTATAGTGTGTTTTGGCAGCAGAGTCAGAAAGGAA GCATATGGCTCAGTGCTCTTACTTTTAAGACATTGGAGAGAATGAAAAAATATGTATT CATTGATGAAAATGTTCAAAAACAGACCTTAATCTGGCTTTCAAGCCAACAGAAAACA AGCGGCTGCTTTAAGAATGATGGCCAGCTTTTCAACCACGCCTGGGAGGGTGGAGATG AAGAGGACATTTCACTCACTGCGTATGTTGTTGGGATGTTCTTTGAAGCTGGGCTCAA TTTCACTTTTCCTGCTCTACGAAACGCACTCTTTTGCCTTGAAGCGGCATTGGACAGT GGTGTCACTAATGGCTATAATCATGCAATTCTAGCTTATGCTTTTGCCTTAGCTGGAA AAGAGAAGCAAGTGGAATCTTTACTCCAAACCCTGGATCAATCTGCCCCAAAACTAAA TAATGTCATCTACTGGGAAAGAGAAAGGAAACCCAAGACAGAAGAATTTCCATCCTTT ATTCCCTGGGCACCTTCTGCTCAGACTGAGAAGAGTTGCTACGTGCTGTTGGCTGTCA TTTCCCGGAAAATTCCTGACCTCACCTATGCTAGTAAGATTGTGCAGTGGCTTGCCCA ACGGATGAATTCCCATGGAGGCTTTTCTTCCAACCAGACACCTGATGATACTCTGTTC AAATTATATACGGGCCAAAAAGAAAGCTTTCGCTCTAGTTCTGTGGGCTATACACTGG GAAAAGCAAATGAAAAGAAGGAAAACAGGAGAAATGGGGGTGAAGGATCCAGTGAGAT TTTCCAGGTTAACGGTCATAACCGCCTACTGGTCCAACGTTCAGAAGTAACACAGGCA CCTGGAGAATACACAGTAGATGTGGAAGGACACGGTTGTACATTTATCCAGGCCACCC TTAAGTACAATGTTCTCCTACCTAAGAAGGCATCTGGATTTTCTCTTTCCTTGGAAAT AGTAAAGAACTACTCTTCGACTGCTTTTGACCTCACAGTGACCCTCAAATACACTGGA ATTCGCAATAAATCCAGTATGGTGGTTATAGATGTAAAAATGCTATCAGGATTTACTC CAACCATGTCATCCATTGAAGAGCTTGAAAACAAGGGCCAAGTGATGAAGACTGAAGT CAAGAATGACCATGTTCTTTTCTACTTGGAAAATGTAGGTTTTGGTCGAGCAGACAGT TTCCCTTTTTCTGTTGAGCAGAGCAACCTTGTGTTCAACATTCAGCCAGCCCCAGCCA TGGTCTACGATTATTATGAAAAAGAAGAATATGCCCTAGCTTTTTACAACATCGACAG TAGTTCAGTTTCCGAGTGAGACAAAGCAATTACTAGAAGAGTTGGAGAAGCATTTCTT GTAACAAACTGATTCTTCTGTATCAAACCTGGAAAAAAATCATGAACCATCTGACATC
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 26B.
Table 26B. Comparison of NOV26a against NOV26b and NOV26c.
Identities/
Protein Sequence NOV26a Residues/ Match Residues Similarities for the Matched Region
NOV26b 164..1411 997/1311 (76%) 150..1436 1072/1311 (81%)
Further analysis of the NOV26a protein yielded the following properties shown in Table 26C
Table 26C. Protein Sequence Properties NOV26a
PSort 0.8200 probability located in outside; 0.1900 probability located in lysosome analysis: (lumen); 0.1380 probability located in microbody (peroxisome); 0.1000 probability located in endoplasmic reticulum (membrane)
SignalP Likely cleavage site between residues 46 and 47 analysis:
A search of the NOV26a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 26D.
In a BLAST search of public sequence databases, the NOV26a protein was found to have homology to the proteins shown in the BLASTP data in Table 26E.
PFam analysis predicts that the NOV26a protein contains the domains shown in the Table 26F.
EXAMPLE 27.
The NOV27 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 27A.
Further analysis of the NOV27a protein yielded the following properties shown in Table 27B.
Table 27B. Protein Sequence Properties NOV27a
PSort 0.3700 probability located in outside; 0.1040 probability located in microbody analysis: (peroxisome); 0.1000 probability located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen)
SignalP Likely cleavage site between residues 19 and 20 analysis:
A search of the NOV27a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 27C
In a BLAST search of public sequence databases, the NOV27a protein was found to have homology to the proteins shown in the BLASTP data in Table 27D.
PFam analysis predicts that the NOV27a protein contains the domains shown in the Table 27E.
EXAMPLE 28.
The NOV28 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 28A.
NOV28a, GCGGTCCCCAGCCTGGGTAAAGATGGCCCCATGGCCCCCGAAGGGCCTAGTCCCAGCT CG59415-01 DNA GTGCTCTGGGGCCTCAGCCTCTTCCTCAACCTCCCAGGACCTATCTGGCTCCAGCCCT CTCCACCTCCCCAGTCTTCTCCCCCGCCTCAGCCCCATCCGTGTCATACCTGCCGGGG Sequence ACTGGTTGACAGCTTTAACAAGGGCCTGGAGAGAACCATCCGGGACAACTTTGGAGGT GGAAACACTGCCTGGGAGGAAGAGAATTTGTCCAAATACAAAGACAGTGAGACCCGCC TGGTAGAGGTGCTGGAGGGTGTGTGCAGCAAGTCAGACTTCGAGTGCCACCGCCTGCT GGAGCTGAGTGAGGAGCTGGTGGAGAGCTGGTGGTTTCACAAGCAGCAGGAGGCCCCG GACCTCTTCCAGTGGCTGTGCTCAGATTCCCTGAAGCTCTGCTGCCCCGCAGGCACCT TCGGGCCCTCCTGCCTTCCCTGTCCTGGGGGAACAGAGAGGCCCTGCGGTGGCTACGG GCAGTGTGAAGGAGAAGGGACACGAGGGGGCAGCGGGCACTGTGACTGCCAAGCCGGC TACGGGGGTGAGGCCTGTGGCCAGTGTGGCCTTGGCTACTTTGAGGCAGAACGCAACG CCAGCCATCTGGTATGTTCGGCTTGTTTTGGCCCCTGTGCCCGATGCTCAGGACCTGA GGAATCAAACTGTTTGCAATGCAAGAAGGGCTGGGCCCTGCATCACCTCAAGTGTGTA GACATTGATGAGTGTGGCACAGAGGGAGCCAACTGTGGAGCTGACCAATTCTGCGTGA ACACTGAGGGCTCCTATGAGTGCCGAGACTGTGCCAAGGCCTGCCTAGGCTGCATGGG GGCAGGGCCAGGTCGCTGTAAGAAGTGTAGCCCTGGCTATCAGCAGGTGGGCTCCAAG TGTCTCGATGTGGATGAGTGTGAGACAGAGGTGTGTCCCGGGAGAGAACAAGCCCAGT GTGAAAACACCGAGGGCGGTTATCGCTGCATCTGTGCCGAGGGCTACAAGCAGATGGA AGGCATCTGTGTGAAGGAGCAGATCCCAGAGTCAGCAGGCTTCTTCTCAGAGATGACA GAAGACGAGTTGGTGGTGCTGCAGCAGATGTTCTTTGGCATCATCATCTGTGCACTGG CCACGCTGGCTGCTAAGGGGGACTTGGTGTTCACCGCCATCTTCATTGGGGCTGTGGC GGCCATGACTGGGTACTGGTTGTCAGAGCGCAGTGACCGTGTGCTGGAGGGCTTCATC AAGGGCAGATAATCGCGGCCACCACCTGTAGGACCTCCTCCCACCCACGCTGCCCCCA
GAGCTTGGGCTGCCCTCCTGCTGGACACTCAGGACAGCTTGGTTTATTTTTGAGAGTG
GGGTAAGCACCCCTACCTGCCTTACAGAGCAGCCCAGGTACCCAGGCCCGGGCAGACA
AGGCCCCTGGGGTAAAAAGTAGCCCTGAAGGTGGATACCATGAGCTCTTCACCTGGCG
GGGACTGGCAGGCTTCACAATGTGTGAATTTCAAAAGTTTTTCCTTAATGGTGGCTGC
TAGAGCTTTGGCCCCTGCTTAGGATTAGGTGGTCCTCACAGGGGTGGGGCCATCACAG
CTCCCTCCTGCCAGCTGCATGCTGCCAGTTCCTGTTCTGTGTTCACCACATCCCCACA
CCCCATTGCCACTTATTTATTCATCTCAGGAAATAAAGAAAGGTCTTGGAAAGTTAAA
AAAAAAAAA
ORF Start: ATG at 23 ORF Stop: TAA at 1286
SEQ ID NO: 130 421 aa MW at 45520.1kD
NOV28a, MAPWPPKGLVPAVL GLSLFLNLPGPIWLQPSPPPQSSPPPQPHPCHTCRGLVDSFNK
CG59415-01 Protein GLERTIRDNFGGGNTAWEEENLSKYKDSETRLVEVLEGVCSKSDFECHRLLELSEELV ES WFHKQQEAPDLFQ LCSDSLKLCCPAGTFGPSCLPCPGGTERPCGGYGQCEGEGT
Sequence RGGSGHCDCQAGYGGEACGQCGLGYFEAERNASHLVCSACFGPCARCSGPEESNCLQC KKG ALHHLKCVDIDECGTEGANCGADQFCVNTEGSYECRDCAKACLGCMGAGPGRCK KCSPGYQQVGSKCLDVDECETEVCPGREQAQCENTEGGYRCICAEGYKQMEGICVKEQ IPESAGFFSEMTEDELWLQQMFFGIIICALATLAAKGDLVFTAIFIGAVAAMTGY L SERSDRVLEGFIKGR
SEQ ID NO: 131 1011 bp
NOV28b, GGATCCCAGCCCTCTCCACCTCCCCAGTCTTCTCCCCCGCCTCAGCCCCATCCGTGTC 191815704 DNA ATACCTGCCGGGGACTGGTTGACAGCTTTAACAAGGGCCTGGAGAGAACCATCCGGGA CAACTTTGGAGGTGGAAACACTGCCTGGGAGGAAGAGAATTTGTCCAAATACAAAGAC Sequence AGTGAGACCCGCCTGGTAGAGGTGCTGGAGGGTGTGTGCAGCAAGTCAGACTTCGAGT GCCACCGCCTGCTGGAGCTGAGTGAGGAGCTGGTGGAGAGCTGGTGGTTTCACAAGCA GCAGGAGGCCCCGGACCTCTTCCAGTGGCTGTGCTCAGATTCCCTGAAGCTCTGCTGC CCCGCAGGCACCTTCGGGCCCTCCTGCCTTCCCTGTCCTGGGGGAACAGAGAGGCCCT GCGGTGGCTACGGGCAGTGTGAAGGAGAAGGGACACGAGGGGGCAGCGGGCACTGTGA CTGCCAAGCCGGCTACGGGGGTGAGGCCTGTGGCCAGTGTGGCCTTGGCTACTTTGAG GCAGAACGCAACGCCAGCCATCTGGTATGTTCGGCTTGTTTTGGCCCCTGTGCCCGAT GCTCAGGACCTGAGGAATCAAACTGTTTGCAATGCAAGAAGGGCTGGGCCCTGCATCA CCTCAAGTGTGTAGACATTGATGAGTGTGGCACAGAGGGAGCCAACTGTGGAGCTGAC CAATTCTGCGTGAACACTGAGGGCTCCTATGAGTGCCGAGACTGTGCCAAGGCCTGCC TAGGCTGCATGGGGGCAGGGCCAGGTCGCTGTAAGAAGTGTAGCCCTGGCTATCAGCA GGTGGGCTCCAAGTGTCTCGATGTGGATGAGTGTGAGACAGAGGTGTGTCCGGGAGAG AACAAGCAGTGTGAAAACACCGAGGGCGGTTATCGCTGCATCTGTGCCGAGGGCTACA
GAGTCAGGTGCTGGGTGGGGGGCCCTAGCAGGACTCTGACCCCTCCCTCCCCTCAAGA TGTGGATGAGTGTGAGACAGAGGTGTGTCCGGGAGAGAACAAGCAGTGTGAAAACACC GAGGGCGGTTATCGCTGCATCTGTGCCGAGGGCTACAAGCAGATGGAAGGCATCTGTG TGAACAGAAGACGAGTTGGTGGTGCTGCAGCAGATGTTCTTTGGCATCATCATCTGTG CACTGGCCACGCTGGCTGCTAAGGGCGACTTGGTGTTCACCGCCATCTTCATTGGGGC
TGTGGCGGCCATGACTGGCTACTGGTTGTCAGAGCGCAGTGACCGTGTGCTGGAGGGC
TTCATCAAGGGCAGATAATCGCGGCCACCACCTGTAGGACCTCCTCCCACCCACGCTG
CCCCCAGAGCTTGGGCTGCCCTCCTGCTGGACACTCAGGACAGCTTGGTTTATTTTTG
AGAGTGGGGTAAGCACCCCTACCTGCCTTACAGAGCAGCCCAGGTACCCAGGCCCGGG
CAGACAAGGCCCCTGGGGTAAAAAGTAGCCCTGAAGGTGGATACCATGAGCTCTTCAC
CTGGCGGGGACTGGCAGGCTTCACAATGTGTGAATTCAAAAGTTTTTCCTTAATGGTG
GCTGCTAGAGCTTTGGCCCCTG
ORF Start: ATG at 29 ORF Stop: TAA at 1238
SEQ ID NO: 136 403 aa MW at 42961.2kD
NOV28d, MAPWPPKGLVPAVLWGLSLFLNLPGPIWLQPSPPPQSSPPPQPHPCHTCRGLVϋSFNK
CG59415-02 Protein GLERTIRDNFGGGNTA EEENLSKYKDSETRLVEVLEGVCSKSDFECHRLLELSEELV ES WFHKQQEAPDLFQ LCSDSLKLCCPAGTFGPSCLPCPGGTERPCGGYGQCEGEGT
Sequence RGGSGHCDCQAGYGGEACGQCGLGYFEAERNASHLVCSACFGPCARCSGPEESNCLQC KKG ALHHLKCVDCAKACLGCMGAGPGRCKKCSPGYQQVGSKCLVSLLLMDTGTGSPS MNGEEAGIWAGGGRKGGMLPGQRGGDGQDGVRCWVGGPSRTLTPPSPQDVDECETEVC PGENKQCENTEGGYRCICAEGYKQMEGICVNRRRVGGAAADVL HHHLCTGHAGC
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 28B.
Further analysis of the NOV28a protein yielded the following properties shown in Table 28C.
Table 28C. Protein Sequence Properties NOV28a
PSort 0.6400 probability located in plasma membrane; 0.4600 probability located in analysis: Golgi body; 0.3700 probability located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen)
SignalP Likely cleavage site between residues 30 and 31 analysis:
A search of the NOV28a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 28D.
In a BLAST search of public sequence databases, the NOV28a protein was found to have homology to the proteins shown in the BLASTP data in Table 28E.
PFam analysis predicts that the NOV28a protein contains the domains shown in the Table 28F.
EXAMPLE 29.
The NOV29 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 29A.
TATTTTGGAGAGGATCCACCAGTGAGGACAACTTCAAGAAGCATTAAAAAAAGACTCA GCATCCCCCAATGGTATCGTGTGATGGTTAAGGCTTCCAACAGGATGAGCAGTGTGGT CTCTGAGCCCCATGTCATCAGGGTGCAGAAGAAAATTGTGGCCAATCGGCTCACGTCC CCCTCCTCAGCTCTGGTAAATGCCAGTGTGGCCTTTGAGTGCTGGATCAACTTCGGCA CAGATGTTGCCTACCTGTGGGACTTTGGGGATGGCACCGTCAGCCTGGGGAGCAGCTC CAGCAGCCATGTCTACAGTAGGGAAGGAGAATTTACAGTGGAGGTCCTTGCCTTCAAT AATGTCAGTGCCTCCACTCTAAGACAGCAACTTTTCATCGTGTGCGAGCCCTGCCAGC CACCCCTGGTGAAGAACATGGGGCCTGGGAAAGTCCAGATATGGAGGTCTCAGCCTGT GAGGCTGGGAGTGACGTTTGAAGCTGCAGTCTTCTGTGATATTTCCCAAGGTCTTTCT TACACCTGGAACTTGATGGACTCTGAAGGGCTCCCTGTCTCCCTCCCTGCTGCTGTGG ACACTCACAGACAGACCCTCATCCTCCCGAGCCACACCTTGGAGTATGGGAACTACAC TGCCCTTGCCAAGGTTCAGATTGAAGGCAGTGTGGTGTACAGCAACTACTGTGTGGGC CTGGAGGTGCGAGCCCAGGCCCCTGTCAGTGTGATCTCCGAGGGCACACACCTATTCT TCTCCAGGACCACCTCATCCCCCATTGTCCTCAGAGGGACCCAGTCCTTCGACCCTGA CGACCCTGGGGCGACTCTCAGCCACTCCGATGACTTCTCCAACAGGTATCACTGGGAA TGCGCCACCGCTGGCTCCCCAGCACATCCCTGCTTCGACTCCTCCACTGCACACCAAC TGGATGCCGCGGCTCCCACTGTTTCCTTTGAGGCACAATGGCTCAGTGACAGCTATGA TCAGTTCCTTGTGATGCTGAGGGTCTCCAGTGGTGGCCGGAACTCTTCTGAGACCCGG GTGTTCCTGTCCCCCTACCCTGACTCGGCGTTCAGATTCGTCCACATCTCCTGGGTCA GCTTTAAAGACACCTTCGTCAACTGGAATGACGAACTCTCTCTTCAAGCTATGTGTGA GGACTGCAGTGAAATACCGAATCTGTCTTATTCCTGGGATCTCTTTTTAGTCAATGCA ACAGAAAAGAATAGGATAGAAGTCCGTGTGAACACTTGTGAGGCACCAGCAGAAGAGG TGACACACTCAAGGGCTGCTTCTGACCTCAGTGTGATATGGAAGGCTGCGCCCAACAC CTGTGTAGGCAGTTTTATTGAGCTAAAGCCACAGTTCAGAAGGACCTGCGATGTGACA CACTGCCCAGAGGGCTGTGTCCGTCACCACCTCGCCTGTCTTTTGGGCCAGCTGCACA AGTCATCACAGTTAAACCTGCTGCCCACTGAGCCTGGCACTGCAGATCCTGATGCAAC GACCACACCATTCTCACGGGAACCTTCACCCGTGACCCTTGGCCAACCTGCCACTTCA GCTCCAAGGGGAACCCCCACAGAGCCCATGACTGGAGTCTACTGGATTCCTCCTGCGG GGGACTCTGCAGTCCTGGGGGAGGCTCCAGAGGAAGGTTCACTAGACCTAGAGCCAGG GCCACAGAGCAAGGGATCCCTGATGACTGGCCGCTCTGAGAGAAGTCAGCCCACCCAC AGCCCTGACCCTCACCTCTCTGCTAAGGACACCAGCTTTCCAGGATCAGGACCTAGCT TGAGTGCCGAGGAGAGCCCTGGAGATGGGGATAACCTGGTGGACCCCTCCCTGTCTGC AGGCAGAGCCGAGCCTGTCCTCATGATTGACTGGCCCAAGGCCCTGCTGGGTCGAGCA GTTTTCCAAGGCTATTCATCCTCAGGTATTACAGAACAGACAGTGACAATCAAGCCAT ACTCTCTGAGCAGTGGAGAGACGTACGTCCTGCAAGTGTCTGTGGCTTCGAAGCATGG CTTACTGGGTAAAGCTCAGCTGTACTTGACAGTCAACCCGGCTCCTCGGGACATGGCC TGTCAGGTGCAGCCCCACCATGGTCTGGAAGCACACACCGTCTTCAGTGTCTTCTGCA TGTCTGGAAAACCGGACTTCCATTATGAATTTAGTTACCAGATAGGAAACACCTCCAA ACACACTTTGTACCATGGGAGAGACACCCAGTATTATTTTGTGTTGCCAGCTGGTGAG CACTTGGACAATTACAAAGTCATGGTTTCCACTGAAATCACAGATGGCAAAGGCTCCA AGGTCCAGCCGTGCACTGTGGTGGTGACTGTGCTGCCCCGCTACCATGGAAATGACTG TCTGGGCGAGGACCTGTATAATTCCAGCCTGAAAAACCTTTCTACCCTCCAGCTGATG GGGAGTTACACAGAAATCAGGAACTACATCACTGTGATCACCAGAATCCTGAGTCGTT TGTCTAAGGAGGACAAAACTGCCTCCTGCAACCAATGGTCACGAATACAGGATGCATT AATTTCTTCAGTATGCAGATTGGCTTTTGTAGATCAGCTAGGCTTTATGAGTGCGGTT CTCATCCTCAAGTACACCCGGGCACTCCTTGCTCAAGGCCAGTTCTCGGGGCCATTTG TGATTGACAAAGGAGTGAGGCTTGAGCTCATCGGTCTCATATCCAGAGTCTGGGAAGT CTCTGAGCAAGAAAACTCGAAGGAGGAAGTCTATCGACATGAAGAAGGAATTACAGTC ATCTCAGATTTATTGTTGATTGGTGGAGTTGTGGGCCTCAACCTCTATACCTGCTCCA GCAGAAGACCCATCAACAGGCAATGGCTAAGGAAACCCGTGATGGTCGAGTTTGGGGA GGAGGATGGCCTGGATAATAGGAGAAATAAAACGACATTTGTATTACTTCGGGATAAA GTGAATCTCCATCAGTTCACTGAGCTTTCCGAAAACCCCCAGGAATCTCTACAGATAG AAATTGAATTTTCCAAACCTGTTACAAGGGCATTTCCCGTCATGTTGCTAGTAAGATT CTCTGAGAAACCTACTCCCTCTGATTTTCTTGTGAAGCAGATCTACTTCTGGGATGAG TCAATTGTGCAGATTTATATACCTGCTGCTTCTCAGAAAGATGCCAGTGTAGGCTATT TATCCTTATTGGATGCTGACTATGACAGAAAACCTCCAAACAGATATTTAGCTAAGGC AGTGAACTATACAGTACATTTCCAGTGGATCCGATGCCTGTTTTGGGACAAGAGAGAG TGGAAATCTGAACGTTTCTCTCCACAACCAGGGACTTCTCCTGAAAAAGTGAACTGCA GCTACCATCGCCTCGCGGCATTCGCTCTCCTAAGGAGAAAGCTGAAGGCCAGTTTTGA AGTGAGTGACATTTCCAAGCTACAGAGCCACCCAGAAAACTTGCTTCCCAGTATTTTT ATTATGGGTTCTGTGATTCTTTATGGATTTTTGGTCGCTAAAAGTAGACAAGTAGATC
ATCATGAAAAAAAGAAAGCTGGTTACATCTTTCTGCAAGAAGCTTCCCTGCCGGGCCA TCAGCTATATGCGGTCGTCATTGACACTGGCTTCCGAGCTCCGGCCAGCGCTCCTGCC CAACTGGGCCTGCTGAGGAAGATCCGCCTCTGGCACGACAGCCGTGGGCCTTCCCCAG GCTGGTTCATCAGCCACGTGATGGTGAAGGAGCTGCACACGGGACAGGGCTGGTTCTT CCCTGCCCAGTGCTGGCTGTCTGCCGGCAGGCATGATGGTCGCGTGGAGCGGGAGCTC ACCTGTCTGCAAGGGGGACTCGGCTTCCGGAAGCTTTTCTATTGCAAGTTCACAGAGT ACCTGGAGGATTTCCATGTCTGGCTGTCGGTGTACAGCAGGCCCTCCTCCAGCCGCTA CCTGCACACGCCGCGCCTCACCGTGTCCTTCTCCCTGCTGTGCGTCTACGCGTGTCTC ACTGCCCTGGTTGCTGCTGGAGGGCAAGAGCAGGTGAGAGCCATCGCTTTTCCTTATA GCAGCTTCCAGATCCGACTACACTGTGGCCCCTTTTTGCCTAAGAAATCAACAAAGCT CACAGTTCTCCGAGAAAAGTTTAAACCAGGGGAAGCAAGCCTGGCTGCCTGGGGACCA GAGAAGGAACAGGAGGGCTCTGCCCGGCTCAGCAAGGTACCTGCGACTTGTCCTCATG GCCCTGTTCTCCTGAGCAGCCCCTTCATTGCTGGGGAACACGCTTGGCGAACCACCTC TTTCCTTCTGCAGGAAGCCCCGGGGTCTGCCCGAGTGGAGCCACACAGCCCACTTAGA GGAGGAGCACAGACCGAGGCACCCCATGGTGGGTCAGAAAGAAGGGGTCTCAGCAGAG GCCTGAAACAGGAAGGAAGTGAAGCCCAGAAGAATTCAGAAAGCCCTGTGTGTCTACT CAGTAAATACCGGCAGGACCGTGGGAGAGACACTGTGGAGCAGCAAGGCTCGGOCACC CAGCAGTGGTTTGGAGGGACTAATGCCCCAGTGGTCAAGGGCCCTTCAGCCTTGGTGG AGCTCTGCAGTGTGGGCCATTTGTGGGACCGCTTCTTTGGCCTGCAGTTTGGGGACAG GATTTCTAGCCTACAGGTATGCCTCATGGCCTTGGGTTTTGCTTGGAAAAGAAGAGCT GACAACCACTTTTTTACTGAGTCTTTATGTGAGGCTACCAGGGATCTGGACTCTGAAT TGGCAGAACGTTCCTGGACTCGCCTCCCCTTCTCTTCAAGCTGCAGTATTCCTGACTG TGCAGGCGAGGTTGAAAAAGTCTTGGCTGCCCGACAACAAGCTCGCCACCTGCGCTGG GCGCATCCACCATCCAAGGCCCAGCTGAGGGGCACCAGACAGAGGATGAGGAGAGAGA GTCGCACACGGGCTGCCCTGAGAGACATTTCCATGGACATCCTCATGCTGCTTCTGCT TTTGTGTGTAATATATGGGAGATTTTCCCAAGATGAATACTCCCTCAATCAAGCTATC CGGAAAGAATTTACAAGAAATGCCAGAAACTGCTTGGGTGGCCTGAGAAACATCGCTG ACTGGTGGGACTGGAGTCTGACCACACTTCTGGATGGCCTGTACCCGGGAGGCACCCC GTCAGCCCGTGTGCCGGGGGCTCAGCCTGGAGCTCTTGGAGGAAAATGCTACCTAATA GGCAGTTCCGTAATTAGGCAGCTAAAAGTTTTTCCTAGGCATTTATGCAAGCCTCCCA GGCCATTTTCAGCACTCATCGAAGACTCTATTCCTACATGTAGTCCCGAAGTTGGAGG CCCTGAGAACCCCTACCTGATAGACCCAGAGAACCAAAACGTGACCCTGAATGGTCCT GGGGGCTGTGGGACAAGGGAGGACTGTGTGCTCAGCCTGGGCAGAACAAGGACTGAAG CCCACACAGCCCTGTCCCGACTCAGGGCCAGCATGTGGATTGACCGCAGCACCAGGGC TGTGTCTGTGCACTTCACTCTCTATAACCCTCCAACCCAACTCTTCACCAGCGTGTCC CTGAGAGTGGAGATCCTCCCTACGGGGAGTCTCGTCCCCTCATCCCTGGTGGAGTCAT TCAGCATCTTCCGCAGCGACTCAGCCCTGCAGTACCACCTCATGCTTCCCCAGGTGAG CTGACCTGCCTCTTGGGCCTCCTGGAGGTGCACAGGAAGATGGGGCTTCACCTGGGCT
GGGCTTCTCCACCAGACAGGACTAGTTCCCTACCCAT
ORF Start: ATG at 1 ORF Stop: TGA at 6904
SEQ ID NO: 138 2301 aa MW at 254558.5kD
NOV29a, MGWRGLIAALPLLSLVQPALGTSSKDEDVGRSWSADCHTCDQLAQDMAEEAAQNISDD
CG59297-01 Protein QERCLQAACCLSFGGELSVSTDKSWGLHLCSCSPPGGGLWVEVYANHVLLMSDGKCGC PWCALNGKAEDRESQSPSSSASRQKNIWKTTSEAALSWNEKTQAWNEKTQAPLDCD Sequence NSADSLRVFADSSIGEN TLQMVCDPDT MRGPSSHGLPPGIPRTPSFTASQSGSEIL YPPTQHPPVAILARNSDNFMNPVLNCSLEVEARAPPNLGFRVHMASGEALCLMMDFGD SSGVEMRLHNMSEAMAVTAYHQYSKEGVYMLKAVIYNEFHGTEVELGPYYVEIGHEAV SAFMNSSSVHEDEVLVFADSQVNQKTVSVYTNGTVFATDTDITFTAVTKETIPLEFEW YFGEDPPVRTTSRSIKKRLSIPQWYRVMVKASNRMSSWSEPHVIRVQKKIVANRLTS PSSALVNASVAFEC INFGTDVAYLWDFGDGTVSLGSSSSSHVYSREGEFTVEVLAFN NVSASTLRQQLFIVCEPCQPPLVKNMGPGKVQIWRSQPVRLGVTFEAAVFCDISQGLS YTWNLMDSEGLPVSLPAAVDTHRQTLILPSHTLEYGNYTALAKVQIEGSWYSNYCVG LEVRAQAPVSVISEGTHLFFSRTTSSPIVLRGTQSFDPDDPGATLSHSDDFSNRYH E CATAGSPAHPCFDSSTAHQLDAAAPTVSFEAQWLSDSYDQFLVMLRVSSGGRNSSETR VFLSPYPDSAFRFVHIS VSFKDTFVN NDELSLQAMCEDCSEIPNLSYS DLFLVNA TEKNRIEVRVNTCEAPAEEVTHSRAASDLSVI KAAPNTCVGSFIELKPQFRRTCDVT HCPEGCVRHHLACLLGQLHKSSQLNLLPTEPGTADPDATTTPFSREPSPVTLGQPATS APRGTPTEPMTGVY IPPAGDSAVLGEAPEEGSLDLEPGPQSKGSLMTGRSERSQPTH SPDPHLSAKDTSFPGSGPSLSAEESPGDGDNLVDPSLSAGRAEPVLMIDWPKALLGRA
VFQGYSSSGITEQTVTIKPYSLSSGETYVLQVSVASKHGLLGKAQLYLTVNPAPRDMA CQVQPHHGLEAHTVFSVFCMSGKPDFHYEFSYQIGNTSKHTLYHGRDTQYYFVLPAGE HLDNYKVMVSTEITDGKGSKVQPCTVWTVLPRYHGNDCLGEDLYNSSLKNLSTLQLM GSYTEIRNYITVITRILSRLSKEDKTASCNQ SRIQDALISSVCRLAFVDQLGFMSAV LILKYTRALLAQGQFSGPFVIDKGVRLELIGLISRVWEVSEQENSKEEVYRHEEGITV ISDLLLIGGWGLNLYTCSSRRPINRQWLRKPVMVEFGEEDGLDNRRNKTTFVLLRDK VNLHQFTELSENPQESLQIEIEFSKPVTRAFPVMLLVRFSEKPTPSDFLVKQIYFWDE SIVQIYIPAASQKDASVGYLSLLDADYDRKPPNRYLAKAVNYTVHFQWIRCLF DKRE KSERFSPQPGTSPEKVNCSYHRLAAFALLRRKLKASFEVSDISKLQSHPENLLPSIF IMGSVILYGFLVAKSRQVDHHEKKKAGYIFLQEASLPGHQLYAWIDTGFRAPASAPA QLGLLRKIRLWHDSRGPSPGWFISHVMVKELHTGQG FFPAQC LSAGRHDGRVEREL TCLQGGLGFRKLFYCKFTEYLEDFHVWLSVYSRPSSSRYLHTPRLTVSFSLLCVYACL TALVAAGGQEQVRAIAFPYSSFQIRLHCGPFLPKKSTKLTVLREKFKPGEASLAAWGP EKEQEGSARLSKVPATCPHGPVLLSSPFIAGEHA RTTSFLLQEAPGSARVEPHSPLR GGAQTEAPHGGSERRGLSRGLKQEGSEAQKNSESPVCLLSKYRQDRGRDTVEQQGSGT QQWFGGTNAPWKGPSALVELCSVGHLWDRFFGLQFGDRISSLQVCLMALGFAWKRRA DNHFFTESLCEATRDLDSELAERS TRLPFSSSCSIPDCAGEVEKVLAARQQARHLRW AHPPSKAQLRGTRQRMRRESRTRAALRDISMDILMLLLLLCVIYGRFSQDEYSLNQAI RKEFTRNARNCLGGLRNIADW DWSLTTLLDGLYPGGTPSARVPGAQPGALGGKCYLI GSSVIRQLKVFPRHLCKPPRPFSALIEDSIPTCSPEVGGPENPYLIDPENQNVTLNGP GGCGTREDCVLSLGRTRTEAHTALSRLRASM IDRSTRAVSVHFTLYNPPTQLFTSVS LRVEILPTGSLVPSSLVESFSIFRSDSALQYHLMLPQVS
Further analysis of the NOV29a protein yielded the following properties shown in Table 29B.
Table 29B. Protein Sequence Properties NOV29a
PSort 0.6400 probability located in plasma membrane; 0.4600 probability located in analysis: Golgi body; 0.3700 probability located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen)
SignalP Likely cleavage site between residues 22 and 23 analysis:
A search of the NOV29a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 29C
In a BLAST search of public sequence databases, the NOV29a protein was found to have homology to the proteins shown in the BLASTP data in Table 29D.
PFam analysis predicts that the NOV29a protein contains the domains shown in the Table 29E.
EXAMPLE 30.
The NOV30 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 30A.
Table 30A. NOV30 Sequence Analysis
SEQ ID NO: 139 3095 bp
NOV30a, CTGGCCAGACCCTGCCTCCAGCCACCGAGGCACATTACCTGGGCCCAACAGATGTCCT CG59264-01 DNA GGCAGCGGGGCCACAGTATCCTCCTCATGCGTCCACTCTCTTCAAGCCCAGTGCAAAG
AAAGCAGCGAATCCCAGCACCTGAAAAATACCCAGGAGGTCCTCGAACCCACTCTGGT Sequence AACTCTCAACCCCTCATCTGCGAGCACGTGGGGCTTGGGGCCACGTTTGTATGTTGGG
GAGGGCCCTGTGTTTTGGGGGAATGCAGCTCCCTTCTGCAGAGATGGGAGGTGGTCAT
GAAGCTGGACCGCAAGGCCTTGGCTCGCGATCCGCCCGCTTCAGCCTCCCAAAGTACT
GGGATTACAAGAGTGAGCCACTGCGCCAGGCCTCAAACATCAATGTTGATACCTGTTT
TCAAAGTACTGGAAGAAGGTAGGGGTAAGGACAAGGAACCGGGAGGAGTGGAGGGCGT
CACTGGGTTTCGGCGTCTGGCAAGCGGTTCAGCTGTCTGCTCCCTAGCAGCCGGCCTT
CGGGTCGGGCGTCTCCGCCGGCTACTGCCGCTTCAGTTCTCCCGGTGTGGCCACGAGT
CGGGTGAGTCTCGGTTCGAAGACACTCAGCCGGGGATGCCAGAGCCTGTGGGCAGCCG
TATCGAACACGCAGGGTATCGTGGCAATCCAGAACGCTTTTCTGAATGGGATAGTTTG
AAAGAAGGGCAGGCGTCTTTGTGGCACGGTAGGAACTGGGATGCACTTTCGCCGCCCA
GAGAGAAATACATAAAATCTATTGAGCGAGCGCTTGTTAATTATATGTGCCTTCTGCT
TATTATATGCCTACAGGTCACAGGAACCTCAAGTATTTCACAGAATGATGCCAAGGAG
CGCAGTTTCTACACCATCCCTCCCGATCAGACCACATCTATTCCAATCTCAGTCTCAA
ACTCTTCCCCTTTTTCAACTCACATTAATGAATTCACTAAGTACCTAGCACTGAGAAT
AAAAAGCGAAAGCAGCATCCGTCTTCTCTACTCTCACACAGCTTACAGTCCACAGCAA
AGCGCAAGTCATCAAACACACCTGGTTGGCAGTGCCCAGATTCGTCAAGTGAGGGTCC
AGGAAAGCTCTTGCCCTCTTGCCCAGCAGCCGCAGTATCTCAACGGATGCCGTGCACC
ATATTCCCTGGATGCTGAAGACATGGCAGACTATGGGTGGCAGTACCAGAGCCAGGAC
CAACGTCAAGGGTATCCCATCTGGGGCAAACTCACTGTGTACCGGGGAGGAGGCTACG
TGGTCCCCTTGTCCAGGACTAGGCAACAAGAGCGAAACTCTGTCCCTGGCAAAAAAAA
GAACACCTGGCTGGACGCCCTGACCAGAGCTGTGTTTGTGGAGTCCACTGTCTACAAC
GCCAACGTCAACCTGTTCTGCATTGTCACGCTGACGCTAGAGACCAGCGCTCTGGGTG
GGTATTTTGAATTTCTTTTCAAGAAATTCATAAATTTCTATCTAACTTTGGGGTCATT
CGTGGTAGCGGCAGAGCTCATCTACTTCCTCTTTCTCCTCTACTACATTGTGGTGCAA
GTGCTTGAATCCAGGAGGCACAGGTTGCACTATTTCTGCAGCAAGTGGAACCTTCTGG
AGCTGGCCATCATCCTGGCCAGCTGGAGCGCCCTGGCGGTGTTTGTGAAGAGGGCTGT
CCTGGCCGAAAGGGACCTCCAGATCATTGAGACTGAGGGCGCTCTACCGAACTTCCAA
GCTGTTCAAGGATCAACTATACAAATGAACAAATTATCCGCCTTCCTGGTACTCCTGT
CCACAGTGAAGCTTTGGCATCTGCTCAGGTTGAATCCCAAAATGAACATGATCACGGC
AGCCCTACGCCGTGCCTGGGGCGACATTTCAGGCTTTATGATTGTCATCCTTACCATG
CTCCTGGCTTACTCCATCG_CGGTAAGTATCTGCTTTGGGTGGAAACTCCGTTCCTACA
Further analysis of the NOV30a protein yielded the following properties shown in Table 30B.
Table 30B. Protein Sequence Properties NOV30a
PSort 0.6000 probability located in plasma membrane; 0.4000 probability located in analysis: Golgi body; 0.3869 probability located in mitochondrial inner membrane; 0.3000 probability located in endoplasmic reticulum (membrane)
SignalP No Known Signal Sequence Predicted analysis:
A search of the NOV30a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 30C
In a BLAST search of public sequence databases, the NOV30a protein was found to have homology to the proteins shown in the BLASTP data in Table 30D.
PFam analysis predicts that the NOV30a protein contains the domains shown in the Table 30E.
EXAMPLE 31.
The NOV31 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 31 A.
Table 31A. NOV31 Sequence Analysis
SEQ ID NO: 141 2316 bp
NOV31a, CCTGAGCCTCATTGGGGGGGTCCTCCCCCCACGGGCCGGGCATGCTGCCCCCCGGAAG CG59623-01 DNA GAACCCCTCTCCTCGCTCCCCCCAGCGTCCACGCGGAGCATGAACATTGAGGATGGCG Sequence CGTGCCCGCGGCTCCCCGTGCCCCCCGCTGCCGCCCGGTAGGATGTCCTGGCCCCACG GGGCATTGCTCTTCCTCTGGCTCTTCTCCCCACCCCTGGGGGCCGGTGGAGGTGGAGT GGCCGTGACGTCTGCCGCCGGAGGGGGCTCCCCGCCGGCCACCTCCTGCCCCGTGGCC TGCTCCTGCAGCAACCAGGCCAGCCGGGTGATCTGCACACGGAGAGACCTGGCCGAGG TCCCAGCCAGCATCCCGGTCAACACGCGGTACCTGAACCTGCAAGAGAACGGCATCCA GGTGATCCGGACGGACACGTTCAAGCACCTGCGGCACCTGGAGATTCTGCAGCTGAGC AAGAACCTGGTGCGCAAGATCGAGGTGGGCGCCTTCAACGGGCTGCCCAGCCTCAACA CGCTGGAGCTTTTTGACAACCGGCTGACCACGGTGCCCACGCAGGCCTTCGAGTACCT GTCCAAGCTGCGGGAGCTCTGGCTGCGGAACAACCCCATCGAGAGCATCCCCTCCTAC GCCTTCAACCGCGTGCCCTCGCTGCGGCGCCTGGACCTGGGCGAGCTCAAGCGGCTGG AATACATCTCGGAGGCGGCCTTCGAGGGGCTGGTCAACCTGCGCTACCTCAACCTGGG CATGTGCAACCTCAAGGACATCCCCAACCTGACGGCCCTGGTGCGCCTGGAGGAGCTG GAGCTGTCGGGCAACCGGCTGGACCTGATCCGCCCGGGCTCCTTCCAGGGTCTCACCA GCCTGCGCAAGCTGTGGCTCATGCACGCCCAGGTAGCCACCATCGAGCGCAACGCCTT CGACGACCTCAAGTCGCTGGAGGAGCTCAACCTGTCCCACAACAACCTGATGTCGCTG CCCCACGACCTCTTCACGCCCCTGCACCGCCTCGAGCGCGTGCACCTCAACCACAACC CCTGGCATTGCAACTGCGACGTGCTCTGGCTGAGCTGGTGGCTCAAGGAGACGGTGCC CAGCAACACGACGTGCTGCGCCCGCTGTCATGCGCCCGCCGGCCTCAAGGGGCGCTAC ATTGGGGAGCTGGACCAGTCGCATTTCACCTGCTATGCGCCCGTCATCGTGGAGCCGC CCACGGACCTCAACGTCACCGAGGGCATGGCTGCCGAGCTCAAATGCCGCACGGGCAC CTCCATGACCTCCGTCAACTGGCTGACGCCCAACGGCACCCTCATGACCCACGGCTCC TACCGCGTGCGCATCTCCGTCCTGCATGACGGCACGCTTAACTTCACCAACGTCACCG TGCAGGACACGGGCCAGTACACGTGCATGGTGACGAACTCAGCCGGCAACACCACCGC CTCGGCCACGCTCAACGTCTCGGCCGTGGACCCCGTGGCGGCCGGGGGCACCGGCAGC GGCGGGGGCGGCCCTGGGGGCAGTGGTGGTGTTGGAGGGGGCAGTGGCGGCTACACCT ACTTCACCACGGTGACCGTGGAGACCCTGGAGACGCAGCCCGGAGAGGAGGCCCTGCA GCCGCGGGGGACGGAGAAGGAACCGCCAGGGCCCACGACAGACGGTGTCTGGGGTGGG GGCCGGCCTGGGGACGCGGCCGGCCCTGCCTCGTCTTCTACCACGGCACCCGCCCCGC GCTCCTCGCGGCCCACGGAGAAGGCGTTCACGGTGCCCATCACGGATGTGACGGAGAA CGCCCTCAAGGACCTGGACGACGTCATGAAGACCACCAAAATCATCATCGGCTGCTTC GTGGCCATCACGTTCATGGCCGCGGTGATGCTCGTGGCCTTCTACAAGCTGCGCAAGC AGCACCAGCTCCACAAGCACCACGGGCCCACGCGCACCGTGGAGATCATCAACGTGGA
Further analysis of the NOV31a protein yielded the following properties shown in Table 3 IB.
Table 31B. Protein Sequence Properties NOV31a
PSort 0.7000 probability located in plasma membrane; 0.3000 probability located in analysis: microbody (peroxisome); 0.2000 probability located in endoplasmic reticulum (membrane); 0.1000 probability located in mitochondrial inner membrane
SignalP Likely cleavage site between residues 38 and 39 analysis:
A search of the NOV31a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 3 lC.
In a BLAST search of public sequence databases, the NOV31a protein was found to have homology to the proteins shown in the BLASTP data in Table 3 ID.
PFam analysis predicts that the NOV3 la protein contains the domains shown in the Table 3 IE.
Table 31E. Domain Analysis of NOV31a
Identities/
Pfam Domain NOV31a Match Region Similarities Expect Value for the Matched Region
EXAMPLE 32.
The NOV32 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 32A.
Further analysis of the NOV32a protein yielded the following properties shown in Table 32B.
Table 32B. Protein Sequence Properties NOV32a
PSort 0.4600 probability located in plasma membrane; 0.1279 probability located in analysis: microbody (peroxisome); 0.1000 probability located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen)
SignalP Likely cleavage site between residues 28 and 29 analysis:
A search of the NOV32a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 32C
In a BLAST search of public sequence databases, the NOV32a protein was found to have homology to the proteins shown in the BLASTP data in Table 32D.
PFam analysis predicts that the NOV32a protein contains the domains shown in the Table 32E.
Table 32E. Domain Analysis of NOV32a
NOV32a Match Identities/ Expect
Pfam Domain Region Value
EXAMPLE 33.
The NOV33 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 33 A.
Further analysis of the NOV33a protein yielded the following properties shown in Table 33B.
Table 33B. Protein Sequence Properties NOV33a
PSort 0.4600 probability located in plasma membrane; 0.1700 probability located in analysis: microbody (peroxisome); 0.1000 probability located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen)
SignalP Likely cleavage site between residues 20 and 21 analysis:
A search of the NOV33a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 33C
In a BLAST search of public sequence databases, the NOV33a protein was found to have homology to the proteins shown in the BLASTP data in Table 33D.
PFam analysis predicts that the NOV33a protein contains the domains shown in the Table 33E.
EXAMPLE 34.
The NOV34 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 34A.
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 34B.
Table 34B. Comparison of NOV34a against NOV34b and NOV34c.
NOV34a Residues/ Identities/
Protein Sequence Match Residues Similarities for the Matched Region
NOV34b 1..341 328/341 (96%) 1..341 328/341 (96%)
Further analysis of the NOV34a protein yielded the following properties shown in Table 34C.
Table 34C. Protein Sequence Properties NOV34a
PSort 0.4500 probability located in cytoplasm; 0.4466 probability located in microbody analysis: (peroxisome); 0.2245 probability located in lysosome (lumen); 0.1000 probability located in mitochondrial matrix space
SignalP No Known Signal Sequence Predicted analysis:
A search of the NOV34a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 34D.
Table 34D. Geneseq Results for NOV34a
NOV34a
Identities/
Geneseq Protein/Organism/Length Residues/ Expect
Similarities for the Identifier [Patent #, Date] Match Value
Matched Region Residues
No Significant Matches Found
In a BLAST search of public sequence databases, the NOV34a protein was found to have homology to the proteins shown in the BLASTP data in Table 34E.
PFam analysis predicts that the NOV34a protein contains the domains shown in the Table 34F.
EXAMPLE 35.
The NOV35 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 35 A.
Table 35A. NOV35 Sequence Analysis
SEQ ID NO: 151 1610 bp
NOV35a, CGTCTTCGGGACGCGCCCGCTCTTCGCCTTTCGCTGCAGTCCGTCGATTTCTTTCTCC CG59547-01 DNA AGGAAGAAAAATGGCATCCGTTGCAGTTGATCCACAACCGAGTGTGGTGACTCGGGTG
GTCAACCTGCCCTTGGTGAGCTCCACGTATGACCTCATGTCCTCAGCCTATCTCAGTA Sequence CAAAGGACCAGTATCCCTACCTGAAGTCTGTGTGTGAGATGNCAGAGAACGGTGTGAA
GACCATCACCTCCGTGGCCATGACCAGTGCTCTGCCCATCATCCAGAAGCTAGAGCCG
CAAATTGCAGTTGCCGATACCTATGCCTGTAAGGGGCTAGACAGGATTGAGGAGAGAC
TGCCTATTCTGAATCAGCCATCAACTCAGATTGTTGCCAATGCCAAAGGCGCTGTGAC
TGGGGCAAAAGATGCTGTGACGACTACTGTGACTGGGGCCAAGGATTCTGTNGCCAGC
ACGATCACAGGGGTGATGGACAAGACCAAAGGGGCAGTGACTGGCAGTGTGGAGAAGA CCAAGTCTGTGGTCAGTGGCAGCATTAACACAGTCTTGGGGAGTCGGATGATGCAGCT CGTGAGCAGTGGCGTAGAAAATGCACTCACCAAATCAGAGCTGTTGGTAGAACAGTAC CTCCCTCTCACTGAGGAAGAACTAGAAAAAGAAGCAAAAAAAGTTGAAGGATTTGATC TGGTTCAGAAGCCAAGTTATTATGTTAGACTGGGATCCCTGTCTACCAAGCTTCACTC CCGTGCCTACCAGCAGGCTCTCAGCAGGGTTAAAGAAGCTAAGCAAAAAAGCCAACAG ACCATTTCTCAGCTCCATTCTACTGTTCACCTGATTGAATTTGCCAGGAAGAATGTGT ATAGTGCCAATCAGAAAATTCAGGATGCTCAGGATAAGCTCTACCTCTCATGGGTAGA GTGGAAAAGGAGCATTGGATATGATGATACTGATGAGTCCCACTGTGCTGAGCACATT GAGTCACGTACTCTTGCAATTGCCCGCAACCTGACTCAGCAGCTCCAGACCACGTGCC ACACCCTCCTGTCCAACATCCTTTGTGTACCACAGAACATCCCCCATCATTTTTTGCA AAAGGGGGTGATGGCAGGCGACATCTACTCAGTGTTCCGGAATGCTGCCTCCTTTAAA. GAAGTGTCTGACAGCCTCCTCACTTCTAGCAAGGGGCAGCTGCAGAAAATGAAGGAAT CTTTAGATGACGTGATGGATTATCTTGTTTACAAAACGCCCCTAAACTGGCTGGTAGG TCCCTTTTATCCTCAGCTGACTGAGTCTCAGAATGCTCAGGACCAAGGTGCAGAGATG GACAAGAGCAGCCAGGAGACCCAGCGATCTGAGCATAAAACTCATTAAACCTGCCCCT ATCACTAGTGCATGCTGTGGCCAGACAGATGACACCTTTTGTTATGTTGAAATTAACT TGCTAGGCAACCCTAAATTGGGAAGCAAGTAGCTAGTATAAAGGCCCTCAATTGTAGT TGTTTCCAGCTGAATTAAGAGCTTTAAAGTTTCTGGCATTAGCAGATGATTTCTGTTC ACCTGGTAAGAAAAGAATGATAGGCTTGTCAGAGCCTATAGCCA
ORF Start: ATG at 69 ORF Stop: TAA at 1380
SEQ ID NO: 152 437 aa MW at 48148.2kD
NOV35a, MASVAVDPQPSWTRWNLPLVSSTYDLMSSAYLSTKDQYPYLKSVCEMXENGVKTIT
CG59547-01 Protein SVAMTSALPIIQKLEPQIAVADTYACKGLDRIEERLPILNQPSTQIVANAKGAVTGAK DAVTTTVTGAKDSVASTITGVMDKTKGAVTGSVEKTKSWSGSINTVLGSRMMQLVSS Sequence GVENALTKSELLVEQYLPLTEEELEKEAKKVEGFDLVQKPSYYVRLGSLSTKLHSRAY QQALSRVKEAKQKSQQTISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKR SIGYDDTDESHCAEHIESRTLAIARNLTQQLQTTCHTLLSNILCVPQNIPHHFLQKGV MAGDIYSVFR AASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVYKTPLNWLVGPFY PQLTESQNAQDQGAEMDKSSQETQRSEHKTH
Further analysis of the NOV35a protein yielded the following properties shown in Table 35B.
Table 35B. Protein Sequence Properties NOV35a
PSort 0.6500 probability located in cytoplasm; 0.1000 probability located in analysis: mitochondrial matrix space; 0.1000 probability located in lysosome (lumen); 0.0000 probability located in endoplasmic reticulum (membrane)
SignalP No Known Signal Sequence Predicted analysis:
A search of the NOV35a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 35C.
In a BLAST search of public sequence databases, the NOV35a protein was found to have homology to the proteins shown in the BLASTP data in Table 35D.
PFam analysis predicts that the NOV35a protein contains the domains shown in the Table 35E.
EXAMPLE 36.
The NOV36 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 36A.
Sequence comparison of the above protem sequences yields the following sequence relationships shown in Table 36B.
Further analysis of the NOV36a protein yielded the following properties shown in Table 36C.
Table 36C. Protein Sequence Properties NOV36a
PSort 0.8200 probability located in outside; 0.1000 probability located in endoplasmic analysis: reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen); 0.1000 probability located in lysosome (lumen)
SignalP Likely cleavage site between residues 24 and 25 analysis: A search of the NOV36a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 36D.
Table 36D. Geneseq Results for NO 36a
NOV36a Identities/
Geneseq Protein/Organism/Length [Patent #, Expect Identifier Residues/ Similarities Date] Value
In a BLAST search of public sequence databases, the NOV36a protein was found to have homology to the proteins shown in the BLASTP data in Table 36E.
PFam analysis predicts that the NOV36a protein contains the domains shown in the Table 36F.
EXAMPLE 37.
The NOV37 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 37A.
TGGCCCAACAGGCCAGAAGACAAAAGAAGCTCAACCAGGCCAATCCCAAGTCTCGTAC CAAGGGCTTCCTGTCCAGAAGACCCAGACCATACATTCCACATACTCCCACCAGCAGG TCATTCCTCACGTCTACCCCGTGGCTGCTAAGACACAGCTTGGCCGGTGCTTCCAGGA AACCATTGGGTCACAGTGTGGCAAAGCGCTCCCTGGCCTTTCAAAGCAAGAGGACTGC TGTGGAACTGTGGGTACCTCCTGGGGCTTTAACAAATGCCAGAAATGCCCCAAGAAAC CATCTTATCATGGATACAACCAAATGATGGAATGCCTACCGGGTTATAAGCGGGTTAA CAACACCTTTTGCCAAGATATTAATGAATGTCAGCTACAAGGTGTATGCCCTAATGGT GAGTGTTTGAATACCATGGGCAGCTATCGATGTACCTGCAAAATAGGATTTGGGCCGG ATCCTACCTTTTCAAGTTGTGTTCCTGATCCCCCTGTGATCTCGGAAGAGAAAGGGCC CTGTTACCGACTTGTCAGTTCTGGAAGACAGTGTATGTACCCTCTGTCTGTTCACCTC ACCAAGCAGCTCTGCTGTTGTAGTGTGGGCAAGGCCTGGGGCCCACACTGTGAGAAAT GTCCCCTTCCAGGCACAGCTGCTTTTAAGGAAATCTGTCCTGGTGGAATGGGTTATAC GGTTTCTGGCGTTCATAGACGCAGGCCAATCCATCACCATGTAGGTAAAGGACCTGTA TTTGTCAAGCCAAAGAACACTCAACCTGTTGCTAAAAGTACTCATCCTCCACCTCTCC CAGCCAAGGAAGAGCCAGTGGAGGCCCTGACCTTCTCCCGGGAACACGGGCCAGGAGT GGCGGAGCCAGAAGTGGCAACTGCACCCCCTGAAAAGGAAATACCTTCATTGGATCAA GAGAAAACCAAACTTGAGCCTGGTCAACCCCAGCTGTCTCCAGGCATTTCCGCTATTC ATCTGCATCCACAGTTTCCAGTAGTGATTGAAAAAACATCACCTCCTGTGCCTGTTGA AGTAGCTCCTGAAGCTTCTACGTCTAGTGCCAGCCAAGTGATTGCTCCTACTCAAGTG ACAGAAATCAATGAATGTACTGTGAACCCTGATATCTGTGGAGCAGGACACTGCATTA ACCTACCAGTGAGATATACCTGTATATGCTACGAGGGCTACAGGTTCAGTGAACAACA GAGGAAATGTGTGTATATTGATGAGTGTACTCAGGTCCAACACCTCTGCTCCCAGGGC CGCTGTGAAAACACCGAGGGAAGTTTCTTGTGCATTTGCCCAGCAGGATTTATGGCCA GTGAGGAGGGTACTAACTGCATAGATGTTGACGAATGCCTGAGGCCGGACGTCTGTGG GGAGGGGCACTGTGTCAATACTGTGGGGGCCTTCCGGTGTGAATACTGTGACAGCGGG TACCGCATGACTCAGAGAGGCCGTTGTGAGGATATTGATGAATGTTTGAATCCAAGCA CTTGTCCAGATGAGCAGTGTGTGAATTCTCCTGGATCTTACCAGTGCGTTCCCTGCAC AGAAGGATTCCGAGGCTGGAATGGACAGTGCCTTGATGTGGACGAGTGCCTGGAACCA AACGTCTGCGCAAATGGTGATTGTTCCAACCTTGAAGGCTCCTACATGTGTTCATGCC ACAAAGGCTATACCCGGACTCCGGACCACAAGCACTGTAGAGATATTGATGAATGTCA GCAAGGGAATCTATGTGTAAACGGGCAGTGCAAAAATACCGAGGGCTCCTTCAGGTGC ACCTGTGGACAGGGGTACCAGCTGTCGGCAGCTAAAGACCAGTGTGAAGACATTGATG AATGCCAGCACCGTCATCTCTGTGCTCATGGGCAGTGCAGGAACACTGAGGGCTCTTT TCAATGTGTGTGTGACCAGGGTTACAGAGCATCTGGGCTTGGAGACCACTGTGAAGAT ATCAATGAATGCTTGGAGGACAAGAGTGTTTGCCAGAGAGGAGACTGCATTAATACTG CAGGGTCCTATGATTGTACTTGTCCGGATGGATTTCAGCTAGATGACAATAAAACATG TCAAGATATTAATGAATGTGAACATCCAGGGCTCTGTGGTCCGCAAGGGGAGTGCCTA AACACAGAGGGTTCTTTCCATTGTGTCTGCCAGCAGGGTTTCTCAATCTCTGCAGATG GCCGTACGTGTGAAGATATTGATGAATGTGTAAACAACACTGTTTGTGACAGTCACGG GTTTTGTGACAATACAGCTGGCTCCTTCCGCTGCCTCTGTTATCAGGGCTTTCAAGCC CCACAGGATGGGCAAGGGTGTGTGGATGTGAATGAATGTGAACTGCTCAGTGGGGTGT GTGGTGAAGCCTTCTGTGAAAACGTGGAAGGGTCCTTCCTGTGCGTGTGTGCTGATGA AAACCAAGAGTACAGCCCCATGACTGGGCAGTGCCGCTCCCGGACCTCCACAGATTTA GATGTAGATGTAGATCAACCCAAAGAAGAAAAGAAAGAATGCTACTATAATCTCAATG ACGCCAGTCTCTGTGATAATGTGTTGGCCCCCAATGTCACGAAACAAGAATGCTGCTG TACATCAGGCGTGGGATGGGGAGATAACTGCGAAATCTTCCCCTGCCCGGTCTTGGGA ACTGCTGAGTTCACTGAAATGTGTCCCAAAGGGAAAGGTTTTGTGCCTGCTGGAGAAT CATCTTCTGAAGCTGGTGGTGAGAACTATAAAGATGCAGATGAATGCCTACTTTTTGG ACAAGAAATCTGCAAAAATGGTTTCTGTTTGAACACTCGGCCTGGGTATGAATGCTAC TGTAAGCAAGGGACGTACTATGATCCTGTGAAACTGCAGTGCTTTGATATGGATGAAT GTCAAGACCCCAGTAGTTGTATTGATGGCCAGTGTGTTAATACAGAGGGCTCTTACAA CTGCTTCTGTACTCACCCCATGGTCCTGGATGCGTCAGAAAAAAGATGTATACGACCG GCTGAGTCAAACGAACAAATAGAAGAAACTGATGTCTACCAAGATTTGTGCTGGGAAC ATCTGAGTGATGAATACGTGTGTAGCCGGCCTCTTGTGGGCAAGCAGACAACGTACAC TGAGTGCTGCTGTCTGTATGGAGAGGCCTGGGCGATGCAGTGTGCCCTCTGCCCCCTG AAGGATTCAGATGACTATGCTCAGCTGTGTAACATCCCCGTGACGGGACGCCGGCAGC CATATGGACGGGACGCCTTGGTTGACTTCAGTGAACAGTATACTCCAGAAGCCGATCC CTACTTCATCCAAGACCGTTTTCTAAATAGCTTTGAGGAGTTACAGGCTGAGGAATGC GGCATCCTCAATGGATGTGAAAATGGTCGCTGTGTGAGGGTCCAGGAAGGTTACACCT GCGATTGCTTTGATGGGTATCACTTGGATACTGCCAAGATGACCTGTTTCGATGTAAA TGAATGCGATGAGTTGAACAACCGGATGTCTCTCTGCAAGAATGCCAAGTGCATTAAC
TGCTGCCGACACCCTGACGGCCACGAACTTCCGAGTGGTAATTTGCCATCTTCCATGT ATGAATGGTGGCCAGTGCAGTTCAAGGGACAAATGTCAGTGCCCTCCAAATTTCACAG GAAAACTTTGTCAGATCCCAGTCCATGGTGCCAGCGTGCCTAAACTTTATCAGCATTC CCAGCAGCCAGGCAAGGCGTTGGGGACGCATGTCATCCATTCAACACATACCTTGCCT CTGACCGTGACTAGCCAGCAAGGAGTCAAAGTGAAATTTCCTCCTAACATAGTCAATA TCCATGTGAAACATCCTCCTGAAGCTTCCGTCCAGATACATCAGGTTTCAAGAATTGA TGGCCCAACAGGCCAGAAGACAAAAGAAGCTCAACCAGGCCAATCCCAAGTCTCGTAC CAAGGGCTTCCTGTCCAGAAGACCCAGACCATACATTCCACATACTCCCACCAGCAGG TCATTCCTCACGTCTACCCCGTGGCTGCTAAGACACAGCTTGGCCGGTGCTTCCAGGA AACCATTGGGTCACAGTGTGGCAAAGCGCTCCCTGGCCTTTCAAAGCAAGAGGACTGC TGTGGAACTGTGGGTACCTCCTGGGGCTTTAACAAATGCCAGAAATGCCCCAAGAAAC CATCTTATCATGGATACAACCAAATGATGGAATGCCTACCGGGTTATAAGCGGGTTAA CAACACCTTTTGCCAAGATATTAATGAATGTCAGCTACAAGGTGTATGCCCTAATGGT GAGTGTTTGAATACCATGGGCAGCTATCGATGTACCTGCAAAATAGGATTTGGGCCGG ATCCTACCTTTTCAAGTTGTGTTCCTGATCCCCCTGTGATCTCGGAAGAGAAAGGGCC CTGTTACCGACTTGTCAGTTCTGGAAGACAGTGTATGCACCCTCTGTCTGTTCACCTC ACCAAGCAGCTCTGCTGTTGTAGTGTGGGCAAGGCCTGGGGCCCACACTGTGAGAAAT GTCCCCTTCCAGGCACAGCCAAGGAAGAGCCAGTGGAGGCCCTGACCTTCTCCCGGGA ACACGGGCCAGGAGTGGCGGAGCCAGAAGTGGCAACTGCACCCCCTGAAAAGGAAATA CCTTCATTGGATCAAGAGAAAACCAAACTTGAGCCTGGTCAACCCCAGCTGTCTCCAG GCATTTCCGCTATTCATCTGCATCCACAGTTTCCAGTAGTGATTGAAAAAACATCACC TCCTGTGCCTGTTGAAGTAGCTCCTGAAGCTTCTACGTCTAGTGCCAGCCAAGTGATT GCTCCTACTCAAGTGACAGAAATCAATGAATGTACTGTGAACCCTGATATCTGTGGAG CAGGACACTGCATTAACCTACCAGTGAGATATACCTGTATATGCTACGAGGGCTACAG GTTCAGTGAACAACAGAGGAAATGTGTGTATATTGATGAGTGTACTCAGGTCCAACAC CTCTGCTCCCAGGGCCGCTGTGAAAACACCGAGGGAAGTTTCTTGTGCATTTGCCCAG CAGGATTTATGGCCAGTGAGGAGGGTACTAACTGCATAGATGTTGACGAATGCCTGAG GCCGGACGTCTGTGGGGAGGGGCACTGTGTCAATACTGTGGGGGCCTTCCGGTGTGAA TACTGTGACAGCGGGTACCGCATGACTCAGAGAGGCCGTTGTGAGGATATTGATGAAT GTTTGAATCCAAGCACTTGTCCAGATGAGCAGTGTGTGAATTCTCCTGGATCTTACCA GTGCGTTCCCTGCACAGAAGGATTCCGAGGCTGGAATGGACAGTGCCTTGATGTGGAC GAGTGCCTGGAACCAAACGTCTGCGCAAATGGTGATTGTTCCAACCTTGAAGGCTCCT ACATGTGTTCATGCCACAAAGGCTATACCCGGACTCCGGACCACAAGCACTGTAGAGA TATTGATGAATGTCAGCAAGGGAATCTATGTGTAAACGGGCAGTGCAAAAATACCGAG GGCTCCTTCAGGTGCACCTGTGGACAGGGGTACCAGCTGTCGGCAGCTAAAGACCAGT GTGAAGACATTGATGAATGCCAGCACCGTCATCTCTGTGCTCATGGGCAGTGCAGGAA CACTGAGGGCTCTTTTCAATGTGTGTGTGACCAGGGTTACAGAGCATCTGGGCTTGGA GACCACTGTGAAGATATCAATGAATGCTTGGAGGACAAGAGTGTTTGCCAGAGAGGAG ACTGCATTAATACTGCAGGGTCCTATGATTGTACTTGTCCGGATGGATTTCAGCTAGA TGACAATAAAACATGTCAAGATATTAATGAATGTGAACATCCAGGGCTCTGTGGTCCG CAAGGGGAGTGCCTAAACACAGAGGGTTCTTTCCATTGTGTCTGCCAGCAGGGTTTCT CAATCTCTGCAGATGGCCGTACGTGTGAAGATATTGATGAATGTGTAAACAACACTGT TTGTGACAGTCACGGGTTTTGTGACAATACAGCTGGCTCCTTCCGCTGCCTCTGTTAT CAGGGCTTTCAAGCCCCACAGGATGGGCAAGGGTGTGTGGATGTGAATGAATGTGAAC TGCTCAGTGGGGTGTGTGGTGAAGCCTTCTGTGAAAACGTGGAAGGGTCCTTCCTGTG CGTGTGTGCTGATGAAAACCAAGAGTACAGCCCCATGACTGGGCAGTGCCGCTCCCGG ACCTCCACAGATTTAGATGTAGATGTAGATCAACCCAAAGAAGAAAAGAAAGAATGCT ACTATAATCTCAATGACGCCAGTCTCTGTGATAATGTGTTGGCCCCCAATGTCACGAA ACAAGAATGCTGCTGTACATCAGGCGTGGGATGGGGAGATAACTGCGAAATCTTCCCC TGCCCGGTCTTGGGAACTGCTGAGTTCACTGAAATGTGTCCCAAAGGGAAAGGTTTTG TGCCTGCTGGAGAATCATCTTCTGAAGCTGGTGGTGAGAACTATAAAGATGCAGATGA ATGCCTACTTTTTGGACAAGAAATCTGCAAAAATGGTTTCTGTTTGAACACTCGGCCT GGGTATGAATGCTACTGTAAGCAAGGGACGTACTATGATCCTGTGAAACTGCAGTGCT TTGATATGGATGAATGTCAAGACCCCAGTAGTTGTATTGATGGCCAGTGTGTTAATAC AGAGGGCTCTTACAACTGCTTCTGTACTCACCCCATGGTCCTGGATGCGTCAGAAAAA AGATGTATACGACCGGCTGAGTCAAACGAACAAATAGAAGAAACTGATGTCTACCAAG ATTTGTGCTGGGAACATCTGAGTGATGAATACGTGTGTAGCCGGCCTCTTGTGGGCAA GCAGACAACGTACACTGAGTGCTGCTGTCTGTATGGAGAGGCCTGGGCGATGCAGTGT GCCCTCTGCCCCCTGAAGGATTCAGATGACTATGCTCAGCTGTGTAACATCCCCGTGA CGGGACGCCGGCAGCCATATGGACGGGACGCCTTGGTTGACTTCAGTGAACAGTATAC TCCAGAAGCCGATCCCTACTTCATCCAAGACCGTTTTCTAAATAGCTTTGAGGAGTTA
GGCCGCATCAAGGTGGTCTTTACTCCGAGCATCTGTAAAGTGACCTGCACCAAGGGCA GCTGTCAGAACAGCTGTGAGAAGGGGAACACCACCACTCTCATTAGTGAGAATGGTCA TGCTGCCGACACCCTGACGGCCACGAACTTCCGAGTGGTAATTTGCCATCTTCCATGT ATGAATGGTGGCCAGTGCAGTTCAAGGGACAAATGTCAGTGCCCTCCAAATTTCACAG GAAAACTTTGTCAGATCCCAGTCCATGGTGCCAGCGTGCCTAAACTTTATCAGCATTC CCAGCAGCCAGGCAAGGCGTTGGGGACGCATGTCATCCATTCAACACATACCTTGCCT CTGACCGTGACTAGCCAGCAAGGAGTCAAAGTGAAATTTCCTCCTAACATAGTCAATA TCCATGTGAAACATCCTCCTGAAGCTTCCGTCCAGATACATCAGGTTTCAAGAATTGA TGGCCCAACAGGCCAGAAGACAAAAGAAGCTCAACCAGGCCAATCCCAAGTCTCGTAC CAAGGGCTTCCTGTCCAGAAGACCCAGACCATACATTCCACATACTCCCACCAGCAGG TCATTCCTCACGTCTACCCCGTGGCTGCTAAGACACAGCTTGGCCGGTGCTTCCAGGA AACCATTGGGTCACAGTGTGGCAAAGCGCTCCCTGGCCTTTCAAAGCAAGAGGACTGC TGTGGAACTGTGGGTACCTCCTGGGGCTTTAACAAATGCCAGAAATGCCCCAAGAAAC CATCTTATCATGGATACAACCAAATGATGGAATGCCTACCGGGTTATAAGCGGGTTAA CAACACCTTTTGCCAAGATATTAATGAATGTCAGCTACAAGGTGTATGCCCTAATGGT GAGTGTTTGAATACCATGGGCAGCTATCGATGTACCTGCAAAATAGGATTTGGGCCGG ATCCTACCTTTTCAAGTTGTGTTCCTGATCCCCCTGTGATCTCGGAAGAGAAAGGGCC CTGTTACCGACTTGTCAGTTCTGGAAGACAGTGTATGTACCCTCTGTCTGTTCACCTC ACCAAGCAGCTCTGCTGTTGTAGTGTGGGCAAGGCTGGGCCACACTGTGAGAAATGTC CCCTTCCAGGCACAGCTGCTTTTAAGGAAATCTGTCCTGGTGGAATGGGTTATACGGT TTCTGGCGTTCATAGACGCAGGCCAATCCATCACCATGTAGGTAAAGGACCTGTATTT GTCAAGCCAAAGAACACTCAACCTGTTGCTAAAAGTACTCATCCTCCACCTCTCCCAG CCAAGGAAGAGCCAGTGGAGGCCCTGACCTTCTCCCGGGAACACGGGGCCAGGAGTGC GGAGCCAGAAGTGGCAACTGCACCCCCTGAAAAGGAAATACCTTCATTGGATCAAGAG AAAACCAAACTTGAGCCTGGTCAACCCCAGCTGTCTCCAGGCATTTCCGCTATTCATC TGCATCCACAGTTTCCAGTAGTGATTGAAAAAACATCACCTCCTGTGCCTGTTGAAGT AGCTCCTGAAGCTTCTACGTCTAGTGCCAGCCAAGTGATTGCTCCTACTCAAGTGACA GAAATCAATGAATGTACTGTGAACCCTGATATCTGTGGAGCAGGACACTGCATTAACC TACCAGTGAGATATACCTGTATATGCTACGAGGGCTACAGGTTCAGTGAACAACAGAG GAAATGTGTGGATATTGATGAGTGTACTCAGGTCCAACACCTCTGCTCCCAGGGCCGC TGTGAAAACACCGAGGGAAGTTTCTTGTGCATTTGCCCAGCAGGATTTATGGCCAGTG AGGAGGGTACTAACTGCATAGATGTTGACGAATGCCTGAGGCCGGACGTCTGTGGGGA GGGGCACTGTGTCAATACTGTGGGGGCCTTCCGGTGTGAATACTGTGACAGCGGGTAC CGCATGACTCAGAGAGGCCGTTGTGAGGATATTGATGAATGTTTGAATCCAAGCACTT GTCCAGATGAGCAGTGTGTGAATTCTCCTGGATCTTACCAGTGCGTTCCCTGCACAGA AGGATTCCGAGGCTGGAATGGACAGTGCCTTGATGTGGACGAGTGCCTGGAACCAAAC GTCTGCGCAAATGGTGATTGTTCCAACCTTGAAGGCTCCTACATGTGTTCATGCCACA AAGGCTATACCCGGACTCCGGACCACAAGCACTGTAGAGATATTGATGAATGTCAGCA AGGGAATCTATGTGTAAACGGGCAGTGCAAAAATACCGAGGGCTCCTTCAGGTGCACC TGTGGACAGGGGGGTTACCAGCTGTCGGCAGCTAAAGACCAGTGTGAAGACATTGATG AATGCCAGCACCGTCATCTCTGTGCTCATGGGCAGTGCAGGAACACTGAGGGCTCTTT TCAATGTGTGTGTGACCAGGGTTACAGAGCATCTGGGCTTGGAGACCACTGTGAAGAT ATCAATGAATGCTTGGAGGACAAGAGTGTTTGCCAGAGAGGAGACTGCATTAATACTG CAGGGTCCTATGATTGTACTTGTCCGGATGGATTTCAGCTAGATGACAATAAAACATG TCAAGATATTAATGAATGTGAACATCCAGGGCTCTGTGGTCCACAAGGGGAGTGCCTA AACACAGAGGGTTCTTTCCATTGTGTCTGCCAGCAGGGTTTCTCAATCTCTGCAGATG GCCGTACGTGTGAAGATGTGAATGAATGTGAACTGCTCAGTGGGGTGTGTGGTGAAGC CTTCTGTGAAAACGTGGAAGGGTCCTTCCTGTGCGTGTGTGCTGATGAAAACCAAGAG TACAGCCCCATGACTGGGCAGTGCCGCTCCCGGACCTCCACAGATTTAGATGTAGATG TAGATCAACCCAAAGAAGAAAAGAAAGAATGCTACTATAATCTCAATGACGCCAGTCT CTGTGATAATGTGTTGGCCCCCAATGTCACGAAACAAGAATGCTGCTGTACATCAGGC GCGGGATGGGGAGATAACTGCGAAATCTTCCCCTGCCCGGTCTTGGGAACTGCTGAGT TCACTGAAATGTGTCCCAAAGGGAAAGGTTTTGTGCCTGCTGGAGAATCATCTTCTGA AGCTGGTGGTGAGAACTATAAAGATGCAGATGAATGCCTACTTTTTGGACAAGAAATC TGCAAAAATGGTTTCTGTTTGAACACTCGGCCTGGGTATGAATGCTACTGTAAGCAAG GGACGTACTATGATCCTGTGAAACTGCAGTGCTTTGATATGGATGAATGTCAAGACCC CAGTAGTTGTATTGATGGCCAGTGTGTTAATACAGAGGGCTCTTACAACTGCTTCTGT ACTCACCCCATGGTCCTGGATGCGTCAGAAAAAAGATGTATACGACCGGCTGAGTCAA ACGAACAAATAGAAGAAACTGATGTCTACCAAGATTTGTGCTGGGAACATCTGAGTGA TGAATACGTGTGTAGCCGGCCTCTTGTGGGCAAGCAGACAACGTACACTGAGTGCTGC TGTCTGTATGGAGAGGCCTGGGGCATGCAGTGTGCCCTCTGCCCCCTGAAGGATTCAG
ATGACTATGCTCAGCTGTGTAACATCCCCGTGACGGGACGCCGGCAGCCATATGGACG GGACGCCTTGGTTGACTTCAGTGAACAGTATACTCCAGAAGCCGATCCCTACTTCATC CAAGACCGTTTTCTAAATAGCTTTGAGGAGTTACAGGCTGAGGAATGCGGCATCCTCA ATGGATGTGAAAATGGTCGCTGTGTGAGGGTCCAGGAAGGTTACACCTGCGATTGCTT TGATGGGTATCACTTGGATACGGCCAAGATGACCTGTGTCGATGTAAATGAATGCGAT GAGTTGAACAACCGGATGTCTCTCTGCAAGAATGCCAAGTGCATTAACACCGATGGTT CCTACAAGTGTTTGTGTCTGCCAGGCTACGTGCCTTCTGACAAGCCAAACTACTGCAC TCCGTTGAATACCGCCTTGAATTTAGAGAAAGACAGTGACCTGGAGTGAAACAGAATC
TACATAACCTAAGCCCATATACTCTGCACTGTGTAAAGGAAAAGGGAGAAATGTATTA
TACTTGAGACATTGCACCTACCCCGGAAGGCTGGAAATACGGAAACAGCATGGAGTTG
CAAGTCCTCTGAAGACAATGAGAGGATTTAGGATGAGCCCGATAGGTGTGGCAGACCA
AATGGACATTTCTCTAAAAAACCAGTATATATAGTCTGTTCATATGTAAAATTCAATG
GAAGAGAGGTGGAACAGTGCTGTTATTTTAAACAGAAGGTTGTATTATTATGTTGTTT
TGTTTTTTTACTATTGCTTGATTAAATTTGGCATTTAAATAGTGGTGGAAATATTTTA
TATAATTTTCATTTTTTGGTTGTGCAGTTCCTTGGCTACTGTTTTTCTTTTACTTCAG
TTTTTTAAAAATCTCAAATGAAAAAGTCTTCGATACAATATTGTTAAGCTGTATTATA
AGTATTGTTACACAGGGTTATGCAATTCCCGGCCTGGAGCATTTTTGAAATTCAAATT
GTCTGTCCTGTGGAGCAGGCAGTGATTTTGTTCCAAAACTTTGTATACACATTTGGAG
AAAAGTACTTTATATTTTCAGTGTTTTGTCTGATTTTAATGTCCGTTCTTAGCCAAGC
TGCTAGCAGGTGTTAATTGGATCCCTTTCCTTCACTGAAATGGAAGAGTTTATAAGCT
TACGTTAGTATTGTAATATGTAAAGTAAGCCCAACAAAAATTTTTAAAAATTTGATGA
TCCCCAATATATCTACCATTGTATGTTAAATAAATCACCATTTTTGTAGAAAAAATTC
TACCTGAGAGTAATTGTCAATGAGTACATGTGTATAAGTTGTATCCCACTCTCCCCAC
TTTTATCTTTTCCAGTGGTCTTCTGTTAATGTAGTGTCTTTTACAAGTTAATCATTAA
ATTTGTTAGATCTTGTTATGGGCTAAAAAAAAAAAAAAAAAA
ORF Start: ATG at 56 ORF Stop: TGA at 5093
SEQ ID NO: 170 1679 aa MW at l82193.4kD
NOV37c, MAGAWLRWGLLLWAGLLASSAHGRLRRITYWHPGPGLAAGALPLSGPPRSRTFNVAL
CG59819-03 Protein NARYSRSSAAAGAPSRASPGVPSERTRRTSKPGGAALQGLRPPPPPPPEPARPAVPGG QLHPNPGGHPAAAPFTKQGRQWRSKVPQETQSGGGSRLQVHQKQQLQGVNVCGGRCC
Sequence HGWSKAPGSQRCTKPSCVPPCQNGGMCLRPQLCVCKPGTKGKACETIAAQDTSSPVFG GQSPGAASSWGPPEQAAKHTSSKKADTLPRVSPVAQMTLTLKPKPSVGLPQQIHSQVT PLSSQSWIHHGQTQEYVLKPKYFPAQKGISGEQSTEGSFPLRYVQDQVAAPFQLSNH TGRIKWFTPSICKVTCTKGSCQNSCEKGNTTTLISENGHAADTLTATNFRWICHLP CMNGGQCSSRDKCQCPPNFTGKLCQIPVHGASVPKLYQHSQQPGKALGTHVIHSTHTL PLTVTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDGPTGQKTKEAQPGQSQVS YQGLPVQKTQTIHSTYSHQQVIPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQED CCGTVGTSWGFNKCQKCPKKPSYHGYNQMMECLPGYKRV NTFCQDINECQLQGVCPN GECLNTMGSYRCTCKIGFGPDPTFSSCVPDPPVISEEKGPCYRLVSSGRQCMYPLSVH LTKQLCCCSVGKAGPHCEKCPLPGTAAFKEICPGGMGYTVSGVHRRRPIHHHVGKGPV FVKPKNTQPVAKSTHPPPLPAKEEPVEALTFSREHGARSAEPEVATAPPEKEIPSLDQ EKTKLEPGQPQLSPGISAIHLHPQFPWIEKTSPPVPVEVAPEASTSSASQVIAPTQV TEINECTVNPDICGAGHCINLPVRYTCICYEGYRFSEQQRKCVDIDECTQVQHLCSQG RCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDSG YRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEP NVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCKNTEGSFRC TCGQGGYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEGSFQCVCDQGYRASGLGDHCE DINECLEDKSVCQRGDCINTAGSYDCTCPDGFQLDDNKTCQDINECEHPGLCGPQGEC LNTEGSFHCVCQQGFSISADGRTCEDVNECELLSGVCGEAFCENVEGSFLCVCADENQ EYSPMTGQCRSRTSTDLDVDVDQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTS GAGWGDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENYKDADECLLFGQE ICKNGFCLNTRPGYECYCKQGTYYDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCF CTHPMVLDASEKRCIRPAESNEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTEC CCLYGEAWGMQCALCPLKDSDDYAQLCNIPVTGRRQPYGRDALVDFSEQYTPEADPYF IQDRFLNSFEELQAEECGILNGCENGRCVRVQEGYTCDCFDGYHLDTAKMTCVDVNEC DELNNRMSLCKNAKCINTDGSYKCLCLPGYVPSDKPNYCTPLNTALNLEKDSDLE
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 37B.
Further analysis of the NOV37a protein yielded the following properties shown in Table 37C.
Table 37C. Protein Sequence Properties NOV37a
PSort 0.3700 probability located in outside; 0.1900 probability located in lysosome analysis: (lumen); 0.1000 probability located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen)
SignalP Likely cleavage site between residues 24 and 25 analysis:
A search of the NOV37a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 37D.
In a BLAST search of public sequence databases, the NOV37a protein was found to have homology to the proteins shown in the BLASTP data in Table 37E.
PFam analysis predicts that the NOV37a protein contains the domains shown in the Table 37F.
EXAMPLE 38.
The NOV38 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 38 A.
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 38B.
Table 38B. Comparison of NOV38a against NOV38b through NOV38c.
NOV38a Residues/ Identities/
Protein Sequence Match Residues Similarities for the Matched Region
NOV38b 20-216 179/197 (90%) 1..193 180/197 (90%)
NOV38c 20..216 180/197 (91%) 1..193 180/197 (91%)
Further analysis of the NOV38a protein yielded the following properties shown in Table 38C.
Table 38C. Protein Sequence Properties NOV38a
PSort 0.5500 probability located in endoplasmic reticulum (membrane); 0.1900 analysis: probability located in lysosome (lumen); 0.1000 probability located in endoplasmic reticulum (lumen); 0.1000 probability located in outside
SignalP Likely cleavage site between residues 22 and 23 analysis:
A search of the NOV38a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 38D.
In a BLAST search of public sequence databases, the NOV38a protein was found to have homology to the proteins shown in the BLASTP data in Table 38E.
PFam analysis predicts that the NOV38a protein contains the domains shown in the Table 38F.
EXAMPLE 39.
The NOV39 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 39A.
Further analysis of the NOV39a protein yielded the following properties shown in Table 39B.
Table 39B. Protein Sequence Properties NOV39a
PSort 0.8200 probability located in outside; 0.4575 probability located in lysosome analysis: j (lumen); 0.1000 probability located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen)
SignalP Likely cleavage site between residues 24 and 25 analysis:
A search of the NOV39a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 39C.
In a BLAST search of public sequence databases, the NOV39a protein was found to have homology to the proteins shown in the BLASTP data in Table 39D.
PFam analysis predicts that the NOV39a protein contains the domains shown in the Table 39E.
Table 39E. Domain Analysis of NOV39a
Identities/
Pfam Domain NOV39a Match Region Similarities Expect Value for the Matched Region
No Significant Matches Found
EXAMPLE 40.
The NOV40 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 40A.
Table 40A. NOV40 Sequence Analysis
SEQ ID NO: 179 6797 bp
NOV40a, GAGGAGCCCCCACGCTCTGAGAGTGGGGCGCAGAGCCGGAGCCCCGGGCCATGCCTCC CG59841-01 DNA GCTGCCGCTGGCGCGGGACACCCGGCAGCCGCCTGGCGCCTCCCTGCTGGTGCGAGGC TTCATGGTGCCCTGCAACGCCTGCCTGATCCTGCTGGCCACCGCCACGCTCGGCTTCG Sequence CGGTGCTGCTGTTCCTCAACAACTGTAAACCCGGGACCCACTTCACTCCAGTGCCTCC GACGCCTCCTGATCCATGCCTCGGGGTGCAGTGTGCATTTGGGGCGACGTGTGCTGTG AAGAACGGGCAGGCAGCGTGTGAATGCCTGCAGGCGTGCTCGAGCCTCTACGATCCTG TGTGCGGCAGCGACGGCGTCACATACGGCAGCGCGTGCGAGCTGGAGGCCACGGCCTG TACCCTCGGGCGGGAGATCCAGGTGGCGCGCAAAGGACCCTGTGGTTCGCGGGACCCC TGCTCCAACGTGACCTGCAGCTTCGGCAGCACCTGTGCGCGCTCGGCCGACGGGCTGA CGGCCTCGTGCCTGTGCCCCGCGACCTGCCGTGGCGCCCCCGAGGGGACCGTCTGCGG CAGCGACGGCGCCGACTACCCCGGCGAGTGCCAGCTCCTGCGCCGCGCCTGCGCCCGC CAGGAGAATGTCTTCAAGAAGTTCGACGGCCCTTGTGACCCCTGTCAGGGCGCCCTCC CTGACCCGAGCCGCAGCTGCCGTGTGAACCCGCGCACGCGGCGCCCTGAGATGCTCCT ACGGCCCGAGAGCTGCCCTGCCCGGCAGGCGCCAGTGTGTGGGGACGACGGAGTCACC TACGAAAACGACTGTGTCATGGGCCGATCGGGGGCCGCCCGGGGTCTCCTCCTGCAGA AAGTGCGCTCCGGCCAGTGCCAGGGTCGAGACCAGTGCCCGGAGCCCTGCCGGTTCAA TGCCGTGTGCCTGTCCCGCCGTGGCCGTCCCCGCTGCTCCTGCGACCGCGTCACCTGT GACGGGGCCTACAGGCCCGTGTGTGCCCAGGACGGGCGCACGTATGACAGTGATTGCT GGCGGCAGCAGGCTGAGTGCCGGCAGCAGCGTGCCATCCCCAGCAAGCACCAGGGCCC GTGTGACCAGGCCCCGTCCCCATGCCTCGGGGTGCAGTGTGCATTTGGGGCGACGTGT GCTGTGAAGAACGGGCAGGCAGCGTGTGAATGCCTGCAGGCGTGCTCGAGCCTCTACG ATCCTGTGTGCGGCAGCGACGGCGTCACATACGGCAGCGCGTGCGAGCTGGAGGCCAC GGCCTGTACCCTCGGGCGGGAGATCCAGGTGGCGGACCGCTGCGGGCAGTGCCGCTTT GGAGCCCTGTGCGAGGCCGAGACCGGGCGCTGCGTGTGCCCCTCTGAATGCGTGGCTT TGGCCCAGCCCGTGTGTGGCTCCGACGGGCACACGTACCCCAGCGAGTGCATGCTGCA CGTGCACGCCTGCACACACCAGATCAGCCTGCACGTGGCCTCAGCTGGACCCTGTGAG ACCTGTGGAGATGCCGTGTGTGCTTTTGGGGCTGTGTGCTCCGCAGGGCAGTGTGTGT GTCCCCGGTGTGAGCACCCCCCGCCCGGCCCCGTGTGTGGCAGCGACGGTGTCACCTA CGGCAGTGCCTGCGAGCTACGGGAAGCCGCCTGCCTCCAGCAGACACAGATCGAGGAG GCCCGGGCAGGGCCGTGCGAGCAGGCCGAGTGCGGTTCCGGAGGCTCTGGCTCTGGGG AGGACGGTGACTGTGAGCAGGAGCTGTGCCGGCAGCGCGGTGGCATCTGGGACGAGGA CTCGGAGGACGGGCCGTGTGTCTGTGACTTCAGCTGCCAGAGTGTCCCAGGCAGCCCG GTGTGCGGCTCAGATGGGGTCACCTACAGCACCGAGTGTGAGCTGAAGAAGGCCAGGT GTGAGTCACAGCGAGGGCTCTACGTAGCGGCCCAGGGAGCCTGCCGAGGCCCCACCTT CGCCCCGCTGCCGCCTGTGGCCCCCTTACACTGTGCCCAGACGCCCTACGGCTGCTGC CAGGACAATATCACCGCAGCCCGGGGCGTGGGCCTGGCTGGCTGCCCCAGTGCCTGCC AGTGCAACCCCCATGGCTCTTACGGCGGCACCTGTGACCCAGCCACAGGCCAGTGCTC CTGCCGCCCAGGTGTGGGGGGCCTCAGGTGTGACCGCTGTGAGCCTGGCTTCTGGAAC TTTCGAGGCATCGTCACCGATGGCCGGAGTGGCTGTACACCCTGCAGCTGTGATCCCC AAGGCGCCGTGCGGGATGACTGTGAGCAGATGACGGGGCTGTGCTCGTGTAAGCCCGG GGTGGCTGGACCCAAGTGTGGGCAGTGTCCAGACGGCCGTGCCCTGGGCCCCGCGGGC TGTGAAGCTGACGCTTCTGCGCCTGCGACCTGTGCGGAGATGCGCTGTGAGTTCGGTG CGCGGTGCGTGGAGGAGTCTGGCTCAGCCCACTGTGTCTGCCCGATGCTCACCTGTCC AGAGGCCAACGCTACCAAGGTCTGTGGGTCAGATGGAGTCACATACGGCAACGAGTGT CAGCTGAAGACCATCGCCTGCCGCCAGGGCCTGCAAATCTCTATCCAGAGCCTGGGCC CGTGCCAGGAGGCTGTTGCTCCCAGCACTCACCCGACATCTGCCTCCGTGACTGTGAC CACCCCAGGGCTCCTCCTGAGCCAGGCACTGCCGGCCCCCCCCGGCGCCCTCCCCCTG GCTCCCAGCAGTACCGCACACAGCCAGACCACCCCTCCGCCCTCATCGCGACCTCGGA CCACTGCCAGCGTCCCCAGGACCACCGTGTGGCCCGTGCTGACGGTGCCCCCCACGGC ACCCTCCCCTGCACCCAGCCTGGTGGCGTCCGCCTTTGGTGAATCTGGCAGCACTGAT GGAAGCAGCGATGAGGAACTGAGCGGGGACCAGGAGGCCAGTGGGGGTGGCTCTGGGG
GGCTCGAGCCCTTGGAGGGCAGCAGCGTGGCCACCCCTGGGCCACCTGTCGAGAGGGC TTCCTGCTACAACTCCGCGTTGGGCTGCTGCTCTGATGGGAAGACGCCCTCGCTGGAC GCAGAGGGCTCCAACTGCCCCGCCACCAAGGTGTTCCAGGGCGTCCTGGAGCTGGAGG GCGTCGAGGGCCAGGAGCTGTTCTACACGCCCGAGATGGCTGACCCCAAGTCAGAACT GTTCGGGGAGACAGCCAGGAGCATTGAGAGCACCCTGGACGACCTCTTCCGGAATTCA GACGTCAAGAAGGATTTCCGGAGTGTCCGCTTGCGGGACCTGGGGCCCGGCAAATCCG TCCGCGCCATTGTGGATGTGCACTTTGACCCCACCACAGCCTTCAGGGCACCCGACGT GGCCCGGGCCCTGCTCCGGCAGATCCAGGTGTCCAGGCGCCGGTCCTTGGGGGTGAGG CGGCCGCTGCAGGAGCACGTGCGATTTATGGACTTTGACTGGTTTCCTGCGTTTATCA CGGGGGCCACGTCAGGAGCCATTGCTGCGGGAGCCACGGCCAGAGCCACCACTGCATC GCGCCTGCCGTCCTCTGCTGTGACCCCTCGGGCCCCGCACCCCAGTCACACAAGCCAG CCCGTTGCCAAGACCACGGCAGCCCCCACCACACGTCGGCCCCCCACCACTGCCCCCA GCCGTGTGCCCGGACGTCGGCCCCCGGCCCCCCAGCAGCCTCCAAAGCCCTGTGACTC ACAGCCCTGCTTCCACGGGGGGACCTGCCAGGACTGGGCATTGGGCGGGGGCTTCACC TGCAGCTGCCCGGCAGGCAGGGGAGGCGCCGTCTGTGAGAAGGTGCTTGGCGCCCCTG TGCCGGCCTTCGAGGGCCGCTCCTTCCTGGCCTTCCCCACCCTCCGCGCCTACCACAC GCTGCGCCTGGCACTGGAATTCCGGGCGCTGGAGCCTCAGGGGCTGCTGCTGTACAAT GGCAACGCCCGGGGCAAGGACTTCCTGGCATTGGCGCTGCTAGATGGCCGCGTGCAGC TCAGGTTTGACACAGGTTCGGGGCCGGCGGTGCTGACCAGTGCCGTGCCGGTAGAGCC GGGCCAGTGGCACCGCCTGGAGCTGTCCCGGCACTGGCGCCGGGGCACCCTCTCGGTG GATGGTGAGACCCCTGTTCTGGGCGAGAGTCCCAGTGGCACCGACGGCCTCAACCTGG ACACAGACCTCTTTGTGGGCGGCGTACCCGAGGACCAGGCTGCCGTGGCGCTGGAGCG GACCTTCGTGGGCGCCGGCCTGAGGGGGTGCATCCGTTTGCTGGACGTCAACAACCAG CGCCTGGAGCTTGGCATTGGGCCGGGGGCTGCCACCCGAGGCTCTGGCGTGGGCGAGT GCGGGGACCACCCCTGCCTGCCCAACCCCTGCCATGGCGGGGCCCCATGCCAGAACCT GGAGGCTGGAAGGTTCCATTGCCAGTGCCCGCCCGGCCGCGTCGGACCAACCTGTGCC GATGAGAAGAGCCCCTGCCAGCCCAACCCCTGCCATGGGGCGGCGCCCTGCCGTGTGC TGCCCGAGGGTGGTGCTCAGTGCGAGTGCCCCCTGGGGCGTGAGGGCACCTTCTGCCA GACAGCCTCGGGGCAGGACGGCTCTGGGCCCTTCCTGGCTGACTTCAACGGCTTCTCC CACCTGGAGCTGAGAGGCCTGCACACCTTTGCACGGGACCTGGGGGAGAAGATGGCGC TGGAGGTCGTGTTCCTGGCACGAGGCCCCAGCGGCCTCCTGCTCTACAACGGGCAGAA GACGGACGGCAAGGGGGACTTCGTGTCGCTGGCACTGCGGGACCGCCGCCTGGAGTTC CGCTACGACCTGGGCAAGGGGGCAGCGGTCATCAGGAGCAGGGAGCCAGTCACCCTGG GAGCCTGGACCAGGGTCTCACTGGAGCGAAACGGCCGCAAGGGTGCCCTGCGTGTGGG CGACGGCCCCCGTGTGTTGGGGGAGTCCCCGGTTCCGCACACCGTCCTCAACCTGAAG GAGCCGCTCTACGTAGGGGGCGCTCCCGACTTCAGCAAGCTGGCCCGTGCTGCTGCCG TGTCCTCTGGCTTCGACGGTGCCATCCAGCTGGTCTCCCTCGGAGGCCGCCAGCTGCT GACCCCGGAGCACGTGCTGCGGCAGGTGGACGTCACGTCCTTTGCAGGTCACCCCTGC ACCCGGGCCTCAGGCCACCCCTGCCTCAATGGGGCCTCCTGCGTCCCGAGGGAGGCTG CCTATGTGTGCCTGTGTCCCGGGGGATTCTCAGGACCGCACTGCGAGAAGGGGCTGGT GGAGAAGTCAGCGGGGGACGTGGATACCTTGGCCTTTGACGGGCGGACCTTTGTCGAG TACCTCAACGCTGTGACCGAGAGCGAGAAGGCACTGCAGAGCAACCACTTTGAACTGA GCCTGCGCACTGAGGCCACGCAGGGGCTGGTGCTCTGGAGTGGCAAGGCCACGGAGCG GGCAGACTATGTGGCACTGGCCATTGTGGACGGGCACCTGCAACTGAGCTACAACCTG GGCTCCCAGCCCGTGGTGCTGCGTTCCACCGTGCCCGTCAACACCAACCGCTGGTTGC GGGTCGTGGCACATAGGGAGCAGAGGGAAGGTTCCCTGCAGGTGGGCAATGAGGCCCC TGTGACCGGCTCCTCCCCGCTGGGCGCCACGCAGCTGGACACTGATGGAGCCCTGTGG CTTGGGGGCCTGCCGGAGCTGCCCGTGGGCCCAGCACTGCCCAAGGCCTACGGCACAG GCTTTGTGGGCTGCTTGCGGGATGTGGTGGTGGGCCGGCACCCGCTGCACCTGCTGGA GGACGCCGTCACCAAGCCAGAGCTGCGGCCCTGCCCCACCCCATGAGCTGGCACCAGA GCCCCGCGCCCGCTGTAATTATTTTCTATTTTTGTAAACTTGTTGCTTTTTGATATGA TTTTCTTGCCTGAGTGTTGGCCGGAGGGACTGCTGGCCCGGCCTCCCTTCCGTCCAGG CAGCCGTGCTGCAGACAGACCTAGTGCTGAGGGATGGACAGGCGAGGTGGCAGCGTGG AGGGCTCGGCGTGGATGGCAGCCTCAGGACACACACCCCTGCCTCAAGGTGCTGAGCC CCCGCCTTGCACTGCGCCTGCCCCACGGTGTCCCCGCCGGGAAGCAGCCCCGGCTCCT GAATCACCCTCGCTCCGTCAGGCGGGACTCGTGTCCCAAAAAGGAAGGGGCTGCTGAG GTCTGATGGGGCCCTTCCTCCGGGTGACCCCACAGGGCCTTTCCAAGCCCCTATTTGA GCTGCTCCTTCCTGTGTGTGCTCTGGACCCTGCCTCGGCCTCCTGCGCCAATACTGTG ACTTCCAAACAATGTTACTGCTGGGCACAGCTCTGCGTTGCTCCCGTGCTGCCTGCGC CAGCCCCAGGCTGCTGAGGAGCAGAGGCCAGACCAGGGCCGATCTGGGTGTCCTGACC CTCAGCTGGCCCTGCCCAGCCACCCTGGACATGACCGTATCCCTCTGCCACACCCCAG
GCCCTGCGAGGGGCTATCGAGAGGAGCTCACTGTGGGATGGGGTTGACCTCTGCCGCC
TGCCTGGGTATCTGGGCCTGGCCATGGCTGTGTTCTTCATGTGTTGATTTTATTTGAC
CCCTGGAGTGGTGGGTCTCATCTTTCCCATCTCGCCTGAGAGCGGCTGAGGGCTGCCT
CACTGCAAATCCTCCCCACAGCGTCAGTGAAAGTCGTCCTTGTCTCAGAATGACCAGG
GGCCAGCCAGTGTCTGACCAAGGTCAAGGGGCAGGTGCAGAGGTGGCAGGGATGGCTC
CGAAGCCAGAA
ORF Start: ATG at 51 ORF Stop: TGA at 5844
SEQ ID NO: 180 1931 aa MW at 201789.3kD
NOV40a, MPPLPLARDTRQPPGASLLVRGFMVPCNACLILLATATLGFAVLLFLNNCKPGTHFTP
CG59841-01 Protein VPPTPPDPCLGVQCAFGATCAVKNGQAACECLQACSSLYDPVCGSDGVTYGSACELEA TACTLGREIQVARKGPCGSRDPCSNVTCSFGSTCARSADGLTASCLCPATCRGAPEGT Sequence VCGSDGADYPGECQLLRRACARQENVFKKFDGPCDPCQGALPDPSRSCRVNPRTRRPE MLLRPESCPARQAPVCGDDGVTYENDCVMGRSGAARGLLLQKVRSGQCQGRDQCPEPC RFNAVCLSRRGRPRCSCDRVTCDGAYRPVCAQDGRTYDSDCWRQQAECRQQRAIPSKH QGPCDQAPSPCLGVQCAFGATCAVKNGQAACECLQACSSLYDPVCGSDGVTYGSACEL EATACTLGREIQVADRCGQCRFGALCEAETGRCVCPSECVALAQPVCGSDGHTYPSEC MLHVHACTHQISLHVASAGPCETCGDAVCAFGAVCSAGQCVCPRCEHPPPGPVCGSDG VTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIW DEDSEDGPCVCDFSCQSVPGSPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRG PTFAPLPPVAPLHCAQTPYGCCQDNITAARGVGLAGCPSACQCNPHGSYGGTCDPATG QCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTGLCSC KPGVAGPKCGQCPDGRALGPAGCEADASAPATCAEMRCEFGARCVEESGSAHCVCPML TCPEANATKVCGSDGVTYGNECQLKTIACRQGLQISIQSLGPCQEAVAPSTHPTSASV TVTTPGLLLSQALPAPPGALPLAPSSTAHSQTTPPPSSRPRTTASVPRTTVWPVLTVP PTAPSPAPSLVASAFGESGSTDGSSDEELSGDQEASGGGSGGLEPLEGSSVATPGPPV ERASCYNSALGCCSDGKTPSLDAEGSNCPATKVFQGVLELEGVEGQELFYTPEMADPK SELFGETARSIESTLDDLFRNSDVKKDFRSVRLRDLGPGKSVRAIVDVHFDPTTAFRA PDVARALLRQIQVSRRRSLGVRRPLQEHVRFMDFDWFPAFITGATSGAIAAGATARAT TASRLPSSAVTPRAPHPSHTSQPVAKTTAAPTTRRPPTTAPSRVPGRRPPAPQQPPKP CDSQPCFHGGTCQDWALGGGFTCSCPAGRGGAVCEKVLGAPVPAFEGRSFLAFPTLRA YHTLRLALEFRALEPQGLLLYNGNARGKDFLALALLDGRVQLRFDTGSGPAVLTSAVP VEPGQWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDTDLFVGGVPEDQAAVA LERTFVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCHGGAPC QNLEAGRFHCQCPPGRVGPTCADEKSPCQPNPCHGAAPCRVLPEGGAQCECPLGREGT FCQTASGQDGSGPFLADFNGFSHLELRGLHTFARDLGEKMALEWFLARGPSGLLLYN GQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIRSREPVTLGAWTRVSLERNGRKGAL RVGDGPRVLGESPVPHTVLNLKEPLYVGGAPDFSKLARAAAVSSGFDGAIQLVSLGGR QLLTPEHVLRQVDVTSFAGHPCTRASGHPCLNGASCVPREAAYVCLCPGGFSGPHCEK GLVEKSAGDVDTLAFDGRTFVEYLNAVTESEKALQSNHFELSLRTEATQGLVLWSGKA TERADYVALAIVDGHLQLSYNLGSQPWLRSTVPVNTNRWLRWAHREQREGSLQVGN EAPVTGSSPLGATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVWGRHPLH LLEDAVTKPELRPCPTP
Further analysis of the NOV40a protein yielded the following properties shown in Table 40B.
Table 40B. Protein Sequence Properties NOV40a
PSort 0.7900 probability located in plasma membrane; 0.3000 probability located in analysis: | microbody (peroxisome); 0.3000 probability located in Golgi body; 0.2000 probability located in endoplasmic reticulum (membrane)
SignalP Likely cleavage site between residues 57 and 58 analysis:
A search of the NOV40a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 40C.
In a BLAST search of public sequence databases, the NOV40a protein was found to have homology to the proteins shown in the BLASTP data in Table 40D.
PFam analysis predicts that the NOV40a protein contains the domains shown in the Table 40E.
EXAMPLE 41.
The NOV41 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 41 A.
Table 41A. NOV41 Sequence Analysis
SEQ ID NO: 181 770 bp
NOV41a, ATGGGCAAAACACTGGACACAGACTGGATATAAAGACAGATGAGCTGGGGAGTGGAGC CG59895-01 DNA CCACTGCTAGAGAAAGACCCATCCCCAGCAACTGTGGAGGAGGCAGTGCTGTCCCTTA
CCAAGATGATGCTGCTGTTGCTGTGTCTGGGGTTGACCCTCGTCTGTGCCCAGGAGGA Sequence AGAAAACATTTCAGGAGAGTGGTATTCGGTTCTCTTGGCCTCTGACTGCAGGGAAAAG
ATAGAAGAAGATGGAAGCATGAGGGTTTTTGTCAAACACATTGATTACCTGGGGAATT
CTTCTCTGACTTTTAAATTGCATGAAATAAATGGAAACTGTACTGAAATTAATTTGGC
TTGTAAACCAACAGAAAAGAACGGACTTAATGTCATTGACATACTTGAAACGGACTAT
GATAATTATATATATT_TT_T_A_T_AACAAGAATATCAAGAATGGGGAAACATTCCTAATGC
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 4 IB.
Table 41B. Comparison of NOV41a against NOV41b and NOV41c.
Protein Sequence NOV41a Residues/ Identities/ Match Residues Similarities for the Matched Region
NOV41b 13-154 124/163 (76%) 13..175 125/163 (76%)
Further analysis of the NOV41a protein yielded the following properties shown in Table 41C.
Table 41C. Protein Sequence Properties NOV41a
PSort 0.4180 probability located in outside; 0.1900 probability located in lysosome analysis: (lumen); 0.1000 probability located in endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen)
SignalP Likely cleavage site between residues 16 and 17 analysis:
A search of the NOV41a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 4 ID.
In a BLAST search of public sequence databases, the NOV41a protein was found to have homology to the proteins shown in the BLASTP data in Table 4 IE.
PFam analysis predicts that the NOV4 la protein contains the domains shown in the Table 41F.
EXAMPLE 42.
The NOV42 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 42A.
Table 42A. NOV42 Sequence Analysis
SEQ ID NO: 185 4205 bp
NOV42a, ATTAATGAATATAAAATTATTATGTACTACACAATTAGTAGAAAGCATATTTTAGAGA CG59889-01 DNA CACACCTGCCGCAAAATACTCAGTCAAGGGAAGGGGCGGGTCCGAATCCAGGGGCGAC Sequence GCCGCCGCCTCCGCCAGTGCCCCGGGCGTCCCGCCGCCTCACTAAGCGCCTGGAGCGC GAGGATCGCTCCACTGCACTCCAGCCTGGGCAACAGAGCGAGACTCTGTCTCAAAAAA AAAAAAGAAGTAAAAATAATTATGCAGTATGTTTAGACATTTTAATATTTGTTTTGAT TTCATTTTTTCTTCCCTTAAAAACACCCCTTGGGGAGACTTCGGCTGCTGGGTGCCCT GACCAGAGCCCTGAGTTGCAACCCTGGAACCCTGGCCATGACCAAGACCACCATGTGC ATATCGGCCAGGGCAAGACACTGCTGCTCACCTCTTCTGCCACGGTCTATTCCATCCA CATCTCAGAGGGAGGCAAGCTGGTCATTAAAGACCACGACGAGCCGATTGTTTTGCGA ACCCGGCACATCCTGATTGACAACGGAGGAGAGCTGCATGCTGGGAGTGCCCTCTGCC CTTTCCAGGGCAATTTCACCATCATTTTGTATGGAAGGGCTGATGAAGGTATTCAGCC GGATCCTTACTATGGTCTGAAGTACATTGGGGTTGGTAAAGGAGGCGCTCTTGAGTTG CATGGACAGAAAAAGCTCTCCTGGACATTTCTGAACAAGACCCTTCACCCAGGTGGCA TGGCAGAAGGAGGCTATTTTTTTGAAAGGAGCTGGGGCCACCGTGGAGTTATTGTTCA TGTCATCGACCCCAAATCAGGCACAGTCATCCATTCTGACCGGTTTGACACCTATAGA TCCAAGAAAGAGAGTGAACGTCTGGTCCAGTATTTGAACGCGGTGCCCGATGGCAGGA TCCTTTCTGTTGCAGTGAATGATGAAGGTTCTCGAAATCTGGATGACATGGCCAGGAA GGCGATGACCAAATTGGGAAGCAAACACTTCCTGCACCTTGGATTTAGGGTGGAGTGG ACGGAGTGGTTCGATCATGATAAAGTATCTCAGACTAAAGGTGGGGAGAAAATTTCAG ACCTCTGGAAAGCTCACCCAGGAAAAATATGCAATCGTCCCATTGATATACAGCAGGC CACTACAATGGATGGAGTTAACCTCAGCACCGAGGTTGTCTACAAAAAAGGCCAGGAT TATAGGTTTGCTTGCTACGACCGGGGCAGAGCCTGCCGGAGCTACCGTGTACGGTTCC TCTGTGGGAAGCCTGTGAGGCCCAAACTCACAGTCACCATTGACACCAATGTGAACAG CACCATTCTGAACTTGGAGGATAATGTACAGTCATGGAAACCTGGAGATACCCTGGTC ATTGCCAGTACTGATTACTCCATGTACCAGGCAGAAGAGTTCCAGGTGCTTCCCTGCA GATCCTGCGCCCCCAACCAGGTCAAAGTGGCAGGGAAACCAATGTACCTGCACATCGG GGAGGAGATAGACGGCGTGGACATGCGGGCGGAGGTTGGGCTTCTGAGCCGGAACATC ATAGTGATGGGGGAGATGGAGGACAAATGCTACCCCTACAGAAACCACATCTGCAATT TCTTTGACTTCGATACCTTTGGGGGCCACATCAAGTTTGCTCTGGGATTTAAGGCAGC ACACTTGGAGGGCACGGAGCTGAAGCATATGGGACAGCAGCTGGTGGGTCAGTACCCG ATTCACTTCCACCTGGCCGGTGATGTAGACGAAAGGGGAGGTTATGACCCACCCACAT
ACATCAGGGACCTCTCCATCCATCATACATTCTCTCGCTGCGTCACAGTCCATGGCTC CAATGGCTTGTTGATCAAGGACGTTGTGGGCTATAACTCTTTGGGCCACTGCTTCTTC ACGGAAGATGGGCCGGAGGAACGCAACACTTTTGACCACTGTCTTGGCCTCCTTGTCA AGTCTGGAACCCTCCTCCCCTCGGACCGTGACAGCAAGATGTGCAAGATGATCACAGA GGACTCCTACCCAGGGTACATCCCCAAGCCCAGGCAAGACTGCAATGCTGTGTCCACC TTCTGGATGGCCAATCCCAACAACAACCTCATCAACTGTGCCGCTGCAGGATCTGAGG AAACTGGATTTTGGTTTATTTTTCACCACGTACCAACGGGCCCCTCCGTGGGAATGTA CTCCCCAGGTTATTCAGAGCACATTCCACTGGGAAAATTCTATAACAACCGAGCACAT TCCAACTACCGGGCTGGCATGATCATAGACAACGGAGTCAAAACCACCGAGGCCTCTG CCAAGGACAAGCGGCCGTTCCTCTCAATCATCTCTGCCAGATACAGCCCTCACCAGGA CGCCGACCCGCTGAAGCCCCGGGAGCCGGCCATCATCAGACACTTCATTGCCTACAAG AACCAGGACCACGGGGCCTGGCTGCGCGGCGGGGATGTGTGGCTGGACAGCTGCCGGT TTGCTGACAATGGCATTGGCCTGACCCTGGCCAGTGGTGGAACCTTCCCGTATGACGA CGGCTCCAAGCAAGAGATAAAGAACAGCTTGTTTGTTGGCGAGAGTGGCAACGTGGGG ACGGAAATGATGGACAATAGGATCTGGGGCCCTGGCGGCTTGGACCATAGCGGAAGGA CCCTCCCTATAGGCCAGAATTTTCCAATTAGAGGAATTCAGTTATATGATGGCCCCAT CAACATCCAAAACTGCACTTTCCGAAAGTTTGTGGCCCTGGAGGGCCGGCACACCAGC GCCCTGGCCTTCCGCCTGAATAATGCCTGGCAGAGCTGCCCCCATAACAACGTGACCG GCATTGCCTTTGAGGACGTTCCGATTACTTCCAGAGTGTTCTTCGGAGAGCCTGGGCC CTGGTTCAACCAGCTGGACATGGATGGGGATAAGACATCTGTGTTCCATGACGTCGAC GGCTCCGTGTCCGAGTACCCTGGCTCCTACCTCACGAAGAATGACAACTGGCTGGTCC GGCACCCAGACTGCATCAATGTTCCCGACTGGAGAGGGGCCATTTGCAGTGGGTGCTA TGCACAGATGTACATTCAAGCCTACAAGACCAGTAACCTGCGAATGAAGATCATCAAG AATGACTTCCCCAGCCACCCTCTTTACCTGGAGGGGGCGCTCACCAGGAGCACCCATT ACCAGCAATACCAACCGGTTGTCACCCTGCAGAAGGGCTACACCATCCACTGGGACCA GACGGCCCCCGCCGAACTCGCCATCTGGCTCATCAACTTCAACAAGGGCGACTGGATC CGAGTGGGGCTCTGCTACCCGCGAGGCACCACATTCTCCATCCTCTCGGATGTTCACA ATCGCCTGCTGAAGCAAACGTCCAAGACGGGCGTCTTCGTGAGGACCTTGCAGATGGA CAAAGTGGAGCAGAGCTACCCTGGCAGGAGCCACTACTACTGGGACGAGGACTCAGGG CTGTTGTTCCTGAAGCTGAAAGCTCAGAACGAGAGAGAGAAGTTTGCTTTCTGCTCCA TGAAAGGCTGTGAGAGGATAAAGATTAAAGCTCTGATTCCAAAGAACGCAGGCGTCAG TGACTGCACAGCCACAGCTTACCCCAAGTTCACCGAGAGGGCTGTCGTAGACGTGCCG ATGCCCAAGAAGCTCTTTGGTTCTCAGCTGAAAACAAAGGACCATTTCTTGGAGGTGA AGATGGAGAGTTCCAAGCAGCACTTCTTCCACCTCTGGAACGACTTCGCTTACATTGA AGTGGATGGGAAGAAGTACCCCAGTTCGGAGGATGGCATCCAGGTGGTGGTGATTGAC GGGAACCAAGGGCGCGTGGTGAGCCACACGAGCTTCAGGAACTCCATTCTGCAAGGCA TACCATGGCAGCTTTTCAACTATGTGGCGACCATCCCTGACAATTCCATAGTGCTTAT GGCATCAAAGGGAAGATACGTCTCCAGAGGCCCATGGACCAGAGTGCTGGAAAAGCTT GGGGCAGACAGGGGTCTCAAGTTGAAAGAGCAAATGGCATTCGTTGGCTTCAAAGGCA GCTTCCGGCCCATCTGGGTGACACTGGACACTGAGGATCACAAAGCCAAAATCTTCCA AGTTGTGCCCATCCCTGTGGTGAAGAAGAAGAAGTTGTGAGGACAGCTGCCGCCCGGT GCCACCTCGTGGTAGACTATGACGGTGAC
ORF Start: ATG at 22 ORF Stop: TGA at 4156
SEQ ID NO: 186 1378 aa MW at l55014.9kD
NOV42a, MYYTISRKHILETHLPQNTQSREGAGPNPGATPPPPPVPRASRRLTKRLEREDRSTAL
CG59889-01 Protein QPGQQSETLSQKKKRSKNNYAVCLDILIFVLISFFLPLKTPLGETSAAGCPDQSPELQ PWNPGHDQDHHVHIGQGKTLLLTSSATVYSIHISEGGKLVIKDHDEPIVLRTRHILID Sequence NGGELHAGSALCPFQGNFTIILYGRADEGIQPDPYYGLKYIGVGKGGALELHGQKKLS WTFLNKTLHPGGMAEGGYFFERSWGHRGVIVHVIDPKSGTVIHSDRFDTYRSKKESER LVQYLNAVPDGRILSVAVNDEGSRNLDDMARKAMTKLGSKHFLHLGFRVEWTEWFDHD KVSQTKGGEKISDLWKAHPGKICNRPIDIQQATTMDGVNLSTEWYKKGQDYRFACYD RGRACRSYRVRFLCGKPVRPKLTVTIDTNVNSTILNLEDNVQSWKPGDTLVIASTDYS MYQAEEFQVLPCRSCAPNQVKVAGKPMYLHIGEEIDGVDMRAEVGLLSRNIIVMGEME DKCYPYRNHICNFFDFDTFGGHIKFALGFKAAHLEGTELKHMGQQLVGQYPIHFHLAG DVDERGGYDPPTYIRDLSIHHTFSRCVTVHGSNGLLIKDWGYNSLGHCFFTEDGPEE RNTFDHCLGLLVKSGTLLPSDRDSKMCKMITEDSYPGYIPKPRQDCNAVSTFWMANPN NNLINCAAAGSEETGFWFIFHHVPTGPSVGMYSPGYSEHIPLGKFYNNRAHSNYRAGM IIDNGVKTTEASAKDKRPFLSIISARYSPHQDADPLKPREPAIIRHFIAYKNQDHGAW LRGGDVWLDSCRFADNGIGLTLASGGTFPYDDGSKQEIKNSLFVGESGNVGTEMMDNR
IWGPGGLDHSGRTLPIGQNFPIRGIQLYDGPINIQNCTFRKFVALEGRHTSALAFRLN NAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYP GSYLTKNDNWLVRHPDCINVPDWRGAICSGCYAQMYIQAYKTSNLRMKIIKNDFPSHP LYLEGALTRSTHYQQYQPWTLQKGYTIHWDQTAPAELAIWLINFNKGDWIRVGLCYP RGTTFSILSDVHNRLLKQTSKTGVFVRTLQMDKVEQSYPGRSHYYWDEDSGLLFLKLK AQNEREKFAFCSMKGCERIKIKALIPKNAGVSDCTATAYPKFTERAWDVPMPKKLFG SQLKTKDHFLEVKMESSKQHFFHLWNDFAYIEVDGKKYPSSEDGIQVWIDGNQGRW SHTSFRNSILQGIPWQLFNYVATIPDNSIVLMASKGRYVSRGPWTRVLEKLGADRGLK LKEQMAFVGFKGSFRPI VTLDTEDHKAKIFQWPIPWKKKKL
SEQ ID NO: 187 7233 bp
NOV42b, GAGCTAGCGCTCAAGCAGAGCCCAGCGCGGTGCTATCGGACAGAGCCTGGCGAGCGCA CG59889-02 DNA AGCGGCGCGGGGAGCCAGCGGGGCTGAGCGCGGCCAGGGTCTGAACCCAGATTTCCCA
GACTAGCTACCACTCCGCTTGCCCACGCCCCGGGAGCTCGCGGCGCCTGGCGGTCAGC Sequence GACCAGACGTCCGGGGCCGCTGCGCTCCTGGCCCGCGAGGCGTGACACTGTCTCGGCT
ACAGACCCAGAGGGAGCACACTGCCAGGATGGGAGCTGCTGGGAGGCAGGACTTCCTC
TTCAAGGCCATGCTGACCATCAGCTGGCTCACTCTGACCTGCTTCCCTGGGGCCACAT CCACAGTGGCTGCTGGGTGCCCTGACCAGAGCCCTGAGTTGCAACCCTGGAACCCTGG CCATGACCAAGACCACCATGTGCATATCGGCCAGGGCAAGACACTGCTGCTCACCTCT TCTGCCACGGTCTATTCCATCCACATCTCAGAGGGAGGCAAGCTGGTCATTAAAGACC ACGACGAGCCGATTGTTTTGCGAACCCGGCACATCCTGATTGACAACGGAGGAGAGCT GCATGCTGGGAGTGCCCTCTGCCCTTTCCAGGGCAATTTCACCATCATTTTGTATGGA AGGGCTGATGAAGGTATTCAGCCGGATCCTTACTATGGTCTGAAGTACATTGGGGTTG GTAAAGGAGGCGCTCTTGAGTTGCATGGACAGAAAAAGCTCTCCTGGACATTTCTGAA CAAGACCCTTCACCCAGGTGGCATGGCAGAAGGAGGCTATTTTTTTGAAAGGAGCTGG GGCCACCGTGGAGTTATTGTTCATGTCATCGACCCCAAATCAGGCACAGTCATCCATT CTGACCGGTTTGACACCTATAGATCCAAGAAAGAGAGTGAACGTCTGGTCCAGTATTT GAACGCGGTGCCCGATGGCAGGATCCTTTCTGTTGCAGTGAATGATGAAGGTTCTCGA AATCTGGATGACATGGCCAGGAAGGCGATGACCAAATTGGGAAGCAAACACTTCCTGC ACCTTGGATTTAGACACCCTTGGAGTTTTCTAACTGTGAAAGGAAATCCATCATCTTC AGTGGAAGACCATATTGAATATCATGGACATCGAGGCTCTGCTGCTGCCCGGGTATTC AAATTGTTCCAGACAGAGCATGGCGAATATTTCAATGTTTCTTTGTCCAGTGAGTGGG TTCAAGACGTGGAGTGGACGGAGTGGTTCGATCATGATAAAGTATCTCAGACTAAAGG TGGGGAGAAAATTTCAGACCTCTGGAAAGCTCACCCAGGAAAAATATGCAATCGTCCC ATTGATATACAGGCCACTACAATGGATGGAGTTAACCTCAGCACCGAGGTTGTCTACA AAAAAGGCCAGGATTATAGGTTTGCTTGCTACGACCGGGGCAGAGCCTGCCGGAGCTA CCGTGTACGGTTCCTCTGTGGGAAGCCTGTGAGGCCCAAACTCACAGTCACCATTGAC ACCAATGTGAACAGCACCATTCTGAACTTGGAGGATAATGTACAGTCATGGAAACCTG GAGATACCCTGGTCATTGCCAGTACTGATTACTCCATGTACCAGGCAGAAGAGTTCCA GGTGCTTCCCTGCAGATCCTGCGCCCCCAACCAGGTCAAAGTGGCAGGGAAACCAATG TACCTGCACATCGGGGAGGAGATAGACGGCGTGGACATGCGGGCGGAGGTTGGGCTTC TGAGCCGGAACATCATAGTGATGGGGGAGATGGAGGACAAATGCTACCCCTACAGAAA CCACATCTGCAATTTCTTTGACTTCGATACCTTTGGGGGCCACATCAAGTTTGCTCTG GGATTTAAGGCAGCACACTTGGAGGGCACGGAGCTGAAGCATATGGGACAGCAGCTGG TGGGTCAGTACCCGATTCACTTCCACCTGGCCGGTGATGTAGACGAAAGGGGAGGTTA TGACCCACCCACATACATCAGGGACCTCTCCATCCATCATACATTCTCTCGCTGCGTC ACAGTCCATGGCTCCAATGGCTTGTTGATCAAGGACGTTGTGGGCTATAACTCTTTGG GCCACTGCTTCTTCACGGAAGATGGGCCGGAGGAACGCAACACTTTTGACCACTGTCT TGGCCTCCTTGTCAAGTCTGGAACCCTCCTCCCCTCGGACCGTGACAGCAAGATGTGC AAGATGATCACAGAGGACTCCTACCCAGGGTACATCCCCAAGCCCAGGCAAGACTGCA ATGCTGTGTCCACCTTCTGGATGGCCAATCCCAACAACAACCTCATCAACTGTGCCGC TGCAGGATCTGAGGAAACTGGATTTTGGTTTATTTTTCACCACGTACCAACGGGCCCC TCCGTGGGAATGTACTCCCCAGGTTATTCAGAGCACATTCCACTGGGAAAATTCTATA ACAACCGAGCACATTCCAACTACCGGGCTGGCATGATCATAGACAACGGAGTCAAAAC CACCGAGGCCTCTGCCAAGGACAAGCGGCCGTTCCTCTCAATCATCTCTGCCAGATAC AGCCCTCACCAGGACGCCGACCCGCTGAAGCCCCGGGAGCCGGCCATCATCAGACACT TCATTGCCTACAAGAACCAGGACCACGGGGCCTGGCTGCGCGGCGGGGATGTGTGGCT GGACAGCTGCCGGTTTGCTGACAATGGCATTGGCCTGACCCTGGCCAGTGGTGGAACC TTCCCGTATGACGACGGCTCCAAGCAAGAGATAAAGAACAGCTTGTTTGTTGGCGAGA GTGGCAACGTGGGGACGGAAATGATGGACAATAGGATCTGGGGCCCTGGCGGCTTGGA CCATAGCGGAAGGACCCTCCCTATAGGCCAGAATTTTCCAATTAGAGGAATTCAGTTA
TATGATGGCCCCATCAACATCCAAAACTGCACTTTCCGAAAGTTTGTGGCCCTGGAGG GCCGGCACACCAGCGCCCTGGCCTTCCGCCTGAATAATGCCTGGCAGAGCTGCCCCCA TAACAACGTGACCGGCATTGCCTTTGAGGACGTTCCGATTACTTCCAGAGTGTTCTTC GGAGAGCCTGGGCCCTGGTTCAACCAGCTGGACATGGATGGGGATAAGACATCTGTGT TCCATGACGTCGACGGCTCCGTGTCCGAGTACCCTGGCTCCTACCTCACGAAGAATGA CAACTGGCTGGTCCGGCACCCAGACTGCATCAATGTTCCCGACTGGAGAGGGGCCATT TGCAGTGGGTGCTATGCACAGATGTACATTCAAGCCTACAAGACCAGTAACCTGCGAA TGAAGATCATCAAGAATGACTTCCCCAGCCACCCTCTTTACCTGGAGGGGGCGCTCAC CAGGAGCACCCATTACCAGCAATACCAACCGGTTGTCACCCTGCAGAAGGGCTACACC ATCCACTGGGACCAGACGGCCCCCGCCGAACTCGCCATCTGGCTCATCAACTTCAACA AGGGCGACTGGATCCGAGTGGGGCTCTGCTACCCGCGAGGCACCACATTCTCCATCCT CTCGGATGTTCACAATCGCCTGCTGAAGCAAACGTCCAAGACGGGCGTCTTCGTGAGG ACCTTGCAGATGGACAAAGTGGAGCAGAGCTACCCTGGCAGGAGCCACTACTACTGGG ACGAGGACTCAGGGCTGTTGTTCCTGAAGCTGAAAGCTCAGAACGAGAGAGAGAAGTT TGCTTTCTGCTCCATGAAAGGCTGTGAGAGGATAAAGATTAAAGCTCTGATTCCAAAG AACGCAGGCGTCAGTGACTGCACAGCCACAGCTTACCCCAAGTTCACCGAGAGGGCTG TCGTAGACGTGCCGATGCCCAAGAAGCTCTTTGGTTCTCAGCTGAAAACAAAGGACCA TTTCTTGGAGGTGAAGATGGAGAGTTCCAAGCAGCACTTCTTCCACCTCTGGAACGAC TTCGCTTACATTGAAGTGGATGGGAAGAAGTACCCCAGTTCGGAGGATGGCATCCAGG TGGTGGTGATTGACGGGAACCAAGGGCGCGTGGTGAGCCACACGAGCTTCAGGAACTC CATTCTGCAAGGCATACCATGGCAGCTTTTCAACTATGTGGCGACCATCCCTGACAAT TCCATAGTGCTTATGGCATCAAAGGGAAGATACGTCTCCAGAGGCCCATGGACCAGAG TGCTGGAAAAGCTTGGGGCAGACAGGGGTCTCAAGTTGAAAGAGCAAATGGCATTCGT TGGCTTCAAAGGCAGCTTCCGGCCCATCTGGGTGACACTGGACACTGAGGATCACAAA GCCAAAATCTTCCAAGTTGTGCCCATCCCTGTGGTGAAGAAGAAGAAGTTGTGAGGAC AGCTGCCGCCCGGTGCCACCTCGTGGTAGACTATGACGGTGACTCTTGGCAGCAGACC AGTGGGGGATGGCTGGGTCCCCCAGCCCCTGCCAGCAGCTGCCTGGGAAGGCCGTGTT TCAGCCCTGATGGGCCAAGGGAAGGCTATCAGAGACCCTGGTGCTGCCACCTGCCCCT ACTCAAGTGTCTACCTGGAGCCCCTGGGGCGGTGCTGGCCAATGCTGGAAACATTCAC TTTCCTGCAGCCTCTTGGGTGCTTCTCTCCTATCTGTGCCTCTTCAGTGGGGGTTTGG GGACCATATCAGGAGACCTGGGTTGTGCTGACAGCAAAGATCCACTCTGGCAGGAGCC CTGACCCAGCTAGGAGGTAGTCTGGAGGGCTGGTCATTCACAGATCCCCATGGTCTTC AGCAGACAAGTGAGGGTGGTAAATGTAGGAGAAAGAGCCTTGGCCTTAAGGAAATCTT TACTCCTGTAAGCAAGAGCCAACCTCACAGGATTAGGAGCTGGGGTAGAACTGGCTAT CCTTGGGGAAGAGGCAAGCCCTGCCTCTGGCCGTGTCCACCTTTCAGGAGACTTTGAG TGGCAGGTTTGGACTTGGACTAGATGACTCTCAAAGGCCCTTTTAGTTCTGAGATTCC AGAAATCTGCTGCATTTCACATGGTACCTGGAACCCAACAGTTCATGGATATCCACTG ATATCCATGATGCTGGGTGCCCCAGCGCACACGGGATGGAGAGGTGAGAACTAATGCC TAGCTTGAGGGGTCTGCAGTCCAGTAGGGCAGGCAGTCAGGTCCATGTGCACTGCAAT GCCAGGTGGAGAAATCACAGAGAGGTAAAATGGAGGCCAGTGCCATTTCAGAGGGGAG GCTCAGGAAGGCTTCTTGCTTACAGGAATGAAGGCTGGGGGCATTTTGCTGGGGGGAG ATGAGGCAGCCTCTGGAATGGCTCAGGGATTCAGCCCTCCCTGCCGCTGCCTGCTGAA GCTGGTGACTACGGGGTCGCCCTTTGCTCACGTCTCTCTGGCCCACTCATGATGGAGA AGTGTGGTCAGAGGGGAGCAATGGGCTTTGCTGCTTATGAGCACAGAGGAATTCAGTC CCCAGGCAGCCCTGCCTCTGACTCCAAGAGGGTGAAGTCCACAGAAGTGAGCTCCTGC CTTAGGGCCTCATTTGCTCTTCATCCAGGGAACTGAGCACAGGGGGCCTCCAGGAGAC CCTAGATGTGCTCGTACTCCCTCGGCCTGGGATTTCAGAGCTGGAAATATAGAAAATA TCTAGCCCAAAGCCTTCATTTTAACAGATGGGGAAAGTGAGCCCCCAAGATGGGAAAG AACCACACAGCTAAGGGAGGGCCTGGGGAGCCCCACCCTAGCCCTTGCTGCCACACCA CATTGCCTCAACAACCGGCCCCAGAGTGCCCAGGCACTCCTGAGGTAGCTTCTGGAAA TGGGGACAAGTCCCCTCGAAGGAAAGGAAATGACTAGAGTAGAATGACAGCTAGCAGA TCTCTTCCCTCCTGCTCCCAGCGCACACAAACCCGCCCTCCCCTTGGTGTTGGCGGTC CCTGTGGCCTTCACTTTGTTCACTACCTGTCAGCCCAGCCTGGGTGCACAGTAGCTGC AACTCCCCATTGGTGCTACCTGGCTCTCCTGTCTCTGCAGCTCTACAGGTTAGGCCCA GCAGAGGGAGTAGGGCTCGCCATGTTTCTGGTGAGCCAATTTGGCTGATCTTGGGTGT CTGAACAGCTATTGGGTCCACCCCAGTCCCTTTCAGCTGCTGCTTAATGCCCTGCTCT CTCCCTGGCCCACCTTATAGAGAGCCCAAAGAGCTCCTGTAAGAGGGAGAACTCTATC TGTGGTTTATAAGCTTGCACGAGGCACCAGAGTCTCCCTGGGTCTTGTGATGAACTAC ATTTATCCCCTTTCCTGCCCCAACCACAAACTCTTTCCTTCAAAGAGGGCCTGCCTGG CTCCCTCCACCCAACTGCACCCATGAGACTCGGTCCAAGAGTCCATTCCCCAGGTGGG AGCCAACTGTCAGGGAGGTCTTTCCCACCAAACATCTTTCAGCTGCTGGGAGGTGACC
ATAGGGCTCTGCTTTTAAAGATATGGCTGCTTCAAAGGCCAGAGTCACAGGAAGGACT
TCTTCCAGGGAGATTAGTGGTGATGGAGAGGAGAGTTAAAATGACCTCATGTCCTTCT
TGTCCACGGTTTTGTTGAGTTTTCACTCTTCTAATGCAAGGGTCTCACACTGTGAACC
ACTTAGGATGTGATCACTTTCAGGTGGCCAGGAATGTTGAATGTCTTTGGCTCAGTTC
ATTTAAAAAAGATATCTATTTGAAAGTTCTCAGAGTTGTACATATGTTTCACAGTACA
GGATCTGTACATAAAAGTTTCTTTCCTAAACCATTCACCAAGAGCCAATATCTAGGCA
TTTTCTTGGTAGCACAAATTTTCTTATTGCTTAGAAAATTGTCCTCCTTGTTATTTCT
GTTTGTAAGACTTAAGTGAGTTAGGTCTTTAAGGAAAGCAACGCTCCTCTGAAATGCT
TGTCTTTTTTCTGTTGCCGAAATAGCTGGTCCTTTTTCGGGAGTTAGATGTATAGAGT
GTTTGTATGTAAACATTTCTTGTAGGCATCACCATGAACAAAGATATATTTTCTATTT
ATTTATTATATGTGCACTTCAAGAAGTCACTGTCAGAGAAATAAAGAATTGTCTTAAA
TGTCATGATTGGAGATGTCCTTTGCATTGCTTGGAAGGGGTGTACCTAGAGCCAAGGA
AATTGGCTCTGGTTTGGAAAAATTTTGCTGTTATTATAGTAAACATACAAAGGATGTC
CAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
ORF Start: ATG at 261 ORF Stop: TGA at 4344
SEQ ID NO: 188 1361 aa MW at l52996.4kD
NOV42b, MGAAGRQDFLFKAMLTISWLTLTCFPGATSTVAAGCPDQSPELQPWNPGHDQDHHVHI
CG59889-02 Protein GQGKTLLLTSSATVYSIHISEGGKLVIKDHDEPIVLRTRHILIDNGGELHAGSALCPF QGNFTIILYGRADEGIQPDPYYGLKYIGVGKGGALELHGQKKLSWTFLNKTLHPGGMA Sequence EGGYFFERSWGHRGVIVHVIDPKSGTVIHSDRFDTYRSKKESERLVQYLNAVPDGRIL SVAVNDEGSRNLDDMARKAMTKLGSKHFLHLGFRHP SFLTVKGNPSSSVEDHIEYHG HRGSAAARVFKLFQTEHGEYFNVSLSSEWVQDVEWTEWFDHDKVSQTKGGEKISDLWK AHPGKICNRPIDIQATTMDGVNLSTEWYKKGQDYRFACYDRGRACRSYRVRFLCGKP VRPKLTVTIDTNV STILNLEDNVQSWKPGDTLVIASTDYSMYQAEEFQVLPCRSCAP NQVKVAGKPMYLHIGEEIDGVDMRAEVGLLSRNIIVMGEMEDKCYPYRNHICNFFDFD TFGGHIKFALGFKAAHLEGTELKHMGQQLVGQYPIHFHLAGDVDERGGYDPPTYIRDL SIHHTFSRCVTVHGSNGLLIKDWGYNSLGHCFFTEDGPEERNTFDHCLGLLVKSGTL LPSDRDSKMCKMITEDSYPGYIPKPRQDCNAVSTFWMANPNN LINCAAAGSEETGFW FIFHHVPTGPSVGMYSPGYSEHIPLGKFYNNRAHSNYRAGMIIDNGVKTTEASAKDKR PFLSIISARYSPHQDADPLKPREPAIIRHFIAYKNQDHGAWLRGGDVWLDSCRFADNG IGLTLASGGTFPYDDGSKQEIKNSLFVGESGNVGTEMMDNRIWGPGGLDHSGRTLPIG QNFPIRGIQLYDGPINIQNCTFRKFVALEGRHTSALAFRLNNAWQSCPHNNVTGIAFE DVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNWLVRHPDC INVPDWRGAICSGCYAQMYIQAYKTSNLRMKIIKNDFPSHPLYLEGALTRSTHYQQYQ PWTLQKGYTIHWDQTAPAELAIWLINFNKGDWIRVGLCYPRGTTFSILSDVHNRLLK QTSKTGVFVRTLQMDKVEQSYPGRSHYYWDEDSGLLFLKLKAQNEREKFAFCSMKGCE RIKIKALIPKNAGVSDCTATAYPKFTERAWDVPMPKKLFGSQLKTKDHFLEVKMESS KQHFFHLWNDFAYIEVDGKKYPSSEDGIQVWIDGNQGRWSHTSFRNSILQGIPWQL FNYVATIPDNSIVLMASKGRYVSRGPWTRVLEKLGADRGLKLKEQMAFVGFKGSFRPI WVTLDTEDHKAKIFQWPIPWKKKKL
SEQ ID NO: 189 3864 bp
NOV42c, GTGCCCTGACCAGAGCCCTGAGTTGCAACCCTGGAACCCTGGCCATGACCAAGACCAC CG59889-04 DNA CATGTGCATATCGGCCAGGGCAAGACACTGCTGCTCACCTCTTCTGCCACGGTCTATT CCATCCACATCTCAGAGGGAGGCAAGCTGGTCATTAAAGACCACGACGAGCCGATTGT Sequence TTTGCGAACCCGGCACATCCTGATTGACAACGGAGGAGAGCTGCATGCTGGGAGTGCC CTCTGCCCTTTCCAGGGCAATTTCACCATCATTTTGTATGGAAGGGCTGATGAAGGTA TTCAGCCGGATCCTTACTATGGTCTGAAGTACATTGGGGTTGGTAAAGGAGGCGCTCT TGAGTTGCATGGACAGAAAAAGCTCTCCTGGACATTTCTGAACAAGACCCTTCACCCA GGTGGCATGGCAGAAGGAGGCTATTTTTTTGAAAGGAGCTGGGGCCACCGTGGAGTTA TTGTTCATGTCATCGACCCCAAATCAGGCACAGTCATCCATTCTGACCGGTTTGACAC CTATAGATCCAAGAAAGAGAGTGAACGTCTGGTCCAGTATTTGAACGCGGTGCCCGAT GGCAGGATCCTTTCTGTTGCAGTGAATGATGAAGGTTCTCGAAATCTGGATGACATGG CCAGGAAGGCGATGACCAAATTGGGAAGCAAACACTTCCTGCACCTTGGATTTAGGGT GGAGTGGACGGAGTGGTTCGATCATGATAAAGTATCTCAGACTAAAGGTGGGGAGAAA ATTTCAGACCTCTGGAAAGCTCACCCAGGAAAAATATGCAATCGTCCCATTGATATAC AGCAGGCCACTACAATGGATGGAGTTAACCTCAGCACCGAGGTTGTCTACAAAAAAGG CCAGGATTATAGGTTTGCTTGCTACGACCGGGGCAGAGCCTGCCGGAGCTACCGTGTA CGGTTCCTCTGTGGGAAGCCTGTGAGGCCCAAACTCACAGTCACCATTGACACCAATG
TGAACAGCACCATTCTGAACTTGGAGGATAATGTACAGTCATGGAAACCTGGAGATAC CCTGGTCATTGCCAGTACTGATTACTCCATGTACCAGGCAGAAGAGTTCCAGGTGCTT CCCTGCAGATCCTGCGCCCCCAACCAGGTCAAAGTGGCAGGGAAACCAATGTACCTGC ACATCGGGGAGGAGATAGACGGCGTGGACATGCGGGCGGAGGTTGGGCTTCTGAGCCG GAACATCATAGTGATGGGGGAGATGGAGGACAAATGCTACCCCTACAGAAACCACATC TGCAATTTCTTTGACTTCGATACCTTTGGGGGCCACATCAAGTTTGCTCTGGGATTTA AGGCAGCACACTTGGAGGGCACGGAGCTGAAGCATATGGGACAGCAGCTGGTGGGTCA GTACCCGATTCACTTCCACCTGGCCGGTGATGTAGACGAAAGGGGAGGTTATGACCCA CCCACATACATCAGGGACCTCTCCATCCATCATACATTCTCTCGCTGCGTCACAGTCC ATGGCTCCAATGGCTTGTTGATCAAGGACGTTGTGGGCTATAACTCTTTGGGCCACTG CTTCTTCACGGAAGATGGGCCGGAGGAACGCAACACTTTTGACCACTGTCTTGGCCTC CTTGTCAAGTCTGGAACCCTCCTCCCCTCGGACCGTGACAGCAAGATGTGCAAGATGA TCACAGAGGACTCCTACCCAGGGTACATCCCCAAGCCCAGGCAAGACTGCAATGCTGT GTCCACCTTCTGGATGGCCAATCCCAACAACAACCTCATCAACTGTGCCGCTGCAGGA TCTGAGGAAACTGGATTTTGGTTTATTTTTCACCACGTACCAACGGGCCCCTCCGTGG GAATGTACTCCCCAGGTTATTCAGAGCACATTCCACTGGGAAAATTCTATAACAACCG AGCACATTCCAACTACCGGGCTGGCATGATCATAGACAACGGAGTCAAAACCACCGAG GCCTCTGCCAAGGACAAGCGGCCGTTCCTCTCAATCATCTCTGCCAGATACAGCCCTC ACCAGGACGCCGACCCGCTGAAGCCCCGGGAGCCGGCCATCATCAGACACTTCATTGC CTACAAGAACCAGGACCACGGGGCCTGGCTGCGCGGCGGGGATGTGTGGCTGGACAGC TGCCGGTTTGCTGACAATGGCATTGGCCTGACCCTGGCCAGTGGTGGAACCTTCCCGT ATGACGACGGCTCCAAGCAAGAGATAAAGAACAGCTTGTTTGTTGGCGAGAGTGGCAA CGTGGGGACGGAAATGATGGACAATAGGATCTGGGGCCCTGGCGGCTTGGACCATAGC GGAAGGACCCTCCCTATAGGCCAGAATTTTCCAATTAGAGGAATTCAGTTATATGATG GCCCCATCAACATCCAAAACTGCACTTTCCGAAAGTTTGTGGCCCTGGAGGGCCGGCA CACCAGCGCCCTGGCCTTCCGCCTGAATAATGCCTGGCAGAGCTGCCCCCATAACAAC GTGACCGGCATTGCCTTTGAGGACGTTCCGATTACTTCCAGAGTGTTCTTCGGAGAGC CTGGGCCCTGGTTCAACCAGCTGGACATGGATGGGGATAAGACATCTGTGTTCCATGA CGTCGACGGCTCCGTGTCCGAGTACCCTGGCTCCTACCTCACGAAGAATGACAACTGG CTGGTCCGGCACCCAGACTGCATCAATGTTCCCGACTGGAGAGGGGCCATTTGCAGTG GGTGCTATGCACAGATGTACATTCAAGCCTACAAGACCAGTAACCTGCGAATGAAGAT CATCAAGAATGACTTCCCCAGCCACCCTCTTTACCTGGAGGGGGCGCTCACCAGGAGC ACCCATTACCAGCAATACCAACCGGTTGTCACCCTGCAGAAGGGCTACACCATCCACT GGGACCAGACGGCCCCCGCCGAACTCGCCATCTGGCTCATCAACTTCAACAAGGGCGA CTGGATCCGAGTGGGGCTCTGCTACCCGCGAGGCACCACATTCTCCATCCTCTCGGAT GTTCACAATCGCCTGCTGAAGCAAACGTCCAAGACGGGCGTCTTCGTGAGGACCTTGC AGATGGACAAAGTGGAGCAGAGCTACCCTGGCAGGAGCCACTACTACTGGGACGAGGA CTCAGGGCTGTTGTTCCTGAAGCTGAAAGCTCAGAACGAGAGAGAGAAGTTTGCTTTC TGCTCCATGAAAGGCTGTGAGAGGATAAAGATTAAAGCTCTGATTCCAAAGAACGCAG GCGTCAGTGACTGCACAGCCACAGCTTACCCCAAGTTCACCGAGAGGGCTGTCGTAGA CGTGCCGATGCCCAAGAAGCTCTTTGGTTCTCAGCTGAAAACAAAGGACCATTTCTTG GAGGTGAAGATGGAGAGTTCCAAGCAGCACTTCTTCCACCTCTGGAACGACTTCGCTT ACATTGAAGTGGATGGGAAGAAGTACCCCAGTTCGGAGGATGGCATCCAGGTGGTGGT GATTGACGGGAACCAAGGGCGCGTGGTGAGCCACACGAGCTTCAGGAACTCCATTCTG CAAGGCATACCATGGCAGCTTTTCAACTATGTGGCGACCATCCCTGACAATTCCATAG TGCTTATGGCATCAAAGGGAAGATACGTCTCCAGAGGCCCATGGACCAGAGTGCTGGA AAAGCTTGGGGCAGACAGGGGTCTCAAGTTGAAAGAGCAAATGGCATTCGTTGGCTTC AAAGGCAGCTTCCGGCCCATCTGGGTGACACTGGACACTGAGGATCACAAAGCCAAAA TCTTCCAAGTTGTGCCCATCCCTGTGGTGAAGAAGAAGAAGTTGTGAGGACAGCTGCC GCCCGGTGCCACCTCGTGGTAGACTATGACGGTGAC
ORF Start: TGC at 2 ORF Stop: TGA at 3815
SEQ ID NO: 190 1271 aa MW at l43122.4kD
NOV42c, CPDQSPELQPWNPGHDQDHHVHIGQGKTLLLTSSATVYSIHISEGGKLVIKDHDEPIV
CG59889-04 Protein LRTRHILIDNGGELHAGSALCPFQGNFTIILYGRADEGIQPDPYYGLKYIGVGKGGAL ELHGQKKLSWTFLNKTLHPGGMAEGGYFFERSWGHRGVIVHVIDPKSGTVIHSDRFDT Sequence YRSKKESERLVQYLNAVPDGRILSVAVNDEGSRNLDDMARKAMTKLGSKHFLHLGFRV EWTEWFDHDKVSQTKGGEKISDLWKAHPGKICNRPIDIQQATTMDGVNLSTEWYKKG QDYRFACYDRGRACRSYRVRFLCGKPVRPKLTVTIDTNVNSTILNLEDNVQSWKPGDT LVIASTDYSMYQAEEFQVLPCRSCAPNQVKVAGKPMYLHIGEEIDGVDMRAEVGLLSR
NIIVMGEMEDKCYPYRNHICNFFDFDTFGGHIKFALGFKAAHLEGTELKHMGQQLVGQ YPIHFHLAGDVDERGGYDPPTYIRDLSIHHTFSRCVTVHGSNGLLIKDWGYNSLGHC FFTEDGPEERNTFDHCLGLLVKSGTLLPSDRDSKMCKMITEDSYPGYIPKPRQDCNAV STFWMANPNNNLINCAAAGSEETGFWFIFHHVPTGPSVGMYSPGYSEHIPLGKFYNNR AHSNYRAGMIIDNGVKTTEASAKDKRPFLSIISARYSPHQDADPLKPREPAIIRHFIA YKNQDHGAWLRGGDVWLDSCRFADNGIGLTLASGGTFPYDDGSKQEIKNSLFVGESGN VGTEMMDNRIWGPGGLDHSGRTLPIGQNFPIRGIQLYDGPINIQNCTFRKFVALEGRH TSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHD VDGSVSEYPGSYLTKNDNWLVRHPDCINVPDWRGAICSGCYAQMYIQAYKTSNLRMKI IKNDFPSHPLYLEGALTRSTHYQQYQPWTLQKGYTIHWDQTAPAELAIWLINFNKGD WIRVGLCYPRGTTFSILSDVHNRLLKQTSKTGVFVRTLQMDKVEQSYPGRSHYYWDED SGLLFLKLKAQNEREKFAFCSMKGCERIKIKALIPKNAGVSDCTATAYPKFTERAWD VPMPKKLFGSQLKTKDHFLEVKMESSKQHFFHLWNDFAYIEVDGKKYPSSEDGIQVW IDGNQGRWSHTSFRNSILQGIPWQLFNYVATIPDNSIVLMASKGRYVSRGPWTRVLE KLGADRGLKLKEQMAFVGFKGSFRPIWVTLDTEDHKAKIFQWPIPWKKKKL
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 42B.
Further analysis of the NOV42a protein yielded the following properties shown in Table 42C.
Table 42C. Protein Sequence Properties NOV42a
PSort 0.7900 probability located in plasma membrane; 0.6499 probability located in analysis: microbody (peroxisome); 0.3000 probability located in Golgi body; 0.3000 probability located in nucleus
SignalP No Known Signal Sequence Predicted analysis: A search of the NOV42a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 42D.
In a BLAST search of public sequence databases, the NOV42a protein was found to have homology to the proteins shown in the BLASTP data in Table 42E.
PFam analysis predicts that the NOV42a protein contains the domains shown in the
Table 42F.
Table 42F. Domain Analysis of NOV42a
Identities/
Pfam Domain NOV42a Match Region Similarities Expect Value for the Matched Region
No Significant Matches Found
EXAMPLE 43.
The NOV43 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 43A.
Sequence comparison of the above protein sequences yields the following sequence relationships shown in Table 43B.
Table 43B. Comparison of NOV43a against NOV43b and NOV43c.
NOV43a Residues/ Identities/
Protein Sequence Match Residues Similarities for the Matched Region
Further analysis of the NOV43a protein yielded the following properties shown in Table 43C.
Table 43C. Protein Sequence Properties NOV43a
PSort 0.6997 probability located in outside; 0.1000 probability located in endoplasmic analysis: reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen); 0.1000 probability located in lysosome (lumen)
SignalP Likely cleavage site between residues 28 and 29 analysis:
A search of the NOV43a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 43D.
In a BLAST search of public sequence databases, the NOV43a protein was found to have homology to the proteins shown in the BLASTP data in Table 43E.
Table 43E. Public B _LA_STP Results for NOV43a
PFam analysis predicts that the NOV43a protein contains the domains shown in the Table 43F.
EXAMPLE 44.
The NOV44 clone was analyzed, and the nucleotide and predicted polypeptide sequences are shown in Table 44A.
Further analysis of the NOV44a protein yielded the following properties shown in Table 44B.
Table 44B. Protein Sequence Properties NOV44a
PSort 0.4600 probability located in plasma membrane; 0.1000 probability located in analysis: endoplasmic reticulum (membrane); 0.1000 probability located in endoplasmic reticulum (lumen); 0.1000 probability located in outside
SignalP Likely cleavage site between residues 24 and 25 analysis:
A search of the NOV44a protein against the Geneseq database, a proprietary database that contains sequences published in patents and patent publications, yielded several homologous proteins shown in Table 44C.
In a BLAST search of public sequence databases, the NOV44a protein was found to have homology to the proteins shown in the BLASTP data in Table 44D.
PFam analysis predicts that the NOV44a protein contains the domains shown in the Table 44E.
EXAMPLE 45: Sequencing Methodology and Identofication of NOVX Clones
1. GeneCalling™ Technology: This is a proprietary method of performing differential gene expression profiling between two or more samples developed at CuraGen and described by Shimkets, et al., "Gene expression analysis by transcript profiling coupled to a gene database query" Nature Biotechnology 17:198-803 (1999). cDNA was derived from various human samples representing multiple tissue types, normal and diseased states, physiological
states, and developmental states from different donors. Samples were obtained as whole tissue, primary cells or tissue cultured primary cells or cell lines. Cells and cell lines may have been treated with biological or chemical agents that regulate gene expression, for example, growth factors, chemokines or steroids. The cDNA thus derived was then digested with up to as many as 120 pairs of restriction enzymes and pairs of linker-adaptors specific for each pair of restriction enzymes were ligated to the appropriate end. The restriction digestion generates a mixture of unique cDNA gene fragments. Limited PCR amplification is performed with primers homologous to the linker adapter sequence where one primer is biotinylated and the other is fluorescently labeled. The doubly labeled material is isolated and the fluorescently labeled single strand is resolved by capillary gel electrophoresis. A computer algorithm compares the electropherograms from an experimental and control group for each of the restriction digestions. This and additional sequence-derived information is used to predict the identity of each differentially expressed gene fragment using a variety of genetic databases. The identity of the gene fragment is confirmed by additional, gene-specific competitive PCR or by isolation and sequencing of the gene fragment.
2. SeqCalling™ Technology: cDNA was derived from various human samples representing multiple tissue types, normal and diseased states, physiological states, and developmental states from different donors. Samples were obtained as whole tissue, primary cells or tissue cultured primary cells or cell lines. Cells and cell lines may have been treated with biological or chemical agents that regulate gene expression, for example, growth factors, chemokines or steroids. The cDNA thus derived was then sequenced using CuraGen's proprietary SeqCalling technology. Sequence traces were evaluated manually and edited for corrections if appropriate. cDNA sequences from all samples were assembled together, sometimes including public human sequences, using bioinformatic programs to produce a consensus sequence for each assembly. Each assembly is included in CuraGen Corporation's database. Sequences were included as components for assembly when the extent of identity with another component was at least 95% over 50 bp. Each assembly represents a gene or portion thereof and includes information on variants, such as splice forms single nucleotide polymorphisms (SNPs), insertions, deletions and other sequence variations.
PathCalling™ Technology:
The NOVX nucleic acid sequences are derived by laboratory screening of cDNA library by the two-hybrid approach. cDNA fragments covering either the full length of the DNA sequence, or part of the sequence, or both, are sequenced. In silico prediction was based on sequences available in CuraGen Corporation's proprietary sequence databases or in the public human sequence databases, and provided either the full length DNA sequence, or some portion thereof.
The laboratory screening was performed using the methods summarized below: cDNA libraries were derived from various human samples representing multiple tissue types, normal and diseased states, physiological states, and developmental states from different donors. Samples were obtained as whole tissue, primary cells or tissue cultured primary cells or cell lines. Cells and cell lines may have been treated with biological or chemical agents that regulate gene expression, for example, growth factors, chemokines or steroids. The cDNA thus derived was then directionally cloned into the appropriate two-hybrid vector (Gal4-activation domain (Gal4-AD) fusion). Such cDNA libraries as well as commercially available cDNA libraries from Clontech (Palo Alto, CA) were then transferred from E.coli into a CuraGen Corporation proprietary yeast strain (disclosed in U. S. Patents 6,057,101 and 6,083,693, incorporated herein by reference in their entireties).
Gal4-binding domain (Gal4-BD) fusions of a CuraGen Corportion proprietary library of human sequences was used to screen multiple Gal4-AD fusion cDNA libraries resulting in the selection of yeast hybrid diploids in each of which the Gal4-AD fusion contains an individual cDNA. Each sample was amplified using the polymerase chain reaction (PCR) using non-specific primers at the cDNA insert boundaries. Such PCR product was sequenced; sequence traces were evaluated manually and edited for corrections if appropriate. cDNA sequences from all samples were assembled together, sometimes including public human sequences, using bioinformatic programs to produce a consensus sequence for each assembly. Each assembly is included in CuraGen Corporation's database. Sequences were included as components for assembly when the extent of identity with another component was at least 95% over 50 bp. Each assembly represents a gene or portion thereof and includes information on variants, such as splice forms single nucleotide polymorphisms (SNPs), insertions, deletions and other sequence variations.
Physical clone: the cDNA fragment derived by the screening procedure, covering the entire open reading frame is, as a recombinant DNA, cloned into pACT2 plasmid (Clontech) used to make the cDNA library. The recombinant plasmid is inserted into the host and selected
by the yeast hybrid diploid generated during the screening procedure by the mating of both CuraGen Corporation proprietary yeast strains N106' and YULH (U. S. Patents 6,057,101 and 6,083,693).
4. RACE: Techniques based on the polymerase chain reaction such as rapid amplification of cDNA ends (RACE), were used to isolate or complete the predicted sequence of the cDNA of the invention. Usually multiple clones were sequenced from one or more human samples to derive the sequences for fragments. Various human tissue samples from different donors were used for the RACE reaction. The sequences derived from these procedures were included in the SeqCalling Assembly process described in preceding paragraphs.
5. Exon Linking: The NOVX target sequences identified in the present invention were subjected to the exon linking process to confirm the sequence. PCR primers were designed by starting at the most upstream sequence available, for the forward primer, and at the most downstream sequence available for the reverse primer. In each case, the sequence was examined, walking inward from the respective termini toward the coding sequence, until a suitable sequence that is either unique or highly selective was encountered, or, in the case of the reverse primer, until the stop codon was reached. Such primers were designed based on in silico predictions for the full length cDNA, part (one or more exons) of the DNA or protein sequence of the target sequence, or by translated homology of the predicted exons to closely related human sequences from other species. These primers were then employed in PCR amplification based on the following pool of human cDNAs: adrenal gland, bone maπow, brain - amygdala, brain - cerebellum, brain - hippocampus, brain - substantia nigra, brain - thalamus, brain -whole, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, lymphoma - Raji, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small intestine, spinal cord, spleen, stomach, testis, thyroid, trachea, uterus. Usually the resulting amplicons were gel purified, cloned and sequenced to high redundancy. The PCR product derived from exon linking was cloned into the pCR2.1 vector from Invitrogen. The resulting bacterial clone has an insert covering the entire open reading frame cloned into the pCR2.1 vector. The resulting sequences from all clones were assembled with themselves, with other fragments in CuraGen Corporation's database and with public ESTs. Fragments and ESTs were included as components for an assembly when the extent of their identity with another component of the assembly was at least 95% over 50 bp. In
addition, sequence traces were evaluated manually and edited for corrections if appropriate. These procedures provide the sequence reported herein.
6. Physical Clone: Exons were predicted by homology and the intron/exon boundaries were determined using standard genetic rules. Exons were further selected and refined by means of similarity determination using multiple BLAST (for example, tBlastN, BlastX, and BlastN) searches, and, in some instances, GeneScan and Grail. Expressed sequences from both public and proprietary databases were also added when available to further define and complete the gene sequence. The DNA sequence was then manually corrected for apparent inconsistencies thereby obtaining the sequences encoding the full-length protein.
The PCR product derived by exon linking, covering the entire open reading frame, was cloned into the pCR2.1 vector from Invitrogen to provide clones used for expression and screening purposes.
Example 46: Identification of Single Nucleotide Polymorphisms in NOVX nucleic acid sequences
Variant sequences are also included in this application. A variant sequence can include a single nucleotide polymorphism (SNP). A SNP can, in some instances, be refeπed to as a "cSNP" to denote that the nucleotide sequence containing the SNP originates as a cDNA. A SNP can arise in several ways. For example, a SNP may be due to a substitution of one nucleotide for another at the polymorphic site. Such a substitution can be either a transition or a transversion. A SNP can also arise from a deletion of a nucleotide or an insertion of a nucleotide, relative to a reference allele. In this case, the polymorphic site is a site at which one allele bears a gap with respect to a particular nucleotide in another allele. SNPs occurring within genes may result in an alteration of the amino acid encoded by the gene at the position of the SNP. Intragenic SNPs may also be silent, when a codon including a SNP encodes the same amino acid as a result of the redundancy of the genetic code. SNPs occurring outside the region of a gene, or in an intron within a gene, do not result in changes in any amino acid sequence of a protein but may result in altered regulation of the expression pattern. Examples include alteration in temporal expression, physiological response regulation, cell type expression regulation, intensity of expression, and stability of transcribed message.
SeqCalling assemblies produced by the exon linking process were selected and extended using the following criteria. Genomic clones having regions with 98% identity to all or part of the initial or extended sequence were identified by BLASTN searches using the
relevant sequence to query human genomic databases. The genomic clones that resulted were selected for further analysis because this identity indicates that these clones contain the genomic locus for these SeqCalling assemblies. These sequences were analyzed for putative coding regions as well as for similarity to the known DNA and protein sequences. Programs used for these analyses include Grail, Genscan, BLAST, HMMER, FASTA, Hybrid and other relevant programs.
Some additional genomic regions may have also been identified because selected SeqCalling assemblies map to those regions. Such SeqCalling sequences may have overlapped with regions defined by homology or exon prediction. They may also be included because the location of the fragment was in the vicinity of genomic regions identified by similarity or exon prediction that had been included in the original predicted sequence. The sequence so identified was manually assembled and then may have been extended using one or more additional sequences taken from CuraGen Corporation's human SeqCalling database. SeqCalling fragments suitable for inclusion were identified by the CuraTools™ program SeqExtend or by identifying SeqCalling fragments mapping to the appropriate regions of the genomic clones analyzed.
The regions defined by the procedures described above were then manually integrated and corrected for apparent inconsistencies that may have arisen, for example, from miscalled bases in the original fragments or from discrepancies between predicted exon junctions, EST locations and regions of sequence similarity, to derive the final sequence disclosed herein. When necessary, the process to identify and analyze SeqCalling assemblies and genomic clones was reiterated to derive the full length sequence (Alderborn et al., Determination of Single Nucleotide Polymorphisms by Real-time Pyrophosphate DNA Sequencing. Genome Research. 10 (8) 1249-1265, 2000). Variants are reported individually but any combination of all or a select subset of variants are also included as contemplated NOVX embodiments of the invention.
NOV2a SNP data:
NOV2a has two SNP variants, whose variant positions for its nucleotide and amino acid sequences is numbered according to SEQ ID NOs:9 and 10, respectively. The nucleotide sequence of the NOV2a variant differs as shown in Table 46 A.
Table 46A SNP data for NOV2a
NOVόa SNP data:
NOVόa has two SNP variants, whose variant positions for its nucleotide and amino acid sequences is numbered according to SEQ ID NOs:23 and 24, respectively. The nucleotide sequence of the NOVόa variant differs as shown in Table 46B.
NOV7a SNP data:
NOV7a has two SNP variants, whose variant positions for its nucleotide and amino acid sequences is numbered according to SEQ ID NOs:25 and 26, respectively. The nucleotide sequence of the NOV7a variant differs as shown in Table 46C.
NOV9a SNP data:
NOV9a has two SNP variants, whose variant positions for its nucleotide and amino acid sequences is numbered according to SEQ ID NOs:31 and 32, respectively. The nucleotide sequence of the NOV9a variant differs as shown in Table 46D.
NOVlla SNP data:
NOVl la has two SNP variants, whose variant positions for its nucleotide and amino acid sequences is numbered according to SEQ ID NOs:35 and 36, respectively. The nucleotide sequence of the NOVl la variant differs as shown in Table 46E.
NOV14a SNP data:
NOVl 4a has two SNP variants, whose variant positions for its nucleotide and amino acid sequences is numbered according to SEQ ID NOs:57 and 58, respectively. The nucleotide sequence of the NOV14a variant differs as shown in Table 46F.
NOV15a SNP data:
NOVl 5a has two SNP variants, whose variant positions for its nucleotide and amino acid sequences is numbered according to SEQ ID NOs: 59 and 60, respectively. The nucleotide sequence of the NOVl 5a variant differs as shown in Table 46G.
NOVlόa SNP data:
NOVlόa has two SNP variants, whose variant positions for its nucleotide and amino acid sequences is numbered according to SEQ ID NOs:65 and 66, respectively. The nucleotide sequence of the NOVlόa variant differs as shown in Table 46H.
NOV18a SNP data:
NOVl 8a has two SNP variants, whose variant positions for its nucleotide and amino acid sequences is numbered according to SEQ ID NOs:73 and 74, respectively. The nucleotide sequence of the NOVl 8a variant differs as shown in Table 46H.
Table 46H SNP data for NOVl 8a
NOV21a SNP data:
NOV21a has two SNP variants, whose variant positions for its nucleotide and amino acid sequences is numbered according to SEQ ID NOs:85 and 86, respectively. The nucleotide sequence of the NOV21a variant differs as shown in Table 461.
NOV25a SNP data:
NOV25a has two SNP variants, whose variant positions for its nucleotide and amino acid sequences is numbered according to SEQ ID NOs: 121 and 122, respectively. The nucleotide sequence of the NOV25a variant differs as shown in Table 46J.
NOV27a SNP data:
NOV27a has two SNP variants, whose variant positions for its nucleotide and amino acid sequences is numbered according to SEQ ID NOs: 127 and 128, respectively. The nucleotide sequence of the NOV27a variant differs as shown in Table 46K.
NOV28a SNP data:
NOV28a has two SNP variants, whose variant positions for its nucleotide and amino acid sequences is numbered according to SEQ ID NOs: 129 and 130, respectively. The nucleotide sequence of the NOV28a variant differs as shown in Table 46K.
NOV31a SNP data:
NOV31a has two SNP variants, whose variant positions for its nucleotide and amino acid sequences is numbered according to SEQ ID NOs: 141 and 142, respectively. The nucleotide sequence of the NOV31a variant differs as shown in Table 46L.
NOV34a SNP data:
NOV34a has two SNP variants, whose variant positions for its nucleotide and amino acid sequences is numbered according to SEQ ID NOs: 147 and 148, respectively. The nucleotide sequence of the NOV34a variant differs as shown in Table 46M.
NOV40a SNP data:
NOV40a has two SNP variants, whose variant positions for its nucleotide and amino acid sequences is numbered according to SEQ ID NOs: 179 and 180, respectively. The nucleotide sequence of the NOV40a variant differs as shown in Table 46N.
NOV42a SNP data:
NOV42a has two SNP variants, whose variant positions for its nucleotide and amino acid sequences is numbered according to SEQ ID NOs: 185 and 186, respectively. The nucleotide sequence of the NOV42a variant differs as shown in Table 460.
NOV44a SNP data:
NOV44a has two SNP variants, whose variant positions for its nucleotide and amino acid sequences is numbered according to SEQ ID NOs: 195 and 196, respectively. The nucleotide sequence of the NOV44a variant differs as shown in Table 46P.
Example 47. Quantitative expression analysis of clones in various cells and tissues
The quantitative expression of various clones was assessed using microtiter plates containing RNA samples from a variety of normal and pathology-derived cells, cell lines and tissues using real time quantitative PCR (RTQ PCR). RTQ PCR was performed on an Applied Biosystems ABI PRISM® 7700 or an ABI PRISM® 7900 HT Sequence Detection System. Various collections of samples are assembled on the plates, and referred to as Panel 1
(containing normal tissues and cancer cell lines), Panel 2 (containing samples derived from tissues from normal and cancer sources), Panel 3 (containing cancer cell lines), Panel 4 (containing cells and cell lines from normal tissues and cells related to inflammatory conditions), Panel 5D/5I (containing human tissues and cell lines with an emphasis on metabolic diseases), AI_comprehensive_panel (containing normal tissue and samples from autoimmune diseases), Panel CNSD.01 (containing central nervous system samples from
normal and diseased brains) and CNS_neurodegeneration_panel (containing samples from normal and Alzheimer's diseased brains).
RNA integrity from all samples is controlled for quality by visual assessment of agarose gel electropherograms using 28S and 18S ribosomal RNA staining intensity ratio as a guide (2: 1 to 2.5: 1 28s: 18s) and the absence of low molecular weight RNAs that would be indicative of degradation products. Samples are controlled against genomic DNA contamination by RTQ PCR reactions run in the absence of reverse transcriptase using probe and primer sets designed to amplify across the span of a single exon.
First, the RNA samples were normalized to reference nucleic acids such as constitutively expressed genes (for example, β-actin and GAPDH). Normalized RNA (5 ul) was converted to cDNA and analyzed by RTQ-PCR using One Step RT-PCR Master Mix Reagents (Applied Biosystems; Catalog No. 4309169) and gene-specific primers according to the manufacturer's instructions.
In other cases, non-normalized RNA samples were converted to single strand cDNA (sscDNA) using Superscript II (Invitrogen Corporation; Catalog No. 18064-147) and random hexamers according to the manufacturer's instructions. Reactions containing up to 10 μg of total RNA were performed in a volume of 20 μl and incubated for 60 minutes at 42°C. This reaction can be scaled up to 50 μg of total RNA in a final volume of 100 μl. sscDNA samples are then normalized to reference nucleic acids as described previously, using IX TaqMan® Universal Master mix (Applied Biosystems; catalog No.4324020), following the manufacturer's instructions.
Probes and primers were designed for each assay according to Applied Biosystems Primer Express Software package (version I for Apple Computer's Macintosh Power PC) or a similar algorithm using the target sequence as input. Default settings were used for reaction conditions and the following parameters were set before selecting primers: primer concentration = 250 nM, primer melting temperature (Tm) range = 58°-60°C, primer optimal Tm = 59°C, maximum primer difference = 2°C, probe does not have 5'G, probe Tm must be 10°C greater than primer Tm, amplicon size 75bp to lOObp. The probes and primers selected (see below) were synthesized by Synthegen (Houston, TX, USA). Probes were double purified by HPLC to remove uncoupled dye and evaluated by mass spectroscopy to verify coupling of reporter and quencher dyes to the 5' and 3' ends of the probe, respectively. Their final concentrations were: forward and reverse primers, 900nM each, and probe, 200nM.
PCR conditions: When working with RNA samples, normalized RNA from each tissue and each cell line was spotted in each well of either a 96 well or a 384-well PCR plate
(Applied Biosystems). PCR cocktails included either a single gene specific probe and primers set, or two multiplexed probe and primers sets (a set specific for the target clone and another gene-specific set multiplexed with the target probe). PCR reactions were set up using TaqMan® One-Step RT-PCR Master Mix (Applied Biosystems, Catalog No. 4313803) following manufacturer's instructions. Reverse transcription was performed at 48°C for 30 minutes followed by amplification/PCR cycles as follows: 95°C 10 min, then 40 cycles of 95°C for 15 seconds, 60°C for 1 minute. Results were recorded as CT values (cycle at which a given sample crosses a threshold level of fluorescence) using a log scale, with the difference in RNA concentration between a given sample and the sample with the lowest CT value being represented as 2 to the power of delta CT. The percent relative expression is then obtained by taking the reciprocal of this RNA difference and multiplying by 100.
When working with sscDNA samples, normalized sscDNA was used as described previously for RNA samples. PCR reactions containing one or two sets of probe and primers were set up as described previously, using IX TaqMan® Universal Master mix (Applied Biosystems; catalog No. 4324020), following the manufacturer's instructions. PCR amplification was performed as follows: 95°C 10 min, then 40 cycles of 95°C for 15 seconds, 60°C for 1 minute. Results were analyzed and processed as described previously.
Panels 1, 1.1, 1.2, and 1.3D The plates for Panels 1 , 1.1, 1.2 and 1.3D include 2 control wells (genomic DNA control and chemistry control) and 94 wells containing cDNA from various samples. The samples in these panels are broken into 2 classes: samples derived from cultured cell lines and samples derived from primary normal tissues. The cell lines are derived from cancers of the following types: lung cancer, breast cancer, melanoma, colon cancer, prostate cancer, CNS cancer, squamous cell carcinoma, ovarian cancer, liver cancer, renal cancer, gastric cancer and pancreatic cancer. Cell lines used in these panels are widely available through the American Type Culture Collection (ATCC), a repository for cultured cell lines, and were cultured using the conditions recommended by the ATCC. The normal tissues found on these panels are comprised of samples derived from all major organ systems from single adult individuals or fetuses. These samples are derived from the following organs: adult skeletal muscle, fetal skeletal muscle, adult heart, fetal heart, adult kidney, fetal kidney, adult liver, fetal liver, adult lung, fetal lung, various regions of the brain, the spleen, bone marrow, lymph node, pancreas, salivary gland, pituitary gland, adrenal gland, spinal cord, thymus, stomach, small intestine, colon, bladder, trachea, breast, ovary, uterus, placenta, prostate, testis and adipose.
In the results for Panels 1, 1.1, 1.2 and 1.3D, the following abbreviations are used: ca. = carcinoma, * = established from metastasis, met = metastasis, s cell var = small cell variant, non-s = non-sm = non-small, squam = squamous, pi. eff = pi effusion = pleural effusion, glio = glioma, astro = astrocytoma, and neuro = neuroblastoma.
General_screening_panel_vl.4
The plates for Panel 1.4 include 2 control wells (genomic DNA control and chemistry control) and 94 wells containing cDNA from various samples. The samples in Panel 1.4 are broken into 2 classes: samples derived from cultured cell lines and samples derived from primary normal tissues. The cell lines are derived from cancers of the following types: lung cancer, breast cancer, melanoma, colon cancer, prostate cancer, CNS cancer, squamous cell carcinoma, ovarian cancer, liver cancer, renal cancer, gastric cancer and pancreatic cancer. Cell lines used in Panel 1.4 are widely available through the American Type Culture
Collection (ATCC), a repository for cultured cell lines, and were cultured using the conditions recommended by the ATCC. The normal tissues found on Panel 1.4 are comprised of pools of samples derived from all major organ systems from 2 to 5 different adult individuals or fetuses. These samples are derived from the following organs: adult skeletal muscle, fetal skeletal muscle, adult heart, fetal heart, adult kidney, fetal kidney, adult liver, fetal liver, adult lung, fetal lung, various regions of the brain, the spleen, bone marrow, lymph node, pancreas, salivary gland, pituitary gland, adrenal gland, spinal cord, thymus, stomach, small intestine, colon, bladder, trachea, breast, ovary, uterus, placenta, prostate, testis and adipose. Abbreviations are as described for Panels 1, 1.1, 1.2, and 1.3D.
Panels 2D and 2.2
The plates for Panels 2D and 2.2 generally include 2 control wells and 94 test samples composed of RNA or cDNA isolated from human tissue procured by surgeons working in close cooperation with the National Cancer Institute's Cooperative Human Tissue Network
(CHTN) or the National Disease Research Initiative (NDRI). The tissues are derived from human malignancies and in cases where indicated many malignant tissues have "matched margins" obtained from noncancerous tissue just adjacent to the tumor. These are termed normal adjacent tissues and are denoted "NAT" in the results below. The tumor tissue and the "matched margins" are evaluated by two independent pathologists (the surgical pathologists and again by a pathologist at NDRI or CHTN). This analysis provides a gross histopathological assessment of tumor differentiation grade. Moreover, most samples include the original surgical pathology report that provides information regarding the clinical stage of the patient. These matched margins are taken from the tissue surrounding (i.e. immediately proximal) to the zone of surgery (designated "NAT", for normal adjacent tissue, in Table RR). In addition, RNA and cDNA samples were obtained from various human tissues derived from autopsies performed on elderly people or sudden death victims (accidents, etc.). These tissues were ascertained to be free of disease and were purchased from various commercial sources such as Clontech (Palo Alto, CA), Research Genetics, and Invitrogen.
Panel 3D
The plates of Panel 3D are comprised of 94 cDNA samples and two control samples. Specifically, 92 of these samples are derived from cultured human cancer cell lines, 2 samples of human primary cerebellar tissue and 2 controls. The human cell lines are generally obtained from ATCC (American Type Culture Collection), NCI or the German tumor cell bank and fall into the following tissue groups: Squamous cell carcinoma of the tongue, breast cancer, prostate cancer, melanoma, epidermoid carcinoma, sarcomas, bladder carcinomas, pancreatic cancers, kidney cancers, leukemias/lymphomas, ovarian/uterine/cervical, gastric, colon, lung and CNS cancer cell lines. In addition, there are two independent samples of cerebellum. These cells are all cultured under standard recommended conditions and RNA extracted using the standard procedures. The cell lines in panel 3D and 1.3D are of the most common cell lines used in the scientific literature.
Panels 4D, 4R, and 4.1D Panel 4 includes samples on a 96 well plate (2 control wells, 94 test samples) composed of RNA (Panel 4R) or cDNA (Panels 4D/4.1D) isolated from various human cell lines or tissues related to inflammatory conditions. Total RNA from control normal tissues such as colon and lung (Stratagene, La Jolla, CA) and thymus and kidney (Clontech) was employed. Total RNA from liver tissue from cirrhosis patients and kidney from lupus patients
was obtained from BioChain (Biochain Institute, Inc., Hayward, CA). Intestinal tissue for RNA preparation from patients diagnosed as having Crohn's disease and ulcerative colitis was obtained from the National Disease Research Interchange (NDRI) (Philadelphia, PA).
Astrocytes, lung fibroblasts, dermal fibroblasts, coronary artery smooth muscle cells, small airway epithelium, bronchial epithelium, microvascular dermal endothelial cells, microvascular lung endothelial cells, human pulmonary aortic endothelial cells, human umbilical vein endothelial cells were all purchased from Clonetics (Walkersville, MD) and grown in the media supplied for these cell types by Clonetics. These primary cell types were activated with various cytokines or combinations of cytokines for 6 and/or 12-14 hours, as indicated. The following cytokines were used; IL-1 beta at approximately l-5ng/ml, TNF alpha at approximately 5-lOng/ml, IFN gamma at approximately 20-50ng/ml, IL-4 at approximately 5-10ng/ml, IL-9 at approximately 5-10ng/ml, IL-13 at approximately 5- lOng/ml. Endothelial cells were sometimes starved for various times by culture in the basal media from Clonetics with 0.1% serum. Mononuclear cells were prepared from blood of employees at CuraGen Corporation, using Ficoll. LAK cells were prepared from these cells by culture in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco/Life Technologies, Rockville, MD), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xl0"5M (Gibco), and lOmM Hepes (Gibco) and Interleukin 2 for 4-6 days. Cells were then either activated with 10-20ng/ml PMA and l-2μg/ml ionomycin, IL-12 at 5-10ng/ml, IFN gamma at 20-50ng/ml and IL-18 at 5- lOng/ml for 6 hours. In some cases, mononuclear cells were cultured for 4-5 days in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xl0"5M (Gibco), and lOmM Hepes (Gibco) with PHA (phytohemagglutinin) or PWM (pokeweed mitogen) at approximately 5μg/ml. Samples were taken at 24, 48 and 72 hours for RNA preparation. MLR (mixed lymphocyte reaction) samples were obtained by taking blood from two donors, isolating the mononuclear cells using Ficoll and mixing the isolated mononuclear cells 1:1 at a final concentration of approximately 2xl06cells/ml in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol (5.5xlO"5M) (Gibco), and lOmM Hepes (Gibco). The MLR was cultured and samples taken at various time points ranging from 1- 7 days for
RNA preparation.
Monocytes were isolated from mononuclear cells using CD 14 Miltenyi Beads, +ve VS selection columns and a Vario Magnet according to the manufacturer's instructions.
Monocytes were differentiated into dendritic cells by culture in DMEM 5% fetal calf serum
(FCS) (Hyclone, Logan, UT), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xl0"5M (Gibco), and lOmM Hepes (Gibco), 50ng/ml GMCSF and 5ng/ml IL-4 for 5-7 days. Macrophages were prepared by culture of monocytes for 5-7 days in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xl0"5M (Gibco), lOmM Hepes (Gibco) and 10% AB Human Serum or MCSF at approximately 50ng/ml. Monocytes, macrophages and dendritic cells were stimulated for 6 and 12-14 hours with lipopolysaccharide (LPS) at lOOng/ml. Dendritic cells were also stimulated with anti-CD40 monoclonal antibody (Pharmingen) at lOμg/ml for 6 and 12-14 hours. CD4 lymphocytes, CD8 lymphocytes and NK cells were also isolated from mononuclear cells using CD4, CD8 and CD56 Miltenyi beads, positive VS selection columns and a Vario Magnet according to the manufacturer's instructions. CD45RA and CD45RO CD4 lymphocytes were isolated by depleting mononuclear cells of CD8, CD56, CD14 and CD19 cells using CD8, CD56, CD14 and CD19 Miltenyi beads and positive selection. CD45RO beads were then used to isolate the CD45RO CD4 lymphocytes with the remaining cells being CD45RA CD4 lymphocytes. CD45RA CD4, CD45RO CD4 and CD8 lymphocytes were placed in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xlO"5M (Gibco), and lOmM Hepes (Gibco) and plated at 106cells/ml onto Falcon 6 well tissue culture plates that had been coated overnight with 0.5μg/ml anti-CD28 (Pharmingen) and 3ug/ml anti-CD3 (OKT3, ATCC) in PBS. After 6 and 24 hours, the cells were harvested for RNA preparation. To prepare chronically activated CD8 lymphocytes, we activated the isolated CD8 lymphocytes for 4 days on anti-CD28 and anti-CD3 coated plates and then harvested the cells and expanded them in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xlO"5M (Gibco), and lOmM Hepes (Gibco) and IL-2. The expanded CD8 cells were then activated again with plate bound anti-CD3 and anti-CD28 for 4 days and expanded as before. RNA was isolated 6 and 24 hours after the second activation and after 4 days of the second expansion culture. The isolated NK cells were cultured in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xl0"5M (Gibco), and lOmM Hepes (Gibco) and IL-2 for 4-6 days before
RNA was prepared.
To obtain B cells, tonsils were procured from NDRI. The tonsil was cut up with sterile dissecting scissors and then passed through a sieve. Tonsil cells were then spun down and resupended at 106cells/ml in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids
(Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xlO"5M (Gibco), and lOmM Hepes (Gibco). To activate the cells, we used PWM at 5μg/ml or anti-CD40 (Pharmingen) at approximately lOμg/ml and IL-4 at 5-lOng/ml. Cells were harvested for RNA preparation at 24,48 and 72 hours. To prepare the primary and secondary Thl/Th2 and Trl cells, six- well Falcon plates were coated overnight with lOμg/ml anti-CD28 (Pharmingen) and 2μg/ml OKT3 (ATCC), and then washed twice with PBS. Umbilical cord blood CD4 lymphocytes (Poietic Systems, German Town, MD) were cultured at 105-106cells/ml in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5x10" 5M (Gibco), lOmM Hepes (Gibco) and IL-2 (4ng/ml). IL-12 (5ng/ml) and anti-IL4 (lμg/ml) were used to direct to Thl, while IL-4 (5ng/ml) and anti-IFN gamma (lμg/ml) were used to direct to Th2 and IL-10 at 5ng/ml was used to direct to Trl. After 4-5 days, the activated Thl, Th2 and Trl lymphocytes were washed once in DMEM and expanded for 4-7 days in DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xl0"5M (Gibco), lOmM Hepes (Gibco) and IL-2 (lng/ml). Following this, the activated Thl , Th2 and Trl lymphocytes were re-stimulated for 5 days with anti-CD28/OKT3 and cytokines as described above, but with the addition of anti-CD95L (lμg/ml) to prevent apoptosis. After 4-5 days, the Thl, Th2 and Trl lymphocytes were washed and then expanded again with IL-2 for 4-7 days. Activated Thl and Th2 lymphocytes were maintained in this way for a maximum of three cycles. RNA was prepared from primary and secondary Thl, Th2 and Trl after 6 and 24 hours following the second and third activations with plate bound anti-CD3 and anti-CD28 mAbs and 4 days into the second and third expansion cultures in Interleukin 2.
The following leukocyte cells lines were obtained from the ATCC: Ramos, EOL-1, KU-812. EOL cells were further differentiated by culture in O.lmM dbcAMP at 5xl05cells/ml for 8 days, changing the media every 3 days and adjusting the cell concentration to 5xl05cells/ml. For the culture of these cells, we used DMEM or RPMI (as recommended by the ATCC), with the addition of 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate (Gibco), mercaptoethanol 5.5xlO"5M (Gibco), lOmM Hepes (Gibco). RNA was either prepared from resting cells or cells activated with PMA at lOng/ml and ionomycin at lμg/ml for 6 and 14 hours. Keratinocyte line CCD106 and an airway epithelial tumor line NCI-H292 were also obtained from the ATCC. Both were cultured in
DMEM 5% FCS (Hyclone), lOOμM non essential amino acids (Gibco), ImM sodium pyruvate
(Gibco), mercaptoethanol 5.5xl0"5M (Gibco), and lOmM Hepes (Gibco). CCD1106 cells were
activated for 6 and 14 hours with approximately 5 ng/ml TNF alpha and lng/ml IL-1 beta, while NCI-H292 cells were activated for 6 and 14 hours with the following cytokines: 5ng/ml IL-4, 5ng/ml IL-9, 5ng/ml IL-13 and 25ng/ml IFN gamma.
For these cell lines and blood cells, RNA was prepared by lysing approximately 107cells/ml using Trizol (Gibco BRL). Briefly, 1/10 volume of bromochloropropane (Molecular Research Corporation) was added to the RNA sample, vortexed and after 10 minutes at room temperature, the tubes were spun at 14,000 rpm in a Sorvall SS34 rotor. The aqueous phase was removed and placed in a 15ml Falcon Tube. An equal volume of isopropanol was added and left at -20°C overnight. The precipitated RNA was spun down at 9,000 rpm for 15 min in a Sorvall SS34 rotor and washed in 70% ethanol. The pellet was redissolved in 300μl of RNAse-free water and 35μl buffer (Promega) 5μl DTT, 7μl RNAsin and 8μl DNAse were added. The tube was incubated at 37°C for 30 minutes to remove contaminating genomic DNA, extracted once with phenol chloroform and re-precipitated with 1/10 volume of 3M sodium acetate and 2 volumes of 100% ethanol. The RNA was spun down and placed in RNAse free water. RNA was stored at -80°C.
AI_comprehensive panel_vl.0
The plates for AJ comprehensive panel vl.O include two control wells and 89 test samples comprised of cDNA isolated from surgical and postmortem human tissues obtained from the Backus Hospital and Clinomics (Frederick, MD). Total RNA was extracted from tissue samples from the Backus Hospital in the Facility at CuraGen. Total RNA from other tissues was obtained from Clinomics.
Joint tissues including synovial fluid, synovium, bone and cartilage were obtained from patients undergoing total knee or hip replacement surgery at the Backus Hospital. Tissue samples were immediately snap frozen in liquid nitrogen to ensure that isolated RNA was of optimal quality and not degraded. Additional samples of osteoarthritis and rheumatoid arthritis joint tissues were obtained from Clinomics. Normal control tissues were supplied by Clinomics and were obtained during autopsy of trauma victims.
Surgical specimens of psoriatic tissues and adjacent matched tissues were provided as total RNA by Clinomics. Two male and two female patients were selected between the ages of 25 and 47. None of the patients were taking prescription drugs at the time samples were isolated.
Surgical specimens of diseased colon from patients with ulcerative colitis and Crohns disease and adjacent matched tissues were obtained from Clinomics. Bowel tissue from three
female and three male Crohn's patients between the ages of 41-69 were used. Two patients were not on prescription medication while the others were taking dexamethasone, phenobarbital, or tylenol. Ulcerative colitis tissue was from three male and four female patients. Four of the patients were taking lebvid and two were on phenobarbital. Total RNA from post mortem lung tissue from trauma victims with no disease or with emphysema, asthma or COPD was purchased from Clinomics. Emphysema patients ranged in age from 40-70 and all were smokers, this age range was chosen to focus on patients with cigarette-linked emphysema and to avoid those patients with alpha- lanti-trypsin deficiencies. Asthma patients ranged in age from 36-75, and excluded smokers to prevent those patients that could also have COPD. COPD patients ranged in age from 35-80 and included both smokers and non-smokers. Most patients were taking corticosteroids, and bronchodilators.
In the labels employed to identify tissues in the AI_comprehensive panel vl .0 panel, the following abbreviations are used:
Al = Autoimmunity Syn = Synovial
Normal = No apparent disease
Rep22 /Rep20 = individual patients
RA = Rheumatoid arthritis
Backus = From Backus Hospital OA = Osteoarthritis
(SS) (BA) (MF) = Individual patients
Adj = Adjacent tissue
Match control = adjacent tissues
-M = Male -F = Female
COPD = Chronic obstructive pulmonary disease
Panels 5D and 51
The plates for Panel 5D and 51 include two control wells and a variety of cDNAs isolated from human tissues and cell lines with an emphasis on metabolic diseases. Metabolic tissues were obtained from patients enrolled in the Gestational Diabetes study. Cells were obtained during different stages in the differentiation of adipocytes from human mesenchymal stem cells. Human pancreatic islets were also obtained.
In the Gestational Diabetes study subjects are young (18 - 40 years), otherwise healthy women with and without gestational diabetes undergoing routine (elective) Caesarean section. After delivery of the infant, when the surgical incisions were being repaired/closed, the obstetrician removed a small sample (<1 cc) of the exposed metabolic tissues during the closure of each surgical level. The biopsy material was rinsed in sterile saline, blotted and fast frozen within 5 minutes from the time of removal. The tissue was then flash frozen in liquid nitrogen and stored, individually, in sterile screw-top tubes and kept on dry ice for shipment to or to be picked up by CuraGen. The metabolic tissues of interest include uterine wall (smooth muscle), visceral adipose, skeletal muscle (rectus) and subcutaneous adipose. Patient descriptions are as follows:
Patient 2: Diabetic Hispanic, overweight, not on insulin
Patient 7-9: Nondiabetic Caucasian and obese (BMI>30)
Patient 10: Diabetic Hispanic, overweight, on insulin
Patient 11 : Nondiabetic African American and overweight Patient 12: Diabetic Hispanic on insulin
Adipocyte differentiation was induced in donor progenitor cells obtained from Osirus (a division of Clonetics/BioWhittaker) in triplicate, except for Donor 3U which had only two replicates. Scientists at Clonetics isolated, grew and differentiated human mesenchymal stem cells (HuMSCs) for CuraGen based on the published protocol found in Mark F. Pittenger, et al., Multilineage Potential of Adult Human Mesenchymal Stem Cells Science Apr 2 1999: 143-147. Clonetics provided Trizol lysates or frozen pellets suitable for mRNA isolation and ds cDNA production. A general description of each donor is as follows:
Donor 2 and 3 U: Mesenchymal Stem cells, Undifferentiated Adipose
Donor 2 and 3 AM: Adipose, AdiposeMidway Differentiated Donor 2 and 3 AD: Adipose, Adipose Differentiated
Human cell lines were generally obtained from ATCC (American Type Culture Collection), NCI or the German tumor cell bank and fall into the following tissue groups: kidney proximal convoluted tubule, uterine smooth muscle cells, small intestine, liver HepG2 cancer cells, heart primary stromal cells, and adrenal cortical adenoma cells. These cells are all cultured under standard recommended conditions and RNA extracted using the standard procedures. All samples were processed at CuraGen to produce single stranded cDNA.
Panel 51 contains all samples previously described with the addition of pancreatic islets from a 58 year old female patient obtained from the Diabetes Research Institute at the
University of Miami School of Medicine. Islet tissue was processed to total RNA at an outside source and delivered to CuraGen for addition to panel 51.
In the labels employed to identify tissues in the 5D and 51 panels, the following abbreviations are used: GO Adipose = Greater Omentum Adipose
SK = Skeletal Muscle
UT = Uterus
PL = Placenta
AD = Adipose Differentiated AM = Adipose Midway Differentiated
U = Undifferentiated Stem Cells
Panel CNSD.01
The plates for Panel CNSD.01 include two control wells and 94 test samples comprised of cDNA isolated from postmortem human brain tissue obtained from the Harvard Brain Tissue Resource Center. Brains are removed from calvaria of donors between 4 and 24 hours after death, sectioned by neuroanatomists, and frozen at -80°C in liquid nitrogen vapor. All brains are sectioned and examined by neuropathologists to confirm diagnoses with clear associated neuropathology. Disease diagnoses are taken from patient records. The panel contains two brains from each of the following diagnoses: Alzheimer's disease, Parkinson's disease, Huntington's disease, Progressive Supernuclear Palsy, Depression, and "Normal controls". Within each of these brains, the following regions are represented: cingulate gyrus, temporal pole, globus palladus, substantia nigra, Brodman Area 4 (primary motor strip), Brodman Area 7 (parietal cortex), Brodman Area 9 (prefrontal cortex), and Brodman area 17 (occipital cortex). Not all brain regions are represented in all cases; e.g., Huntington's disease is characterized in part by neurodegeneration in the globus palladus, thus this region is impossible to obtain from confirmed Huntington's cases. Likewise Parkinson's disease is characterized by degeneration of the substantia nigra making this region more difficult to obtain. Normal control brains were examined for neuropathology and found to be free of any pathology consistent with neurodegeneration.
In the labels employed to identify tissues in the CNS panel, the following abbreviations are used:
PSP = Progressive supranuclear palsy Sub Nigra = Substantia nigra Glob Palladus= Globus palladus Temp Pole = Temporal pole Cing Gyr = Cingulate gyrus
BA 4 = Brodman Area 4
Panel CNS_Neurodegeneration_V1.0
The plates for Panel CNS_Neurodegeneration_V1.0 include two control wells and 47 test samples comprised of cDNA isolated from postmortem human brain tissue obtained from the Harvard Brain Tissue Resource Center (McLean Hospital) and the Human Brain and Spinal Fluid Resource Center (VA Greater Los Angeles Healthcare System). Brains are removed from calvaria of donors between 4 and 24 hours after death, sectioned by neuroanatomists, and frozen at -80°C in liquid nitrogen vapor. All brains are sectioned and examined by neuropathologists to confirm diagnoses with clear associated neuropathology. Disease diagnoses are taken from patient records. The panel contains six brains from Alzheimer's disease (AD) patients, and eight brains from "Normal controls" who showed no evidence of dementia prior to death. The eight normal control brains are divided into two categories: Controls with no dementia and no Alzheimer's like pathology (Controls) and controls with no dementia but evidence of severe Alzheimer's like pathology, (specifically senile plaque load rated as level 3 on a scale of 0-3; 0 = no evidence of plaques, 3 = severe AD senile plaque load). Within each of these brains, the following regions are represented: hippocampus, temporal cortex (Brodman Area 21), parietal cortex (Brodman area 7), and occipital cortex (Brodman area 17). These regions were chosen to encompass all levels of neurodegeneration in AD. The hippocampus is a region of early and severe neuronal loss in AD; the temporal cortex is known to show neurodegeneration in AD after the hippocampus; the parietal cortex shows moderate neuronal death in the late stages of the disease; the occipital cortex is spared in AD and therefore acts as a "control" region within AD patients. Not all brain regions are represented in all cases. In the labels employed to identify tissues in the CNS_Neurodegeneration_Vl .0 panel, the following abbreviations are used:
AD = Alzheimer's disease brain; patient was demented and showed AD-like pathology upon autopsy
Control = Control brains; patient not demented, showing no neuropathology
Control (Path) = Control brains; pateint not demented but showing sever AD-like pathology
SupTemporal Ctx = Superior Temporal Cortex
Inf Temporal Ctx = Inferior Temporal Cortex
A. NOVla, NOVlc, and NOVld: NEUREXOPHILIN 1 PRECURSOR
Expression of gene NOVla and variants NOVlc and NOVld was assessed using the primer-probe set Ag3371, described in Table AA. Results of the RTQ-PCR runs are shown in Tables AB and AC. Please note that NOVlc and NOVld represent full-length physical clones of the NOVla gene, validating the prediction of the gene sequence.
Table AA. Probe Name Ag3371
Table AB. CNS_neurodegeneration_vl.O
CNS_neurodegeneration_vl.0 Summary: Ag3371 This panel confirms the expression of this gene at moderate levels in the brains of an independent group of individuals. However, no differential expression of this gene was detected between Alzheimer's diseased postmortem brains and those of non-demented controls in this experiment. Please see Panel 1.4 for a discussion of the potential utility of this gene in treatment of central nervous system disorders.
General_screening_panel_vl.4 Summary: Ag3371 Moderate expression of the NOVla gene is seen in all regions of the brain represented on this panel (CT=29.2-31.7), with the highest level of expression in fetal brain. Thus, expression of this gene may be used to distinguish brain from the other samples on this panel. The NOVla gene encodes a protein with homology to neurexophilins. Neurexophilins are members of a family of neuropeptide- like glycoproteins that bind to alpha-neurexins, receptor-like proteins expressed on the neuronal cell surface (Missler and Sudhof, J Neurosci 18(10):3630-8), 1998). Therefore, this gene may play a role in central nervous system disorders such as Alzheimer's disease, Parkinson's disease, epilepsy, multiple sclerosis, schizophrenia and depression.
Panel 4D Summary: Ag3371 Expression of this gene is low/undetectable (CTs > 35) across all of the samples on this panel.
B. NOV2a: NEUROPHILIN
Expression of gene NOV2a was assessed using the primer-probe set Ag3369, described in Table BA. Results of the RTQ-PCR runs are shown in Tables BB, BC and BD. Table BA. Probe Name Ag3369
Table BD. Panel 4D
CNS_neurodegeneration_vl.0 Summary: Ag3369 This panel confirms the expression of the NOV2a gene at moderate levels in the brains of an independent group of individuals. However, no differential expression of this gene was detected between Alzheimer's diseased postmortem brains and those of non-demented controls in this experiment. Please see Panel 1.4 for a discussion of the potential utility of this gene in treatment of central nervous system disorders.
General_screening_panel_vl.4 Summary: Ag3369 Expression of the NOV2a gene is highest in the cerebellum (CT=26.2). Therefore, expression of this gene can be used to distinguish this sample from the others on the panel. In addition, this gene is expressed at moderate levels in hippocampus, thalamus, substantia nigra, cerebral cortex and spinal cord. The NOV2a gene encodes a protein with homology to rat neurexophilin 3. Neurexophilins are members of a family of neuropeptide-like glycoproteins that bind to alpha-Neurexins,
receptor-like proteins expressed on the neuronal cell surface (ref. 1). Therefore, this gene may play a role in central nervous system disorders such as Alzheimer's disease, Parkinson's disease, epilepsy, multiple sclerosis, schizophrenia and depression.
Among tissues with metabolic or endocrine function, this gene is expressed at moderate levels in pancreas, adipose, pituitary gland, heart, and the gastrointestinal tract and at low levels in adrenal gland, thyroid, and skeletal muscle. Therefore, therapeutic modulation of the activity of this gene may prove useful in the treatment of endocrine/metabolically related diseases, such as obesity and diabetes. Expression of this gene is also significantly higher in adult heart (CT = 30) when compared to fetal heart (CT = 33.3), suggesting that it can be used to distinguish adult and fetal sources of this tissue.
Expression of this gene appears to be primarily associated with normal tissues rather than cancer cell lines. NOV2a gene expression appears to be down-regulated in CNS, colon, gastric, and renal cancer cell lines when compared to the corresponding normal tissues. Thus, expression of this gene may be useful as a marker for these types of cancers. Furthermore, application of the NOV2a gene product as a protein therapeutic may be of benefit in the treatment of CNS, colon, gastric, and renal cancer (Missler and Sudhof 1998)).
Panel 4D Summary: Ag3369 Highest expression of the NOV2a gene is seen in gamma interferon treated HUVECs (CT=31.6). Therefore, regulation of the transcript expression in HUVECs suggests that the protein encoded by this transcript may contribute to the inflammatory changes due to gamma interferon. Therefore, therapies designed with the protein encoded by this transcript may reduce or eliminate the symptoms in patients with autoimmune and inflammatory diseases in which endothelial cells and astrocytes are involved, such as lupus erythematosus, asthma, emphysema, Crohn's disease, ulcerative colitis, multiple sclerosis, rheumatoid arthritis, osteoarthritis, and psoriasis. Significant levels of expression are also seen in normal colon and lung, suggesting that therapeutic modulation of the activity of this protein may be useful in the treatment of inflammatory bowel and lung diseases.
C. NOV3a: PROTEASE INHIBITOR 9 Expression of gene NOV3a was assessed using the primer-probe set Ag3368, described in Table CA.
Table CA. Probe Name Ag3368
CNS_neurodegeneration_vl.O Summary: Ag3368 Expression of this gene is low/undetectable (CTs > 35) across all of the samples on this panel.
General_screening_panel_vl.4 Summary: Ag3368 Expression of this gene is low/undetectable (CTs > 35) across all of the samples on this panel. Panel 4D Summary: Ag3368 Expression of this gene is low/undetectable (CTs > 35) across all of the samples on this panel.
D. NOVόa: Growth Suppressor/Leprecan
Expression of gene NOVόa was assessed using the primer-probe set Ag3354, described in Table DA. Results of the RTQ-PCR runs are shown in Tables DB, DC and DD. Table DA. Probe Name Ag3354
Primers) Sequences Length Start Position
Forward|5 ' -gcagcacacaccttctttgtag-3 ' (SEQ ID Nθ : 206 ) 22 561
Probe JTET- 5 ' -caaaccccatgcacctgcagatg-3 ' -TAMRA (SEQ ID Nθ : 207 ) 23 583
Reverse|5 ' -ccgacattcgtctgtacttagc-3 ' (SEQ ID NO : 208 ) 22 618
Table DB. CNS neurodegeneration vl.O
Table DC. Panel 2.2
Table DP. Panel 4D
CNS_neurodegeneration_vl.O Summary: Ag3354 This panel confirms the expression of the NOVόa gene at low to moderate levels in the brains of several individuals. However, no differential expression of this gene was detected between Alzheimer's diseased postmortem brains and those of non-demented controls in this experiment.
General_screening_panel_vl.4 Summary: Ag3354 Results from one experiment are not included. The amp plot indicates that there were experimental difficulties with this run.
Panel 2.2 Summary: Ag3354 Highest expression of the NOVόa gene is seen in normal ovary (CT=32.3). Thus, expression of this gene could be used to differentiate between this sample and other samples on this panel and as a marker of ovarian tissue. The NOVόa gene encodes a protein with homology to the human Grosl and rat leprecan genes. Stable transfection of the mouse Grosl cDNA into NIH3T3 cells resulted in their slow growth and reduced colony-forming efficiency, suggesting that this protein can act as a growth suppressor. Therefore, use of the NOVόa gene product as a protein therapeutic may be of benefit in the treatment of cancer (Kaul et al., Oncogene 19(32):3576-83, 2000).
Panel 4D Summary: Ag3354 Expression of the NOVόa gene is highest in dermal and lung fibroblasts, regardless of treatment (CTs = 28-30). This gene is also expressed at moderate levels in endothelial cells. Thus, the transcript or the protein it encodes could be used to identify endothelium or fibroblasts. Endothelial cells are known to play important roles in inflammatory responses by altering the expression of surface proteins that are involved in activation and recruitment of effector inflammatory cells. The expression of this gene in dermal fibroblasts and dermal microvascular endothelial cells suggests that this protein product may be involved in inflammatory responses to skin disorders, including psoriasis. Expression in lung fibroblasts and lung microvascular endothelial cells suggests that the protein encoded by this transcript may also be involved in lung disorders including asthma, allergies, chronic obstructive pulmonary disease, and emphysema. Therefore, therapeutic modulation of the protein encoded by this gene may lead to amelioration of symptoms associated with psoriasis, asthma, allergies, chronic obstructive pulmonary disease, and emphysema.
E. NOVlOa: olfactomedin-like
Expression of gene NOVlOa was assessed using the primer-probe set Ag3384, described in Table EA. Results of the RTQ-PCR runs are shown in Tables EB, EC, ED, EE and EF. Table EA. Probe Name Ag3384
Table EB. CNS_neurodegeneration_vl.O
Temporal Ctx Parietal Ctx
Table EC. General_screening_panel_vl.4
Table ED. Panel 2.2
Table EE. Panel 4D
CNS_neurodegeneration_vl.0 Summary: Ag3384 The NOVlOa gene, an olfactomedin homolog, is slighlty upregulated in the temporal cortex of Alzheimer's disease patients. Members of the olfactomedin family have been implicated in regulating physical properties of the extracellular environment. Therefore, therapeutic inhibition of this protein may be of use in reversing the dementia/memory loss associated with Alzheimer's disease and neuronal death (Kulkarni et al., Genet Res 76(l):41-50, 2000).
General_screening_panel_vl.4 Summary: Ag3384 Expression of the NOVlOa gene is highest in an ovarian cancer cell line (CT=30.4). Significant expression of this gene is also seen in a gastric cancer cell line. Thus, expression of this gene could be used to differentiate between these samples and other samples on this panel and as a marker to detect the presence of ovarian and gastric cancer. Furthermore, therapeutic modulation of the expression or function of this gene may be effective in the treatment of ovarian and gastric cancer.
Among tissues with metabolic function, this gene is expressed at moderate to low levels in pituitary, adipose, adrenal gland, pancreas, thyroid, fetal skeletal muscle, fetal liver and adult/fetal heart. This widespread expression among these tissues suggests that this gene product may play a role in normal neuroendocrine and metabolic and that disregulated expression of this gene may contribute to neuroendocrine disorders or metabolic diseases, such as obesity and diabetes. In addition, this gene has low expression in some samples derived from the central nervous system, including the substantia nigra, fetal brain, and spinal cord. Please see CNS_neurodegeneration_vl .0 for further discussion of the utility of this gene in the central nervous system.
Panel 2.2 Summary: Ag3384 In agreement with Panel 4D below, this gene is expressed at significant levels in the kidney, with highest expression in the kidney margin sample OD04348 (CT = 32.6). There is also low expression in samples from stomach, uterus, lung, and ovary. Thus, expression of this gene could be used to differentiate between the kidney and other samples on this panel and as a marker for kidney tissue.
Panel 4D Summary: Ag3384 Expression of the NOVlOa gene is highest in kidney (CT=32.5) and thymus (CT=32.7). Therefore, protein, antibody or small molecule therapies designed with the NOVlOa protein could be used to modulate kidney or T cell development
and be important in the treatment of inflammatory or autoimmune diseases that affect the kidney and thymus, including lupus, glomerulonephritis, organ transplant, AIDS treatment or post chemotherapy immune reconstitiution.
Panel CNS_1 Summary: Ag3384 Expression of this gene is low/undetectable (CTs > 35) across all of the samples on this panel.
F. NOV12a and NOV13a: NEURAL CELL ADHESION PROTEIN BIG-2 PRECURSOR
Expression of genes NOVl 2a and NOVl 3a was assessed using the primer-probe sets Ag3228, Ag3261, Ag5267 and Ag5268, described in Tables FA, FB, FC and FD. Results of the RTQ-PCR runs are shown in Tables FE, FF, FG, FH, FI, FJ and FK.
Table FA. Probe Name Ag3228
Table FB. Probe Name Ag3261
Table FC. Probe Name Aε5267
Primers Sequences JLength Start Position
Forward 5' -gcggtcccggaaca-3' (SEQ ID NO: 218) robe TET-5 ' -cacgcctggtctctcagtggca-3 ' -TAMRA (SEQ ID NO:219) 1j 214 2810
P 2 2841
Reverse 5' -gcctgctgccacacatt-3 ' (SEQ ID NO:220) j 17 2871
Table FD. Probe Name Ag5268
Table FE. Al comprehensive panel vl.O
Tissue Name 1 Rel. Exp.(%) [ Rel. Exp.(%) [ Rel. Exp.(%) [ Rel. Exp.(%) | Rel. Exp.(%)
Table FF. CNS_neurodegeneration_vl .0
Control (Path) 4
0.0 37.1 44.1 38.7 Parietal Ctx
Table FG. General_screening_panel_vl.4
Table FH. General_screening_panel_vl.5
Table FI. Panel 2.2
Table FJ. Panel 4. ID
Table FK. Panel 4D
AI_comprehensive panel_vl.0 Summary: Ag5267/Ag5268 Results from two experiments using different probe/primer sets show expression of this transcript in several normal and disease tissues; these results disagree with the data generated with the other two primer/probe sets. This observation suggests that the AG5267 and Ag5268 primer/probe sets may detect an isoform of the transcript with a wider expression pattern than that detected by Ag3228 and Ag3261. Please see Panel 4D for a discussion of the potential role of this protein in inflammation and its therapeutic utility. Ag3261 Significant expression of the NOV12a gene is limited to one psoriasis sample. Ag3228 Expression of this gene is low/undetectable (CTs > 35) across all of the samples on this panel.
CNS_neurodegeneration_vl.0 Summary: Ag3261/Ag5267/Ag5268 Results from three experiments using this panel confirm the expression of this gene at low levels in the
brains of an independent group of individuals. However, no differential expression of this gene was detected between Alzheimer's diseased postmortem brains and those of non- demented controls in this experiment. Please see Panel 1.4 for a discussion of the potential utility of this gene in treatment of central nervous system disorders. Results from one experiment with the Ag3228 probe/primer set show low/undetectable levels (CTs>35) of expression in all the samples on this panel.
General_screening_panel_vl.4 Summary: Ag3228 Highest expression of the NOV12a gene is seen in the cerebellum (CT = 30.4). Thus, expression of this gene can be used as a marker for cerebellum. Furthermore, this highly brain-preferential expression suggests a specific role for this gene product in the brain. The NOVl 2a gene encodes a protein with homology to neural cell adhesion molecules (NCAM). NCAM related proteins, such as Nr- CAM, play a critical role in neurite extension (ref. 1). Therefore, the introduction of ligands specific for this gene product, such as contactin, in directed brain regions may have utility in fostering focal neurite outgrowth and, thus may have utility in therapeutically countering neurite degeneration in neurodegenerative diseases such as Alzheimer's disease, ataxias, and Parkinson's disease.
Results from a second experiment with the Ag3261 probe and primer set are not included. The amp plot indicates that there were experimental difficulties with this run (Sakurai et al., J Cell Biol 154(6): 1259-73, 2001). General_screening_panel_vl.5 Summary: Ag5268 Significant expression of the
NOVl 2a gene is seen in the brain. Please see Panel 1.4 for discussion of utility of this gene in the brain. Significant expression is also seen in brain cancer cell lines. Thus, expression of this gene could be used to differentiate between brain derived samples and other samples on this panel. Among tissues with metabolic function, this gene is expressed at moderate to low levels in pituitary, adipose, adrenal gland, pancreas, thyroid, and adult and fetal skeletal muscle, heart, and liver. This widespread expression among these tissues suggests that this gene product may play a role in normal neuroendocrine and metabolic and that disregulated expression of this gene may contribute to neuroendocrine disorders or metabolic diseases, such as obesity and diabetes.
Panel 2.2 Summary: Ag3228 Significant expression of this gene is seen exclusively in an ovarian cancer sample (CT = 33.8). Therefore, expression of this gene may be used to distinguish ovarian cancers from the other samples on this panel. Furthermore, therapeutic
modulation of the activity of the protein encoded by this gene may be beneficial in the treatment of ovarian cancer.
Panel 4.1D Summary: Ag5267/Ag5268 Results from two experiments using different probe/primer sets are in good agreement with each other and show a similar overall pattern of expression as in Panel 4 but at much higher levels. This may result from differences in the two panels or from differences in the probe/primer sets used. The NOVl 2a transcript is expressed in LAK cells and treatment of the LAK cells with PMA and ionomycin upregulates the expression of this transcript. This transcript is also induced in activated EOL cells and in fibroblasts. The NOVl 2a gene encodes a putative NCAM, a type of cell surface protein often involved in cellular interaction, adhesion and signaling. Therefore, therapeutics designed with the protein encoded for this transcript could be important in the treatment of diseases such as asthma, emphysema, psoriasis and arthritis.
Panel 4D Summary: Ag3228/Ag3261 Results from two experiments using identical probe/primer sets are in good agreement. The NOVl 2a transcript is expressed in LAK cells and treatment of the LAK cells with PMA and ionomycin upregulates the expression of this transcript. The NOVl 2a gene encodes a putative NCAM, a type of cell surface protein often involved in cellular interaction, adhesion and signaling. Therefore, therapeutics designed with the protein encoded for this transcript could be important in the treatment of diseases such as asthma, emphysema, psoriasis and arthritis.
G. NOV13b and NOV13c: protein containing MAM and Ig domains
Expression of genes NOVl 3b and NOVl 3c was assessed using the primer-probe set
Ag5267, described in Table GA. Results of the RTQ-PCR runs are shown in Tables GB, GC,
GD and GE. Table GA. Probe Name Ag5267
Table GB. AI_comprehensive panel vl.O
Table GC. CNS_neurodegeneration_vl.O
Table GD. General_screening_panel_vl.5
Table GE. Panel 4. ID
AI_comprehensive panel_vl.0 Summary: Ag5267 This panel confirmes the expression of the NOVl 3b gene in several normal and disease tissues with relevance to human immune function. Please see Panel 4. ID for a discussion of the potential role of this protein in inflammation and its therapeutic utility.
CNS_neurodegeneration_vl.0 Summary: Ag5267 Results from this experiment show the expression of this gene at low levels in the brains of several individuals. However, no differential expression of this gene was detected between Alzheimer's diseased postmortem brains and those of non-demented controls in this experiment.
The NOVl 3b gene encodes a protein with homology to neural cell adhesion molecules (NCAM). NCAM related proteins, such as Nr-CAM, play a critical role in neurite extension (ref. 1). Therefore, the introduction of ligands specific for this gene product, such as contactin, in directed brain regions may have utility in fostering focal neurite outgrowth and, thus may have utility in therapeutically countering neurite degeneration in neurodegenerative diseases such as Alzheimer's disease, ataxias, and Parkinson's disease (Sakurai et al., 2001).
General_screeningj)anel_ l.5 Summary: Ag5267 Results from one experiment are not included. The amp plot indicates that there were experimental difficulties with this run.
Panel 4.1D Summary: Ag5267 The NOVl 3b transcript is expressed in LAK cells and treatment of the LAK cells with PMA and ionomycin upregulates the expression of this transcript. This transcript is also induced in activated EOL cells and in fibroblasts. The NOVl 3b gene encodes a putative NCAM, a type of cell surface protein often involved in cellular interaction, adhesion and signaling. Therefore, therapeutics designed with the protein encoded for this transcript could be important in the treatment of diseases such as asthma, emphysema, psoriasis and arthritis.
H. NOVl 8a: Adipophilin
Expression of gene NOVl 8a was assessed using the primer-probe set Ag5737, described in Table HA. Results of the RTQ-PCR runs are shown in Tables HB and HC. Table HA. Probe Name Ag5737
Table HB. General_screening_panel_vl.5
Table HC. Panel 5 Islet
General_screening_panel_vl.5 Summary: Ag5737 Expression of the NOVlδa gene is highest in adult skeletal muscle (CT = 28.2) and is much lower in fetal skeletal muscle (CT
= 34.4). Thus, expression of this gene may be used to distinguish adult and fetal skeletal muscle. Among other tissues with metabolic or endocrine function, this gene is expressed at low to moderate levels in adipose, liver, heart, pancreas, adrenal gland, pituitary gland and thyroid. The NOVl 8a gene encodes a protein with homology to adipophilin. Adipophilin is believed to be involved in fatty acid uptake in adipocytes and is associated with lipid globules in many types of animal cells (ref. 1-2). This gene product may be a critical player in lipid homeostasis; therefore, therapeutic modulation of the activity of the NOV 18a gene or its protein product may be a treatment for metabolic disease, including obesity and diabetes.
In addition, this gene is expressed at low levels in all regions of the central nervous system examined, including amygdala, hippocampus, substantia nigra, thalamus, cerebellum, cerebral cortex, and spinal cord. Therefore, this gene may play a role in central nervous system disorders such as Alzheimer's disease, Parkinson's disease, epilepsy, multiple sclerosis, schizophrenia and depression.
Finally, expression of this gene appears to be primarily associated with normal tissues as compared to cancer cell lines. NOVl 8a gene expression appears to be down regulated in
CNS and renal cancer cell lines. Therefore, use of the NOVl 8a gene product as a protein therapeutic may be of benefit in the treatment of CNS and renal cancers (Londos et al., Semin
Cell Dev Biol. 10(l):51-8, 1999; Serrero et al., Biochim Biophys Acta. 1488(3):245-54, 2000).
Panel 5 Islet Summary: Ag5737 The NOV 18a gene is moderately expressed in the pancreatic islets of Langerhans (CT = 32.4), as well as in a sample of skeletal muscle. The
NOVl 8a gene encodes a protein with homology to adipophilin, which is believed to be involved in fatty acid uptake in adipocytes and is associated with lipid globules in many types of animal cells. Lipid homeostasis is critically involved in insulin secretion by islet beta cells. Therapeutic modulation of this gene product may be a treatment for the beta cell secretory defect in Type 2 diabetes (Unger and Orci, FASEB J. 15(2):312-21, 2001; Unger and Zhou, Diabetes. 50 Suppl 1:S118-21, 2001).
I. NOV19a: ##
Expression of gene NOV 19a was assessed using the primer-probe set Ag3549, described in Table IA.
Table IA. Probe Name Ag3549
is low/undetectable in all samples on this panel (CTs>35).
General_screening_panel_vl.4 Summary: Ag3549 Expression of the NOV19a gene is low/undetectable in all samples on this panel (CTs>35).
Panel 4D Summary: Ag3549 Expression of the NOV 19a gene is low/undetectable in all samples on this panel (CTs>35).
J. NOV20a: ##
Expression of gene NOV20a was assessed using the primer-probe set Ag3866, described in Table JA.
Table JA. Probe Name Ag3866
CNS_neurodegeneration_vl.0 Summary: Ag3866 Expression of the CG59846-01 gene is low/undetectable in all samples on this panel (CTs>35). The amp plot indicates that there is a high probability of a probe failure.
General screening panel vl.4 Summary: Ag3866 Expression of the CG59846-01 gene is low/undetectable in all samples on this panel (CTs>35). The amp plot indicates that there is a high probability of a probe failure.
Panel 2.2 Summary: Ag3866 Expression of the CG59846-01 gene is low/undetectable in all samples on this panel (CTs>35). The amp plot indicates that there is a high probability of a probe failure.
Panel 4.1D Summary: Ag3866 Expression of the CG59846-01 gene is low/undetectable in all samples on this panel (CTs>35). The amp plot indicates that there is a high probability of a probe failure.
K. NOV21a: Neurotransmission-associated protein
Expression of gene NOV21a was assessed using the primer-probe set Ag675, described in Table KA.
Table KA. Probe Name Ag675
Panel 1.1 Summary: Ag675 Expression of the NOV21a gene is low/undetectable in all samples on this panel (CTs>35).
L. NOV21n: Neurotransmission-associated Protein (NTAP)
Expression of gene NOV21n was assessed using the primer-probe set Ag675, described in Table LA.
Table LA. Probe Name Ag675
all samples on this panel (CTs>35).
M. NOV22a: drebrin
Expression of gene NOV22a was assessed using the primer-probe set Ag3946, described in Table MA.
Table MA. Probe Name Ag3946
'anel CNS_1 Summary: Ag3946 Expression of the NOV22a gene is low/undetectable in all samples on this panel (CTs>35).
N. NOV23a: UNC5H2 homolog
Expression of gene NOV23a was assessed using the primer-probe set Ag3546, described in Table NA. Results of the RTQ-PCR runs are shown in Tables NB, NC, ND, NE and NF.
Table NA. Probe Name Ag3546
Table NB. CNS neurodegeneration vl.O
Table NC. General_screening_panel_vl.4
Table ND. Panel 2.2
Table NE. Panel 4D
Table NF. Panel CNS 1
CNS_neurodegeneration_vl.0 Summary: Ag3546 This panel confirms the expression of the NOV23a gene at significant levels in the brains of an independent group of individuals. However, no differential expression of this gene was detected between Alzheimer's diseased postmortem brains and those of non-demented controls in this experiment. Please see Panel 1.4 for a discussion of the potential utility of this gene in treatment of central nervous system disorders.
General_screening_panel_vl.4 Summary: Ag3546 Highest expression of the NOV23a gene is detected in fetal brain (CT=25.2). In addition, this gene is expressed at high levels in all regions of the central nervous system examined, including amygdala, hippocampus, substantia nigra, thalamus, cerebellum, cerebral cortex, and spinal cord (CTs=26-29). Therefore, this gene may play a role in central nervous system disorders such as Alzheimer's disease, Parkinson's disease, epilepsy, multiple sclerosis, schizophrenia and depression.
The NOV23a gene encodes a homologue of rat UNC5H2 gene. Members of UNC5H are membrane receptors for netrin-1 and crucial for axon guidance and neuronal migration. Netrins are a family of chemotropic factors that guide axon outgrowth during development. In situ hybridization has revealed that the netrin 1 receptors, DCCl and UNC5H2 mRNAs are expressed by normal adult retinal ganglion cells (RGCs). In addition, expression of DCCl and UNC5H2 mRNA is down regulated in RGCs that has undergone axotomy. Thus, netrin-1, DCC, and UNC5H2 may contribute to regulating the regenerative capacity of adult RGCs (Ref.l). Thus, high expression of the NOV23a gene in both fetal and adult brain, suggests this gene product may also play a role in the regenerative capacity of adult RGCs. Recently, it was shown that netrin-1 receptors UNC5H (UNC5H1 , UNC5H2,
UNC5H3) also act as dependence receptors. They induce apoptosis, but this effect is blocked in the presence of netrin-1. Thus, during development of the nervous system, the presence of netrin-1 is crucial to maintain survival of UNC5H- and DCC-expressing neurons, especially in the ventricular zone of the brainstem (Ref. 2). Therefore, the NOV23a gene product along with Netrin 1 may be important in the survival of the neurons.
Among tissues with metabolic or endocrine function, this gene is expressed at high to moderate levels in pancreas, adipose, adrenal gland, thyroid, pituitary gland, skeletal muscle, heart, liver and the gastrointestinal tract. Therefore, therapeutic modulation of the activity of this gene may prove useful in the treatment of endocrine/metabolically related diseases, such as obesity and diabetes.
Significant expression is also detected in fetal liver and fetal lung. Interestingly, this gene is expressed at much higher levels in fetal (CTs = 32-34.9) when compared to adult liver and lung (CTs = 40). This observation suggests that expression of this gene can be used to distinguish fetal from adult liver or lung, respectively (Ellezam et al., Exp Neurol 168(1): 105- 15, 2001; Llambi et al., EMBO J 20(11):2715-22, 2001).
Panel 2.2 Summary: Ag3546 Expression of the NOV23a gene on this panel is seen primarily in kidney derived tissue (CTs=32-33). Thus, expression of this gene could be used to differentiate between kidney derived samples and other samples on this panel.
Panel 4D Summary: Ag3546 Expression of the NOV23a gene is highest in normal colon (CT=28.3). Therefore, expression of this gene may be used to distinguish colon from the other tissues on this panel. Furthermore, expression of this gene is decreased in colon samples from patients with IBD colitis and Crohn's disease relative to normal colon. Therefore, therapeutic modulation of the activity of the protein encoded by this gene may be useful in the treatment of inflammatory bowel disease.
Panel CNS_1 Summary: Ag3546 This panel confirms the expression of the NOV23a gene at significant levels in the brains of an independent group of individuals. Please see Panel 1.4 for a discussion of the potential utility of this gene in treatment of central nervous system disorders.
O. NOV24a: Trypsin inhibitor
Expression of gene NOV24a was assessed using the primer-probe set Ag3485, described in Table OA. Results of the RTQ-PCR runs are shown in Tables OB and OC. Table OA. Probe Name Ag3485
Table OB. General_screening_panel_vl.4
Table PC. Panel 4D
CNS_neurodegeneration_vl.0 Summary: Ag3485 Expression of the NOV24a gene is low/undetectable in all samples on this panel (CTs>35).
General screening panel_vl.4 Summary: Ag3485 Expression of the NOV24a gene is restricted to two samples derived from lung cancer cell lines (CTs=30-34). Thus, expression of this gene could be used to differentiate between these sample and other samples on this panel and as a marker to detect the presence of lung cancer. Furthermore, therapeutic modulation of the expression or function of this gene may be effective in the treatment of lung cancer.
Panel 4D Summary: Ag3485 Expression of the NOV24a gene is restricted to normal lung tissue. This specific expression in lung derived tissue in both this panel and panel 1.4 suggests a role for this gene in the normal homeostasis of this tissue. Therapeutic modulation of the expression or function of this gene may be useful in maintaining or restoring normal function to the lung during inflammation.
P. NOV26a and NOV26b: Ovostatin
Expression of gene NOV26a and variant NOV26b was assessed using the primer-probe set Agl282, described in Table PA. Results of the RTQ-PCR runs are shown in Tables PB, PC, PD, PE and PF.
Table PA. Probe Name Agl282
Table PB. General_screening__panel_vl.4
Table PC. Panel 1.3D
Table PP. Panel 2D
Table PE. Panel 4. ID
Table PF. Panel 4D
General_screening_panel_vl.4 Summary: Agl282 Highest expression of the NOV26a gene is seen in a melanoma cell line. In addition, significantly higher levels of expression are seen in a breast cancer cell line. Thus, expression of this gene could be used to differentiate between these samples and other samples on this panel and as a marker to detect the presence of melanoma and breast cancer. Furthermore, therapeutic modulation of the expression or function of this gene may be effective in the treatment of melanoma and breast cancers.
Among tissues with metabolic function, this gene is expressed at moderate levels in pituitary, adipose, adrenal gland, pancreas, thyroid, and adult and fetal skeletal muscle, heart, and liver. This widespread expression among these tissues suggests that this gene product may play a role in normal neuroendocrine and metabolic and that disregulated expression of this gene may contribute to neuroendocrine disorders or metabolic diseases, such as obesity and diabetes. In addition, this gene is expressed at much higher levels in fetal lung, liver and skeletal muscle tissue (CTs=27-29) when compared to expression in the adult counterpart (CTs=30- 32). Thus, expression of this gene may be used to differentiate between the fetal and adult source of these tissue.
This molecule is a novel ovostatin that is also expressed at moderate in the gegions of the CNS examined and may therefore be a target for the treatment of neurologic diseases.
Panel 1.3D Summary: Agl282 Expression of the NOV26a gene is consistent with expression in Panel 1.4. The expression of this gene appears to be highest in a sample derived from a breast cancer cell line (MDA-N) (CT=26.9). In addition, there appears to be substantial expression in other samples derived from lung cancer cell lines and melanoma cell lines. Thus, the expression of this gene could be used to distinguish MDA-N cells from other samples in the panel. This gene encodes a novel ovostatin. Ovostatins are protease inhibitors that have been shown to support the growth of tumor cells in the absence of serum. They have also been shown to mediate accelerated fibroblast growth, collagen deposition and capillary formation. These activities suggest a role for this ovostatin homolog in tumor progression and proliferation. Thus, therapeutic targeting of this gene product may block the uncontrolled growth of cancer cells related to the action of the NOV26a gene. This could occur in any possible combination of cell growth, collagen deposition or capillary formation, especially in those cancer types like lung, breast and melanoma tumors where the gene is overexpressed in the tumor compared to the normal adjacent tissue. Please see Panel 1.4 for additional utility of this gene.
Panel 2D Summary: Agl282 Highest expression of the NOV26a gene is seen in a sample derived from an ocular melanoma metastasis to the liver (CT=27). In addition, there appears to be substantial expression in other samples derived from lung cancers. Thus, expression of this gene could be used to distinguish liver cancer cells from other samples in the panel. Moreover, therapeutic modulation of this gene, through the use of small molecule drugs, protein therapeutics or antibodies could be of benefit in the treatment of liver or lung cancer. Panel 3D Summary: Agl282 Results from one experiment with the NOV26a gene are not included. The amp plot indicates that there were experimental difficulties with this run. Panels 4 and 4.1D Summary: Agl282 The NOV26a gene, an ovostatin-like protein, is related to ovostatin, a known inhibitor of proteinases of all four mechanistic classes, (serine proteinases, cysteine proteinases, aspartyl proteinases, and metalloproteinases) (see references). Highest expression of the gene is seen in the thymus and kidney (CTs=28-29). In addition, moderate to low levels of expression are seen in most of the samples on this panel.Thus, the NOV26a protein product may be useful as a therapeutic protein for the reduction of various proteolytic activities involved in inflammatory and autoimmune diseases such as, but not limited to, Crohn's disease, ulcerative colitis, multiple sclerosis, chronic
obstructive pulmonary disease, asthma, emphysema, rheumatoid arthritis, lupus erythematosus, or psoriasis, wound healing, and infection (Saxena and Tayyab, Cell Mol Life Sci 53(l):13-23, 1997; Ofuji et al., Periodontal Clin lnvestig 14(2):13-22, 1992)
Q. NOV28a: Laminin-type EGF like protein
Expression of gene NOV28a was assessed using the primer-probe set Ag399, described in Table QA. Results of the RTQ-PCR runs are shown in Tables QB, QC, QD, QE and QF.
Table OA. Probe Name Ag399
Primers) Sequences ΪLength Start Posi tion
Forward! 5 ' -gcggccatgactgggtact - 3 ' (SEQ ID NO : 254 ) ' -agcacacggtcactgcgctctga- 1 » : 1217
Probe |TET- 5 3 ' -TAMRA (SEQ ID NO 255) | 23 1241 everse|5 ' -gcgattatctgcccttgatga-3 ' (SEQ ID NO : 256 ) I 21 1272
Table QB. CNS neurodegeneration vl .0
Table PC. Panel 1.1
Table OP. Panel 1.2
Table QE. Panel 1.3D
Table OF. Panel 4D
CNS_neurodegeneration_vl.0 Summary: Ag399 This panel confirms the expression of the NOV28a gene at low levels in the brains of an independent group of individuals. However, no differential expression of this gene was detected between Alzheimer's diseased postmortem brains and those of non-demented controls in this experiment. Please see Panel 1.4 for a discussion of the potential utility of this gene in treatment of central nervous system disorders.
Panel 1.1 Summary: Ag399 Highest expression of the NOV28a gene is seen in a lung cancer (non-s.cell) cell line HOP-62 (CT=21). Therefore, expression of this gene can be used in distinguishing this sample from other samples in the panel. The NOV28a gene encodes a laminin-type EGF-like protein, which belongs to the laminin family. Laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth
migration, and differentiation ( Please see Ref. 1 in panel 1.4). Therefore, the moderate to high expression of this gene in samples throughout this panel suggests the possibility of a wider role of this gene product in cell adhesion, growth migration, and differentiation.
Among tissues with metabolic or endocrine function, this gene is expressed at high to moderate levels in pancreas, adipose, adrenal gland, thyroid, pituitary gland, skeletal muscle, heart, liver and the gastrointestinal tract. Therefore, therapeutic modulation of the activity of this gene may prove useful in the treatment of endocrine/metabolically related diseases, such as obesity and diabetes.
In addition, this gene is expressed at significant levels in all regions of the central nervous system examined, including amygdala, hippocampus, substantia nigra, thalamus, cerebellum, cerebral cortex, and spinal cord. Therefore, this gene may play a role in central nervous system disorders such as Alzheimer's disease, Parkinson's disease, epilepsy, multiple sclerosis, schizophrenia and depression (Beck et al., FASEB J. 4: 148-160, 1990).
Panel 1.2 Summary: Ag399 Highest expression of the NOV28a gene is seen in the pituitary gland (CT=22). Therefore, expression of this gene can be used in distinguishing this sample from other samples in the panel. In addition, moderate to high expression of this gene is seen samples throughout this panel suggesting the possibility of a wider role of this gene product in cell adhesion, growth migration, and differentiation.
Among tissues with metabolic or endocrine function, this gene is expressed at high to moderate levels in pancreas, adipose, adrenal gland, thyroid, pituitary gland, skeletal muscle, heart, liver and the gastrointestinal tract. Therefore, therapeutic modulation of the activity of this gene may prove useful in the treatment of endocrine/metabolically related diseases, such as obesity and diabetes.
In addition, this gene is expressed at significant levels in all regions of the central nervous system examined, including amygdala, hippocampus, substantia nigra, thalamus, cerebellum, cerebral cortex, and spinal cord. Therefore, this gene may play a role in central nervous system disorders such as Alzheimer's disease, Parkinson's disease, epilepsy, multiple sclerosis, schizophrenia and depression.
Panel 1.3D Summary: Ag399 Highest expression of the NOV28a gene is detected in brain (hippocampus) sample (CT=29). High expression of this gene is also seen throughout the
CNS, including in amygdala, substantia nigra, thalamus, cerebellum, cerebral cortex, spinal cord and glioma cells. Therefore, this gene may play a role in central nervous system disorders such as Alzheimer's disease, Parkinson's disease, epilepsy, multiple sclerosis, schizophrenia and depression. In addition, expression of this gene can be used to distinguish the brain
derived tissue samples from other samples used in this panel. The NOV28a gene encodes a laminin-type EGF-like protein, which belongs to the laminin family. Laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation (Beck et al., 1990). Normal brain cells can produce laminin, fibronectin and collagen type IV when confronted by invading glioma cells, laminin also stimulates cell migration of several human glioma cell lines in vitro (Tysnes et al., Invasion Metastasis 17(5):270-80, 1997).
Low levels of expression of NOV28a gene is also observed in almost all the samples used in this panel suggesting the possibility of a wider role of this gene product in cell adhesion, growth migration, and differentiation.
Among the tissue with metabolic function, this gene is expressed at low to moderate levels in a number of tissues, including adipose, adrenal gland, gastrointestinal tract, pancreas, skeletal muscle and thyroid. Therefore, therapeutic modulation of the activity of this gene may prove useful in the treatment of endocrine/metabolically related diseases, such as obesity and diabetes.
Panel 4D Summary: Ag399 NOV28a codes for laminin-type EGF-like protein, with highest expression in B lymphocytes activated with PWM (CT=30). In addition, this gene is expressed at high to moderate levels in a wide range of cell types of significance in the immune response in health and disease. These cells include members of the T-cell, B-cell, endothelial cell, macrophage/monocyte, and peripheral blood mononuclear cell family, as well as epithelial and fibroblast cell types from lung and skin, and normal tissues represented by colon, lung, thymus and kidney. This ubiquitous pattern of expression suggests that this gene product may be involved in homeostatic processes for these and other cell types and tissues. This pattern is in agreement with the expression profile in General_screening_panel_vl .5 and also suggests a role for the gene product in cell survival and proliferation. Therefore, modulation of the gene product with a functional therapeutic may lead to the alteration of functions associated with these cell types and lead to improvement of the symptoms of patients suffering from autoimmune and inflammatory diseases such as asthma, allergies, inflammatory bowel disease, lupus erythematosus, psoriasis, rheumatoid arthritis, and osteoarthritis.
R. NOV29a: polycystic kidney disease 1 protein
Expression of gene NOV29a was assessed using the primer-probe set Ag3519, described in Table RA. Results of the RTQ-PCR runs are shown in Tables RB, RC and RD.
Table RA. Probe Name Ag3519
Table RB. CNS_neurodegeneration_vl.O
Table RC. General_screening_panel_vl.4
Table RD. Panel 4D
CNS_neurodegeneration_vl.0 Summary: Ag3519 This panel confirms the expression of the NOV29a gene at low levels in the brain in an independent group of individuals. However, no differential expression of this gene was detected between Alzheimer's diseased postmortem brains and those of non-demented controls in this experiment. Please see Panel 1.4 for a discussion of the potential utility of this gene in treatment of central nervous system disorders.
General_screening_panel_vl.4 Summary: Ag3519 Expression of NOV29a is highest in one of the breast cancer T47D cell line (CT=29). Therefore, expression of this gene may be used to distinguish this sample from the other samples on this panel. In addition, low to moderate expression of this gene is detected in large number of samples used in this panel. Therefore, this gene may be playing an important role in cellular function.
In addition, this gene is expressed at moderate levels (CTs=31-33) in all regions of the central nervous system examined, including amygdala, hippocampus, substantia nigra, thalamus, cerebellum, cerebral cortex, and spinal cord. Therefore, this gene may play a role in central nervous system disorders such as Alzheimer's disease, Parkinson's disease, epilepsy, multiple sclerosis, schizophrenia and depression.
Among tissues with metabolic or endocrine function, this gene is expressed at low to moderate levels in pancreas, adipose, adrenal gland, thyroid, pituitary gland, skeletal muscle, heart, liver and the gastrointestinal tract. Therefore, therapeutic modulation of the activity of this gene may prove useful in the treatment of endocrine/metabolically related diseases, such as obesity and diabetes.
Moderate expression of this gene is detected in Kidney sample (CT=31). This gene codes for protein similar to polycystic kidney disease (PKD) protein, which is thought to function as part of a multiprotein membrane-spanning complex involved in cell-cell or cell- matrix interactions. Mutations in either of 2 different PKD genes (PKD1 or PKD2) give rise to Autosomal dominant polycystic kidney disease (ADPKD). ADPKD is a major, inherited disorder that is characterized by the growth of large, fluid-filled cysts from the tubules and collecting ducts of affected kidneys, and by a number of extrarenal manifestations including liver and pancreatic cysts, hypertension, heart valve defects, and cerebral and aortic aneurysms (Ref. 1). Therefore, therapeutic modulation of this gene or its protein product may be beneficial in the treatment of ADPKD (Calvet and Grantham, Semin Nephrol 21 (2): 107-23, 2001).
Panel 4D Summary: Ag3519 Low to moderate expression of NOV29a gene is detected in large number of samples used in this panel. Interestingly, expression in LPS stimulated monocytes (CT=32) is higher than in resting monocytes (CT=36). treatment of resting monocytes (CT=36) with LPS stimulated the expression this gene (CT=32).Therefore, expression of this gene may be used to distinguish between these two samples. Highest expression of this gene is seen in TNFalpha + IL-lbeta treated HPAEC (CT=29.4). Based on expression in this panel, therapeutic modulation of this gene or its protein product may be beneficial in the treatment of general autoimmunity, rheumatoid disease, asthma, and B-cell disorders.
S. NOV30a: POLYCYSTIN 2
Expression of gene NOV30a was assessed using the primer-probe set Ag3522, described in Table SA.
Table SA. Probe Name Ag3522
CNS_neurodegeneration_vl.O Summary: Ag3522 Expression of NOV30a gene is low/undetectable (CTs > 35) across all of the samples on this panel.
General_screening_panel_vl.4 Summary: Ag3522 Expression of this gene is low/undetectable (CTs > 35) across all of the samples on this panel.
Panel 4.1D Summary: Ag3522 Results from one experiment with this gene are not included. The amp plot indicates that there were experimental difficulties with this run.
T. NOV31a: SLIT-like protein Expression of gene NOV31 a was assessed using the primer-probe sets Ag907 and
Agl925, described in Tables TA and TB. Results of the RTQ-PCR runs are shown in Tables TC, TD, TE and TF.
Table TA. Probe Name Ag907
Table TB. Probe Name Agl925
Table TC. CNS_neurodegeneration_vl.O
Table TD. Panel 1.2
Kidney (fetal) 0.0 17.3
Table TE. Panel 4D
Table TF. Panel CNS 1
CNS_neurodegeneration_vl.O Summary: Ag907 This panel confirms the expression of the NOV31a gene at significant levels in the brain in an independent group of individuals. However, no differential expression of this gene was detected between Alzheimer's diseased postmortem brains and those of non-demented controls in this experiment. Please see Panel 1.2 for a discussion of the potential utility of this gene in treatment of central nervous system disorders.
Panel 1.2 Summary: Ag907 Two independent experiments with same probe and primer sets produce results that are in excellent agreement, with high expression of the NOV31a gene, a Slit homolog, throughout the CNS, including in amygdala, substantia nigra, thalamus, cerebellum, cerebral cortex, and spinal cord. The Slits are a family of secreted guidance proteins that can repel neuronal migration and axon growth via interaction with their cellular roundabout receptors, making this an excellent candidate neuronal guidance protein for axons, dendrites and/or growth cones in general (Ref. 1-2). Therapeutic modulation of the levels of this protein, or possible signaling via this protein may be of utility in
enhancing/directing compensatory synaptogenesis and fiber growth in the CNS in response to neuronal death (stroke, head trauma), axon lesion (spinal cord injury), or neurodegeneration (Alzheimer's, Parkinson's, Huntington's, vascular dementia or any neurodegenerative disease). Therefore, this gene may play a role in central nervous system disorders such as Alzheimer's disease, Parkinson's disease, epilepsy, multiple sclerosis, schizophrenia and depression.
In addition, low to moderate expression of this gene is also detected in a melanoma, testis, prostate, prostate cancer, placenta, uterus, ovarian cancer, a breast cancer, mammary gland, lung cancer, adult and fetal lung, adult and fetal liver, lymph node, spleen, skeletal muscle, stomach, small intestine, a colon cancer and a renal cancer sample suggesting the possibility of a wider role in intercellular signaling.
Among tissues with metabolic or endocrine function, this gene is expressed at low to moderate levels in pancreas, adrenal gland, thyroid, pituitary gland, skeletal muscle, heart, liver and the gastrointestinal tract. Therefore, therapeutic modulation of the activity of this gene may prove useful in the treatment of endocrine/metabolically related diseases, such as obesity and diabetes (Battye et al., J. Neurosci. 21: 4290-4298, 2001; Itoh et al., Brain Res. Mol. Brain Res. 62: 175-186, 1998).
Panel 4D Summary: Ag907 Moderate to high expression of the NOV31a gene is seen in samples derived from colon, lung, astrocytes, coronary artery SMC, and lung microvascular EC cells. Highest expression of this gene is seen in untreated lung microvascular EC cells (CT=29.3). Thus, the expression of this gene could be used to distinguish these samples from the other samples in the panel. Furthermore, expression of this gene is decreased in colon samples from patients with IBD colitis and Crohn's disease (CT=40) relative to normal colon (CT=31.1). Therefore, therapeutic modulation of the activity of the SLIT-like protein encoded by this gene may be useful in the treatment of inflammatory bowel disease.
Expression of this gene is in TNFalpha + IL-lbeta treated astrocytes and to resting astrocytes (CT=29.53; 84.7%). suggests that therapeutic modulation of the activity of the SLIT-like protein encoded by this gene may also be useful in the treatment of CNS inflammatory disease. Panel CNS_1 Summary: Ag907 This panel confirms expression of the NOV3 la gene in the brain. Please see Panel 1.2 for a discussion of the potential utility of this gene in treatment of central nervous system disorders.
NOV32a: TYROSYLPROTEIN SULFOTRANSFERASE-2
Expression of gene NOV32a was assessed using the primer-probe set Ag3408, described in Table UA. Results of the RTQ-PCR runs are shown in Tables UB and UC. Table UA. Probe Name Ag3408
Table UB. General_screening_panel_vl.4
Table UC. Panel 4D
CNS_neurodegeneration_vl.0 Summary: Ag3408 Expression of this gene is low/undetectable (CTs > 34) across all of the samples on this panel.
General_screening_panel_vl.4 Summary: Ag3408 Highest expression of NOV32a is detected in a breast cancer cell line (CT=2). Therefore, expression of this gene may be used to distinguish this sample from other samples on this panel. In addition, moderate expression of this gene is also observed in an ovarian cancer cell line. Hence, therapeutic modulation of
the activity of this gene product may be beneficial in the treatment of breast and ovarian cancers.
This gene is expressed at low to moderate levels in a number of tissues with metabolic or endocrine function, including gastrointestinal tract, pancreas, and skeletal muscle. Therefore, therapeutic modulation of the activity of this gene may prove useful in the . treatment of endocrine/metabolically related diseases, such as obesity and diabetes.
Panel 4D Summary: Ag3408 Highest expression of the NOV32a gene is seen in IL- 4 treated NCI-H292 cells (CT=31). However, this gene is expressed at high to moderate levels in a wide range of cell types of significance in the immune response in health and disease. These cells include members of the T-cell, B-cell, endothelial cell, macrophage/monocyte, and peripheral blood mononuclear cell family, as well as epithelial and fibroblast cell types from lung and skin, and normal tissues represented by lung, thymus and kidney. This ubiquitous pattern of expression suggests that this gene product may be involved in homeostatic processes for these and other cell types and tissues. Interestingly, expression of this gene is stimulated in PWM/PHA-L treated PBMC cells, IL-2/1L-2+IFN gamma/IL-2+ IL-18 treated LAK cells and ionomycin treated Ramos (B- cell) cells. Therefore, small molecules that antagonize the function of this gene product may be useful as therapeutic drugs to reduce or eliminate the symptoms in patients with autoimmune and inflammatory diseases in which T and B cells play a part in the initiation or progression of the disease process, such as systemic lupus erythematosus, Crohn's disease, ulcerative colitis, multiple sclerosis, chronic obstructive pulmonary disease, asthma, emphysema, rheumatoid arthritis, or psoriasis.
V. NOV33a: SERINE PROTEASE INHIBITOR Expression of gene NOV33a was assessed using the primer-probe set Ag3436, described in Table VA. Results of the RTQ-PCR runs are shown in Table VB. Table VA. Probe Name Ag3436
Table VB. Panel 4D
CNS_neurodegeneration_vl.O Summary: Ag3436 Expression of NOV33a gene is low/undetectable (CTs > 35) across all of the samples on this panel.
General screening panel vl.4 Summary: Ag3436 Expression of NOV33a gene is low/undetectable (CTs > 35) across all of the samples on this panel.
Panel 4D Summary: Ag3436 Highest expression of the NOV33a gene is detected in a liver cirrhosis sample (CT=31.8). Thus, expression of this gene can be used to distinguish this sample from other samples in this panel. Furthermore, therapeutic modulation of the expression or function of this gene could reduce or inhibit fibrosis that occurs in liver cirrhosis. In addition, expression of this gene could also be used for the diagnosis of liver cirrhosis.
Furthermore, low but significant expression of this gene is detected in the colon (CT=33.1) . Expression of this gene is decreased in colon samples from patients with IBD colitis and Crohn's disease (CTs>35). Therefore, therapeutic modulation of the activity of the protein encoded by this gene may be useful in the treatment of inflammatory bowel disease. A related serine protease inhibitor, camostat mesilate, has been used to induce and maintain remission in two patients with ulcerative colitis, to whom salicylazosulfapyridine could not be administered due to previous side effects (Senda et al., Intern Med 32(4):350-4, 1993).
W. NOV34a and NOV34b: Fibronectin type III -like
Expression of gene NOV34a and NOV34b was assessed using the primer-probe set
Ag3538, described in Table WA. Results of the RTQ-PCR runs are shown in Tables WB and
WC. Please note that NOV34b represents a full-length physical clone of the NOV34a gene, validating the prediction of the gene sequence. Table WA. Probe Name Ag3538
Table WC. Panel 4D
CNS_neurodegeneration_vl.O Summary: Ag3538 Expression of this gene is low/undetectable (CTs > 35) across all of the samples on this panel.
General_screening_panel_vl.4 Summary: Ag3538 Highest expression of the NOV34a gene is detected in sample derived from testis (CT=29.8). Thus, expression of this gene can be used to distinguish this sample from other samples in the panel. Furthermore, therapeutic modulation of the expression or function of this gene may be effective in the treatment of fertility disorders and hypogonadism.
In addition, significant expression of this gene is seen in pancreatic, CNS, colon, gastric, renal, lung, breast, ovarian and squamous cell carcinoma cell lines. Therefore, therapeutic modulation of the activity of this gene or its protein product, through the use of small molecule drugs, protein therapeutics or antibodies, might be beneficial in the treatment of these cancers.
Interestingly, this gene is expressed at much higher levels in fetal (CT = 33) when compared to adult brain samples (CT=36-40). This observation suggests that expression of this gene can be used to distinguish fetal from adult brain.
Panel 4D Summary: Ag3538 Highest expression of NOV34a is detected in sample derived from colon (CT=29.78). Thus, expression of this gene can be used to distinguish this sample from other samples in the panel. Furthermore, expression of this gene is decreased in colon samples from patients with IBD colitis and Crohn's disease (CTs>37) relative to normal colon. Therefore, therapeutic modulation of the activity of the GPCR encoded by this gene may be useful in the treatment of inflammatory bowel disease.
X. NOV35a: ADIPOPHILIN (ADIPOSE DIFFERENTIATION-RELATED PROTEIN)
Expression of gene NOV35a was assessed using the primer-probe set Ag5733, described in Table XA. Results of the RTQ-PCR runs are shown in Table XB. Table XA. Probe Name Ag5733
Table XB. General_screening_panel_vl.5
General screening panel yl.5 Summary: Ag5733 Highest expression of NOV35a is detected in sample derived from liver cancer cell line (CT=24). Thus, expression of this
gene can be used to distinguish this sample from other samples in this panel. In addition, high expression of this gene is also associated with renal cancer, melanoma, breast cancer, colon cancer, and lung cancer cell lines. Therefore, therapeutic modulation of this gene product may be beneficial in the treatment of these cancers.
This gene is expressed at moderate to high levels in a number of tissues with metabolic or endocrine function, including adipose, adrenal gland, gastrointestinal tract, pancreas, skeletal muscle and thyroid. The NOV35a gene codes for adipophilin, which belongs to perilipin family. Perilipin is known to play a role in regulation of triacylglycerol hydrolysis and lipid metabolism of adipose tissue (Ref.l). Therefore, therapeutic modulation of the activity of this gene may prove useful in the treatment of endocrine/metabolically related diseases, such as obesity and diabetes.
In addition, this gene is expressed at moderate levels in all regions of the central nervous system examined, including amygdala, hippocampus, substantia nigra, thalamus, cerebellum, cerebral cortex, and spinal cord. Therefore, this gene may play a role in central nervous system disorders such as Alzheimer's disease, Parkinson's disease, epilepsy, multiple sclerosis, schizophrenia and depression (Tansey et al., Proc Natl Acad Sci U S A 98(11):6494- 9, 2001).
Y. NOV37a, NOV37b and NOV37c: Latent transforming growth factor beta binding protein 1
Expression of gene NOV37a, NOV37b and NOV37c was assessed using the primer- probe set Ag3596, described in Table YA. Results of the RTQ-PCR runs are shown in Tables YB, YC and YD.
Table YA. Probe Name Ag3596
Table YB. CNS_neurodegeneration_vl.O
Table YC. General_screening_panel_vl.4
Table YD. Panel 4. ID
CNS_neurodegeneration_vl.0 Summary: Ag3596 This panel confirms the expression of the NOV37a gene at low levels in the brain in an independent group of individuals. This gene is found to be upregulated in the temporal cortex of Alzheimer's disease patients. Blockade of this gene product may be useful in the treatment of this disease and decrease neuronal death.
General_screening_panel_vl.4 Summary: Ag3596 Highest expression of the NOV37a gene is detected in one of the CNS cancer cell line (CT=26). Thus, expression of this gene can be used to distinguish this sample from other samples in this panel. In addition, significant expression of this gene is also associated with prostate cancer (CT=27). Therefore, therapeutic modulation of the activity of this gene or its protein product, through the use of small molecule drugs, protein therapeutics or antibodies, might be beneficial in the treatment of CNS cancer or prostate cancer.
In prostatic carcinoma there is immunohistochemical evidence that TGF-beta 1 is produced without the associated-LTBP 1 in malignant cells, although TGF beta 1 -LTBP 1 complexes are present in cystectomized prostatic and benign prostatic hyperplastic tissues (Eklov et al., Cancer Res. 53, 3193-3197, 1993).
Among tissues with metabolic or endocrine function, this gene is expressed at moderate levels in pancreas, adipose, adrenal gland, thyroid, pituitary gland, skeletal muscle, heart, liver and the gastrointestinal tract. Therefore, therapeutic modulation of the activity of this gene may prove useful in the treatment of endocrine/metabolically related diseases, such as obesity and diabetes.
In addition, this gene is expressed at significant levels in all regions of the central nervous system examined, including amygdala, hippocampus, substantia nigra, thalamus, cerebellum, cerebral cortex, and spinal cord. Therefore, this gene may play a role in central nervous system disorders such as Alzheimer's disease, Parkinson's disease, epilepsy, multiple sclerosis, schizophrenia and depression.
Panel 4.1D Summary: Ag3596 Highest expression of the NOV37a gene is detected in IL-9 treated lung fibroblast (CT=27.3). In addition, high expression of this gene is detected in TNF alpha + IL-1 beta/IL-4/IL-13/IFN gamma treated as well as untreated lung fibroblast and also in IFN gamma treated and untreated dermal fibroblasts. Thus, expression of this gene can be used to distinguish the lung and dermal fibroblast samples from other samples in this panel. Also, modulation of this gene product with a functional therapeutic may lead to the alteration of functions associated with these cell types and lead to improvement of the symptoms of patients suffering from autoimmune and inflammatory diseases such as asthma, allergies, psoriasis and idiopathic pulmonary fibrosis (IPF).
Recently, Saika et al. (Saika et al., Graefes Arch Clin Exp Ophthalmol 239(3):234-41, 2001) have shown that LTBP-1, beta 1-LAP and fibrillin-1 co-localize to the ECM of the filtering bleb and of cultured conjunctival fibroblasts. Both conjunctival epithelium and fibroblasts are considered to be the source of TGF beta in healing bleb. ECM secreted by in vivo and in vitro subconjunctival fibroblasts may works as a scavenger or repository of TGF beta.
Z. NOV39a: Urokinase plasminogen activator surface receptor precursor
Expression of gene NOV39a was assessed using the primer-probe set Ag3134, described in Table ZA. Results of the RTQ-PCR runs are shown in Tables ZB, ZC, ZD, ZE and ZF.
Table ZA. Probe Name Ag3134
Table ZB. CNS_neurodegeneration_vl.O
Table ZC. Panel 1.3D
Table ZD. Panel 2D
Tissue Name | Rel. Exp.(%) Ag3134, | Tissue Name | Rel. Exp.(%) A 3134
Table ZE. Panel 3D
Table ZF. Panel 4D
CNS_neurodegeneration_vl.0 Summary: Ag3134 This panel confirms the expression of this gene at low to moderate levels in the brains of an independent group of individuals. However, no differential expression of this gene was detected between Alzheimer's diseased postmortem brains and those of non-demented controls in this experiment. Please see Panel 1.3D for a discussion of the potential utility of this gene in treatment of central nervous system disorders.
Panel 1.3D Summary: Ag3134 Expression of the NOV39a gene is highest in placenta (CT = 29.5). In addition, this gene is expressed at moderate levels in all regions of the central nervous system examined, including amygdala, hippocampus, substantia nigra, thalamus, cerebellum, cerebral cortex, and spinal cord (CTs = 29.5-32). Thus, expression of this gene may be used to distinguish brain and placenta from the other samples on this panel. Furthermore, this gene may play a role in central nervous system disorders such as Alzheimer's disease, Parkinson's disease, epilepsy, multiple sclerosis, schizophrenia and depression.
Panel 2D Summary: Ag3134 Expression of this gene is highest in a bladder cancer sample (CT = 28.3). Interestingly, expression in the matched normal adjacent bladder tissue is much lower (CT = 34.5). In addition, the NOV39a gene is expressed at higher levels in a number of other tumor samples when compared to normal matched adjacent tissue. Specifically, expression of this gene is upregulated in gastric cancers and lung cancers. Thus, expression of this gene can be used to distinguish bladder, gastric and lung cancers.
Furthermore, therapeutic modulation of the activity of this gene or its protein product, using small molecule drugs, antibodies, or protein therapeutics, may be of benefit in the treatment of bladder, gastric and lung cancer.
The NOV39a gene encodes a protein with homology to urokinase plasminogen activator surface receptor precusor, which has previously been shown to play an important role in metastasis of lung and other cancers (Lakka et al., Clin Cancer Res 7(4): 1087-93, 2001). In addition, it has been shown that inhibition of urokinase-type plasminogen activator receptor gene using antisense technology reduces tumor cell invasion and metastasis in non-small cell lung cancer cell lines (Lakka et al., Clin Cancer Res 7(4): 1087-93, 2001). This observation suggests that therapeutic inhibition of the NOV39a gene may also be useful for reducing tumor cell invasion and metastasis.
Panel 3D Summary: Ag3134 Expression of this gene is highest in a lung cancer cell line (CT = 29). The NOV39a gene is expressed at moderate levels in a number of other cancer cell lines including several lung, gastric, and bladder cancer cell lines. This observation is consistent with what is seen in Panel 2D.
Panel 4D Summary: Ag3134 Expression of the NOV39a gene is upregulated in activated keratinocytes as well as in IFN gamma treated dermal fibroblasts. Therefore, modulation of the activity of the protein encoded by this gene using small molecule drugs or antibodies may be useful in the treatment of psoriasis. The NOV39a gene encodes a protein with homology to urokinase plasminogen activator surface receptor precusor. Consistent with a potential role for this gene in psoriasis, alterations in plasminogen activator expression have previously been shown to be occur in psoriasis (Spiers et al., J Invest Dermatol 102(3):333-8, 1994).
In addition, expression of this gene is upregulated in TNF alpha + IFN gamma treated HUVEC cells (CT=29.8) and IFN gamma treated NCI-H292 cells (CT=31) as compared to their untreated counterparts (CTs=37-40). This gene also shows a moderate expression in normal lung. The expression of this gene in the activated mucoepidermoid cell line (NCI- H292 cells), and the endothelial cells (HUVEC) suggests that this gene may be important in the proliferation or activation of these cell types. Therefore, therapeutics designed with the protein encoded by the gene may reduce or eliminate symptoms caused by inflammation in lung epithelia in chronic obstructive pulmonary disease, asthma, allergy, and emphysema.
AA. NOV40a: novel human agrin
Expression of gene NOV40a was assessed using the primer-probe set Ag3605, described in Table AAA. Results of the RTQ-PCR runs are shown in Tables AAB, AAC, AAD, AAE and AAF.
Table AAA. Probe Name Ag3605
Table AAC. General_screening_panel_vl.4
Table AAD. Panel 2.2
Table AAE. Panel 4. ID
Table AAF. Panel CNS 1
CNS_neurodegeneration_vl.0 Summary: Ag3605 This panel confirms the expression of this gene at moderate levels in the brains of an independent group of individuals. However, no differential expression of this gene was detected between Alzheimer's diseased postmortem brains and those of non-demented controls in this experiment. Please see Panel 1.4 for a discussion of the potential utility of this gene in treatment of central nervous system disorders.
General_screening_panel_vl.4 Summary: Ag3605 Expression of the NOV40a gene is highest in a breast cancer cell line (CT = 25.2). In addition, expression of this gene is primarily associated with cancer cell lines rather than with normal tissues. Specifically, expression of this gene is upregulated in pancreatic, CNS, colon, gastric, renal, lung, breast, ovarian, and prostate cancer cell lines when compared to their respective normal tissues. Thus, therapeutic modulation of the activity of this gene or its protein product, using small molecule drugs, antibodies or protein therapeutics, may be of benefit in the treatment of these types of cancers.
In addition, this gene is expressed at moderate levels in all regions of the central nervous system examined, including amygdala, hippocampus, substantia nigra, thalamus, cerebellum, cerebral cortex, and spinal cord. The NOV40a gene encodes a protein with homology to agrin, a neuronal aggregating factor that induces the aggregation of acetylcholine receptors and other postsynaptic proteins on muscle fibers and is crucial for the formation of the neuromuscular junction. More recently, it has been shown that agrin plays an important role in defining neuronal responses to excitatory neurotransmitters both in vitro and in vivo (Hilgenberg et al., Mol Cell Neurosci 19(1):97-110, 2002; Bixby et al., J Neurobiol 50(2): 164- 79, 2002). The NOV40a gene expression in the central nervous system is consistent with the hypothesis that this protein may have similar functions as agrin. Therefore, this gene may play
a role in central nervous system disorders such as Alzheimer's disease, Parkinson's disease, epilepsy, multiple sclerosis, schizophrenia and depression.
Among tissues with metabolic or endocrine function, this gene is expressed at moderate levels in pancreas, adipose, thyroid, and the gastrointestinal tract and at low levels in adrenal gland, pituitary gland, skeletal muscle, heart, and liver. Therefore, therapeutic modulation of the activity of this gene may prove useful in the treatment of endocrine/metabolically related diseases, such as obesity and diabetes. In support of this hypothesis, decreased glomerular expression of agrin in has been observed in diabetic nephropathy (Yard et al., Decreased glomerular expression of agrin in diabetic nephropathy and podocytes, cultured in high glucose medium. Exp Nephrol 9(3):214-22, 2001).
Panel 2.2 Summary: Ag3605 Expression of the NOV40a gene is highest in a sample of normal kidney (CT = 27.4). Interestingly, expression of this gene appears to be upregulated in a number of ovarian and renal cancers when compared to the matched control margins. Thus, expression of this gene could be used as a marker for ovarian and renal carcinoma. Furthermore, therapeutic modulation of the activity of this gene or its protein product, using small molecule drugs, antibodies or protein therapeutics, could be of benefit in the treatment of renal and ovarian cancer. This gene is expressed at moderate levels in the remaining samples on this panel, with little or no difference in expression levels between tumor and normal tissue. Panel 4.1D Summary: Ag3605 Expression of the NOV40a gene is highest in lung microvascular endothelial cells, microvascular dermal endothelial cells, mucoepidermoid cell line NCI-H292, astrocytes, and keratinocytes. Therefore, small molecule drug, antibody or protein therapeutics designed against the protein encoded by the NOV40a gene could reduce or inhibit inflammation in asthma, emphysema, allergy, psoriasis, muscular dystrophy and multiple sclerosis.
The NOV40a gene encodes a protem with homology to agrin. Recently, it has been demonstrated that agrin, an aggregating protein crucial for formation of the neuromuscular junction, is also expressed in lymphocytes and is important in reorganization of membrane lipid microdomains and setting the threshold for T cell signaling (Khan et al., Science 292(5522):1681-6, 2001). T cell activation is dependent on both a primary signal delivered through the T cell receptor and a secondary costimulatory signal mediated by coreceptors.
Costimulation is thought to act through the specific redistribution and clustering of membrane and intraceliular kinase-rich lipid raft microdomains at the contact site between T cells and antigen-presenting cells. This site has been termed the immunologic synapse. Khan et al.
(2001) concluded that agrin induces the aggregation of signaling proteins and the creation of signaling domains in both immune and nervous systems through a common lipid raft pathway. Panel CNS_1 Summary: Ag3605 This panel confirms the expression of this gene at low levels in the brains of an independent group of individuals. Please see Panel 1.4 for a discussion of the potential utility of this gene in treatment of central nervous system disorders.
AB. NOV41a: MAJOR URINARY PROTEIN 4 PRECURSOR (MUP 4)
Expression of gene NOV41a was assessed using the primer-probe set Ag2289, described in Table ABA. Results of the RTQ-PCR runs are shown in Tables ABB, ABC, and ABD.
Table ABA. Probe Name Ag2289
Table ABB. CNS_neurodegeneration_vl.O
Table ABC. Panel 1.3D
Table ABD. Panel 4. ID
CNS_neurodegeneration_vl.0 Summary: Ag2289 This panel does not show differential expression of the NOV41a gene in Alzheimer's disease. However, this expression profile confirms the presence of this gene in the brain. Please see Panel 1.3D for discussion of utility of this gene in the central nervous system. Panel 1.3D Summary: Ag2289 Expression of the NOV41a gene appears to be highly brain specific, with highest expression in hippocampus (CT=30). Therefore, this gene may play a role in central nervous system disorders such as Alzheimer's disease, Parkinson's disease, epilepsy, multiple sclerosis, schizophrenia and depression.
In addition, this gene is expressed at much higher levels in fetal skeletal muscle tissue (CT=32) when compared to expression in the adult counteφart (CT=40). Thus, expression of this gene may be used to differentiate between the fetal and adult source of this tissue. Furthermore, the relative overexpression of this gene in fetal skeletal muscle suggests that the protein product may enhance muscular growth or development in the fetus and thus may also act in a regenerative capacity in the adult. Therefore, therapeutic modulation of the protein encoded by this gene could be useful in treatment of muscle related diseases. More specifically, treatment of weak or dystrophic muscle with the protein encoded by this gene could restore muscle mass or function.
This gene is a homolog of MUP, whose murine homolog has been shown to have pheremone binding activity (Timm et al., Protein Sci 10(5):997-1004, 2001; Novotny et al., Proc R Soc Lond B Biol Sci 266(1432):2017-22, 1999). Based on the homology, this protein may play a role in sexual maturation and cycling in adult females.
Panel 2.2 Summary: Ag2289 Expression of the NOV41a gene is low/undetectable in all samples on this panel (CTs>35).
Panel 4.1D Summary: Ag2289 The NOV41a gene is only expressed at detectable levels in the kidney (CT=34.7). The putative protein encoded for by this gene may allow cells within the kidney to respond to specific microenvironmental signals. Therefore, therapies designed with the protein encoded by this gene may modulate kidney function and be important in the treatment of inflammatory or autoimmune diseases that affect the kidney, including lupus and glomerulonephritis. Panel CNS_1 Summary: Ag2289 Expression of the NOV41a gene is low/undetectable in all samples on this panel (CTs>35).
AC. NOV41b: MAJOR URINARY PROTEIN 4 PRECURSOR
Expression of gene NOV41b was assessed using the primer-probe set Ag2321, described in Table ACA.
Table ACA. Probe Name Ag2321
Panel 1.3D Summary: Ag2321 Expression of the NOV41b gene is low/undetectable in all samples on this panel (CTs>35).
Panel 2.2 Summary: Ag2321 Expression of the NOV41b gene is low/undetectable in all samples on this panel (CTs>35).
Panel 4D Summary: Ag2321 Expression of the NOV41b gene is low/undetectable in all samples on this panel (CTs>35).
AD. NOV42a and CG59889-02 and NOV42c: KIAA1199
Expression of gene NOV42a, variant CG59889-02 and full length clone NOV42c was assessed using the primer-probe set Ag3626, described in Table ADA. Results of the RTQ- PCR runs are shown in Tables ADB, ADC, ADD, ADE and ADF. Please note that NOV42c represents a full-length physical clone of the NOV42c gene, validating the prediction of the gene sequence
Table ADA. Probe Name Ag3626
Table ADB. AI_comprehensive panel_vl.O
Table ADC. CNS_neurodegeneration_vl .0
Temporal Ctx Parietal Ctx
Table ADD. General_screening_panel_vl.4
Table APE. Panel 2.2
Table ADF. Panel 3D
Table ADG. Panel 4. ID
AI_comprehensive panel_vl.0 Summary: Ag3626 The NOV42a transcript is expressed in both normal and disease tissue. Transcript expression is higher in some joint tissues isolated from osteoarthritic (OA) patients as compared to normal joint tissues, with highest expression in an OA bone sample (CT=28.5). These findings suggest that the transscript or the protein it encodes could be used to detect osteoarthritic tissues. Furthermore, therapies designed with the protein encoded for by this transcript could be important for the treament of arthritis.
CNS_neurodegeneration_vl.0 Summary: Ag3626 This panel does not show differential expression of the NOV42a gene in Alzheimer's disease. However, this expression profile shows the presence of this gene in the brain. Therefore, therapeutic modulation of the expression or function of this gene may be useful in the treatment of neurologic diseases. General_screening_panel_vl.4 Summary: Ag3626 Results from one experiment with the NOV42c gene are not included. The amp plot indicates that there were experimental difficulties with this run.
Panel 2.2 Summary: Ag3626 The expression of this gene appears to be highest in a sample derived from a normal lung tissue (CT=30.8). In addition, there appears to be substantial expression in other samples derived from lung cancers, bladder cancers, breast cancers, ovarian cancers and colon cancers. Thus, the expression of this gene could be used to distinguish normal lung tissue from other samples in the panel. Moreover, therapeutic modulation of this gene, through the use of small molecule drugs, protein therapeutics or antibodies could be of benefit in the treatment of lung, bladder, breast, ovarian and colon cancer.
Panel 3D Summary: Ag3626 The expression of this gene appears to be highest in a sample derived from a lung cancer cell line (LX-1) (CT=27.5). In addition, there appears to be substantial expression in other samples derived from colon cancer cell lines and gastric cancer cell lines. Thus, the expression of this gene could be used to distinguish LX-1 cells from other samples in the panel. Moreover, therapeutic modulation of this gene, through the use of small molecule drugs, protein therapeutics or antibodies could be of benefit in the treatment of colon or gastric cancer.
Panel 4.1D Summary: Ag3626 Highest expression of the NOV42c gene is seen in TNF-alpha and IL-1 beta treated astrocytes. This expression suggests that therapeutics designed against the protein encoded by this gene may be useful for the treatment of inflammatory CNS diseases such as multiple sclerosis. In addition, this gene is expressed in clusters of samples from both treated and untreated lung and dermal fibroblasts. Therefore, modulation of the expression or activity of the protein encoded by this transcript may be beneficial for the treatment of lung inflammatory diseases such as asthma, and chronic obstructive pulmonary diseases, inflammatory skin diseases such as psoriasis, atopic dermatitis, ulcerative dermatitis, ulcerative colitis.
OTHER EMBODIMENTS
Although particular embodiments have been disclosed herein in detail, this has been done by way of example for purposes of illustration only, and is not intended to be limiting with respect to the scope of the appended claims, which follow. In particular, it is contemplated by the inventors that various substitutions, alterations, and modifications may be made to the invention without departing from the spirit and scope of the invention as defined by the claims. The choice of nucleic acid starting material, clone of interest, or library type is believed to be a matter of routine for a person of ordinary skill in the art with knowledge of the embodiments described herein. Other aspects, advantages, and modifications considered to be within the scope of the following claims. The claims presented are representative of the inventions disclosed herein. Other, unclaimed inventions are also contemplated. Applicants reserve the right to pursue such inventions in later claims.