EP1341916A2 - Abscisic acid 8'- and 7'- hydroxylase genes and related sequences from plants - Google Patents

Abscisic acid 8'- and 7'- hydroxylase genes and related sequences from plants

Info

Publication number
EP1341916A2
EP1341916A2 EP01999639A EP01999639A EP1341916A2 EP 1341916 A2 EP1341916 A2 EP 1341916A2 EP 01999639 A EP01999639 A EP 01999639A EP 01999639 A EP01999639 A EP 01999639A EP 1341916 A2 EP1341916 A2 EP 1341916A2
Authority
EP
European Patent Office
Prior art keywords
seq
protein
aba
dna
plant
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP01999639A
Other languages
German (de)
French (fr)
Inventor
Joan E. Krochko
Adrian J. Cutler
Suzanne R. Abrams
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
National Research Council of Canada
Original Assignee
National Research Council of Canada
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by National Research Council of Canada filed Critical National Research Council of Canada
Publication of EP1341916A2 publication Critical patent/EP1341916A2/en
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004Oxidoreductases (1.)
    • C12N9/0071Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14)
    • C12N9/0077Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14) with a reduced iron-sulfur protein as one donor (1.14.15)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8261Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
    • C12N15/8291Hormone-influenced development
    • C12N15/8293Abscisic acid [ABA]

Definitions

  • the present invention relates to plant enzymes responsible for the inactivation of the biological activity of abscisic acid, said enzymes capable of 7'- and ⁇ '-hydroxylation of abscisic acid, polynucleotides encoding the same and methods to use said polynucleotides to alter plant metabolism.
  • ABA phytohormone S-(+)-abscisic acid
  • ABA mediates stress tolerance responses in higher plants, is a key signal compound that regulates water loss or transpiration and, in concert with other plant signaling compounds, is implicated in mediating responses to pathogens and wounding.
  • ABA promotes seed development, desiccation tolerance, and inhibition of germination.
  • ABA affects plant architecture, including root growth and morphology, root-to-shoot ratios, and plant fertility and reproduction.
  • the plant growth regulator ABA has been the subject of study for many years. However little is known in regarding the control of ABA levels or the specific mechanisms by which ABA mediates its activity. Specific physiological processes that are known to be mediated at least in part by ABA include those related to a number of important agronomic characteristics.
  • ABA concentrations are important for stages of embryogenesis, and for plant growth and development in general. Plant architecture, size and yield are affected by levels and metabolism of ABA. Examples of the potential effects of manipulating ABA levels follow.
  • Increased ABA levels have been shown to increase expression of genes involved in lipid accumulation in microspore-derived B. napus embryos.
  • Experiments utilizing long lasting ABA analogs i.e. ABA analogs that act as ABA agonists and are not subject to degradation by 8'-hydroxylation, Abrams S.R., et al, 1997, Plant Physiol 114: 89-97
  • ABA activity has been clearly demonstrated to have important and potentially beneficial effects on oil accumulation in oilseeds. Therefore increasing ABA content of embryos by reducing catabolism is likely to be beneficial in terms of increased oil accumulation.
  • seed protein accumulation is dependent upon ABA in many crop species.
  • seed proteins napin, oleosin and cruciferin
  • LSA's late embryogenesis abundant proteins
  • ABA plays an important role in storage protein biosynthesis in seeds. ABA promotes maturation and desiccation tolerance in seeds, and high ABA levels accelerate seed maturation (Green B.R., et al, 1998, Physiol Plantarum 104: 125-133).
  • ABA promotes maturation and desiccation tolerance in seeds, so seed maturation will be accelerated by alteration of ABA activity (Johnson-Flanagan A.M., et al, 1992, Plant Physiol 99: 700-706).
  • An aspect of this function in canola is that ABA is implicated in chlorophyll clearing in maturing B. napus seed (Green et al. bid).
  • the green seed problem in oilseed canola (persistence of seed chlorophyll after frosts leading to discolored oil) can be potentially modulated by controlling ABA levels.
  • ABA In response to abiotic stresses such as cold, heat and drought, levels of ABA rise in plants, triggering biochemical and physiological responses to accommodate the stress. ABA directly causes closure of stomata and reduced transpiration. Mutants of Arabidopsis thaliana have been produced that have increased sensitivity to ABA (Bonetta D. and McCourt P., 1998, Trends Plant Science 3: 231-235) and appear more stress tolerant. Combining this hypersensitivity to ABA with increased ABA levels during perception of stress may lead to a further enhancement of stress tolerance in transgenic crops such as canola.
  • Inappropriate dormancy regulation causes problems in a variety of crops in specific situations. These problems may be abolished by fine-tuning ABA levels in seeds. Preharvest sprouting in cereals is a problem that occurs when germination of the seed in the head proceeds prematurely and is facilitated by high moisture levels. The problem is acute for malting barley that is bred for low dormancy.
  • Fall seeding of some normally spring-sown amiual crops affords early spring germination and emergence resulting in a longer season for plant maturity. Early emergence also allows the seedling to take better advantage of accumulated winter moisture and avoid pests and pathogens. Flowering can occur earlier in the season and heat stress is avoided. However, premature fall germination (of spring crops sown in the fall) can result in counterproductive winterkill. Therefore adjusting ABA levels so that seed remains dormant in the fall, but germinates relatively early in the following spring would allow growers to take full advantage of fall seeding.
  • amiual crops e.g. spring canola
  • Crosstalk or interactive, cooperative and combined effects between plant growth regulators and other signaling molecules including sugars have been documented (Moller S.G. and Chua N-H., 1999, J Mol Biol 293: 219-234). Auxins are thought to work through ethylene and ABA. Thus ABA plays an important role in the physiological control of plant developmental processes and influences processes not normally specifically associated with ABA action. For example, ABA influences the ability to set flowers, therefore alteration in ABA metabolism has consequences for male and female sterility and seed production.
  • ABA is produced within plant cells in response to physiological and developmental signals.
  • ABA affects a number of physiological processes important to plant growth and development.
  • ABA is one of the primary plant growth regulators that have been the object of study for some time.
  • auxins, cytokinins, brassinosteroids, gibberellins and ethylene represent the predominant molecules for the hormonal control of plant growth.
  • ABA synthesis and degradation is an important factor in the control of plant growth and development.
  • plant growth regulator concentrations As a means to control plant growth.
  • manipulation of the effects of plant growth regulators has been through the development and application of analogs, development and use of compounds that inhibit the production or transport of plant growth regulators, or the application of synthetic versions of plant growth regulators.
  • plant cells typically modulate the levels of these substances by balancing synthesis and degradation (Cutler A.J. and Krochko J.E., 1999, TIPS 4: 472-478, Zeevaart J.A.D., 1999, In Biochemistry and Molecular Biology of Plant Hormones, pp 189-207).
  • a primary control point for maintaining growth regulator levels in plant cells is believed to be the metabolism through control of enzymatic activity responsible for the biochemical conversion of a plant growth regulator to an inactive or substantially less active compound.
  • the degradation of plant growth regulators provides a mechanism for the plant cell to rapidly alter levels of specific regulators in response to physiological conditions. This mechanism, which is usually mediated by a specific enzyme activity, can be regulated at a number of different levels including gene expression of the catabolic enzyme, specific manipulation of enzyme activity through allosteric regulation or availability of co-factors, as well as the turnover of the enzyme itself.
  • the degradation of ABA is one of the primary control points for the mediation of ABA activity in plant cells.
  • ABA once produced or transported into a plant cell is metabolized very quickly.
  • the molecule is susceptible to rapid enzymatic degradation through oxidative catabolism to 8'-hydroxyABA, with subsequent conversion to (-)- Phaseic Acid (PA) and in some tissues reduction to (-)-Dihydrophaseic Acid (DP A).
  • PA Phaseic Acid
  • DP A Dihydrophaseic Acid
  • the key step in the catabolism of ABA is the hydroxylation activity. It is believed that an 8'-hydroxylase activity is the predominant means for inactivation and catabolism of ABA, but it has also been postulated that a T- hydroxylase can produce (+)-7'-hydroxyABA from (+)-ABA. This process also leads to inactive compounds and hence conversion of ABA to 7'-hydroxyABA is another mechanism for the catabolism of ABA. It has also been postulated that a reductase activity may function in the conversion of ABA to ABA cis- l',4'-diol, the extent to which this operates in vivo is unknown.
  • inactive ABA conjugates through the activity of a glucosyltransferase also has been implicated as a means of modulating concentrations of hormonally active ABA in plant cells. Nonetheless, the published evidence suggests that the primary pathway for degradation of ABA is through hydroxylation, and the predominant activity appears to be the 8'- hydroxylase activity (Cutler and Krochko, ibid).
  • ABA degradation can be very rapid, the half-life of applied ABA has been observed to be 42 and 60 minutes in leaves of maize and Commelina communis, respectively (Jia et al.Jbid), and in isolated maize root tips the turnover was greater than 60% in one hour (Ribaut J.M., et al., 1996, J Plant Physiol 148: 761-764).
  • ABA 8'-hydroxylase activity is induced by ABA and possibly regulated by osmotic stress and phytochrome-dependent signaling pathways (Cutler et al.Jbid, Kraepiel Y., et al, 1994, Plant J 6: 665-672). Enzyme characterization indicates that ABA 8 '-hydroxylase is a member of the cytochrome P450 monooxygenase superfamily (Krochko J.E., et al, 1998, Plant Physiol 118: 849-860).
  • ABA 8 '-hydroxylase activity is transient in Black Mexican Sweet corn suspension cells (BMS cells) with a peak of activity at 16 hours after the addition of (+)-ABA to the BMS corn suspension culture medium.
  • ABA 8 '-hydroxylase is a microsomal enzyme; ABA 8'-hydroxylase requires NADPH; ABA 8'-hydroxylase requires O 2 ; ABA 8'-hydroxylase is inhibited by CO, tetcyclacis and oxidized cytochrome c; the CO inhibition of ABA 8'- hydroxylase is relieved by blue-light, all of these criteria showing that ABA 8'- hydroxylase is a cytochrome P450 monooxygenase.
  • biochemical characterization of enzyme requirements, appearance and overall enzyme characteristics indicate that the 8 '-hydroxylase activity responsible for the hydroxylation of ABA is a member of the P450 monooxygenase family, the expression of which is induced by the occurrence of ABA itself.
  • the polypeptide sequence of the enzyme itself has remained elusive since many P450 monooxygenase enzymes have proved difficult to purify.
  • a gene encoding an ABA 8'-hydroxylase activity, a 7'-hydroxylase activity, or any ABA hydroxylase activity has not been described in the art.
  • many P450 monooxygenase coding sequences have been identified.
  • Plant cytochrome P450 monooxygenases (excluding CYP51) are named from CYP71 - CYP99 and from CYP701 upwards as new discoveries are made.
  • ABA 7'-hydroxylase and ABA 8 '-hydroxylase sequences to modify plant metabolism by alteration of the activity of exogenously applied ABA. It is another object of the present invention to provide a means to utilize ABA 7'-hydroxylase and ABA 8 '-hydroxylase sequences to modify plant metabolism by alteration of the activity of exogenously applied ABA analogs.
  • the present invention provides nucleic acid sequences encoding a novel hydroxylase enzyme involved in catabolism of ABA.
  • the pBE 10-30-3 cDNA sequence encodes an ABA hydroxylase gene that is expressed following ABA induction in plant cells.
  • the gene sequence is useful for identification of related sequences from other plant species.
  • an isolated polynucleotide comprising a nucleotide sequence encoding a polypeptide of a plant P450 monooxygenase family capable of hydroxylating ABA.
  • the polynucleotide may be DNA or RNA.
  • an isolated polynucleotide comprising SEQ ID NO: 1 or the complement of SEQ ID NO:l or a sequence homologous to SEQ ID NO:l or the complement of SEQ ID NO: 1.
  • an isolated polynucleotide comprising SEQ ID NO:2 or the complement of SEQ ID NO:2, or a sequence homologous to SEQ ID NO:2 or the complement of SEQ ID NO:2.
  • an isolated polynucleotide comprising SEQ ID NO:3 or the complement of SEQ ID NO:3, or a sequence homologous to SEQ ID NO:3 or the complement of SEQ ID NO:3.
  • an isolated polynucleotide comprising SEQ ID NO:4 or the complement of SEQ ID NO:4, or a sequence homologous to SEQ ID NO:4 or the complement of SEQ ID NO:4.
  • the invention provides an isolated polynucleotide comprising a sequence encoding a ABA 8'-hydroxylase enzyme of a plant or a protein having the same enzymatic activity thereas.
  • the invention provides an isolated polynucleotide comprising a sequence encoding an ABA 7'-hydroxylase enzyme of a plant or a protein having the same enzymatic activity thereas.
  • the invention provides a chimeric gene comprising a polynucleotide sequence of the type described above, operably linked to suitable regulatory sequences.
  • the invention provides a method for modifying the ABA catabolism of a plant comprising: (a) introducing into a plant cell capable of being transformed and regenerated to a whole plant a genetic construct comprising a first DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in plant cells, a DNA sequence that encodes a polynucleotide as described above, operably linked to a suitable transcriptional regulatory region, and (b) recovery of a plant which contains said recombinant DNA.
  • the polynucleotide may be in the sense or the antisense orientation relative to the transcriptional regulatory region.
  • the invention provides a method for modifying the ABA catabolism of a plant comprising: (a) introducing into a plant cell capable of being transformed and regenerated to a whole plant a genetic construct comprising a first DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in plant cells, a DNA sequence that encodes a polynucleotide as described above, operably linked to a transcriptional regulatory region that can be induced for expression and (b) recovery of a plant which contains said recombinant DNA.
  • the polynucleotide may be in the sense or the antisense orientation relative to the transcriptional regulatory region.
  • the invention provides a method for modifying the catabolism of a plant comprising: (a) introducing into a plant cell capable of being transformed and regenerated to a whole plant a genetic construct comprising a first DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in plant cells, a DNA sequence that encodes a polynucleotide as described above, operably linked to a transcriptional regulatory region that is tissue specific, and (b) recovery of a plant which contains said recombinant DNA.
  • the polynucleotide may be in the sense or the antisense orientation relative to the transcriptional regulatory region.
  • Another object of the present invention relates to the use of a polynucleotide comprising a nucleotide sequence encoding a polypeptide of a plant P450 monooxygenase family capable of hydroxylating ABA analogs.
  • a method for modifying the catabolism of ABA analogs in a plant cell comprising: (a) introducing into a plant cell capable of being transformed and regenerated to a whole plant a genetic construct comprising a first DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in plant cells, a DNA sequence that encodes a polynucleotide as described above, operably linked to a suitable transcriptional regulatory region, (b) recovery of a plant which contains said recombinant DNA, and exposing said plant cell to an ABA analog.
  • Said transcriptional control region may be constitutive, conditional or tissue specific in its expression pattern.
  • the plant cell described above is induced to regenerate a whole plant and the whole plant comprising a novel ABA hydroxylase activity is treated with an ABA analog plant exhibiting different physiological responses at the whole plant level when compared to a plant without the novel ABA hydroxylase gene being exposed to said ABA analog.
  • the invention also relates to plants and plant parts transformed with a chimeric gene as described above.
  • the pJK6-29 (SEQ ID NO:l) and pBEl 0-30-3 (SEQ ID NO:2) sequence and related sequences CYP72A7 (SEQ ID NO:3) and CYP72A14 (SEQ ID NO:4) are used to modify catabolism of ABA by the transformation of plant cells with a plant transformation vector comprising a sense or antisense portion of the gene or a double stranded RNA comprising of both sense and antisense portions of the gene.
  • the pJK6-29 and pBEl 0-30-3 sequence may also be used for identification of related homologous sequences deposited in public databases through comparative techniques well-known in the art, or as hybridization probes for the identification of related cDNA or genomic sequences from various plant species where the DNA sequence information is not known.
  • the invention also relates to protein sequences encoding ABA hydroxylase activity, said protein sequences having at least 50% protein identity to the protein encoded by SEQ ID NO:2.
  • the invention also relates to proteins encoding an ABA hydroxylase activity, said proteins having conserved amino acid regions identified as 'EVLRLY' (SEQ IS NO.22) and 'DVIS[KRH]xAFG' (SEQ ID NO.23) as described herein. 5.
  • 'EVLRLY' SEQ IS NO.22
  • 'DVIS[KRH]xAFG' SEQ ID NO.23
  • Figure 1 Evaluation of the subtractive cloning procedure for the ability to select cDNA uniquely expressed in response to ABA induction (i.e. assessment of the quality of the PCR suppression subtraction (Clonetech)). Comparison of the cDNA populations following the subtractive procedure.
  • Four cDNA samples (NI / S; non-ABA-induced and subtracted, NI / N; non-ABA-induced and non-subtracted, IND / S; ABA-induced and subtracted, IND / N; ABA-induced and non-subtracted) resulting from the subtractive hybridization were amplified by PCR and equivalent amounts were loaded onto an agarose gel.
  • FIG. 1 Isolation of an ABA-induced cytochrome P450 monooxygenase cDNA by screening a population of subtracted cDNA with probes from subtracted induced and subtracted non-induced tissues.
  • the figure illustrates randomly selected cDNA clones from a subtracted ABA-induced library (PCR- amplified inserts of 48 clones arrayed in dulpicate / blot). The PCR-amplified inserts were arrayed in duplicate on nylon membranes and probed with labeled subtracted non-ABA-induced cDNA (NI / S) and subtracted ABA-induced cDNA (IND / S).
  • NI / S labeled subtracted non-ABA-induced cDNA
  • IND / S subtracted ABA-induced cDNA
  • the isolated P450 cDNA (pJK6-29) was used as a probe against the four cDNA pools resulting from the subtractive hybridization procedure.
  • This cytochrome P450 was upregulated by ABA (compare NI / N and IND N) and successfully amplified within the subtracted ABA-induced cDNA pool (compare NI /S and IND / S).
  • FIG. 4 Northern blot analysis with P450 cDNA pJK6-29 (333bp, C-terminal). Total RNA isolated from non-ABA-induced and ABA-induced (9 hr at 200 ⁇ M (+)-ABA) BMS corn suspension was probed with radiolabeled pJK6-29 to examine the regulation of expression by (+)-ABA in corn suspension cells.
  • FIG. 1 Comparison of ABA 8 '-hydroxylase activity and expression of pJK6- 29 mRNA after induction of plant cells with (+)-ABA.
  • ABA 8 '-hydroxylase activity was dete ⁇ nined in BMS corn suspension cells at defined periods after the addition of 200 ⁇ M (+)-ABA.
  • Total RNA was extracted from duplicate tissue samples and expression of the P450 clone, pJK6-29, was determined by Northern blot analysis, a) ABA 8 '-hydroxylase activity; b) mRNA accumulation JK6-29 (P450).
  • FIG. 6 Heterologous expression of an Arabidopsis P450 ABA 7'-hydroxylase activity in yeast.
  • the CYP72A7 cDNA from Arabidopsis thaliana was inserted into the pYeDP60 vector, transformed into the WAT11 yeast strain (but not the WAT21 yeast strain) and analyzed for the ability to metabolize (+)-ABA.
  • the biotransformation of (+)-ABA to 7'-hydroxyAB A was assessed by High Performance Liquid Chromatography - Mass Spectrometry. (HPLC/MS/MS) 7'-hydroxyABA was excreted into the media. Measured activity was limited by access of enzyme to the substrate (ABA).
  • Figure 8 Identification of the 'DNIS[KRH]xAFG' (SEQ ID ⁇ O.23) conserved amino acid sequence in CYP72A genes in plants. This figure illustrates the position of the conserved amino acid sequence found in all CYP72A genes, including those identified as encoding ABA hydroxylase activity. conserveed regions are boxed. Position of the conserved sequence is shown relative to the amino acid residue number shown on the right hand side of the listing. The specific genes encoding the protein sequences are shown on the left hand side.
  • Figure 10 Construction of the Yeast pYeDP60.Ath30-2 expression plasmid.
  • Figure 12 Construction of the binary vectors, pCAMBIA2300.Ath30-2Forward and pCAMBIA2300.Ath30-2Reverse.
  • the 35S.Ath30-2Forward cassette or the 35S.Ath30-2Reverse cassette was cut out with Xho I, blunt ended and then cut with Kpn I.
  • Figure 13 Construction of the binary vectors, pCAMBIA2300.Ath29-3Forward and pCAMBIA2300.Ath29-3Reverse.
  • the 35S.Ath29-3Forward cassette or the 35S.Ath29-3Reverse cassette was cut out with Xho I, blunt ended and then cut with Kpn I.
  • Figure 14 Construction ofthe pJIT61.CornP450Forward plasmid.
  • FIG. 16 Construction ofthe pCAMBIA2301.CornP450Forward plasmid. Initially, p35S.CAMBIA2301 was cut with Pst I, blunted ended and cut with Bam HI. In addition, pJIT61.CornP450Forward was cut with BamH I and EcoR V.
  • Figure 17 Construction of the pJIT61.CornP450Reverse plasmid.
  • FIG. 18 Construction of the binary vector, CAMBIA2301.CornP450Reverse. Initially, p35S.CAMBIA2301 was cut with Pst I, blunt-ended and cut with Xba I. In addition, pJIT61.CornP450Reverse was cut with Xba I and EcoR V.
  • FIG. 19 Construction of the plasmid for tetracycline-inducible expression, pBINHygTx.Ath30-2. Initially, pYeD60.Ath30-2 was cut with BamH I, blunt- ended and cut with Kpn I.
  • Figure 20 Construction of the plasmid for tetracycline-inducible expression, pBINHygTx.Ath29-4.
  • Figure 21 Construction of the plasmid for tetracycline-inducible expression, pBINHygTx.CornP450. 6. DETAILED DESCRIPTION OF THE INVENTION
  • abscisic acid is defined as a molecule structurally resembling abscisic acid comprised of a six-membered ring with a side chain containing two units of unsaturation.
  • the ring can have a double bond like abscisic acid but also may be saturated.
  • the methyl groups of the ring may be replaced with hydrogen, chains or rings containing unsaturated carbon-carbon functional groups, or heteroatoms.
  • the oxygens of ABA can be altered in oxidation state or can be replaced with hydrogen or other functional groups. Analogs can confer activity similar to abscisic acid or can antagonize ABA effects.
  • a “coding sequence” or “coding region” is the part of a gene that codes for the amino acid sequence of a protein, or for a functional RNA such as a tRNA or rRNA.
  • a coding sequence typically represents the final amino acid sequence of a protein or the final sequence of a structural nucleic acid. Coding sequences may be interrupted in the gene by intervening sequences, typically intervening sequences are not found in the mature coding sequence.
  • a “complement” or “complementary sequence” is a sequence of nucleotides which forms a hydrogen-bonded duplex with another sequence of nucleotides according to Watson-Crick base-pairing rules.
  • the complementary base sequence for 5 -AGCT-3' is 3'-TCGA-5'.
  • “Expression” refers to the transcription of a gene into structural RNA (rRNA, tRNA) or messenger RNA (mRNA) with subsequent translation into a protein in the case of the mRNA.
  • Polynucleotides are "functionally equivalent” if they perform substantially the same biological function. By substantially the same biological function it is meant that similar protein activities or protein function are encoded by a mRNA polynucleotide, or a structural polynucleotide has a similar structure and biological activity
  • Polynucleotides are "heterologous" to one another if they do not naturally occur together in the same a ⁇ angement in the same organism.
  • a polynucleotide is heterologous to an organism if it does not naturally occur in its particular form and arrangement in that organism.
  • Polynucleotides or polypeptides have "homologous” or “identical” sequences if the sequence of nucleotides or amino acid residues, respectively, in the two sequences is the same when aligned for maximum correspondence as described herein. Sequence comparisons between two or more polynucleotides or polypeptides are generally performed by comparing portions of the two sequences over a portion of the sequence to identify and compare local regions. The comparison portion is generally from about 20 to about 200 contiguous nucleotides or contiguous amino acid residues or more.
  • the "percentage of sequence identity” or “percentage of sequence homology" for polynucleotides and polypeptides, such as 50, 60, 70, 80, 90, 95, 98, 99 or 100 percent sequence identity may be determined by comparing two optimally aligned sequences which may or may not include gaps for optimal alignment over a comparison region, wherein the portion of the polynucleotide or polypeptide sequence in the comparison may include additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences.
  • the percentage of homology or similarity is calculated by: (a) determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions; (b) dividing the number of matched positions by the total number of positions in the window of comparison; and, (c) multiplying the result by 100 to yield the percentage of sequence identity.
  • Optimal alignment of sequences for comparison may be conducted by computerized implementations of known algorithms, or by inspection.
  • Readily available sequence comparison and multiple sequence alignment algorithms are, respectively, the Basic Local Alignment Search Tool (BLAST) (Altschul S.F., et al.,1990, J Mol Biol 215: 403, Altschul S.F., et al., 1997, Nucleic Acids Res 25: 3389-3402) and ClustalW programs.
  • BLAST is available on the Internet at http://www.ncbi.nlm.nih.gov and a version of ClustalW is available at http ://www2.ebi.ac.uk.
  • Other suitable programs include GAP, BESTFIT,
  • Sequence identity typically refers to sequences that have identical residues in order, whereas sequence similarity refers to sequences that have similar or functionally related residues in order.
  • sequence similarity refers to sequences that have similar or functionally related residues in order.
  • an identical polynucleotide sequence would have the same nucleotide bases in a specific nucleotide sequence has found in a different polynucleotide sequence.
  • Sequence similarity would include sequences that are similar in character for example purines and pyrimidines arranged in a specific fashion.
  • sequence of identity means the same amino acid residues in a specific order, where as sequence similarity would allow for amino acids with similar chemical characteristics (for instance basic amino acids, or hydrophobic amino acids) to reside within a specific order.
  • stringent conditions or “stringent hybridization conditions” includes reference to conditions under which a probe will hybridize to its target sequence, to a detectably greater degree than other sequences (e.g. at least 2- fold over background).
  • Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures.
  • stringent conditions are selected to be about 5 ° C lower than the thermal melting point (T m ) for the specific sequence at a defined ionic strength and pH.
  • T m is the temperature (under defined ionic strength and pH) at which 50% of a complementary target sequence hybridizes to a perfectly matched probe.
  • stringent conditions will be those in which the salt concentration is less than about 1.0 M Na ion, typically about 0.01 to 1.0 M Na ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes (e.g. 10 to 50 nucleotides) and at least about 60°C for long probes (e.g. greater than 50 nucleotides).
  • Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide.
  • Exemplary low stringency conditions include hybridization with a buffer solution of 30% formamide, 1 M NaCI, 1% SDS at 37°C, and a wash in 2X SSC at 50°C.
  • Exemplary high stringency conditions include hybridization in 50% formamide, 1 M NaCI, 1% SDS at 37°C, and a wash in 0.1 X SSC at 60°C.
  • Hybridization procedures are well-known in the art and are described in Ausubel et ⁇ /.,(Ausubel F.M., et al.,1994, Current Protocols in Molecular Biology, John Wiley & Sons Inc.).
  • isolated refers to material that is: (1) substantially or essentially free from components which normally accompany or interact with it as found in its naturally occurring environment; or (2) if in its natural environment, the material has been non-naturally altered to a composition and/or placed at a locus in the cell not native to a material found in that environment.
  • the isolated material optionally comprises material not found with the material in its natural environment. For example, a naturally occurring nucleic acid becomes an isolated nucleic acid if it is altered, or if it is transcribed from DNA which is altered, by non-natural, synthetic methods performed within the cell from which it originates.
  • Two DNA sequences are "operably linked” if the linkage allows the two sequences to carry out their no ⁇ nal functions relative to each other.
  • a promoter region would be operably linked to a coding sequence if the promoter were capable of effecting transcription of that coding sequence.
  • a "polynucleotide” is a sequence of two or more deoxyribonucleotides
  • RNA ribonucleotides
  • a "DNA construct” is a nucleic acid molecule that is isolated from a naturally occurring gene or which has been modified to contain segments of nucleic acid which are combined and juxtaposed in a manner which would not otherwise exist in nature.
  • a “polypeptide” is a sequence of two or more amino acids.
  • a “promoter” or transcriptional regulatory region is a cis-acting DNA sequence, generally located upstream of the initiation site of a gene, to which RNA polymerase may bind and initiate correct transcription.
  • a "recombinant" polynucleotide for instance a recombinant DNA molecule, is a novel nucleic acid sequence formed tlirough the ligation of two or more nonhomologous DNA molecules (for example a recombinant plasmid containing one or more inserts of foreign DNA cloned into it).
  • Transformation means the directed modification of the genome of a cell by the external application of recombinant DNA from another cell of different genotype, leading to its uptake and integration into the subject cell's genome.
  • a "transgenic plant” encompasses all descendants, hybrids, and crosses thereof, whether reproduced sexually or asexually, and which continue to harbour the foreign DNA.
  • the present invention describes a nucleic acid sequences that encode enzyme activities capable of hydroxylating ABA.
  • These nucleic acid sequences are members of the P450 monooxygenase family. Specifically these nucleic acid sequences are members of the CYP72A gene subfamily. These genes were isolated based on a number of characteristics that are indicative of an ABA hydroxylase activity. It is known that there are a number of P450 monooxygenase genes that have been described in plants. Those P450 monooxygenase genes that encode ABA hydroxylase activity have been found to be limited to a subset of the P450 gene family as described herein.
  • differential screening is used to identify a subset of sequences induced by ABA within a cell population exposed to ABA.
  • P450 monooxygenase sequences are identified using characteristics of the sequences - known to be conserved in P450 enzymes.
  • the enzyme activity responsible for the hydroxylation, and hence inactivation of ABA is known to be a cytochrome P450 monooxygenase (see Krochko et al, 1998, Plant Physiol 118: 849-860) This evidence proved that ABA hydroxylase activity can be induced in Black Mexican Sweet com suspension cells and is a microsomal enzyme.
  • the biochemical characterization of ABA hydroxylase demonstrates the enzyme is a member of the P450 monooxygenase family.
  • ABA hydroxylase requires NADPH and O 2 , the enzyme activity is inhibited by CO, tetcyclacis and oxidized cytochrome c and the CO inhibition is relieved by blue-light, all of these criteria showing that ABA hydroxylase is a cytochrome P450 monooxygenase as these indicators are diagnostic for P450 monooxygenase activity.
  • the induction of ABA hydroxylase activity is inhibited by cycloheximide (a protein synthesis inhibitor) and cordecypin (a RNA synthesis inhibitor) thus indicating the hydroxylase activity is induced at the genetic level following exposure to ABA.
  • the present inventors searched for a polynucleotide that can be induced by ABA in com suspension cultures and encoded structural features of a protein that indicate it is part of the P450 monooxygenase family.
  • the present invention allowed the inventors to ascribe function to a subfamily of the larger P450 monooxygenase family.
  • a cDNA sequence was isolated from com suspension cultures that was found to encode a protein that possessed characteristics consistent with an ABA hydroxylase.
  • the partial cDNA clone pJK6-29 (SEQ ID NO:l) was found to be induced by ABA and comprised a protein with P450 monooxygenase motifs.
  • a full-length cDNA clone (SEQ ID NO:2) was isolated and used for searching for other related sequences.
  • the present invention encompasses, in one embodiment, a nucleic acid pBE 10-30-3 encoding an enzyme from com with ABA hydroxylation activity and similarity to the general family of P450 monooxygenase enzymes from plants.
  • the specification also describes the partial cDNA pJK6-29 sequence used to derive the full-length pBE 10-30-3 cDNA. Based on the structure and expression of this coding sequence, and on the biochemical and genetic evidence, it has been designated as ABA 8 '-hydroxylase. The gene encoding this enzyme activity has not previously been identified in the art.
  • the present invention also encompasses, in one embodiment, a series of genes from the CYP72A subfamily of the super family of P450 monooxygenase genes. Genes from Arabidopsis thaliana have been isolated and shown to possess enzymatic activity capable of specifically hydroxylating ABA in a heterologous system. One of these genes, CYP72A7 has been shown to possess a 7'-hydroxylase activity in a heterologous yeast system. Thus, the present invention provides clear evidence of the nature of ABA hydroxylase genes and functional expression thereof.
  • the identification of this unique genetic activity allows for development of novel strategies to manipulate the catabolism of ABA in plant cells.
  • the novel nucleic acid can also be used to identify species-specific members of this plant gene family, and to utilize those sequences for alteration of ABA catabolism.
  • the sequence can also be used to isolate corresponding related similar or identical sequences from other plant species.
  • the identification of an ABA 7'-hydroxylase activity allows for the identification of an ABA 8'-hydroxylase activity through sequence comparison. This can be conducted within a plant species or between plant species. Similar or identical sequences can be isolated. It has been discovered that the CYP72A P450 monooxygenase gene subfamily encodes a small number of enzymes capable of hydroxylation of ABA. The inplanta function of the enzymes encoded by the CYP72A family was heretofore unknown, and the information described in the present invention demonstrates that this gene family encodes enzymes capable of hydroxylating ABA.
  • the present invention encompasses the nucleotide and peptide sequences disclosed in the present application, as well as other DNA sequences that show a degree of homology to the sequences disclosed herein.
  • homologous sequences may be identified by any one of a number of routine techniques that are known in the art for the isolation and characterization of homologous DNA or peptide sequences from species that are either the same or different from the original species.
  • sequence comparisons were conducted using the BLAST programs, three designed for nucleic acid sequences, (BLASTN, BLASTX and TBLASTX) and two designed for protein sequences (BLASTP and TBLASTN) (Coulson A., 1994, Trends in Biotechnology, 12:76-80).
  • the BLASTX program is publicly available from NCBI and other sources such as the BLAST Manual, Altschul, S., et /.,NCBI NLM NIH Bethesda Maryland 20984, also http ://www .ncbi .nlm .mh.gov/BLAST/blast help .html provides online help and further literature references for BLAST and related protein analysis methods, and Altschul S., et al.,1990, J Mol Biol 215:403-410.
  • the 333 bp cDNA clone pJK6-29 of com P450 cDNA isolated by subtractive hybridization shows strong homologies to cytochrome P450 genes of the CYP72A gene subfamily. Comparison of the sequence of JK6-29 with deposited sequences in gene databases using the BLAST search programs and the default setting reveals similarity with a subset of P450 monooxygenase clones identified as the CYP72A gene subfamily.
  • CYP72A gene family was one of the first P450 monooxygenase genes to be cloned in plants and was originally cloned from periwinkle (Vetter H.-P., et al, 1992, Plant Physiol 100: 998-1007). Those authors tentatively assigned geraniol-10-hydroxylase activity to this protein based on induction kinetics, however, they were unable to demonstrate conclusively that this P450 had GE10H activity.
  • CYP72 As are still frequently described in the literature and even in some newer databases as possible geraniol 10-hydroxylases (see Stanford Microarray Database). Now, with the discovery of JK6-29 and the isolation of the full-length sequence pBE10-30-3, the function of CYP72A sequences is better understood to comprise at least ABA hydroxylation enzymes, including ABA 7'-hydroxylase as demonstrated by in vitro enzyme activity.
  • CYP72A gene subfamily organization of the CYP72A gene subfamily in plants
  • the CYP72A gene family has been found in most plant species including Arabidopsis, rice, tomato, potato, com, Medicago (alfalfa), soybean, sorghum and barley.
  • the assignment of a DNA sequence to the CYP72A subfamily has been based on sequence comparison and a high degree of similarity within these various sequences.
  • a combination of genomic DNA sequences as well as EST sequences have provided information on the occurrence of these gene sequences.
  • the family has not however, been characterized in regard to function.
  • homologous sequences from Arabidopsis were identified and the related genes were assigned to a moderate size (9 members) cytochrome P450 gene subfamily whose members are a ⁇ ayed in tandem on chromosome 3.
  • This sequence information was first submitted to GenBank by the Kazusa DNA Research Institute on Feb 1st 1999 (PI clone MIE1; GenBank AB023038, Sato et ⁇ /.,DNA Research 7:131-135, 2000), but the function of these genes was unknown.
  • CYP 72A12P (exon 5 only) AB023038, chromosome 3, MIE1 52192-52485
  • sequence identity of these nine family members ranges between 63- 92% at the DNA level, while the protein sequence identity range between 55 - 90% .
  • sequence identity to the com full-length cDNA (SEQ ID NO:2) isolated by the present inventors ranges from 50-60% at the DNA level and 50-55% at the level of the protein sequence. This is illustrated by the comparative table shown below, where eight members of the Arabidopsis CYP72A gene family are compared to each other as well as compared to the com cDNA clone(SEQ ID NO:2).
  • CYP72A7 is referred to as CYP7 for this analysis.
  • the gene sequences of this family are highly similar and the identity ranges from 63-92%, with a typical identity being about 65-70% for the least related, 74-78% for the more related sequences and 85- 92% for the most related sequences.
  • Nearly all of the Arabidopsis sequences of the CYP72A family show at least 50% identity, with some specific sequences showing 60% similarity.
  • CYP72A subfamily are highly similar. When members of this family are compared to P450 monooxygenase genes in general, the similarity is not evident. For example, comparison of Arabidopsis CYP72A7 sequences with other members of the P450 monooxygenase genes from plants reveal that the CYP72A family can be discriminated from other P450 monooxygenases by a difference of approximately at least 10% in homology between the CYP72A types and other CYP P450 monooxygenases. Typically CYP72A genes exhibit at least 50% identity to each other, whereas non CYP72A genes exhibit less that 40% identity to CYP72A genes. It is the CYP72A genes that have demonstrated ABA hydroxylase activity as described within the present invention.
  • CYP72A7 (SEQ ID NO:5) Sequenced compared to "identity” and "positives” score
  • CYP72A18 (Oryza sativa) 55% identity, 70% positives
  • CYP72A1 Catharanthus roseus 51% identity, 71% positives (LI 0081)
  • CYP72A-like (tobacco) 49% identity, 67% positives (U35226)
  • CYP72A-like (tomato) 47% identity, 65% positives (AF249329)
  • CYP72A25 (O. sativa) 44% identity, 61% positives
  • CYP72B1 (Arabidopsis) 40% identity, 62% positives .CYP72C1 (Arabidopsis) 41% identity, 61% positives CYP709B2 (Arabidopsis) 39% identity, 57% positives CYP709B3 (Arabidopsis) 36% identity, 56% positives CYP709B-like (maize) 37% identity, 55% positives CYP721A1 (Arabidopsis) 38% identity, 56% positives CYP709B1 (Arabidopsis) 38% identity, 58% positives CYP709B-like (O.
  • CYP72A-like (Oryza sativa) 69% identity, 81% positives
  • CYP72A23 (O. sativa) 65% identity, 77% positives CYP72A21 (O. sativa) 64% identity, 77% positives CYP72A19 (O. sativa) 63% identity, 77% positives CYP72A22 (O. sativa) 63% identity, 76% positives CYP72A20 (O. sativa) 61% identity, 74% positives CYP72A17 (O. sativa) 61% identity, 75% positives CYP72A24 (O.
  • sativa 62% identity, 75% positives CYP72A15 (Arabidopsis) 57% identity, 72% positives CYP72A14 (Arabidopsis) 55% identity, 70% positives CYP72A10 (Arabidopsis) 55% identity, 70% positives CYP72A11 (Arabidopsis) 55% identity, 70% positives CYP72A25 (O.
  • CYP72A-like (tobacco) 50% identity, 66% positives
  • CYP72B1 (Arabidopsis) 43% identity, 62% positives CYP72C1 (Arabidopsis) 41%o identity, 61% positives CYP709B-like (O. sativa) 42% identity, 58% positives
  • CYP709B2 (Arabidopsis) 39% identity, 57% positives
  • CYP709B1 (Arabidopsis) 38% identity, 57% positives CYP721A1 (Arabidopsis) 40% identity, 58% positives
  • CYP709B3 (Arabidopsis) 39% identity, 57% positives
  • CYP709A1 (Arabidopsis) 37% identity, 59% positives
  • CYP714A2 (Arabidopsis) 32% identity, 56% positives
  • CYP714A1 (Arabidopsis) 34% identity, 54% positives CYP709A2 (Arabidopsis) 36% identity, 57% positives
  • CYP715A1 (Arabidopsis) 30% identity, 50% positives CYP715A-like (Persea americana) 34% identity, 56% positives
  • CYP709B-like O. sativa 40% identity, 59% positives CYP709-like (Agrobacterium tumefaciens) 30% identity, 45% positives
  • CYP72As from different species identified by BLAST and homology analysis. These include:
  • a 6 amino acid sequence 'EVLRLY' (SEQ ID NO.22) that is conserved in the CYP72A (8 genes) and the CYP72C (1 gene) P450 subfamilies in Arabidopsis. This sequence is found in only one other P450 in. Arabidopsis (CYP715A1) and only one non-P450 protein sequence in Arabidopsis
  • CYP72A subfamily in Arabidopsis has both of these sequences and this forms a basis for selecting CYP72A genes in general that encode ABA hydroxylase activity.
  • a third region of conserved amino acid residues includes eight amino acids located approximately 170 amino acids upstream of the Cysteine residue of the heme-binding region.
  • the conserved sequence "D[LI]LG[LIV][LM][VL][EQKJ" (SEQ ID NO.24) is generally found in CYP72A genes and constitutes a third region of amino acid similarity that is diagnostic for CYP72A genes that can encode ABA hydroxylase activity.
  • CYP72C1 does not show conservation in this region.
  • the only other Arabidopsis protein that has been shown to contain this sequence is a P450 monooxygenase named CYP709B1, which is not a member of the CYP72A subfamily.
  • CYP709B1 does not have the other conserved amino acid sequences and hence would not be a candidate for ABA hydroxylase activity.
  • Other P450 monooxygenase genes that have related sequences include CYP72B1, which has a conservative substitution of T in the 7th position ([NLI]).
  • CYP72A has a conservative substitution of T in the 7th position ([NLI]).
  • CYP72A genes Another plant species that contains a small number of CYP72A related sequences is rice, (Oryza sativa), which also has 9 CYP72A genes, similar to that seen for Arabidopsis. (http://dmelson.utmem.edu/rice.cyp72as.html).
  • the designation of the rice CYP72A genes which are clustered on chromosome 1 are as follows:
  • CYP72A19 AP002839 Oryza sativa genomic DNA chromosome 1 51708- 53699 CYP72A20 AP002839 Oryza sativa genomic DNA, chromosome 1 56581-
  • CYP72A24 AP002839 Oryza sativa genomic DNA chromosome 1 109964-113787 CYP72A25 AP002839 Oryza sativa genomic DNA, chromosome 1
  • deduced amino acid sequences are used more frequently than cDNA sequences in order to focus on structural features of the derived protein.
  • the similarity of the rice CYP72A deduced protein sequences to the Arabidopsis CYP72A protein sequences ranges from 46 - 55%. This range of similarity is typical of the range of similarity already identified between the Arabidopsis gene family and the comparison of that gene family to SEQ ID NO:2.
  • the rice CYP72A gene family described above represents genes encoding an ABA hydroxylase activity.
  • Lolium rigidum clone Lol-83 AF321870 78% to 72A18 (rice)
  • Lolium rigidum clone Lol-79 AF321869 79% to 72A18 (rice)
  • Lolium rigidum clone Lol-78 AF321868 78% to 72A18 (rice)
  • Lolium rigidum clone Lol-62 AF321867 77% to 72A18 (rice)
  • Lolium rigidum clone Lol-22 AF321866 78% to 72A18 (rice)
  • the clone Lol-83 AF321870 has 54% similarity to the Arabidopsis CYP72A15 clone.
  • members of the CYP72A family in plants that are associated with ABA hydroxylase activity are typically found to have between 50 and 80% similarity at the protein level between unrelated plant species. Within a plant species that similarity can be as high as 92%. Even between monocots and dicots the similarity of the coding regions does not fall below 50%.
  • CYP72A genes are found among diverse species.
  • a TBLASTN similarity search of the TIGR Gene Indices database http://www.tigr.org/tdb/tgi.shtml was conducted and the results reveal that many CYP72A sequences previously identified can now be assigned a potential function in ABA catabolism.
  • Representative CYP72A sequences identified in this database include:
  • Tomato TIGR contig TC85158 (26 ESTs) TIGR contig TC94028 (47 ESTs) TIGR contig TC93825 (45 ESTs) TIGR contig TC85178 (29 ESTs)
  • Medicago trunculata TIGR contig TC31893 (33 ESTs) TIGR contig TC32102 (44 ESTs) TIGR contig TC28776 (4 ESTs) TIGR contig TC28751 (16 ESTs)
  • TIGR contig TC76645 (2 ESTs)
  • TIGR contig TC76455 (3 ESTs)
  • CYP72A sequences that are highly similar to CYP72A sequences both at the overall protein identity as well as at the level of specific conserved sequences to identify genes that encode an ABA hydroxylase activity. Identification of these sequences allows the isolation of an ABA hydroxylase gene by routine procedures such as identification of specific ESTs or sequences that are induced or expressed in response to ABA related physiological changes, or by matching the expression pattern of these sequences to expression patterns that are typical of ABA related genes.
  • identification of CYP72A sequences that are associated with physiological events associated with ABA provides an important element for screening within the CYP72A family for functional genes and genes most likely to encode an ABA hydroxylase activity.
  • ABA-hydroxylase is found predominantly in dividing and meristematic tissues, as well as leaves. There is reduced expression in the dark.
  • ABA hydroxylase is up-regulated in leaves relative to flowers, down-regulated in iron deficient plants, up-regulated under conditions of high CO2, up-regulated in some mutants and down-regulated in suspension cells relative to leaves.
  • Genbank was conducted to generate a list of Arabidopsis CYP72A ESTs; a total of 27 EST records were found.
  • CYP72A genes are not limited in their expression to particular tissues; CYP72A9 and CYP72A13 are the only members of this gene family so far found in developing seed tissues; CYP72A8 has so far only been isolated from roots; CYP72A10 has not been associated with any ESTs. It is believed that the genes most likely to be involved in ABA catabolism in planta are CYP15, CYP14, CYP13 and CYP11 based on the EST prevalence data and expression analysis of these cDNAs using microarrays (StanfordMicroarrayDatabase).
  • (+)-ABA 7'-hydroxylase activity is found naturally in plants and this observed activity in yeast may represent an allelic variant within this gene family.
  • the present inventors have accumulated a substantial set of data that demonstrates that the newly discovered polynucleotides encode ABA hydroxylase enzymes.
  • the supporting data includes: isolation of a P450 cDNA (pJK6-29, and subsequently the full-length conesponding cDNA pBEl 0-30-3) from the ABA-induced subtracted maize cDNA library; confirmation by Northern expression analysis that this P450 coding sequence is induced by ABA; the time-course of that induction is consistent with this P450 being ABA 8'-hydroxylase; isolation of a full-length maize cDNA that allows for expression of enzyme activity in plant cells; isolation of homologous ABA hydroxylase sequences from other plant species and; demonstration in yeast of (+)-AB A 7'- hydroxylase activity with the homologous Arabidopsis CYP72A7 sequence.
  • JK6-29 cDNA and pBE 10-30-3 sequences it is possible to isolate polynucleotides encoding ABA hydroxylase activity. These polynucleotides may be used to alter ABA catabolism in plant cells.
  • RNA inhibition technologies such as antisense RNA (e.g., US 4,801,540, US 5,107,065; US 5,453,566 , use of ribozymes (e.g., US 4,987,071; US 5,037,746; US 5,116,742; US 5,354,855) or co-suppression (e.g., US 5,034,323; 1994, US 5,283,184, & US 5,231,020) or double stranded RNA interference (Chuang C.-F. and Meyerowitz E.M., 2000, PNAS 97: 4985-4990, Smith N.A., et al, 2000, Nature 407: 319-320) is contemplated within the scope of the present invention.
  • antisense RNA e.g., US 4,801,540, US 5,107,065; US 5,453,566
  • ribozymes e.g., US 4,987,071; US 5,037,746; US 5,116,
  • the isolated ABA hydroxylase gene sequence is operably linked to a suitable regulatory element.
  • the chimeric gene is introduced into a plant cell and a plant cell recovered wherein said gene is integrated into the plant chromosome.
  • the plant cell is induced to regenerate and a whole plant is recovered.
  • inhibition of the expression of an ABA 8 '-hydroxylase may provide a number of beneficial characteristics to plants. These may include: increased seed dormancy to allow fall planting of certain crops, reduced stomatal conductance to reduce water loss, reduced growth rate in some crops to better control production, reduced shoot growth versus root growth to allow for greater establishment of a crop, larger seeds because of more storage product accumulation and in general greater stress tolerance.
  • over-expression of ABA hydroxylation enzymes can be used as a mechanism for altering ABA levels. This method may employ the use of the coding sequence, under the control of an appropriate promoter, to express ABA hydroxylation activity in a temporal and spatial fashion not normally found in plants.
  • the promoter may be constitutive, tissue specific or inducible.
  • Expected results of over-expression of ABA 8 '-hydroxylase in plants leading to ABA deficient plants include: seeds that may germinate faster after collection, seeds may be non-dormant whereas before they might have been dormant, increased branching, changes in fertility, reduced plant stature and leaf area (dwarf plants), reduced root growth versus shoot growth to provide more biomass.
  • the method further relies on the use of transformation to introduce the gene encoding the enzyme into plant cells. Transformation of the plant cell can be accomplished by a variety of different means. Methods that have general utility include Agrobacterium based systems, using either binary and cointegrate plasmids of both A. tumifaciens and A. rhyzogenies.
  • the subject method includes a method for modifying the catabolism of ABA in a plant comprising: (a) Introducing into a plant cell capable of being transformed and regenerated to a whole plant a genetic construct comprising a first DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in plant cells, a DNA sequence that encodes the polynucleotide encoding a plant ABA hydroxylase sequence, said sequence encoding a ABA 7' or 8 '-hydroxylase activity, operably linked to a suitable transcriptional regulatory region and,
  • the polynucleotide encoding the ABA hydroxylase sequence can be in the antisense (for inhibition by antisense RNA) or sense (for inhibition by co-suppression, or over-expression) orientation, relative to the transcriptional regulatory region, or a combination of sense and antisense RNA to induce double stranded RNA interference.
  • a transcriptional regulatory region is often referred to as a promoter region and there are numerous promoters that can be used within the scope of the present invention.
  • any number of specific alterations in ABA catabolism will lead to changes in processes and plant physiology controlled by ABA. These include alteration in water loss or transpiration and water use efficiency; responses to pathogens and wounding; embryogenesis, seed development and maturation including seed storage product accumulation (protein, oil), seed dormancy, seedling vigour and seed desiccation tolerance; plant architecture, including root growth and mo ⁇ hology, plant height and root-to-shoot ratios; abiotic stress tolerance; fertility and reproduction; and fruit (silique) maturation, dehiscence and abscission.
  • Alteration in ABA catabolism by increased or decreased expression of ABA hydroxylase enzymes can include changes in: Abscission, Bud Dormancy, Fruit Ripening, Seed Maturation including the Accumulation of Storage Products, Seed Desiccation Tolerance, Plant Architecture, Fertility, Seed Dormancy, Elongation Growth, Water Loss and Root Growth, and Abiotic Stress Tolerance.
  • Other alterations of plant physiology may also be envisioned by the use of the ABA hydroxylase enzymes and the use of a tissue specific or inducible promoter.
  • coding sequences can be used to isolate genes from other plant species with similar function.
  • members of the CYP72A gene family have been shown to encode an ABA hydroxylase activity, and there are many highly similar sequences in other plant species that can be easily evaluated for ABA hydroxylase activity as described herein.
  • homologous sequences to pBEl 0-30-3 are P450 monooxygenases that are found associated with stress or developmental conditions known to be modulated by ABA.
  • the activity of these enzymes may be used directly or be modified to hydroxylate substrates related to ABA.
  • analogs of ABA have been described where the ABA molecule is modified to resist degradation (US 6,004,905).
  • These modified ABA compounds could be used as novel herbicides since application of these compounds would lead to persistent ABA effects, including growth retardation in some cases.
  • Modification of the T- and 8'- hydroxylase genes to more effectively degrade these modified ABA compounds would allow those plants comprising a modified ABA hydroxylase gene to grow more efficiently in the presence of the modified ABA analogs than plants without the modified hydroxylase activity.
  • modification of the enzyme to oxidize ABA to produce 9'-hydroxyABA would permit a further means of manipulating ABA activities.
  • the gene encoding an enzyme capable of 7'- or 8 '-hydroxylation of ABA can be modified and/or selected for increased activity by using such techniques as site-specific modification, mutation and selection of altered specificity in heterologous systems such as bacterial or fungal cells.
  • This may include expression of the gene encoding said altered enzyme in bacterial cells unable to metabolize ABA analogs, selecting bacteria that express the enzyme and are able to hydroxylate the analogs as determined by a variety of analytical techniques including high performance liquid chromatography/ mass spectrometry (HPLC/MS).
  • plant cells or plant seeds such as those from Arabidopsis can be mutagenized and grown in the presence of the ABA analogs, under conditions where plant cells unable to catabolize the ABA analogs are unable to grow.
  • Plant or plant cells where the members of the CYP72A family, or the genes encoding 7'- and 8'- ABA hydroxylase activity are altered and are now able to catabolize the ABA analogs are selected, and using the sequences provides in this specification, the modified genes can be isolated and the nature of the modification determined.
  • cDNA inserts from individual clones of this subtracted library were PCR amplified and arrayed on nylon membranes according to the methods outlined in Clontech's PCR-Select Differential Screening kit. 420 clones were a ⁇ ayed on duplicate nylon membranes and these were differentially screened using 32 P-labelled subtracted probes (#3, IND / S and #1 , NI / S).
  • cDNAs showing greater expression with the IND / S probe compared to the NI / S probe were candidate clones possibly up-regulated by (+)-ABA in co suspension cells. These putatively ABA- regulated clones were sequenced and identities detennined by BLAST searches of GenBank. In addition, cDNA clones were randomly sequenced, and later the entire subtracted library was sequenced.
  • N; non-ABA-induced and non-subtracted, IND / S; ABA-induced and subtracted, IND / N; ABA-induced and non-subtracted) resulting from the subtractive hybridization were amplified by PCR and equivalent amounts were loaded onto an agarose gel. After transfer to nylon membrane the blot was probed successively with radiolabeled rice actin cDNA and subtracted ABA- induced cDNA (IND / S).
  • the cDNA subtraction was successful in identifying uniquely expressed genes in response to ABA induction. Actin, an abundant constitutively expressed gene was effectively removed and the cDNAs in the ABA-induced subtracted probe were very different from those in the non-ABA-treated subtracted cDNA probe. As well, the ABA-induced subtracted cDNA pool contained genes that were expressed in greater abundance in the ABA-induced cDNA pool as compared to the non-ABA-treated cDNA pool. This is shown in Figure 1.
  • Subtracted ABA-induced cDNAs were PCR amplified and cloned into the Clontech pT-Adv vector. Clones were selected randomly from this ABA- induced subtracted library and the inserts amplified by PCR. The PCR- amplified inserts were arrayed in duplicate on nylon membranes and probed with radiolabeled subtracted non-ABA-induced cDNA (NI / S) and subtracted ABA-induced cDNA (IND / S). Clones that showed at least a 3 to 5-fold greater intensity of labeling with the IND / S cDNA probe were deemed to be upregulated by ABA in this first screen. Plasmids were sequenced. One of these, pJK6-29, was a C-terminal fragment of a cytochrome P450 monooxygenase. This clone is indicated with a box on the nylon cDNA array shown in Figure 2.
  • the proportion of ABA-induced cDNAs in the subtracted library was estimated at 30-40% based on the initial differential screening and secondary screens that were carried out by spotting the individual cDNA clones on nylon membranes and screening with subtracted non-induced and induced probes as evident from Figure 2. From the sequencing data the cDNAs in the subtracted library are mostly regulatory genes or cDNAs representing rarer mRNAs. There were no constitutively expressed abundant sequences.
  • the upregulated genes in the ABA-induced subtracted library include genes known to be induced by ABA, for example LEAs (late-embryogenesis abundant proteins).
  • the isolated P450 cDNA (pJK6-29) was used as a probe against the four cDNA pools resulting from the subtractive hybridization (as described in example 1).
  • This cytochrome P450 was upregulated by ABA (compare NI / N and IND /N) and successfully amplified within the subtracted ABA-induced cDNA pool (compare NI /S and IND / S). The results of this analysis are shown in Figure 3.
  • RNA isolated from non-ABA-induced and ABA-induced (9 hr at 200 ⁇ M (+)-ABA) BMS com suspension was probed with radiolabeled pJK6- 29.
  • the Northern blot confirmed that this P450 was upregulated by (+)-ABA in com suspension cells ( Figure 4).
  • Example 5 Evaluation of expression pattern of JK6-29 following ABA induction. Further Northern blot analysis was carried out. In this experiment, the time course of gene expression was compared with the appearance of ABA 8'- hydroxylase activity.
  • ABA 8 '-hydroxylase activity was determined by in vitro assay (see Krochko J.E., et al, 1998, Plant Physiol 118: 849-860) with isolated microsomes isolated from BMS com suspension cells at defined periods after the addition of 200 ⁇ M (+)-ABA. Enzyme activity was assayed at 0 (control), 3, 6, 9, 12, 16, 20.5, 25.5 and 28.5 hours after the addition of (+)-ABA.
  • a full-length sequence for the com CYP72A cDNA has been obtained by a sib-selection strategy (Alfandari D. and Da ⁇ ibere T., 1994, In PCR Methods and Applications, pp 46-49, Cold Spring Harbour) from a full-length cDNA library made from RNA extracted from ABA-induced BMS com suspension cells, screened by PCR with primers designed specifically for the JK6-29 sequence.
  • SEQ ID NO:8 5' GCTCGGTGGAATCAAATATCC 3'.
  • the putative full-length sequence was cut out of pYES2 (pBE 10-30, EcoRI / Notl insert) with BamHI and Notl and subcloned into pT-Adv (Clontech) (pBEl 0-30-3) and was sequenced first using vector primers to determine whether it was full-length. On the basis of this sequence infomiation and sequences of partial length clones the following sequencing primers were designed.
  • SEQ ID NO:9 5' GATTCCTGACCCAGAGTTAG 3',
  • the full-length cDNA sequence is given in SEQ ID NO:2. Comparison of this full-length sequence pBE10-30-3 confirmed that this P450 contains the pJK6-29 sequence and is related to the CYP72A gene family.
  • cDNA was PCR-amplified from plasmid pBEl 0-30-3, adding BamHI and EcoRN sites to the sequence at the ⁇ -terminal and C-terminal ends, respectively.
  • Primers used are:
  • PCR conditions were 94°C for 30 sec, then 5 cycles of 94°C/30s, 50°C/30s, 68°C/120s and 25 cycles of 94°C/30s, 60°C/30s, 68°C/120s followed by an extension step at 68°C for 3 minutes, using Clontech' s Advantage 2 Polymerase Mix.
  • the PCR product was TA cloned into pT-Adv (Clontech) and the sequence confirmed by sequencing (pTAdv.ComP450).
  • Vector pYeDP60 was cut with BamHI and Smal and the cornP450 insert was cut from ⁇ pTAdv.ComP450 with BamHI and EcoRV and gel-purified.
  • the vector and insert were ligated to make YeDP60.CornP450 ( Figure 9) and the orientation and sequence fidelity were confirmed by sequencing again.
  • Example 7 Isolation of homologous clones from other plant species.
  • CYP72A P450 subfamily Several P450 ESTs belonging to the CYP72A P450 subfamily were obtained from ABRC (Arabidopsis Biological Resource Center) and the inserts were sequenced and the sizes determined. These P450s included full-length sequences for CYP72A7 and CYP72A14.
  • cDNA was PCR-amplified from the ABRC plasmid 187N22T7 with gene-specific PCR primers, adding BamHI and Kpnl sites to the N-terminal and C-terminal ends, respectively using the following primers.
  • PCR conditions were 94°C for 30 sec, then 5 cycles of 95°C/30s, 50°C/30s, 68°C/150s and 20 cycles of 95°C/30s, 68°C/180s, followed by an extension step at 68°C for 5 minutes, with Advantage 2 Polymerase Mix (Clontech).
  • the pYEDP60 vector and PCR product were cut separately with BamHI and Kpnl, and then the linearized vector and PCR product were gel- purified.
  • Plasmid pYeDP60.Ath30-2 ( Figure 10) was isolated from selected colonies and the insert confirmed by sequencing.
  • CYP72A14 (Ath29): clone 181D14T7 received from ABRC (GB
  • H36956 was similarly analyzed. Full-length was confirmed initially by sequencing using vector primers, followed by sequencing with gene-specific primers.
  • cDNA was PCR-amplified from the ABRC plasmid 181 D 14T7 using gene-specific PCR primers adding Kpnl and EcoRI sites to the sequence at the N-terminal and C-terminal ends, respectively. Primers used:
  • PCR conditions were 94°C for 30 sec, then 5 cycles of 95°C/30s, 55°C/30s, 68°C/150s and 20 cycles of 95°C/30s, 68°C/180s, followed by an extension step at 68°C for 5 minutes, using Clontech's Advantage 2 Polymerase Mix.
  • the pYEDP60 vector and PCR product were cut separately with Kpnl and EcoRI, and then the PCR products gel-purified.
  • the PCR product was ligated into the cut vector and transfonned into TOPIOF' competent cells. Plasmid pYeDP60.Ath29-3 ( Figure 11) was isolated from selected colonies and the insert confirmed by sequencing .
  • Example 8 Expression of ABA hydroxylase genes in heterologous systems.
  • the cDNAs were transfe ⁇ ed into the expression vector pYeDP60 (Pompon D., et al, 1996, Method Enzymol 272: 51-64), and purified recombinant plasmid was subsequently transformed into WAT 11 and WAT 21 yeast strains over-expressing the Arabidopsis cytochrome P450 reductases, CTR1 and CTR2, respectively (Pompon et al.Jbid).
  • Plasmid was isolated from pYeDP60.CornP450 ( Figure 9), pYeDP60.Ath30-2 ( Figure 10) and pYeDP60.Ath29-3 ( Figure 11) and used to transform yeast strains, WAT 11 and WAT21, using a Li Acetate technique (Kohlami S.E., et al.,1997, In Differentially Expressed Genes in Plants, Taylor and Francis, pp 63-83). Transformants were selected on SC minus URA (6J g/L yeast nitrogen base without amino acids (BIO-101), 1.8 g/L uracil drop-out powder) containing 2% Glucose. Yeast transformation was confirmed by PCR.
  • YPG yeast extract, peptone lOg/L, glucose 20g/L
  • YPL yeast extract lOg/L, peptone lOg/L, galactose 20g/L
  • OD 0.5 OD 0.5 in YPL
  • (+)-ABA was added at 20 ⁇ M to 50 ⁇ M.
  • the cultures were incubated for 24 hours at 30°C with shaking.
  • the culture media was collected by centrifugation of the entire culture volume at 5000 m for 15 minutes.
  • the media was acidified with HCL (0.166 N final concentration) and re-centrifuged to remove additional protein contamination.
  • One to 10 mis of the sample was loaded onto an Oasis HLB column (Waters) to purify ABA and AB A- metabolites and the resulting eluant was analyzed by LC/MS/MS.
  • ABA 7'-hydroxylase activity was demonstrated by LC/MS/MS in the cultures in which the CYP72A7 gene was inserted in the pYeDP60 vector (pYeDP60.Ath30-2) and this constmct transformed into the WATl 1 yeast strain ( Figure 6).
  • the WAT21 yeast strain did not support any ABA hydroxylase activity in these experiments.
  • cDNAs were cloned into a 35S expression cassette in pJIT61 (received from Roger Hellens and Phil Mullineaux; http://www.pgreen.ac.uk/).
  • the expression cassette containing the gene of interest was then subcloned into the MCS of the binary vector pCAMBIA 2300 (received from CAMBIA; http://www.cambia.org/).
  • the insert was confirmed by restriction digests and the resultant plasmid construct was used to transform Agrobacterium strain MP90.
  • yeast expression constmct pYeDP60.Ath30-2 was cut first with Kpnl and BamHI.
  • the Ath30-2 insert was gel-purified and blunt-ended with T4 DNA polymerase.
  • pJIT61 vector was cut with Smal to give a linearized and blunt-ended vector and was dephosphorylated using CIAP (calf intestinal alkaline phosphatase).
  • CIAP calf intestinal alkaline phosphatase
  • pJIT61.Ath30-2Forward, pJIT61.Ath30-2Reverse Figure 12
  • the pJIT61.Ath30-2Forward and pJIT61.Ath30-2Reverse plasmids were cut with Xhol, blunt-ended with T4 DNA polymerase and re-cut with Kpnl to liberate the 35S.Ath30-2Forward and 35S.Ath30-2Reverse cassettes. These fragments were gel-purified.
  • pCAMBIA2300 was cut with Hindlll, blunt- ended and re-cut with Kpnl.
  • the 35S-P450 cassettes were ligated into pCAMBIA2300 to give plasmids pCAMBIA2300.Ath30-2Forward and pCAMBIA2300.Ath30-2Reverse ( Figure 12). These plasmids were transformed into Agrobacterium strain MP90 and these cultures were used to transform Arabidopsis thaliana (strain Columbia) by the floral dip method (Clough S.J and Bent A.F., 1998, Plant J 16: 735-743). Plants were obtained and analyzed for the presence of the inserted gene.
  • Arabidopsi /plant transformation the yeast expression constmct pYeDP60.Ath29-3 was cut with Kpnl and EcoRI, and the insert was gel- purified and blunt-ended with T4 DNA polymerase.
  • pJIT61 was cut with Smal to give a linearized and blunt-ended vector and was dephosphorylated using CLAP (calf intestinal alkaline phosphatase).
  • CLAP calf intestinal alkaline phosphatase
  • the Ath29-3 fragment was ligated into the pJIT ⁇ l vector and transformed into E. coli TOPIOF'. Purified plasmid was checked for orientation and both Ath29-3Forward and Ath29-3Reverse colonies were chosen (pJIT61.Ath29-3Forward, pJIT61.Ath29-3Reverse) ( Figure 13).
  • the pJIT61.Ath29-3Forward and pJIT61.Ath29-3Reverse plasmids were cut with Xhol, blunt-ended with T4 DNA polymerase and re-cut with Kpnl to liberate the 35S.Ath29-3Forward and 35S.Ath29-3Reverse cassettes. These fragments were gel-purified.
  • pCAMBIA2300 was cut with Hindlll, blunt-ended and re-cut with Kpnl.
  • the 35S-P450 cassettes were ligated into pCAMBIA2300 to give plasmids pCAMBIA2300.Ath29-3Forward and pCAMBIA2300.Ath29-3Reverse ( Figure 13). These plasmids were transformed into Agrobacterium strain MP90 and these cultures were used to transform Arabidopsis thaliana (strain Columbia) as described above. Plants were obtained and analyzed for the presence of the inserted gene.
  • the CornP450Forward.CaMVTerm was isolated from pJIT61.CornP450Forward by digestion with BamHI and EcoRV and gel- purified.
  • the ComP450Forward.CaMVTerm piece was ligated into the linearized p35S.CAMBIA2301 to reconstitute the 35S.P450CornForward expression cassette in the binary vector pCAMBIA2301.
  • PCR conditions were 94°C for 3 minutes, 5 cycles of 94°C/30s, 48°C/30s, 72°C/120s, 25 cycles of 94°C/30s, 57°C/30s,72°C/120s, and 72°C for 3 minutes using PfuTurbo (Stratagene).
  • the product was ligated into EcoRV cut dephosphorylated pBluescript SK(+), and transformed into TOPIOF' to give pBSK.CornP450 ( Figure 17). Colonies were selected and sequenced using gene-specific primers, as before, to ensure fidelity of the PCR amplification.
  • the cornP450 insert was excised from pBSK.ComP450 by cutting with Hpal and Xbal and gel-purified.
  • the purified insert was ligated to Xbal and Smal cut pJIT61 vector to give pJIT61.ComP450Reverse ( Figure 17).
  • This vector was cut with Xbal and EcoRV and the ComP450Reverse.CaMVTerm piece was gel- purified.
  • the CornP450Reverse.CaMNTerm was ligated into p35S.CAMBIA2301 that had been cut with Pstl, blunt-ended and then cut again with Xbal.
  • the structure of the resultant vector pCAMBIA2301.CornP450Reverse (Figure 18) was verified by restriction digests, sequenced and trnsformed into Agrobacterium strain MP90.
  • Example 12 Construction of Plant Transformation Vectors Using an Inducible Promoter and a CYP72A Gene It some instances it is desirable to have a CYP72A gene under the control of a inducible promoter.
  • the cDNAs were cloned into the binary vector pBINHygTX (Gatz C, et al, 1992, Plant J 2: 397-404). This promoter is repressed in plants expressing the TetR gene but de-repressed when tetracycline is applied to the plant (Gatz et al.Jbid). In this way specific temporal and spatial expression can be achieved. Tobacco seeds from plants already expressing TetR were received from Christiane Gatz. Expression of TetR was confirmed by Northern blot expression analysis.
  • the vector pYeDP60.Ath30-2 was cut with BamHI, blunt-ended with T4 DNA polymerase and the Ath30-2 gene insert was liberated by a final cut with Kpnl.
  • the Ath30-2 insert was gel- purified.
  • pBINHygTx was cut with Hpal and Kpnl sequentially and the Ath30- 2 insert ligated to the Hpal/Kpnl cut vector to give pBINHygTx.Ath30-2 ( Figure 19).
  • the plasmid constmction was confirmed by restriction digestion and sequencing.
  • pYES2.Ath29-4 sequence was PCR amplified (as described for pYeDP60.Ath29-3), cut with EcoRI and Kpnl to expose the ends, and ligated into pYES2 vector cut with EcoRI and Kpnl).
  • pYES2.Ath29-4 was cut with Xbal and Kpnl and the gel-purified insert was ligated into Xbal/Kpnl cut pBINHygTx.
  • Ath29-4 ( Figure 20), was confirmed by restriction digestion and sequencing.
  • the CornP450 insert was cut from ⁇ BSK.CornP450 with Hpal and Xbal, gel-purified and ligated into pBINHygTx vector cut with Hpal and Xbal to give pBINHygTx. CornP450 ( Figure 21). This plasmid was purified and the plasmid construction confirmed by restriction digestion and sequencing.
  • the plasmids pBINHygTx. Ath30-2, pBINHygTx.Ath29-4 and pBINHygTx.CornP450 were transformed into Agrobacterium MP90. Successful Agrobacterium transformation was confirmed by restriction digestion of isolated plasmid.
  • the vectors pBINHygTx.Ath30-2, pBINHygTx.Ath29-4 and pBINHygTx. CornP450 were used to re-transform tobacco, already expressing the TetR. Tobacco plants were selected on hygromycin due to the presence of kanamycin resistance in the TetR plants. Plants were obtained and analyzed for the presence of the inserted gene.
  • SEQ ID NO: 14 Synthetic DNA 5 'ATGGATCCATGCTGCGGGAAGTCTCTC 3 '
  • SEQ ID NO: 17 Synthetic DNA 5' TCGTGGTACCAAATCAGAGCTTGTGCAG 3'

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Organic Chemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Molecular Biology (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Endocrinology (AREA)
  • Cell Biology (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Agricultural Chemicals And Associated Chemicals (AREA)

Abstract

The present invention relates to plant enzymes responsible for hydroxylation of abscisic acid, said enzymes capable of 7'- and 8'- hydroxylation of abscisic acid, and polynucleotides encoding the same. The invention further relates to methods for using said polynucleotides to alter plant metabolism, in particular metabolism of abscisic acid. The invention further relates to plants exhibiting altered characteristics as a result of the alteration of abscisic acid metabolism.

Description

ABSCISIC ACID 8'- AND T- HYDROXYLASE GENES AND RELATED SEQUENCES FROM PLANTS
BACKGROUND OF THE INVENTION
1. FIELD OF THE INVENTION
The present invention relates to plant enzymes responsible for the inactivation of the biological activity of abscisic acid, said enzymes capable of 7'- and δ'-hydroxylation of abscisic acid, polynucleotides encoding the same and methods to use said polynucleotides to alter plant metabolism.
2. BACKGROUND ART
The phytohormone S-(+)-abscisic acid (ABA) plays regulatory roles in a host of physiological processes in all higher as well as lower plants. ABA mediates stress tolerance responses in higher plants, is a key signal compound that regulates water loss or transpiration and, in concert with other plant signaling compounds, is implicated in mediating responses to pathogens and wounding. In plant seeds, ABA promotes seed development, desiccation tolerance, and inhibition of germination. ABA affects plant architecture, including root growth and morphology, root-to-shoot ratios, and plant fertility and reproduction.
The plant growth regulator ABA has been the subject of study for many years. However little is known in regarding the control of ABA levels or the specific mechanisms by which ABA mediates its activity. Specific physiological processes that are known to be mediated at least in part by ABA include those related to a number of important agronomic characteristics.
ABA concentrations are important for stages of embryogenesis, and for plant growth and development in general. Plant architecture, size and yield are affected by levels and metabolism of ABA. Examples of the potential effects of manipulating ABA levels follow.
Increased ABA levels have been shown to increase expression of genes involved in lipid accumulation in microspore-derived B. napus embryos. Experiments utilizing long lasting ABA analogs (i.e. ABA analogs that act as ABA agonists and are not subject to degradation by 8'-hydroxylation, Abrams S.R., et al, 1997, Plant Physiol 114: 89-97) provide a prolonged, higher intensity ABA-like signal than that produced by ABA itself, with resulting increases in oil accumulation relative to untreated and ABA-treated embryos (Qi Q., et al, 1998, Plant Physiol 117: 979-987). Thus ABA activity has been clearly demonstrated to have important and potentially beneficial effects on oil accumulation in oilseeds. Therefore increasing ABA content of embryos by reducing catabolism is likely to be beneficial in terms of increased oil accumulation.
In addition to oil accumulation, seed protein accumulation, including storage proteins, is dependent upon ABA in many crop species. For example, in B. napus the accumulation of seed proteins (napin, oleosin and cruciferin) including late embryogenesis abundant proteins (LEA's), increases in response to ABA treatments. In maize and wheat, globulin accumulation is dependent on ABA activity (Bewley J.D. and Black M., 1994, Seeds: Physiology of Development and Germination. Plenum Press, New York and London). Therefore ABA plays an important role in storage protein biosynthesis in seeds. ABA promotes maturation and desiccation tolerance in seeds, and high ABA levels accelerate seed maturation (Green B.R., et al, 1998, Physiol Plantarum 104: 125-133).
ABA promotes maturation and desiccation tolerance in seeds, so seed maturation will be accelerated by alteration of ABA activity (Johnson-Flanagan A.M., et al, 1992, Plant Physiol 99: 700-706). An aspect of this function in canola is that ABA is implicated in chlorophyll clearing in maturing B. napus seed (Green et al. bid). The green seed problem in oilseed canola (persistence of seed chlorophyll after frosts leading to discolored oil) can be potentially modulated by controlling ABA levels.
In response to abiotic stresses such as cold, heat and drought, levels of ABA rise in plants, triggering biochemical and physiological responses to accommodate the stress. ABA directly causes closure of stomata and reduced transpiration. Mutants of Arabidopsis thaliana have been produced that have increased sensitivity to ABA (Bonetta D. and McCourt P., 1998, Trends Plant Science 3: 231-235) and appear more stress tolerant. Combining this hypersensitivity to ABA with increased ABA levels during perception of stress may lead to a further enhancement of stress tolerance in transgenic crops such as canola.
Genetic and physiological data indicates that ABA is involved in maintaining and inducing dormancy as well inhibiting germination (Bewley and Black, ibid, Bonetta and McCourt, ibid). Therefore germination of seeds can be inhibited by ABA, whether supplied exogenously or synthesized in the seed.
Inappropriate dormancy regulation causes problems in a variety of crops in specific situations. These problems may be abolished by fine-tuning ABA levels in seeds. Preharvest sprouting in cereals is a problem that occurs when germination of the seed in the head proceeds prematurely and is facilitated by high moisture levels. The problem is acute for malting barley that is bred for low dormancy.
An example of a situation in which fine-tuning the seed dormancy of a crop would be advantageous is provided by fall seeding of annual crops. Fall seeding of some normally spring-sown amiual crops (e.g. spring canola), affords early spring germination and emergence resulting in a longer season for plant maturity. Early emergence also allows the seedling to take better advantage of accumulated winter moisture and avoid pests and pathogens. Flowering can occur earlier in the season and heat stress is avoided. However, premature fall germination (of spring crops sown in the fall) can result in counterproductive winterkill. Therefore adjusting ABA levels so that seed remains dormant in the fall, but germinates relatively early in the following spring would allow growers to take full advantage of fall seeding.
Exogenous application of ABA and related ABA analogs have been shown to cause a shift in the ratio of shoot to root growth, favouring increased root growth. Therefore, increased endogenous ABA levels could result in altering the balance in crop plants to permit greater root growth and better nutrient and water uptake.
"Crosstalk" or interactive, cooperative and combined effects between plant growth regulators and other signaling molecules including sugars have been documented (Moller S.G. and Chua N-H., 1999, J Mol Biol 293: 219-234). Auxins are thought to work through ethylene and ABA. Thus ABA plays an important role in the physiological control of plant developmental processes and influences processes not normally specifically associated with ABA action. For example, ABA influences the ability to set flowers, therefore alteration in ABA metabolism has consequences for male and female sterility and seed production.
The biosynthesis and metabolism of ABA is only partly understood (Cutler A.J. and Krochko J.E., 1999, Trends in Plant Science 4: 472-478). ABA is produced within plant cells in response to physiological and developmental signals. As evidenced above, once produced, ABA affects a number of physiological processes important to plant growth and development. ABA is one of the primary plant growth regulators that have been the object of study for some time. ABA, in conjunction with the plant growth regulators auxins, cytokinins, brassinosteroids, gibberellins and ethylene represent the predominant molecules for the hormonal control of plant growth. Hence the control of ABA synthesis and degradation is an important factor in the control of plant growth and development.
In order to improve plant performance and increase plant productivity, it is advantageous to manipulate plant growth regulator concentrations as a means to control plant growth. Typically manipulation of the effects of plant growth regulators has been through the development and application of analogs, development and use of compounds that inhibit the production or transport of plant growth regulators, or the application of synthetic versions of plant growth regulators.
Alternatively it is possible to manipulate the response of plant cells by inhibition or alteration of the natural metabolism of plant hormones, thus altering the natural levels by either increasing or decreasing the rate at which the growth regulator is metabolized. For naturally occurring plant growth regulators, plant cells typically modulate the levels of these substances by balancing synthesis and degradation (Cutler A.J. and Krochko J.E., 1999, TIPS 4: 472-478, Zeevaart J.A.D., 1999, In Biochemistry and Molecular Biology of Plant Hormones, pp 189-207).
A primary control point for maintaining growth regulator levels in plant cells is believed to be the metabolism through control of enzymatic activity responsible for the biochemical conversion of a plant growth regulator to an inactive or substantially less active compound. The degradation of plant growth regulators provides a mechanism for the plant cell to rapidly alter levels of specific regulators in response to physiological conditions. This mechanism, which is usually mediated by a specific enzyme activity, can be regulated at a number of different levels including gene expression of the catabolic enzyme, specific manipulation of enzyme activity through allosteric regulation or availability of co-factors, as well as the turnover of the enzyme itself. The degradation of ABA is one of the primary control points for the mediation of ABA activity in plant cells.
ABA, once produced or transported into a plant cell is metabolized very quickly. The molecule is susceptible to rapid enzymatic degradation through oxidative catabolism to 8'-hydroxyABA, with subsequent conversion to (-)- Phaseic Acid (PA) and in some tissues reduction to (-)-Dihydrophaseic Acid (DP A). These latter compounds are generally not as active as ABA in mediating physiological responses, thus, as a consequence of these conversions the effectiveness of ABA synthesized in, or imported into tissues is reduced. These compounds derived by catabolism of ABA can then be further catabolized within the cell.
The key step in the catabolism of ABA is the hydroxylation activity. It is believed that an 8'-hydroxylase activity is the predominant means for inactivation and catabolism of ABA, but it has also been postulated that a T- hydroxylase can produce (+)-7'-hydroxyABA from (+)-ABA. This process also leads to inactive compounds and hence conversion of ABA to 7'-hydroxyABA is another mechanism for the catabolism of ABA. It has also been postulated that a reductase activity may function in the conversion of ABA to ABA cis- l',4'-diol, the extent to which this operates in vivo is unknown. In addition, the formation of inactive ABA conjugates through the activity of a glucosyltransferase also has been implicated as a means of modulating concentrations of hormonally active ABA in plant cells. Nonetheless, the published evidence suggests that the primary pathway for degradation of ABA is through hydroxylation, and the predominant activity appears to be the 8'- hydroxylase activity (Cutler and Krochko, ibid).
Experimental evidence implicates the turnover of ABA to be a critical factor in controlling ABA responses in plants and mediation of ABA effects. Some of the metabolic markers used to identify tissues expressing ABA hydroxylase enzymes include the disappearance of internal or externally applied ABA, accumulation of PA and DPA, and reduced sensitivity to applied ABA (Uknes S.J. and Ho T.H.D., 1984, Plant Physiol 75: 1126-1132, Garello G. and LePage-Degivry M.T., 1995, Plant Physiol 95: 45-50, Jia W., et al, 1996, J Exp Bot 47: 1085-1091, Cutler A. J., et al, 1991, J Exp Bot 48: 1787-1795, Qi Q., et α/., 1998, Plant Physiol 117: 979-987).
ABA degradation can be very rapid, the half-life of applied ABA has been observed to be 42 and 60 minutes in leaves of maize and Commelina communis, respectively (Jia et al.Jbid), and in isolated maize root tips the turnover was greater than 60% in one hour (Ribaut J.M., et al., 1996, J Plant Physiol 148: 761-764).
Evidence suggests that ABA 8'-hydroxylase activity is induced by ABA and possibly regulated by osmotic stress and phytochrome-dependent signaling pathways (Cutler et al.Jbid, Kraepiel Y., et al, 1994, Plant J 6: 665-672). Enzyme characterization indicates that ABA 8 '-hydroxylase is a member of the cytochrome P450 monooxygenase superfamily (Krochko J.E., et al, 1998, Plant Physiol 118: 849-860).
The purification of ABA 8 '-hydroxylase has not been previously achieved, thus information on the protein structure and genetic characterization of the enzyme is lacking. However, general studies on characterization of ABA 8'-hydroxylase activity in tissue extracts have provided evidence that the enzyme is a cytochrome P450 monooxygenase (see Krochko et α/.,1998, Plant Physiol 118: 849-860). In these studies ABA 8 '-hydroxylase activity (determined by in vitro assay) is transient in Black Mexican Sweet corn suspension cells (BMS cells) with a peak of activity at 16 hours after the addition of (+)-ABA to the BMS corn suspension culture medium. It was found that ABA 8 '-hydroxylase is a microsomal enzyme; ABA 8'-hydroxylase requires NADPH; ABA 8'-hydroxylase requires O2; ABA 8'-hydroxylase is inhibited by CO, tetcyclacis and oxidized cytochrome c; the CO inhibition of ABA 8'- hydroxylase is relieved by blue-light, all of these criteria showing that ABA 8'- hydroxylase is a cytochrome P450 monooxygenase.
Other studies (see Cutler et /., 1997, J Exp Bot 48: 277-287) have concluded that: the ABA 8 '-hydroxylase is induced by (+)-ABA (its substrate) in maize BMS suspension cultured cells; ABA 8 '-hydroxylase expression in corn suspension cells is short-lived even in the continuing presence of the inducing compound, (+)-ABA; induction of ABA 8 '-hydroxylase in corn suspension cells is inhibited by cycloheximide (a protein synthesis inhibitor) and cordecypin (an RNA synthesis inhibitor). These data suggest that this enzyme activity is transcriptionally regulated, i.e. (+)-ABA induces the synthesis of new mRNA for ABA 8'-hydroxylase.
Thus, biochemical characterization of enzyme requirements, appearance and overall enzyme characteristics indicate that the 8 '-hydroxylase activity responsible for the hydroxylation of ABA is a member of the P450 monooxygenase family, the expression of which is induced by the occurrence of ABA itself. The polypeptide sequence of the enzyme itself has remained elusive since many P450 monooxygenase enzymes have proved difficult to purify. Thus a gene encoding an ABA 8'-hydroxylase activity, a 7'-hydroxylase activity, or any ABA hydroxylase activity has not been described in the art. However, as more DNA sequence, and inferred protein sequences have become available from gene sequencing studies, many P450 monooxygenase coding sequences have been identified. There are a significant number of P450 genes that have been identified by sequencing, however, the function of the majority of these sequences remains unknown. Most of the sequences have not yet been ascribed a function in terms of plant metabolism or more relevant to the present problem, their role in ABA hydroxylation. Thus, the art does not provide a means to identify an ABA hydroxylase activity within the P450 monooxygenase family.
Plant cytochrome P450 monooxygenases (excluding CYP51) are named from CYP71 - CYP99 and from CYP701 upwards as new discoveries are made. There are currently 273 P450 genes named according to this scheme in Arabidopsis thaliana (http://drnelson.utmem.edu/Arabfam.html) comprising 45 distinct P450 families. Functions have been ascribed to less than 30 of these P450 genes. At present, the genes encoding an ABA 8' or 7'-hydroxylase gene has not been identified.
The search for the specific P450 gene sequence encoding an ABA hydroxylase has been undertaken in many laboratories. Many genetic screens of mutant plant lines have been carried out that should have led to the isolation of an ABA 8'-hydroxylase gene. However, these studies have not been successful and this suggests that mutants in the ABA 8'-hydroxylase gene could be lethal, or that this enzyme activity is coded by a multigene family. Thus the gene encoding the enzyme has not been unequivocally identified.
As a result of the novel screening methodology employed, and on the basis of the genetic sequences obtained by this method, the present inventors have identified a novel ABA hydroxylase gene. The results presented in this specification suggest that genes responsible for ABA hydroxylase activities are part of a multigene family with an inherent redundancy of gene function, which has prevented this gene from being isolated by current genetic methods. The methods employed within the scope of this invention have allowed these limitations to be overcome and hence led to the isolation of this genetic activity encoding an ABA hydroxylase.
4. Summary of the Invention
It is the object of the present invention to provide a P450 monooxygenase enzyme encoding an ABA hydroxylase activity.
It is another object of the present invention to provide a polynucleotide sequences encoding an ABA 8'-hydiOxylase activity.
It is another object of the present invention to provide a polynucleotide sequences encoding an ABA 7'-hydroxylase activity.
It is the object of the present invention to provide a polynucleotide sequence encoding an ABA hydroxylase activity from corn cells.
It is still another object of the present invention to provide polynucleotide sequences homologous to ABA 7'-hydroxylase and ABA 8'- hydroxylase sequences from a variety of plant species. These sequences are identified by homology to the sequences of the CYP72A P450 monooxygenase family that have been now identified as encoding ABA hydroxylase activity.
It is another object of the present invention to provide a means to utilize ABA hydroxylase activities to alter plant metabolism through the modified catabolism of endogenously produced ABA.
It is another object of the present invention to provide a means to utilize
ABA 7'-hydroxylase and ABA 8 '-hydroxylase sequences to modify plant metabolism by alteration of the activity of exogenously applied ABA. It is another object of the present invention to provide a means to utilize ABA 7'-hydroxylase and ABA 8 '-hydroxylase sequences to modify plant metabolism by alteration of the activity of exogenously applied ABA analogs.
The present invention provides nucleic acid sequences encoding a novel hydroxylase enzyme involved in catabolism of ABA. The pBE 10-30-3 cDNA sequence encodes an ABA hydroxylase gene that is expressed following ABA induction in plant cells. The gene sequence is useful for identification of related sequences from other plant species.
According to one aspect of the invention, there is provided an isolated polynucleotide comprising a nucleotide sequence encoding a polypeptide of a plant P450 monooxygenase family capable of hydroxylating ABA. The polynucleotide may be DNA or RNA.
According to another aspect of the invention, there is provided an isolated polynucleotide comprising SEQ ID NO: 1 or the complement of SEQ ID NO:l or a sequence homologous to SEQ ID NO:l or the complement of SEQ ID NO: 1.
According to another aspect of the invention, there is provided an isolated polynucleotide comprising SEQ ID NO:2 or the complement of SEQ ID NO:2, or a sequence homologous to SEQ ID NO:2 or the complement of SEQ ID NO:2.
According to another aspect of the invention, there is provided an isolated polynucleotide comprising SEQ ID NO:3 or the complement of SEQ ID NO:3, or a sequence homologous to SEQ ID NO:3 or the complement of SEQ ID NO:3.
According to another aspect of the invention, there is provided an isolated polynucleotide comprising SEQ ID NO:4 or the complement of SEQ ID NO:4, or a sequence homologous to SEQ ID NO:4 or the complement of SEQ ID NO:4.
In another aspect, the invention provides an isolated polynucleotide comprising a sequence encoding a ABA 8'-hydroxylase enzyme of a plant or a protein having the same enzymatic activity thereas.
In another aspect, the invention provides an isolated polynucleotide comprising a sequence encoding an ABA 7'-hydroxylase enzyme of a plant or a protein having the same enzymatic activity thereas.
In yet another aspect, the invention provides a chimeric gene comprising a polynucleotide sequence of the type described above, operably linked to suitable regulatory sequences.
In yet another aspect, the invention provides a method for modifying the ABA catabolism of a plant comprising: (a) introducing into a plant cell capable of being transformed and regenerated to a whole plant a genetic construct comprising a first DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in plant cells, a DNA sequence that encodes a polynucleotide as described above, operably linked to a suitable transcriptional regulatory region, and (b) recovery of a plant which contains said recombinant DNA. The polynucleotide may be in the sense or the antisense orientation relative to the transcriptional regulatory region.
In yet another aspect, the invention provides a method for modifying the ABA catabolism of a plant comprising: (a) introducing into a plant cell capable of being transformed and regenerated to a whole plant a genetic construct comprising a first DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in plant cells, a DNA sequence that encodes a polynucleotide as described above, operably linked to a transcriptional regulatory region that can be induced for expression and (b) recovery of a plant which contains said recombinant DNA. The polynucleotide may be in the sense or the antisense orientation relative to the transcriptional regulatory region.
In yet another aspect, the invention provides a method for modifying the catabolism of a plant comprising: (a) introducing into a plant cell capable of being transformed and regenerated to a whole plant a genetic construct comprising a first DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in plant cells, a DNA sequence that encodes a polynucleotide as described above, operably linked to a transcriptional regulatory region that is tissue specific, and (b) recovery of a plant which contains said recombinant DNA. The polynucleotide may be in the sense or the antisense orientation relative to the transcriptional regulatory region.
Another object of the present invention relates to the use of a polynucleotide comprising a nucleotide sequence encoding a polypeptide of a plant P450 monooxygenase family capable of hydroxylating ABA analogs.
In this aspect of the invention, there is provided a method for modifying the catabolism of ABA analogs in a plant cell comprising: (a) introducing into a plant cell capable of being transformed and regenerated to a whole plant a genetic construct comprising a first DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in plant cells, a DNA sequence that encodes a polynucleotide as described above, operably linked to a suitable transcriptional regulatory region, (b) recovery of a plant which contains said recombinant DNA, and exposing said plant cell to an ABA analog.
Said transcriptional control region may be constitutive, conditional or tissue specific in its expression pattern.
In a still further embodiment of the invention, the plant cell described above is induced to regenerate a whole plant and the whole plant comprising a novel ABA hydroxylase activity is treated with an ABA analog plant exhibiting different physiological responses at the whole plant level when compared to a plant without the novel ABA hydroxylase gene being exposed to said ABA analog.
The invention also relates to plants and plant parts transformed with a chimeric gene as described above.
The pJK6-29 (SEQ ID NO:l) and pBEl 0-30-3 (SEQ ID NO:2) sequence and related sequences CYP72A7 (SEQ ID NO:3) and CYP72A14 (SEQ ID NO:4) are used to modify catabolism of ABA by the transformation of plant cells with a plant transformation vector comprising a sense or antisense portion of the gene or a double stranded RNA comprising of both sense and antisense portions of the gene.
The pJK6-29 and pBEl 0-30-3 sequence may also be used for identification of related homologous sequences deposited in public databases through comparative techniques well-known in the art, or as hybridization probes for the identification of related cDNA or genomic sequences from various plant species where the DNA sequence information is not known.
The invention also relates to protein sequences encoding ABA hydroxylase activity, said protein sequences having at least 50% protein identity to the protein encoded by SEQ ID NO:2.
The invention also relates to proteins encoding an ABA hydroxylase activity, said proteins having conserved amino acid regions identified as 'EVLRLY' (SEQ IS NO.22) and 'DVIS[KRH]xAFG' (SEQ ID NO.23) as described herein. 5. BRIEF DESCRIPTIONS OF THE DRAWINGS
Figure 1. Evaluation of the subtractive cloning procedure for the ability to select cDNA uniquely expressed in response to ABA induction (i.e. assessment of the quality of the PCR suppression subtraction (Clonetech)). Comparison of the cDNA populations following the subtractive procedure. Four cDNA samples (NI / S; non-ABA-induced and subtracted, NI / N; non-ABA-induced and non-subtracted, IND / S; ABA-induced and subtracted, IND / N; ABA- induced and non-subtracted) resulting from the subtractive hybridization were amplified by PCR and equivalent amounts were loaded onto an agarose gel. After transfer to nylon membrane the blot was probed successively with radiolabeled rice actin cDNA and subtracted ABA-induced cDNA (IND / S). Probes: a) Rice Actin; b) Subtracted ABA-Induced cDNA (IND/S); c) Ethidium Bromide.
Figure 2. Isolation of an ABA-induced cytochrome P450 monooxygenase cDNA by screening a population of subtracted cDNA with probes from subtracted induced and subtracted non-induced tissues. The figure illustrates randomly selected cDNA clones from a subtracted ABA-induced library (PCR- amplified inserts of 48 clones arrayed in dulpicate / blot). The PCR-amplified inserts were arrayed in duplicate on nylon membranes and probed with labeled subtracted non-ABA-induced cDNA (NI / S) and subtracted ABA-induced cDNA (IND / S). Clones that showed at least a 3 to 5-fold greater intensity of labeling with the IND / S cDNA probe were deemed to be upregulated by ABA and DNA sequences were determined. One of these, pJK6-29, indicated with a box on the nylon cDNA array represents a C-terminal fragment of a cytochrome P450 monooxygenase. a) Subtracted non-induced cDNA probe (NI/S); b) Subtracted induced cDNA probe (IND/S). Figure 3. Southern blot analysis of cDNA populations obtained from induced and non-induced cells using the P450 cDNA clone pJK6-29 (333bp, C- terminal). The isolated P450 cDNA (pJK6-29) was used as a probe against the four cDNA pools resulting from the subtractive hybridization procedure. This cytochrome P450 was upregulated by ABA (compare NI / N and IND N) and successfully amplified within the subtracted ABA-induced cDNA pool (compare NI /S and IND / S).
Figure 4. Northern blot analysis with P450 cDNA pJK6-29 (333bp, C-terminal). Total RNA isolated from non-ABA-induced and ABA-induced (9 hr at 200μM (+)-ABA) BMS corn suspension was probed with radiolabeled pJK6-29 to examine the regulation of expression by (+)-ABA in corn suspension cells.
Figure 5. Comparison of ABA 8 '-hydroxylase activity and expression of pJK6- 29 mRNA after induction of plant cells with (+)-ABA. ABA 8 '-hydroxylase activity was deteπnined in BMS corn suspension cells at defined periods after the addition of 200 μM (+)-ABA. Total RNA was extracted from duplicate tissue samples and expression of the P450 clone, pJK6-29, was determined by Northern blot analysis, a) ABA 8 '-hydroxylase activity; b) mRNA accumulation JK6-29 (P450).
Figure 6. Heterologous expression of an Arabidopsis P450 ABA 7'-hydroxylase activity in yeast. The CYP72A7 cDNA from Arabidopsis thaliana was inserted into the pYeDP60 vector, transformed into the WAT11 yeast strain (but not the WAT21 yeast strain) and analyzed for the ability to metabolize (+)-ABA. The biotransformation of (+)-ABA to 7'-hydroxyAB A was assessed by High Performance Liquid Chromatography - Mass Spectrometry. (HPLC/MS/MS) 7'-hydroxyABA was excreted into the media. Measured activity was limited by access of enzyme to the substrate (ABA). Figure 7. Identification of the ENLRLY (SEQ ID NO.22) conserved amino acid sequence in CYP72A genes in plants. This figure illustrates the position of the conserved amino acid sequence found in all CYP72A genes, including those identified as encoding ABA hydroxylase activity. Conserved regions are boxed. Position of the conserved sequence is shown relative to the amino acid residue number shown on the right hand side of the listing. The specific genes encoding the protein sequences are shown on the left hand side.
Figure 8. Identification of the 'DNIS[KRH]xAFG' (SEQ ID ΝO.23) conserved amino acid sequence in CYP72A genes in plants. This figure illustrates the position of the conserved amino acid sequence found in all CYP72A genes, including those identified as encoding ABA hydroxylase activity. Conserved regions are boxed. Position of the conserved sequence is shown relative to the amino acid residue number shown on the right hand side of the listing. The specific genes encoding the protein sequences are shown on the left hand side.
Figure 9. Construction of the Yeast pYeDP60.CornP450 expression plasmid
Figure 10. Construction of the Yeast pYeDP60.Ath30-2 expression plasmid.
Figure 11. Construction of the Yeast pYeDP60.Atb.29-3 expression plasmid
Figure 12. Construction of the binary vectors, pCAMBIA2300.Ath30-2Forward and pCAMBIA2300.Ath30-2Reverse. In a first step, the 35S.Ath30-2Forward cassette or the 35S.Ath30-2Reverse cassette was cut out with Xho I, blunt ended and then cut with Kpn I.
Figure 13. Construction of the binary vectors, pCAMBIA2300.Ath29-3Forward and pCAMBIA2300.Ath29-3Reverse. In a first step, the 35S.Ath29-3Forward cassette or the 35S.Ath29-3Reverse cassette was cut out with Xho I, blunt ended and then cut with Kpn I.
Figure 14. Construction ofthe pJIT61.CornP450Forward plasmid.
Figure 15. Construction of the p35S.CAMBIA2301 plasmid.
Figure 16. Construction ofthe pCAMBIA2301.CornP450Forward plasmid. Initially, p35S.CAMBIA2301 was cut with Pst I, blunted ended and cut with Bam HI. In addition, pJIT61.CornP450Forward was cut with BamH I and EcoR V.
Figure 17. Construction of the pJIT61.CornP450Reverse plasmid.
Figure 18. Construction of the binary vector, CAMBIA2301.CornP450Reverse. Initially, p35S.CAMBIA2301 was cut with Pst I, blunt-ended and cut with Xba I. In addition, pJIT61.CornP450Reverse was cut with Xba I and EcoR V.
Figure 19. Construction of the plasmid for tetracycline-inducible expression, pBINHygTx.Ath30-2. Initially, pYeD60.Ath30-2 was cut with BamH I, blunt- ended and cut with Kpn I.
Figure 20. Construction of the plasmid for tetracycline-inducible expression, pBINHygTx.Ath29-4.
Figure 21. Construction of the plasmid for tetracycline-inducible expression, pBINHygTx.CornP450. 6. DETAILED DESCRIPTION OF THE INVENTION
Definitions
In order to provide a clear and consistent understanding of the specification and claims, including the scope to be given certain terms used therein, the following definitions are provided.
The singular forms "a," "an," and "the" include plural reference unless the context clearly dictates otherwise.
An analog of abscisic acid is defined as a molecule structurally resembling abscisic acid comprised of a six-membered ring with a side chain containing two units of unsaturation. The ring can have a double bond like abscisic acid but also may be saturated. The methyl groups of the ring may be replaced with hydrogen, chains or rings containing unsaturated carbon-carbon functional groups, or heteroatoms. The oxygens of ABA can be altered in oxidation state or can be replaced with hydrogen or other functional groups. Analogs can confer activity similar to abscisic acid or can antagonize ABA effects.
A "coding sequence" or "coding region" is the part of a gene that codes for the amino acid sequence of a protein, or for a functional RNA such as a tRNA or rRNA. A coding sequence typically represents the final amino acid sequence of a protein or the final sequence of a structural nucleic acid. Coding sequences may be interrupted in the gene by intervening sequences, typically intervening sequences are not found in the mature coding sequence.
A "complement" or "complementary sequence" is a sequence of nucleotides which forms a hydrogen-bonded duplex with another sequence of nucleotides according to Watson-Crick base-pairing rules. For example, the complementary base sequence for 5 -AGCT-3' is 3'-TCGA-5'.
"Expression" refers to the transcription of a gene into structural RNA (rRNA, tRNA) or messenger RNA (mRNA) with subsequent translation into a protein in the case of the mRNA.
Polynucleotides are "functionally equivalent" if they perform substantially the same biological function. By substantially the same biological function it is meant that similar protein activities or protein function are encoded by a mRNA polynucleotide, or a structural polynucleotide has a similar structure and biological activity
Polynucleotides are "heterologous" to one another if they do not naturally occur together in the same aπangement in the same organism. A polynucleotide is heterologous to an organism if it does not naturally occur in its particular form and arrangement in that organism.
Polynucleotides or polypeptides have "homologous" or "identical" sequences if the sequence of nucleotides or amino acid residues, respectively, in the two sequences is the same when aligned for maximum correspondence as described herein. Sequence comparisons between two or more polynucleotides or polypeptides are generally performed by comparing portions of the two sequences over a portion of the sequence to identify and compare local regions. The comparison portion is generally from about 20 to about 200 contiguous nucleotides or contiguous amino acid residues or more. The "percentage of sequence identity" or "percentage of sequence homology" for polynucleotides and polypeptides, such as 50, 60, 70, 80, 90, 95, 98, 99 or 100 percent sequence identity may be determined by comparing two optimally aligned sequences which may or may not include gaps for optimal alignment over a comparison region, wherein the portion of the polynucleotide or polypeptide sequence in the comparison may include additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences.
The percentage of homology or similarity is calculated by: (a) determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions; (b) dividing the number of matched positions by the total number of positions in the window of comparison; and, (c) multiplying the result by 100 to yield the percentage of sequence identity.
Optimal alignment of sequences for comparison may be conducted by computerized implementations of known algorithms, or by inspection. Readily available sequence comparison and multiple sequence alignment algorithms are, respectively, the Basic Local Alignment Search Tool (BLAST) (Altschul S.F., et al.,1990, J Mol Biol 215: 403, Altschul S.F., et al., 1997, Nucleic Acids Res 25: 3389-3402) and ClustalW programs. BLAST is available on the Internet at http://www.ncbi.nlm.nih.gov and a version of ClustalW is available at http ://www2.ebi.ac.uk. Other suitable programs include GAP, BESTFIT,
FASTA, and TFASTA in the Wisconsin Genetics Software Package (Genetics Computer Group (GCG), 575 Science Dr., Madison, WI). For greater certainty, as used herein and in the claims, "percentage of sequence identity" or "percentage of sequence homology" of amino acid sequences is determined based on optimal sequence alignments determined in accordance with the default values of the BLASTX program, available as described above.
Sequence identity typically refers to sequences that have identical residues in order, whereas sequence similarity refers to sequences that have similar or functionally related residues in order. For example an identical polynucleotide sequence would have the same nucleotide bases in a specific nucleotide sequence has found in a different polynucleotide sequence. Sequence similarity would include sequences that are similar in character for example purines and pyrimidines arranged in a specific fashion. In the case of amino acid sequences, sequence of identity means the same amino acid residues in a specific order, where as sequence similarity would allow for amino acids with similar chemical characteristics (for instance basic amino acids, or hydrophobic amino acids) to reside within a specific order.
The terms "stringent conditions" or "stringent hybridization conditions" includes reference to conditions under which a probe will hybridize to its target sequence, to a detectably greater degree than other sequences (e.g. at least 2- fold over background). Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures. Generally, stringent conditions are selected to be about 5 ° C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength and pH) at which 50% of a complementary target sequence hybridizes to a perfectly matched probe. Typically, stringent conditions will be those in which the salt concentration is less than about 1.0 M Na ion, typically about 0.01 to 1.0 M Na ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes (e.g. 10 to 50 nucleotides) and at least about 60°C for long probes (e.g. greater than 50 nucleotides). Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide. Exemplary low stringency conditions include hybridization with a buffer solution of 30% formamide, 1 M NaCI, 1% SDS at 37°C, and a wash in 2X SSC at 50°C. Exemplary high stringency conditions include hybridization in 50% formamide, 1 M NaCI, 1% SDS at 37°C, and a wash in 0.1 X SSC at 60°C. Hybridization procedures are well-known in the art and are described in Ausubel et α/.,(Ausubel F.M., et al.,1994, Current Protocols in Molecular Biology, John Wiley & Sons Inc.).
"Isolated" refers to material that is: (1) substantially or essentially free from components which normally accompany or interact with it as found in its naturally occurring environment; or (2) if in its natural environment, the material has been non-naturally altered to a composition and/or placed at a locus in the cell not native to a material found in that environment. The isolated material optionally comprises material not found with the material in its natural environment. For example, a naturally occurring nucleic acid becomes an isolated nucleic acid if it is altered, or if it is transcribed from DNA which is altered, by non-natural, synthetic methods performed within the cell from which it originates.
Two DNA sequences are "operably linked" if the linkage allows the two sequences to carry out their noπnal functions relative to each other. For instance, a promoter region would be operably linked to a coding sequence if the promoter were capable of effecting transcription of that coding sequence.
A "polynucleotide" is a sequence of two or more deoxyribonucleotides
(in DNA) or ribonucleotides (in RNA).
A "DNA construct" is a nucleic acid molecule that is isolated from a naturally occurring gene or which has been modified to contain segments of nucleic acid which are combined and juxtaposed in a manner which would not otherwise exist in nature.
A "polypeptide" is a sequence of two or more amino acids. A "promoter" or transcriptional regulatory region is a cis-acting DNA sequence, generally located upstream of the initiation site of a gene, to which RNA polymerase may bind and initiate correct transcription.
A "recombinant" polynucleotide, for instance a recombinant DNA molecule, is a novel nucleic acid sequence formed tlirough the ligation of two or more nonhomologous DNA molecules (for example a recombinant plasmid containing one or more inserts of foreign DNA cloned into it).
"Transformation" means the directed modification of the genome of a cell by the external application of recombinant DNA from another cell of different genotype, leading to its uptake and integration into the subject cell's genome.
A "transgenic plant" encompasses all descendants, hybrids, and crosses thereof, whether reproduced sexually or asexually, and which continue to harbour the foreign DNA.
Unless defined otherwise all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this invention belongs.
Isolation of ABA hydroxylase Sequences
The present invention describes a nucleic acid sequences that encode enzyme activities capable of hydroxylating ABA. These nucleic acid sequences are members of the P450 monooxygenase family. Specifically these nucleic acid sequences are members of the CYP72A gene subfamily. These genes were isolated based on a number of characteristics that are indicative of an ABA hydroxylase activity. It is known that there are a number of P450 monooxygenase genes that have been described in plants. Those P450 monooxygenase genes that encode ABA hydroxylase activity have been found to be limited to a subset of the P450 gene family as described herein.
Biochemical evidence of the function of these genes has been demonstrated in a heterologous system.
These discoveries were made as a result of utilizing a strategy for isolation of the genes which included:
a.) the development of cDNA libraries from plant cells that were treated and plant cells not treated with ABA; b.) identification of DNA sequences that are specifically induced in the presence of ABA; c.) identifying those induced sequences that have characteristics of P450 monooxygenases, d.) correlating the expression pattern of those induced sequences with the structure of the encoded proteins encoded by said sequences to identify a P450 monooxygenase enzyme induced by ABA and, e.) expressing said enzyme in a heterologous system or as part of a heterologous DNA construct to demonstrate ABA hydroxylase activity.
As described herein, methods for the identification of nucleic acid sequences likely to encode ABA hydroxylase activity are provided. In this method differential screening is used to identify a subset of sequences induced by ABA within a cell population exposed to ABA. Within this subset of sequences that are induced and isolated by standard procedures, P450 monooxygenase sequences are identified using characteristics of the sequences - known to be conserved in P450 enzymes.
The enzyme activity responsible for the hydroxylation, and hence inactivation of ABA is known to be a cytochrome P450 monooxygenase (see Krochko et al, 1998, Plant Physiol 118: 849-860) This evidence proved that ABA hydroxylase activity can be induced in Black Mexican Sweet com suspension cells and is a microsomal enzyme. The biochemical characterization of ABA hydroxylase demonstrates the enzyme is a member of the P450 monooxygenase family. ABA hydroxylase requires NADPH and O2, the enzyme activity is inhibited by CO, tetcyclacis and oxidized cytochrome c and the CO inhibition is relieved by blue-light, all of these criteria showing that ABA hydroxylase is a cytochrome P450 monooxygenase as these indicators are diagnostic for P450 monooxygenase activity. The induction of ABA hydroxylase activity is inhibited by cycloheximide (a protein synthesis inhibitor) and cordecypin (a RNA synthesis inhibitor) thus indicating the hydroxylase activity is induced at the genetic level following exposure to ABA.
Thus, biochemical characterization of enzyme requirements, appearance and overall enzyme characteristics indicate that the ABA hydroxylase activity responsible for the hydroxylation of ABA is a member of the P450 monooxygenase family. There are a significant number of P450 genes that have been identified by sequencing however, the function of the majority of these sequences remains unknown.
Thus, the present inventors searched for a polynucleotide that can be induced by ABA in com suspension cultures and encoded structural features of a protein that indicate it is part of the P450 monooxygenase family.
The present invention allowed the inventors to ascribe function to a subfamily of the larger P450 monooxygenase family. A cDNA sequence was isolated from com suspension cultures that was found to encode a protein that possessed characteristics consistent with an ABA hydroxylase. The partial cDNA clone pJK6-29 (SEQ ID NO:l) was found to be induced by ABA and comprised a protein with P450 monooxygenase motifs. A full-length cDNA clone (SEQ ID NO:2) was isolated and used for searching for other related sequences.
Related sequences were identified within the CYP72A P450 monooxygenase subfamily of Arabidopsis. Two of these sequences (SEQ ID NO: 3 and SEQ ID NO:4) were expressed in a heterologous system and ABA hydroxylase activity was demonstrated for one of these sequences. Thus, the inventors have succeeded in identifying-a ABA hydroxylase activity and corresponding gene from two plant species, a monocot and a dicot species. The inventors also succeeded in ascribing ABA hydroxylase activity to a member of a gene family where function was previously unknown.
Sequence similarity and conservation of certain amino acid motifs within this subfamily suggest that there are numerous ABA hydroxylase genes within the CYP72A subfamily as supported by biochemical and physiological studies in the art. Examination of the expression pattern of many of these specific sequences indicate the expression patterns are consistent with catabolism of ABA. Thus, it is fully believed that the present invention ascribes function to a subfamily of the P450 monooxygenase family previously unknown in function, and this demonstrated function is the hydroxylation of ABA. Accordingly the present invention provides a function and utility to DNA sequences heretofore described in primary structure but having no assigned functionality.
The present invention encompasses, in one embodiment, a nucleic acid pBE 10-30-3 encoding an enzyme from com with ABA hydroxylation activity and similarity to the general family of P450 monooxygenase enzymes from plants. The specification also describes the partial cDNA pJK6-29 sequence used to derive the full-length pBE 10-30-3 cDNA. Based on the structure and expression of this coding sequence, and on the biochemical and genetic evidence, it has been designated as ABA 8 '-hydroxylase. The gene encoding this enzyme activity has not previously been identified in the art. Recently similar genes have been isolated (Persans M., et al.,2001, Plant Physiol 125: 1126-1138, Irmler S., et al.,2000, Plant Journal 24: 797-804), however, the role of these genes in ABA metabolism was not described.
The present invention also encompasses, in one embodiment, a series of genes from the CYP72A subfamily of the super family of P450 monooxygenase genes. Genes from Arabidopsis thaliana have been isolated and shown to possess enzymatic activity capable of specifically hydroxylating ABA in a heterologous system. One of these genes, CYP72A7 has been shown to possess a 7'-hydroxylase activity in a heterologous yeast system. Thus, the present invention provides clear evidence of the nature of ABA hydroxylase genes and functional expression thereof.
The identification of this unique genetic activity allows for development of novel strategies to manipulate the catabolism of ABA in plant cells. The novel nucleic acid can also be used to identify species-specific members of this plant gene family, and to utilize those sequences for alteration of ABA catabolism. In addition to the use of the pBE10-30-3 sequence for the genetic modification of plant tissue, the sequence can also be used to isolate corresponding related similar or identical sequences from other plant species.
In particular, the identification of an ABA 7'-hydroxylase activity allows for the identification of an ABA 8'-hydroxylase activity through sequence comparison. This can be conducted within a plant species or between plant species. Similar or identical sequences can be isolated. It has been discovered that the CYP72A P450 monooxygenase gene subfamily encodes a small number of enzymes capable of hydroxylation of ABA. The inplanta function of the enzymes encoded by the CYP72A family was heretofore unknown, and the information described in the present invention demonstrates that this gene family encodes enzymes capable of hydroxylating ABA.
It has been shown by the present inventors that an ABA-induced genetic activity found in com suspension cultures treated with ABA encodes a P450 monooxygenase enzyme. The sequence of this enzyme was used to identify related sequences from Arabidopsis. The inventors utilized one of these related sequences for heterologous expression in a yeast system and demonstrated that the enzyme encoded an ABA 7'-hydroxylase activity. It is fully expected that other related sequences described will also encode ABA hydroxylase activities.
The present invention encompasses the nucleotide and peptide sequences disclosed in the present application, as well as other DNA sequences that show a degree of homology to the sequences disclosed herein. For this purpose, such homologous sequences may be identified by any one of a number of routine techniques that are known in the art for the isolation and characterization of homologous DNA or peptide sequences from species that are either the same or different from the original species.
As described, the similarity or identity of two polypeptide or polynucleotide sequences is determined by comparing sequences. In the present invention, sequence comparisons were conducted using the BLAST programs, three designed for nucleic acid sequences, (BLASTN, BLASTX and TBLASTX) and two designed for protein sequences (BLASTP and TBLASTN) (Coulson A., 1994, Trends in Biotechnology, 12:76-80). The BLASTX program is publicly available from NCBI and other sources such as the BLAST Manual, Altschul, S., et /.,NCBI NLM NIH Bethesda Maryland 20984, also http ://www .ncbi .nlm .mh.gov/BLAST/blast help .html provides online help and further literature references for BLAST and related protein analysis methods, and Altschul S., et al.,1990, J Mol Biol 215:403-410. The 333 bp cDNA clone pJK6-29 of com P450 cDNA isolated by subtractive hybridization shows strong homologies to cytochrome P450 genes of the CYP72A gene subfamily. Comparison of the sequence of JK6-29 with deposited sequences in gene databases using the BLAST search programs and the default setting reveals similarity with a subset of P450 monooxygenase clones identified as the CYP72A gene subfamily.
Members of the CYP72A gene family was one of the first P450 monooxygenase genes to be cloned in plants and was originally cloned from periwinkle (Vetter H.-P., et al, 1992, Plant Physiol 100: 998-1007). Those authors tentatively assigned geraniol-10-hydroxylase activity to this protein based on induction kinetics, however, they were unable to demonstrate conclusively that this P450 had GE10H activity. Heterologous expression of these P450s in tobacco failed to confirm the GE10H activity (Mangold U., et al., 1994, Plant Science 96: 129-136) although since that time there have been many citations in the literature referencing that paper in describing the function of the CYP72A genes. None of these functions have been clearly demonstrated, making the activity of the enzymes encoded for by the CYP72A gene family unknown. Moreover, a patent for plant geraniol/nerol 10 -hydroxylase activity has demonstrated the GE1 OH activity to be encoded by CYP76C 1 gene sequence (US 5,753,507), thus the function of the CYP72A gene family remained unknown until the present invention. However, CYP72 As are still frequently described in the literature and even in some newer databases as possible geraniol 10-hydroxylases (see Stanford Microarray Database). Now, with the discovery of JK6-29 and the isolation of the full-length sequence pBE10-30-3, the function of CYP72A sequences is better understood to comprise at least ABA hydroxylation enzymes, including ABA 7'-hydroxylase as demonstrated by in vitro enzyme activity.
Organization of the CYP72A gene subfamily in plants The CYP72A gene family has been found in most plant species including Arabidopsis, rice, tomato, potato, com, Medicago (alfalfa), soybean, sorghum and barley. For the most part, the assignment of a DNA sequence to the CYP72A subfamily has been based on sequence comparison and a high degree of similarity within these various sequences. A combination of genomic DNA sequences as well as EST sequences have provided information on the occurrence of these gene sequences. The family has not however, been characterized in regard to function.
In the present invention, in at least one embodiment, homologous sequences from Arabidopsis were identified and the related genes were assigned to a moderate size (9 members) cytochrome P450 gene subfamily whose members are aπayed in tandem on chromosome 3. This sequence information was first submitted to GenBank by the Kazusa DNA Research Institute on Feb 1st 1999 (PI clone MIE1; GenBank AB023038, Sato et α/.,DNA Research 7:131-135, 2000), but the function of these genes was unknown.
The members of the CYP72A gene family in Arabidopsis are found in Genbank and are listed as follows:
CYP72A7 AB023038, chromosome 3, MIE1 40525-42463 protein id:
BAB02393.1
CYP72A8 AB023038, chromosome 3, MIE1 42938-44813 protein id: BAB02394.1
CYP 72A9 AB023038, chromosome 3, MIE1 45293-47369 protein id:
BAB02395.1
CYP 72A10 AB023038, chromosome 3, MIE1 47816-49747 prptein id:
BAB02396.1 CYP 72A11 AB023038, chromosome 3, MIE1 50166-52125 protein id:
BAB02397.1
CYP 72A12P (exon 5 only) AB023038, chromosome 3, MIE1 52192-52485
CYP 72A13 AB023038, chromosome 3, MIE1 52920-54871 protein id:
BAB02398.1 CYP 72A14 AB023038, chromosome 3, MIE1 62438-64422 protein id: BAB02400.1 CYP 72A15 AB023038, chromosome 3, MIE1 65370-67270 protein id: BAB02401.1
The sequence identity of these nine family members ranges between 63- 92% at the DNA level, while the protein sequence identity range between 55 - 90% . Of interest to note is that the sequence identity to the com full-length cDNA (SEQ ID NO:2) isolated by the present inventors ranges from 50-60% at the DNA level and 50-55% at the level of the protein sequence. This is illustrated by the comparative table shown below, where eight members of the Arabidopsis CYP72A gene family are compared to each other as well as compared to the com cDNA clone(SEQ ID NO:2).
The alignment of the sequences was based on ClustalW (1.81) analysis of com sequence (cDNA and deduced protein) and the 8 full-length Arabidopsis genes as described above. In these tables, each of the CYP72A genes identified are abbreviated for convenience by deletion of the internal "72A" notation in the sequence name. Thus, CYP72A7 is referred to as CYP7 for this analysis.
Table 1 : Comparison of the Arabidopsis CYP72A full length cDNA sequences
As evidenced by this table, the gene sequences of this family are highly similar and the identity ranges from 63-92%, with a typical identity being about 65-70% for the least related, 74-78% for the more related sequences and 85- 92% for the most related sequences. Nearly all of the Arabidopsis sequences of the CYP72A family show at least 50% identity, with some specific sequences showing 60% similarity.
This similarity extends to the protein level, where the translated protein sequences show similar ranges of identity as shown below.
Table 2: Comparison of the Arabidopsis CYP72A deduced protein sequences
It is clear that the members of this CYP72A subfamily are highly similar. When members of this family are compared to P450 monooxygenase genes in general, the similarity is not evident. For example, comparison of Arabidopsis CYP72A7 sequences with other members of the P450 monooxygenase genes from plants reveal that the CYP72A family can be discriminated from other P450 monooxygenases by a difference of approximately at least 10% in homology between the CYP72A types and other CYP P450 monooxygenases. Typically CYP72A genes exhibit at least 50% identity to each other, whereas non CYP72A genes exhibit less that 40% identity to CYP72A genes. It is the CYP72A genes that have demonstrated ABA hydroxylase activity as described within the present invention.
For example, a BLASTP 2.2.1 analysis of protein encoded by the Arabidopsis CYP72A7 (SEQ ID NO:5) compared to other P450 monooxygenase genes found at the NCBI database, (default settings, sequences shown in order of identity) reveal the following homologies. In this analysis, "identity" refers to identical amino acids, whereas "positives" refer to amino acids that are identical or conservatively substituted.
BLASTP 2.2.1 analysis of deduced amino acid sequence of Arabidopsis
CYP72A7 (SEQ ID NO:5) Sequenced compared to "identity" and "positives" score
CYP72A7 100%
CYP72A13 74% identity, 85% positives
CYP72A11 73% identity, 83% positives
CYP72A15 71% identity, 83% positives
CYP72A10 73% identity, 83% positives
CYP72A9 69% identity, 82% positives
CYP72A14 70% identity, 81% positives
CYP72A8 58% identity, 77% positives
CYP72A18 (Oryza sativa) 55% identity, 70% positives
CYP72A1 (Catharanthus roseus) 51% identity, 71% positives (LI 0081)
CYP72A-like (seq B, C. roseus) 50% identity, 70% positives (LI 9074)
Lolium-62 52% identity, 68% positives
Lolium-78 52% identity, 68% positives
CYP72A-like (seq C, C. roseus) 50% identity, 70% positives (L19075)
CYP72A20 (O. sativa) 49% identity, 64% positives
Lolium-83 52% identity, 69% positives
Lolium-22 52% identity, 69% positives
CYP72A-like (O. sativa) 50% identity, 69% positives (AP002899)
Lolium-79 52% identity, 69% positives
CYP72A24 53% identity, 69% positives
CYP72A17 49% identity, 67% positives
CYP72A23 51% identity, 68% positives
CYP72A19 50% identity, 66% positives
CYO72A21 50% identity, 66% positives
CYP72A22 49% identity, 66% positives
CYP72A-like (tobacco) 49% identity, 67% positives (U35226) CYP72A-like (tomato) 47% identity, 65% positives (AF249329)
CYP72A25 (O. sativa) 44% identity, 61% positives
Non-CYP72A genes
CYP72B1 (Arabidopsis) 40% identity, 62% positives .CYP72C1 (Arabidopsis) 41% identity, 61% positives CYP709B2 (Arabidopsis) 39% identity, 57% positives CYP709B3 (Arabidopsis) 36% identity, 56% positives CYP709B-like (maize) 37% identity, 55% positives CYP721A1 (Arabidopsis) 38% identity, 56% positives CYP709B1 (Arabidopsis) 38% identity, 58% positives CYP709B-like (O. sativa) 36% identity, 54% positives CYP709A2 (Arabidopsis) 36% identity, 56% positives CYP709A1 (Arabidopsis) 36% identity, 55% positives CYP714A-like (Lolium) 31% identity, 51% positives CYP714A1 (Arabidopsis) 33% identity, 51% positives CYP714A2 (Arabidopsis) 32% identity, 52% positives CYP715A1 (Arabidopsis) 29% identity, 50% positives CYP715A-like (Persea americana) 34% identity, 58% positives CYP709B-like (O. sativa) 37% identity, 57% positives C ι_.Y ϊ P4^FJt 2 ( tHrtoommoo s saappiieennss); 2 /8δ%7o i ldαeennttiitτyy,, 4 f6 o% 7o p poossiittiivveess
CYP709-like (Agrobacterium tumefaciens) 30% identity, 47% positives
Thus, it is apparent that a minimal sequence identity of approximately 50% is required for a new gene to be identified as a member of the CYP72A family and hence be a candidate for ABA hydroxylase activity.
This similarity extends to other P450 monooxygenase genes that are predicted to possess ABA hydroxylase activity. For example, when the deduced amino acid sequence of the pBE10-30-3 cDNA (SEQ ID NO:2) is used in a BLASTP 2.2.1 with P450s in general, a clear discrimination between CYP72A and other P450 monooxygenase genes is observed. This is shown below. As above, in this analysis, "identity" refers to identical amino acids, whereas "positives" refer to amino acids that are identical or conservatively substituted. BLASTP 2.2.1 comparison of deduced amino acid sequence of pBEl 0-30-3 cDNA (SEQ ID NO:2) Sequenced compared to "identity" and "positives" score
Lol-78 80% identity, 90% positives
Lol-62 79% identity, 89% positives
CYP72A18 77% identity, 88% positives
Lol-83 79% identity, 89% positives
Lol-79 79% identity, 89% positives
Lol-22 78% identity, 88% positives
CYP72A-like (Oryza sativa) 69% identity, 81% positives
(AP002899)
CYP72A23 (O. sativa) 65% identity, 77% positives CYP72A21 (O. sativa) 64% identity, 77% positives CYP72A19 (O. sativa) 63% identity, 77% positives CYP72A22 (O. sativa) 63% identity, 76% positives CYP72A20 (O. sativa) 61% identity, 74% positives CYP72A17 (O. sativa) 61% identity, 75% positives CYP72A24 (O. sativa) 62% identity, 75% positives CYP72A15 (Arabidopsis) 57% identity, 72% positives CYP72A14 (Arabidopsis) 55% identity, 70% positives CYP72A10 (Arabidopsis) 55% identity, 70% positives CYP72A11 (Arabidopsis) 55% identity, 70% positives CYP72A25 (O. sativa) 53% identity, 68% positives CYP72A13 (Arabidopsis) 55% identity, 70% positives CYP72A9 (Arabidopsis) 54% identity, 68% positives CYP72A7 (Arabidopsis) 53% identity, 69% positives CYP72A8 52% identity, 70% positives CYP72A1 (Catharanthus roseus) 49% identity, 68% positives
(L10081)
CYP72A-like (seq B, C. roseus) 49% identity, 69% positives
(LI 9074)
CYP72A-like (seq C, C. roseus) 49% identity, 68% positives
(LI 9075)
CYP72A-like (tobacco) 50% identity, 66% positives
(U35226)
CYP72A-like (tomato) 46% identity, 63% positives
(AF249329)
Non-CYP72A genes
CYP72B1 (Arabidopsis) 43% identity, 62% positives CYP72C1 (Arabidopsis) 41%o identity, 61% positives CYP709B-like (O. sativa) 42% identity, 58% positives
CYP709B-like (maize) 39% identity, 56% positives
CYP709B2 (Arabidopsis) 39% identity, 57% positives
CYP709B1 (Arabidopsis) 38% identity, 57% positives CYP721A1 (Arabidopsis) 40% identity, 58% positives
CYP709B3 (Arabidopsis) 39% identity, 57% positives
CYP709A1 (Arabidopsis) 37% identity, 59% positives
CYP714A2 (Arabidopsis) 32% identity, 56% positives
CYP714A1 (Arabidopsis) 34% identity, 54% positives CYP709A2 (Arabidopsis) 36% identity, 57% positives
CYP714A-like (Lolium) 33% identity, 53% positives
CYP715A1 (Arabidopsis) 30% identity, 50% positives CYP715A-like (Persea americana) 34% identity, 56% positives
CYP709B-like (O. sativa) 40% identity, 59% positives CYP709-like (Agrobacterium tumefaciens) 30% identity, 45% positives
Accordingly, it is clear that it is possible to distinguish the CYP72A family of genes from P450 monooxygenase genes in general by overall sequence similarity. It is also noted that there are specific motifs within the CYP72A family that distinguishes this family from other P450 monooxygenases.
There are several conserved regions that have become apparent from multi-sequence alignments of putative ABA hydroxylase genes (CYP72As from different species identified by BLAST and homology analysis). These include:
A 6 amino acid sequence 'EVLRLY' (SEQ ID NO.22) that is conserved in the CYP72A (8 genes) and the CYP72C (1 gene) P450 subfamilies in Arabidopsis. This sequence is found in only one other P450 in. Arabidopsis (CYP715A1) and only one non-P450 protein sequence in Arabidopsis
(BAB01891.1). This small sequence is positioned approximately 80 amino acids upstream of the Cysteine of the heme-binding region. This sequence is also found in all of the other CYP72A genes identified from other plant species. See Figure 7. A second conserved region also occurs in the CYP72As. A 9 amino acid sequence with the highly conserved elements: "DVIS[KRH]xAFG" (SEQ ID NO.23), is found approximately 240 - 250 amino acids upstream of the conserved Cysteine of the heme-binding region. In Arabidopsis this sequence is specific for the CYP72A and CYP72B subfamilies. See Figure 8.
Thus, only the CYP72A subfamily in Arabidopsis has both of these sequences and this forms a basis for selecting CYP72A genes in general that encode ABA hydroxylase activity.
Thus, in addition to overall sequence homologies, there are conserved identical amino acid sequences in CYP72A plant genes known to possess ABA hydroxylase activity as described above. These sequences provide another means to specifically identify genes encoding an ABA hydroxylase activity.
A third region of conserved amino acid residues includes eight amino acids located approximately 170 amino acids upstream of the Cysteine residue of the heme-binding region. The conserved sequence "D[LI]LG[LIV][LM][VL][EQKJ" (SEQ ID NO.24) is generally found in CYP72A genes and constitutes a third region of amino acid similarity that is diagnostic for CYP72A genes that can encode ABA hydroxylase activity. CYP72C1 does not show conservation in this region. The only other Arabidopsis protein that has been shown to contain this sequence is a P450 monooxygenase named CYP709B1, which is not a member of the CYP72A subfamily. Notably, CYP709B1 does not have the other conserved amino acid sequences and hence would not be a candidate for ABA hydroxylase activity. Other P450 monooxygenase genes that have related sequences include CYP72B1, which has a conservative substitution of T in the 7th position ([NLI]). Thus, the combination of sequence identity across the entire encoded protein, as well as the presence of these highly conserved sequence motifs provide key features of the P450 monooxygenase genes that are candidates for ABA hydroxylase activity. As described within the present invention, one of these CYP72A genes was demonstrated by biochemical conversion, to possess an ABA 7'-hydroxylase activity.
Another plant species that contains a small number of CYP72A related sequences is rice, (Oryza sativa), which also has 9 CYP72A genes, similar to that seen for Arabidopsis. (http://dmelson.utmem.edu/rice.cyp72as.html). The designation of the rice CYP72A genes which are clustered on chromosome 1 are as follows:
CYP72A17 AP002839 Oryza sativa genomic DNA, chromosome 1 36553- 39431
CYP72A18 AP002839 Oryza sativa genomic DNA, chromosome 1 41630- 44993
CYP72A19 AP002839 Oryza sativa genomic DNA, chromosome 1 51708- 53699 CYP72A20 AP002839 Oryza sativa genomic DNA, chromosome 1 56581-
59004
CYP72A21 AP002839 Oryza sativa genomic DNA, chromosome 1 61972- 63890
CYP72A22 AP002839 Oryza sativa genomic DNA, chromosome 1 66435- 68424
CYP72A23 AP002839 Oryza sativa genomic DNA, chromosome 1 72149- 74091
CYP72A24 AP002839 Oryza sativa genomic DNA, chromosome 1 109964-113787 CYP72A25 AP002839 Oryza sativa genomic DNA, chromosome 1
115472-117492
In analyzing sequence similarities, deduced amino acid sequences are used more frequently than cDNA sequences in order to focus on structural features of the derived protein. The similarity of the rice CYP72A deduced protein sequences to the Arabidopsis CYP72A protein sequences ranges from 46 - 55%. This range of similarity is typical of the range of similarity already identified between the Arabidopsis gene family and the comparison of that gene family to SEQ ID NO:2. Thus it is fully believed that the rice CYP72A gene family described above represents genes encoding an ABA hydroxylase activity.
These comparisons within the CYP72A gene family can also be extended to other species where little is known as to the nature of P450 monooxygenase genes, for example, a number of Lolium rigidum genes have been isolated by a PCR strategy (these have not been assigned CYP numbers as of yet) and these sequences show a high level of similarity to the CYP72A gene family (http://dmelson.utmem.edu/lolium.html and Fischer T.C., Klattig J.T. and Gierl A. A general cloning strategy of divergent plant cytochrome P450 genes and its application in Lolium rigidum and Ocimum basilicum. Unpublished).
Comparison of the Rice CYP72A sequences to the deposited sequences from Lolium listed below demonstrate striking similarities, indicating their likely function to include an ABA hydroxylase. These similarities include the conserved amino acids regions as described (see Figures 7 and 8). These sequences are listed below.
Lolium rigidum clone Lol-83 AF321870 78% to 72A18 (rice) Lolium rigidum clone Lol-79 AF321869 79% to 72A18 (rice) Lolium rigidum clone Lol-78 AF321868 78% to 72A18 (rice) Lolium rigidum clone Lol-62 AF321867 77% to 72A18 (rice) Lolium rigidum clone Lol-22 AF321866 78% to 72A18 (rice) It should be noted that the clone Lol-83 AF321870 has 54% similarity to the Arabidopsis CYP72A15 clone. Thus, members of the CYP72A family in plants that are associated with ABA hydroxylase activity are typically found to have between 50 and 80% similarity at the protein level between unrelated plant species. Within a plant species that similarity can be as high as 92%. Even between monocots and dicots the similarity of the coding regions does not fall below 50%.
It has been found that the similarity of CYP72A genes is found among diverse species. Using the deduced protein sequence of Arabidopsis CYP72A14 and the deduced protein sequence of pBEl 0-30-3 cDNA (SEQ ID NO:2), a TBLASTN similarity search of the TIGR Gene Indices database (http://www.tigr.org/tdb/tgi.shtml) was conducted and the results reveal that many CYP72A sequences previously identified can now be assigned a potential function in ABA catabolism. Representative CYP72A sequences identified in this database include:
Tomato: TIGR contig TC85158 (26 ESTs) TIGR contig TC94028 (47 ESTs) TIGR contig TC93825 (45 ESTs) TIGR contig TC85178 (29 ESTs)
Potato:
TIGR contig TCI 9836 (43 ESTs) TIGR contig TCI 9818 (53 ESTs)
Medicago trunculata: TIGR contig TC31893 (33 ESTs) TIGR contig TC32102 (44 ESTs) TIGR contig TC28776 (4 ESTs) TIGR contig TC28751 (16 ESTs)
Soybean: TIGR contig TC73251 (36 ESTs) TIGR contig TC63297
Sorghum TIGR contig TC20554 (18 ESTS)
Barley
TIGR contig TC3433 (2 ESTs)
Maize
TIGR contig TC76645 (2 ESTs) TIGR contig TC76455 (3 ESTs)
Rice TIGR contig TC52700 (12 ESTs) TIGR contig TC54931 (1 EST) TIGR contig TC53498 (1 EST) TIGR contig TC50219 (1 EST)
Screening these putative sequences for the presence of the conserved amino acid sequences, "ENLRLY" (SEQ ID ΝO.22), "DNIS[KRH]xAFG" (SEQ ID ΝO.23) and "D[LI]LG[LIV][LM][VL][EQK]" (SEQ ID NO.24) as described, also allows for the identification of CYP72A genes likely to contain ABA hydroxylase activity as these sequences are conserved in these proteins.
Thus, it is possible to identify a large number of CYP72A sequences that are highly similar to CYP72A sequences both at the overall protein identity as well as at the level of specific conserved sequences to identify genes that encode an ABA hydroxylase activity. Identification of these sequences allows the isolation of an ABA hydroxylase gene by routine procedures such as identification of specific ESTs or sequences that are induced or expressed in response to ABA related physiological changes, or by matching the expression pattern of these sequences to expression patterns that are typical of ABA related genes.
Expression of the CYP72A gene subfamily:
As one aspect of the present invention, identification of CYP72A sequences that are associated with physiological events associated with ABA provides an important element for screening within the CYP72A family for functional genes and genes most likely to encode an ABA hydroxylase activity. ABA-hydroxylase is found predominantly in dividing and meristematic tissues, as well as leaves. There is reduced expression in the dark. Typically ABA hydroxylase is up-regulated in leaves relative to flowers, down-regulated in iron deficient plants, up-regulated under conditions of high CO2, up-regulated in some mutants and down-regulated in suspension cells relative to leaves. A search of Genbank was conducted to generate a list of Arabidopsis CYP72A ESTs; a total of 27 EST records were found. The pattern of expression associated with these EST sequences were analyzed and the following conclusion were drawn that describe the general expression patterns of CYP72A genes in Arabidopsis: individual genes are not limited in their expression to particular tissues; CYP72A9 and CYP72A13 are the only members of this gene family so far found in developing seed tissues; CYP72A8 has so far only been isolated from roots; CYP72A10 has not been associated with any ESTs. It is believed that the genes most likely to be involved in ABA catabolism in planta are CYP15, CYP14, CYP13 and CYP11 based on the EST prevalence data and expression analysis of these cDNAs using microarrays (StanfordMicroarrayDatabase).
Demonstration of ABA hydroxylase activity associated with CYP72A genes. Several P450 ESTs belonging to this P450 CYP72A subfamily of Arabidopsis were obtained from ABRC (Arabidopsis Biological Resource Center) and the inserts were sequenced and the sizes determined. These P450s included full-length sequences for CYP72A7 and CYP72 A 14. These cDNAs were expressed in a yeast expression system and ABA 7'-hydroxylase activity was demonstrated in the cultures in which the CYP72A7 gene was inserted. These yeast expression results using the Arabidopsis CYP72A7 gene show that (+)-ABA fits into the substrate access channel in this P450 subfamily and that one of the methyl groups of the substrate is appropriately positioned for hydroxylation. (+)-ABA 7'-hydroxylase activity is found naturally in plants and this observed activity in yeast may represent an allelic variant within this gene family.
The data outlined above provide compelling evidence that the ABA T- and 8'-hydroxylases are coded by the CYP72A cytochrome P450 subfamily in plants. This is a new discovery of cytochrome P450 gene function, this function was not known previously. Indeed, one of the members of the CYP72A family was demonstrated to encode an activity capable of hydroxylating ABA at the T position.
The present inventors have accumulated a substantial set of data that demonstrates that the newly discovered polynucleotides encode ABA hydroxylase enzymes. The supporting data includes: isolation of a P450 cDNA (pJK6-29, and subsequently the full-length conesponding cDNA pBEl 0-30-3) from the ABA-induced subtracted maize cDNA library; confirmation by Northern expression analysis that this P450 coding sequence is induced by ABA; the time-course of that induction is consistent with this P450 being ABA 8'-hydroxylase; isolation of a full-length maize cDNA that allows for expression of enzyme activity in plant cells; isolation of homologous ABA hydroxylase sequences from other plant species and; demonstration in yeast of (+)-AB A 7'- hydroxylase activity with the homologous Arabidopsis CYP72A7 sequence.
Thus with the JK6-29 cDNA and pBE 10-30-3 sequences it is possible to isolate polynucleotides encoding ABA hydroxylase activity. These polynucleotides may be used to alter ABA catabolism in plant cells.
The use of gene inhibition technologies such as antisense RNA (e.g., US 4,801,540, US 5,107,065; US 5,453,566 , use of ribozymes (e.g., US 4,987,071; US 5,037,746; US 5,116,742; US 5,354,855) or co-suppression (e.g., US 5,034,323; 1994, US 5,283,184, & US 5,231,020) or double stranded RNA interference (Chuang C.-F. and Meyerowitz E.M., 2000, PNAS 97: 4985-4990, Smith N.A., et al, 2000, Nature 407: 319-320) is contemplated within the scope of the present invention. In these approaches, the isolated ABA hydroxylase gene sequence is operably linked to a suitable regulatory element. The chimeric gene is introduced into a plant cell and a plant cell recovered wherein said gene is integrated into the plant chromosome. The plant cell is induced to regenerate and a whole plant is recovered. The use of these techniques has been well- described in the art, and it is apparent that polynucleotide sequences encoding ABA hydroxylase enzymes, or portions thereof can be employed within the scope of the present invention to alter ABA catabolism.
For example, inhibition of the expression of an ABA 8 '-hydroxylase may provide a number of beneficial characteristics to plants. These may include: increased seed dormancy to allow fall planting of certain crops, reduced stomatal conductance to reduce water loss, reduced growth rate in some crops to better control production, reduced shoot growth versus root growth to allow for greater establishment of a crop, larger seeds because of more storage product accumulation and in general greater stress tolerance. In addition, it is contemplated that over-expression of ABA hydroxylation enzymes can be used as a mechanism for altering ABA levels. This method may employ the use of the coding sequence, under the control of an appropriate promoter, to express ABA hydroxylation activity in a temporal and spatial fashion not normally found in plants. The promoter may be constitutive, tissue specific or inducible.
Expected results of over-expression of ABA 8 '-hydroxylase in plants leading to ABA deficient plants include: seeds that may germinate faster after collection, seeds may be non-dormant whereas before they might have been dormant, increased branching, changes in fertility, reduced plant stature and leaf area (dwarf plants), reduced root growth versus shoot growth to provide more biomass.
The method further relies on the use of transformation to introduce the gene encoding the enzyme into plant cells. Transformation of the plant cell can be accomplished by a variety of different means. Methods that have general utility include Agrobacterium based systems, using either binary and cointegrate plasmids of both A. tumifaciens and A. rhyzogenies. (e.g., US 4,940,838, US 5,464,763), the biolistic approach (e.g, US 4,945,050, US 5,015,580, US 5,149,655), microinjection, (e.g., US 4,743,548), direct DNA uptake by protoplasts, (e.g., US 5,231,019, US 5,453,367) or needle-like whiskers (e.g., US 5,302,523). The disclosures of these references are specifically incoφorated herein by reference. Any method for the introduction of foreign DNA and/or genetic transfomiation of a plant cell may be used within the context of the present invention.
Accordingly, in a preferred embodiment of the invention the subject method includes a method for modifying the catabolism of ABA in a plant comprising: (a) Introducing into a plant cell capable of being transformed and regenerated to a whole plant a genetic construct comprising a first DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in plant cells, a DNA sequence that encodes the polynucleotide encoding a plant ABA hydroxylase sequence, said sequence encoding a ABA 7' or 8 '-hydroxylase activity, operably linked to a suitable transcriptional regulatory region and,
(b) recovery of a plant which contains said recombinant DNA.
It is apparent to the skilled artisan that the polynucleotide encoding the ABA hydroxylase sequence can be in the antisense (for inhibition by antisense RNA) or sense (for inhibition by co-suppression, or over-expression) orientation, relative to the transcriptional regulatory region, or a combination of sense and antisense RNA to induce double stranded RNA interference. A transcriptional regulatory region is often referred to as a promoter region and there are numerous promoters that can be used within the scope of the present invention.
It will be apparent to the skilled practitioner that any number of specific alterations in ABA catabolism will lead to changes in processes and plant physiology controlled by ABA. These include alteration in water loss or transpiration and water use efficiency; responses to pathogens and wounding; embryogenesis, seed development and maturation including seed storage product accumulation (protein, oil), seed dormancy, seedling vigour and seed desiccation tolerance; plant architecture, including root growth and moφhology, plant height and root-to-shoot ratios; abiotic stress tolerance; fertility and reproduction; and fruit (silique) maturation, dehiscence and abscission.
Alteration in ABA catabolism by increased or decreased expression of ABA hydroxylase enzymes can include changes in: Abscission, Bud Dormancy, Fruit Ripening, Seed Maturation including the Accumulation of Storage Products, Seed Desiccation Tolerance, Plant Architecture, Fertility, Seed Dormancy, Elongation Growth, Water Loss and Root Growth, and Abiotic Stress Tolerance. Other alterations of plant physiology may also be envisioned by the use of the ABA hydroxylase enzymes and the use of a tissue specific or inducible promoter.
It is also apparent to the skilled practitioner that the exemplified coding sequences can be used to isolate genes from other plant species with similar function. As described, members of the CYP72A gene family have been shown to encode an ABA hydroxylase activity, and there are many highly similar sequences in other plant species that can be easily evaluated for ABA hydroxylase activity as described herein.
Thus, homologous sequences to pBEl 0-30-3 are P450 monooxygenases that are found associated with stress or developmental conditions known to be modulated by ABA.
These homologous sequences will encode T- and 8'-ABA hydroxylases and be part of the P450 CYP72A monooxygenase family. It is further apparent to the skilled artisan that these sequences can be used in heterologous plant species to alter ABA catabolism.
It is further contemplated within the scope of the present invention that the activity of these enzymes may be used directly or be modified to hydroxylate substrates related to ABA. For example, analogs of ABA have been described where the ABA molecule is modified to resist degradation (US 6,004,905). These modified ABA compounds could be used as novel herbicides since application of these compounds would lead to persistent ABA effects, including growth retardation in some cases. Modification of the T- and 8'- hydroxylase genes to more effectively degrade these modified ABA compounds would allow those plants comprising a modified ABA hydroxylase gene to grow more efficiently in the presence of the modified ABA analogs than plants without the modified hydroxylase activity. Alternatively, modification of the enzyme to oxidize ABA to produce 9'-hydroxyABA (a non-natural hormone metabolite of unknown biological activity) would permit a further means of manipulating ABA activities.
As one example of an enzyme modification, the gene encoding an enzyme capable of 7'- or 8 '-hydroxylation of ABA can be modified and/or selected for increased activity by using such techniques as site-specific modification, mutation and selection of altered specificity in heterologous systems such as bacterial or fungal cells. This may include expression of the gene encoding said altered enzyme in bacterial cells unable to metabolize ABA analogs, selecting bacteria that express the enzyme and are able to hydroxylate the analogs as determined by a variety of analytical techniques including high performance liquid chromatography/ mass spectrometry (HPLC/MS).
It is also possible to mutagenize a population of plant cells and select plant cells for resistance to the ABA analogs. In this approach, plant cells or plant seeds, such as those from Arabidopsis can be mutagenized and grown in the presence of the ABA analogs, under conditions where plant cells unable to catabolize the ABA analogs are unable to grow. Plant or plant cells where the members of the CYP72A family, or the genes encoding 7'- and 8'- ABA hydroxylase activity are altered and are now able to catabolize the ABA analogs are selected, and using the sequences provides in this specification, the modified genes can be isolated and the nature of the modification determined.
Thus, it is possible to contemplate not only the alteration of the natural catabolism of ABA using these newly described functions for the CYP72A P450 monooxygenase sequences and the exemplified T and 8 '-hydroxylase gene sequences, but it is within the scope of the present invention that these new T- and 8'- ABA hydroxylase activities, as well as the activities of related CYP72A sequences can be used to modify the catabolism of ABA analogs.
The following examples serve to illustrate the present invention but should not be regarded as limiting the scope of the invention in any way.
Example 1. Cloning of the Genes for ABA 7'- and 8'-hydroxylase.
In this example, differential screening of induced and non-induced plant cells was conducted to isolate a cDNA clone encoding a ABA hydroxylase gene. The biochemical enzyme assay data (Krochko J.E., et al, 1998, Plant Physiology 118:849-860) demonstrated that there is no ABA 8 '-hydroxylase activity in non-ABA-treated corn suspension cells while the maximum enzyme activity in ABA-treated com suspension cells occurs around 16 hours after the addition of (+)-ABA. If the mRNA for ABA 8 '-hydroxylase is uniquely expressed in response to ABA in this suspension cell system then there is a very strong likelihood that the gene can be isolated using a subtractive hybridization protocol. This subtractive protocol was employed to isolate an ABA hydroxylase cDNA. Black Mexican Sweet com suspension cells were treated with 200 μM (+)-ABA for 9 hours. Total RNA was extracted from both ABA- treated and non-ABA-treated cells using a modified LiCl technique (Ausubel F.M., et al.,1994, Current Protocols in Molecular Biology, John Wiley & Sons Inc.). Poly A+ mRNA was extracted from total RNA using a Qiagen Oligotex mRNA kit (www.quiagen.com). cDNA was prepared from 2 μg of mRNA according to the directions in Clontech's PCR-Select cDNA Subtraction Kit (www.Clontech. com) .
The resulting cDNA samples were subtracted according to the PCR- Select cDNA Subtraction Kit instructions resulting in 4 cDNA fractions:
1) NI / S (non-ABA-induced subtracted)
2) NI / N (non-ABA-induced non-subtracted) 3) IND / S (ABA-induced subtracted)
4) IND / N (ABA-induced non-subtracted)
After PCR amplification a portion of the subtracted ABA-induced cDNA sample (#3, IND / S) was ligated into Clontech' s TA cloning vector and transformed into TOPI O F' competent cells. cDNA inserts from individual clones of this subtracted library were PCR amplified and arrayed on nylon membranes according to the methods outlined in Clontech's PCR-Select Differential Screening kit. 420 clones were aπayed on duplicate nylon membranes and these were differentially screened using 32P-labelled subtracted probes (#3, IND / S and #1 , NI / S). cDNAs showing greater expression with the IND / S probe compared to the NI / S probe were candidate clones possibly up-regulated by (+)-ABA in co suspension cells. These putatively ABA- regulated clones were sequenced and identities detennined by BLAST searches of GenBank. In addition, cDNA clones were randomly sequenced, and later the entire subtracted library was sequenced.
Example 2. Evaluation of the cloning procedure
The four cDNA samples (NI / S; non-ABA-induced and subtracted, NI /
N; non-ABA-induced and non-subtracted, IND / S; ABA-induced and subtracted, IND / N; ABA-induced and non-subtracted) resulting from the subtractive hybridization were amplified by PCR and equivalent amounts were loaded onto an agarose gel. After transfer to nylon membrane the blot was probed successively with radiolabeled rice actin cDNA and subtracted ABA- induced cDNA (IND / S).
The cDNA subtraction was successful in identifying uniquely expressed genes in response to ABA induction. Actin, an abundant constitutively expressed gene was effectively removed and the cDNAs in the ABA-induced subtracted probe were very different from those in the non-ABA-treated subtracted cDNA probe. As well, the ABA-induced subtracted cDNA pool contained genes that were expressed in greater abundance in the ABA-induced cDNA pool as compared to the non-ABA-treated cDNA pool. This is shown in Figure 1.
Subtracted ABA-induced cDNAs were PCR amplified and cloned into the Clontech pT-Adv vector. Clones were selected randomly from this ABA- induced subtracted library and the inserts amplified by PCR. The PCR- amplified inserts were arrayed in duplicate on nylon membranes and probed with radiolabeled subtracted non-ABA-induced cDNA (NI / S) and subtracted ABA-induced cDNA (IND / S). Clones that showed at least a 3 to 5-fold greater intensity of labeling with the IND / S cDNA probe were deemed to be upregulated by ABA in this first screen. Plasmids were sequenced. One of these, pJK6-29, was a C-terminal fragment of a cytochrome P450 monooxygenase. This clone is indicated with a box on the nylon cDNA array shown in Figure 2.
The proportion of ABA-induced cDNAs in the subtracted library was estimated at 30-40% based on the initial differential screening and secondary screens that were carried out by spotting the individual cDNA clones on nylon membranes and screening with subtracted non-induced and induced probes as evident from Figure 2. From the sequencing data the cDNAs in the subtracted library are mostly regulatory genes or cDNAs representing rarer mRNAs. There were no constitutively expressed abundant sequences. The upregulated genes in the ABA-induced subtracted library include genes known to be induced by ABA, for example LEAs (late-embryogenesis abundant proteins).
Example 3. Isolation of a P450 clone for an ABA-hydroxylase:
Only one P450 related sequence was isolated from the differential screening of the ABA-induced subtracted library. The sequence isolated was a 333 bp C-terminal piece including the signature P450 heme-binding region. This sequence JK6-29 is shown in SEQ ID NO.1.
Example 4. Analysis of JK6-29 expression
The isolated P450 cDNA (pJK6-29) was used as a probe against the four cDNA pools resulting from the subtractive hybridization (as described in example 1). This cytochrome P450 was upregulated by ABA (compare NI / N and IND /N) and successfully amplified within the subtracted ABA-induced cDNA pool (compare NI /S and IND / S). The results of this analysis are shown in Figure 3.
Total RNA isolated from non-ABA-induced and ABA-induced (9 hr at 200μM (+)-ABA) BMS com suspension was probed with radiolabeled pJK6- 29. The Northern blot confirmed that this P450 was upregulated by (+)-ABA in com suspension cells (Figure 4).
Example 5. Evaluation of expression pattern of JK6-29 following ABA induction. Further Northern blot analysis was carried out. In this experiment, the time course of gene expression was compared with the appearance of ABA 8'- hydroxylase activity. ABA 8 '-hydroxylase activity was determined by in vitro assay (see Krochko J.E., et al, 1998, Plant Physiol 118: 849-860) with isolated microsomes isolated from BMS com suspension cells at defined periods after the addition of 200 μM (+)-ABA. Enzyme activity was assayed at 0 (control), 3, 6, 9, 12, 16, 20.5, 25.5 and 28.5 hours after the addition of (+)-ABA. Total RNA was extracted from duplicate tissue samples and expression of the P450 clone, pJK6-29, was determined by Northern blot analysis. The time-course of mRNA induction for pJK6-29 is consistent with the appearance of ABA 8'- hydroxylase activity (Figure 5).
The pattern of accumulation of the mRNA corresponding to this cDNA in com suspension cells after the addition of (+)-ABA confirmed that this P450 enzyme was transcriptionally regulated by (+)- AB A and that the expression of its mRNA was short-lived (Figure 5). The mRNA induction profile was consistent with the enzyme activity profile. Messenger RNA accumulation was strongest soon after the addition of ABA (3 hours). At every time point thereafter the expression of this P450 mRNA was progressively diminished. The data suggest that gene transcription is induced as a pulse of activity soon after the addition of (+)-ABA (200 μM). Messenger RNA accumulation declined rapidly after this initial burst of synthesis and following the decline in mRNA levels the enzymatic activity demonstrated a similar decline.
Example 6.
Isolation of full-length copies of JK6-29
A full-length sequence for the com CYP72A cDNA has been obtained by a sib-selection strategy (Alfandari D. and Daπibere T., 1994, In PCR Methods and Applications, pp 46-49, Cold Spring Harbour) from a full-length cDNA library made from RNA extracted from ABA-induced BMS com suspension cells, screened by PCR with primers designed specifically for the JK6-29 sequence.
These primers are:
SEQ ID NO:7: 5' CGTTGGAGGATGGTGCATAG 3'
and
SEQ ID NO:8: 5' GCTCGGTGGAATCAAATATCC 3'.
The putative full-length sequence was cut out of pYES2 (pBE 10-30, EcoRI / Notl insert) with BamHI and Notl and subcloned into pT-Adv (Clontech) (pBEl 0-30-3) and was sequenced first using vector primers to determine whether it was full-length. On the basis of this sequence infomiation and sequences of partial length clones the following sequencing primers were designed.
SEQ ID NO:9: 5' GATTCCTGACCCAGAGTTAG 3',
SEQ ID NO: 10 5' GCAAGGAGAACTAGCTGAAC 3',
SEQ ID NO11: 5' CCGGATTATGATAGCTTGAG 3',
SEQ ID NO:12 5' CCTGTGCTTTGCCCATT 3',
SEQ ID NO:13 5' CGCAACCAGGCATCAG 3'.
The full-length cDNA sequence is given in SEQ ID NO:2. Comparison of this full-length sequence pBE10-30-3 confirmed that this P450 contains the pJK6-29 sequence and is related to the CYP72A gene family.
cDNA was PCR-amplified from plasmid pBEl 0-30-3, adding BamHI and EcoRN sites to the sequence at the Ν-terminal and C-terminal ends, respectively. Primers used are:
Forward primer,
SEQ ID ΝO:14 5'ATGGATCCATGCTGCGGGAAGTCTCTC 3',
Reverse primer
SEQ ID NO:15 5' ACGATATCGTCCGGTAGCAGCATAGAAG 3').
PCR conditions were 94°C for 30 sec, then 5 cycles of 94°C/30s, 50°C/30s, 68°C/120s and 25 cycles of 94°C/30s, 60°C/30s, 68°C/120s followed by an extension step at 68°C for 3 minutes, using Clontech' s Advantage 2 Polymerase Mix. The PCR product was TA cloned into pT-Adv (Clontech) and the sequence confirmed by sequencing (pTAdv.ComP450). Vector pYeDP60 was cut with BamHI and Smal and the cornP450 insert was cut from pTAdv.ComP450 with BamHI and EcoRV and gel-purified. The vector and insert were ligated to make YeDP60.CornP450 (Figure 9) and the orientation and sequence fidelity were confirmed by sequencing again.
Example 7. Isolation of homologous clones from other plant species.
Using the com JK6-29 cDNA sequence as the standard, orthologous sequences from Arabidopsis were identified by screening the Arabidopsis database. The related genes in Arabidopsis belong to a large (9 members) cytochrome P450 gene subfamily whose members are arrayed in tandem on chromosome 3. The sequence information on this series of P450 monooxygenase genes was first submitted to GenBank by the Kazusa DNA Research Institute on Feb 1st 1999 (PI clone MIE1; GenBank AB023038). The original submission did not describe a function for these P450 gene sequences.
Several P450 ESTs belonging to the CYP72A P450 subfamily were obtained from ABRC (Arabidopsis Biological Resource Center) and the inserts were sequenced and the sizes determined. These P450s included full-length sequences for CYP72A7 and CYP72A14. The CYP72A7 (Ath30): clone 187N22T7 received from ABRC (GB R90024) was analyzed as follows. Full- length of the coding sequence was confirmed initially by sequencing using vector primers, followed by sequencing with gene-specific primers.
cDNA was PCR-amplified from the ABRC plasmid 187N22T7 with gene-specific PCR primers, adding BamHI and Kpnl sites to the N-terminal and C-terminal ends, respectively using the following primers.
A7-Forward-2 primer
SEQ ID NO: 16 5' ATCAGGATCCGTGAGAATCGGAGATGTC 3'
and A7-Reverse-2 primer
SEQ ID NO: 17 5' TCGTGGTACCAAATCAGAGCTTGTGCAG 3'
PCR conditions were 94°C for 30 sec, then 5 cycles of 95°C/30s, 50°C/30s, 68°C/150s and 20 cycles of 95°C/30s, 68°C/180s, followed by an extension step at 68°C for 5 minutes, with Advantage 2 Polymerase Mix (Clontech). The pYEDP60 vector and PCR product were cut separately with BamHI and Kpnl, and then the linearized vector and PCR product were gel- purified.
The PCR product was ligated into the cut vector and transformed into TOPIOF' competent cells. Plasmid pYeDP60.Ath30-2 (Figure 10) was isolated from selected colonies and the insert confirmed by sequencing.
The CYP72A14 (Ath29): clone 181D14T7 received from ABRC (GB
H36956) was similarly analyzed. Full-length was confirmed initially by sequencing using vector primers, followed by sequencing with gene-specific primers.
cDNA was PCR-amplified from the ABRC plasmid 181 D 14T7 using gene-specific PCR primers adding Kpnl and EcoRI sites to the sequence at the N-terminal and C-terminal ends, respectively. Primers used:
A14-Forward-l primer
SEQ ID NO: 18 5' GTGGTACCATGGAGATATCAGTTTCTTCG 3'
and A14-Reverse-1 primer
SEQ ID NO:19 5'CTGAATTCATGTGATTAGAGCTTGTGCAG 3'.
PCR conditions were 94°C for 30 sec, then 5 cycles of 95°C/30s, 55°C/30s, 68°C/150s and 20 cycles of 95°C/30s, 68°C/180s, followed by an extension step at 68°C for 5 minutes, using Clontech's Advantage 2 Polymerase Mix. The pYEDP60 vector and PCR product were cut separately with Kpnl and EcoRI, and then the PCR products gel-purified. The PCR product was ligated into the cut vector and transfonned into TOPIOF' competent cells. Plasmid pYeDP60.Ath29-3 (Figure 11) was isolated from selected colonies and the insert confirmed by sequencing .
Example 8. Expression of ABA hydroxylase genes in heterologous systems.
For yeast expression, the cDNAs were transfeπed into the expression vector pYeDP60 (Pompon D., et al, 1996, Method Enzymol 272: 51-64), and purified recombinant plasmid was subsequently transformed into WAT 11 and WAT 21 yeast strains over-expressing the Arabidopsis cytochrome P450 reductases, CTR1 and CTR2, respectively (Pompon et al.Jbid).
Plasmid was isolated from pYeDP60.CornP450 (Figure 9), pYeDP60.Ath30-2 (Figure 10) and pYeDP60.Ath29-3 (Figure 11) and used to transform yeast strains, WAT 11 and WAT21, using a Li Acetate technique (Kohlami S.E., et al.,1997, In Differentially Expressed Genes in Plants, Taylor and Francis, pp 63-83). Transformants were selected on SC minus URA (6J g/L yeast nitrogen base without amino acids (BIO-101), 1.8 g/L uracil drop-out powder) containing 2% Glucose. Yeast transformation was confirmed by PCR.
For expression analysis the cultures were grown for two days on SC minus URA agar plates at 30°C. A colony was then transfeπed to liquid culture in YPG (lOg/L yeast extract, peptone lOg/L, glucose 20g/L) for growth overnight at 30°C with shaking. The following day the culture was collected by centrifugation (5000 φm for 10 minutes), washed twice with YPL (yeast extract lOg/L, peptone lOg/L, galactose 20g/L), and diluted to OD 0.5 in YPL (Bishop G.J., et al, 1999, Proc Natl Acad Sci 96: 1761-1766). (+)-ABA was added at 20μM to 50 μM. The cultures were incubated for 24 hours at 30°C with shaking. At the conclusion of the experiment the culture media was collected by centrifugation of the entire culture volume at 5000 m for 15 minutes. The media was acidified with HCL (0.166 N final concentration) and re-centrifuged to remove additional protein contamination. One to 10 mis of the sample was loaded onto an Oasis HLB column (Waters) to purify ABA and AB A- metabolites and the resulting eluant was analyzed by LC/MS/MS.
ABA 7'-hydroxylase activity was demonstrated by LC/MS/MS in the cultures in which the CYP72A7 gene was inserted in the pYeDP60 vector (pYeDP60.Ath30-2) and this constmct transformed into the WATl 1 yeast strain (Figure 6). The WAT21 yeast strain did not support any ABA hydroxylase activity in these experiments.
Example 9 Construction of a Plant Transformation Vectors Using the CYP72A7 gene
For constitutive over-expression and anti-sense expression in plants the cDNAs were cloned into a 35S expression cassette in pJIT61 (received from Roger Hellens and Phil Mullineaux; http://www.pgreen.ac.uk/). The expression cassette containing the gene of interest was then subcloned into the MCS of the binary vector pCAMBIA 2300 (received from CAMBIA; http://www.cambia.org/). The insert was confirmed by restriction digests and the resultant plasmid construct was used to transform Agrobacterium strain MP90.
To make the 35S.CYP72A7 expression constructs for Arabidopsis/τplant transformation, the yeast expression constmct pYeDP60.Ath30-2 was cut first with Kpnl and BamHI. The Ath30-2 insert was gel-purified and blunt-ended with T4 DNA polymerase. pJIT61 vector was cut with Smal to give a linearized and blunt-ended vector and was dephosphorylated using CIAP (calf intestinal alkaline phosphatase). The Ath30-2 fragment was ligated into the pJIT61 vector and transformed into E. coli TOPIOF'. Purified plasmid was checked for orientation and both Ath30-2Forward and Ath30-2Reverse colonies were chosen (pJIT61.Ath30-2Forward, pJIT61.Ath30-2Reverse) (Figure 12). The pJIT61.Ath30-2Forward and pJIT61.Ath30-2Reverse plasmids were cut with Xhol, blunt-ended with T4 DNA polymerase and re-cut with Kpnl to liberate the 35S.Ath30-2Forward and 35S.Ath30-2Reverse cassettes. These fragments were gel-purified. pCAMBIA2300 was cut with Hindlll, blunt- ended and re-cut with Kpnl. The 35S-P450 cassettes were ligated into pCAMBIA2300 to give plasmids pCAMBIA2300.Ath30-2Forward and pCAMBIA2300.Ath30-2Reverse (Figure 12). These plasmids were transformed into Agrobacterium strain MP90 and these cultures were used to transform Arabidopsis thaliana (strain Columbia) by the floral dip method (Clough S.J and Bent A.F., 1998, Plant J 16: 735-743). Plants were obtained and analyzed for the presence of the inserted gene.
Example 10 Construction of a Plant Transformation Vectors Using the CYP72A14 gene
To make the 35S.CYP72A14 expression constructs for
Arabidopsi /plant transformation, the yeast expression constmct pYeDP60.Ath29-3 was cut with Kpnl and EcoRI, and the insert was gel- purified and blunt-ended with T4 DNA polymerase. pJIT61 was cut with Smal to give a linearized and blunt-ended vector and was dephosphorylated using CLAP (calf intestinal alkaline phosphatase). The Ath29-3 fragment was ligated into the pJITδl vector and transformed into E. coli TOPIOF'. Purified plasmid was checked for orientation and both Ath29-3Forward and Ath29-3Reverse colonies were chosen (pJIT61.Ath29-3Forward, pJIT61.Ath29-3Reverse) (Figure 13). The pJIT61.Ath29-3Forward and pJIT61.Ath29-3Reverse plasmids were cut with Xhol, blunt-ended with T4 DNA polymerase and re-cut with Kpnl to liberate the 35S.Ath29-3Forward and 35S.Ath29-3Reverse cassettes. These fragments were gel-purified. pCAMBIA2300 was cut with Hindlll, blunt-ended and re-cut with Kpnl. The 35S-P450 cassettes were ligated into pCAMBIA2300 to give plasmids pCAMBIA2300.Ath29-3Forward and pCAMBIA2300.Ath29-3Reverse (Figure 13). These plasmids were transformed into Agrobacterium strain MP90 and these cultures were used to transform Arabidopsis thaliana (strain Columbia) as described above. Plants were obtained and analyzed for the presence of the inserted gene.
Example 11
Constmction of a Plant Transformation Vectors Using the com CYP72A Gene
To make the 35 S. Com P450Forward expression constructs for Arabidopsis/plant transformation, the pTAdv.CornP450 was cut with EcoRV and BamHI, and the insert was gel-purified. pJIT61 was cut with Smal and BamHI. The CornP450 fragment was ligated into the linearized pJIT61 vector and transformed into E. coli TOPIOF' to give pJIT61.ComP450Forward (Figure 14). The 35S promoter was removed from pJIT61.ComP450Forward by Kpnl and BamHI digestion, gel-purified and ligated to pCAMBIA2301 previously cut with Kpnl and BamHI to give p35S.CAMBIA2301 (Figure 15). After transformation, colony selection and plasmid preparation the p35S.CAMBIA2301 was cut with Pstl, blunt-ended with T4 DNA polymerase and re-cut with BamHI. The CornP450Forward.CaMVTerm was isolated from pJIT61.CornP450Forward by digestion with BamHI and EcoRV and gel- purified. The ComP450Forward.CaMVTerm piece was ligated into the linearized p35S.CAMBIA2301 to reconstitute the 35S.P450CornForward expression cassette in the binary vector pCAMBIA2301. Purified plasmid (pCAMBIA2301.CornP450Forward) (Figure 16) was prepared, sequenced and transfom ed into Agrobacterium strain MP90. To make the 35S.Com P450Reverse expression constmct the cDNA was PCR amplified from plasmid BE10-30-3 using gene-specific primers that added Hpal and Xbal sites to the N-terminal and C-terminal, respectively: cornPCR-N:
SEQ ID NO:20 5'ACGTTAACATGCTGCGGGAAGTCTCTC 3'
comPCR-C:
SEQ ID NO:21 5 'ACTCTAGACCGGTAGCAGCATAGAAGGA 3 '
PCR conditions were 94°C for 3 minutes, 5 cycles of 94°C/30s, 48°C/30s, 72°C/120s, 25 cycles of 94°C/30s, 57°C/30s,72°C/120s, and 72°C for 3 minutes using PfuTurbo (Stratagene). The product was ligated into EcoRV cut dephosphorylated pBluescript SK(+), and transformed into TOPIOF' to give pBSK.CornP450 (Figure 17). Colonies were selected and sequenced using gene-specific primers, as before, to ensure fidelity of the PCR amplification. The cornP450 insert was excised from pBSK.ComP450 by cutting with Hpal and Xbal and gel-purified. The purified insert was ligated to Xbal and Smal cut pJIT61 vector to give pJIT61.ComP450Reverse (Figure 17). This vector was cut with Xbal and EcoRV and the ComP450Reverse.CaMVTerm piece was gel- purified. The CornP450Reverse.CaMNTerm was ligated into p35S.CAMBIA2301 that had been cut with Pstl, blunt-ended and then cut again with Xbal. The structure of the resultant vector pCAMBIA2301.CornP450Reverse (Figure 18) was verified by restriction digests, sequenced and trnsformed into Agrobacterium strain MP90.
Example 12 Construction of Plant Transformation Vectors Using an Inducible Promoter and a CYP72A Gene It some instances it is desirable to have a CYP72A gene under the control of a inducible promoter. For conditional tetracycline-inducible expression in tobacco, the cDNAs were cloned into the binary vector pBINHygTX (Gatz C, et al, 1992, Plant J 2: 397-404). This promoter is repressed in plants expressing the TetR gene but de-repressed when tetracycline is applied to the plant (Gatz et al.Jbid). In this way specific temporal and spatial expression can be achieved. Tobacco seeds from plants already expressing TetR were received from Christiane Gatz. Expression of TetR was confirmed by Northern blot expression analysis.
For the CYP72A7-containing construct, the vector pYeDP60.Ath30-2 was cut with BamHI, blunt-ended with T4 DNA polymerase and the Ath30-2 gene insert was liberated by a final cut with Kpnl. The Ath30-2 insert was gel- purified. pBINHygTx was cut with Hpal and Kpnl sequentially and the Ath30- 2 insert ligated to the Hpal/Kpnl cut vector to give pBINHygTx.Ath30-2 (Figure 19). The plasmid constmction was confirmed by restriction digestion and sequencing.
For the CYP72A14-containing constmct the gene was obtained from pYES2.Ath29-4 (pYES2.Ath29-4: sequence was PCR amplified (as described for pYeDP60.Ath29-3), cut with EcoRI and Kpnl to expose the ends, and ligated into pYES2 vector cut with EcoRI and Kpnl). pYES2.Ath29-4 was cut with Xbal and Kpnl and the gel-purified insert was ligated into Xbal/Kpnl cut pBINHygTx. The resultant plasmid, pBINHygTx. Ath29-4 (Figure 20), was confirmed by restriction digestion and sequencing.
For the CornP450-containing constmct the CornP450 insert was cut from ρBSK.CornP450 with Hpal and Xbal, gel-purified and ligated into pBINHygTx vector cut with Hpal and Xbal to give pBINHygTx. CornP450 (Figure 21). This plasmid was purified and the plasmid construction confirmed by restriction digestion and sequencing.
After plasmid purification, the plasmids pBINHygTx. Ath30-2, pBINHygTx.Ath29-4 and pBINHygTx.CornP450 were transformed into Agrobacterium MP90. Successful Agrobacterium transformation was confirmed by restriction digestion of isolated plasmid.
Example 13 Transformation of Plant Cells with a Vector Containing an Inducible Promoter and a CYP72A Gene
The vectors pBINHygTx.Ath30-2, pBINHygTx.Ath29-4 and pBINHygTx. CornP450 were used to re-transform tobacco, already expressing the TetR. Tobacco plants were selected on hygromycin due to the presence of kanamycin resistance in the TetR plants. Plants were obtained and analyzed for the presence of the inserted gene.
SEQUENCE LISTING FREE TEXT
SEQ ID NO.7 JK6-29 PCR primer SEQ ID NO.8 JK6-29 PCR primer SEQ ID NO.9 Sequencing primer SEQ ID NO.10 Sequencing primer SEQ ID NO.11 Sequencing primer SEQ ID NO.12 Sequencing primer SEQ ID NO.13 Sequencing primer SEQ ID NO.14 BE10-30-3 PCR primer (BamH I) SEQ ID NO.15 BE10-30-3 PCR primer (EcoR V) SEQ ID NO.16 CYP72A7 (Ath30) PCR primer (BamH I) SEQ ID NO.17 CYP72A7 (Ath30) PCR primer (Kpn I)
SEQ ID NO.18 CYP72A14 (Ath29) PCR primer (Kpn I)
SEQ ID NO.19 CYP72A14 (Ath29) PCR primer (EcoR I)
SEQ ID NO.20 BE10-30-3 PCR primer (Hpa I) SEQ ID NO.21 BE10-30-3 PCR primer (Xba I)
SEQ ID NO.22 Conserved motif
SEQ ID NO.23 Conserved motif
In position 5, Xaa = Lys, Arg or His
In position 6, Xaa — Any amino acid SEQ ID NO.24 Conserved motif
In position 2, Xaa = Leu or He
In position 5, Xaa = Leu, He or Val
In position 6, Xaa = Leu or Met
In position 7, Xaa = Val or Leu In position 8, Xaa = Glu, Gin or lys
NUCLEOTIDE AND PEPTIDE SEQUENCES
SEQ ID NO:l pJK6-29 CDNA
ACGGCGCGTGGGTGTAGGATGGCGAGAGCTCGAACGAGAAGCGTTGGAGGATGGTGCATAGCGT CATCTTGGCTTCCAGCAACGCAAAGCTCTGGCCGATGCAGATTCTAGGCCCCCCTCCGAACGGA AAGAAAGCAGCCTGATGCCTGGTTGCGCTGGAGATGCCGTTGGCAAACCTTTCTGGGTTGAACT CGCTTGCGTCTTTTCCCCAAATGTCAGGATCATGGTGAATGAAGATGAC<3GGTAGAAGGAGGTC AACTCCTGCAGGATATTTGATTCCACCGAGCTCCATTTCCTTATAAGTTCTTCTTGTTAGAAAG GTTGCCGGTGGGT
SEQ ID NO: 2 pBE10-30-3 CDNA
GGCTGTATCCGCCATCTGCTTCTCTCTTCCACTGCCCCAAGCCGCCACCAATGGCGACCTGCGT TCTGCTGATGCTGCGGGAAGTCTCTCCGTGGGCGCTGGCCAGCGTGGTGGCGTCCGTGTCGCTG
TTGTGGCTGGTGGTCTGGACGCTGGAGTGGGCCTGGTGGACGCCTTGGCGGCTCGAGCGGGCCC TGCGGGTCCAGGGCCTCAAGGGCACCAGGTACCGCCTCTTCACCGGCGACCTGAGGGAAACCGC CCGGGCTAACCGGGAGGCTCGCAAGAAGCCGCTGCCGCTCGGCAGCCACGACATCGCCCCACGC GTGCAGCCCATGCATCACAGCACCATCAAGGAATACGGGAAACTATCGTTCACCTGGTTCGGCC CAACACCAAGGGTGATGATTCCTGACCCAGAGTTAGTCAAAGAGGTGCTGTCTAATAAGTTTGG CCACTTTGGCAAACCAAGGAGTAACCGCATTGGGAGGTTGCTAGCCAACGGGCTTGTAAATCAT GATGGTGAAAAATGGGCAAAGCACAGGAGAATTCTTAATCCTGCATTTCACCATGAAAAAATAA AGGGGATGATGCCAGTATTTTCTACCTGCTGTATTGAAATGATTACTAGATGGGATAATTCAAT GCCTTCTGAGGGATCTTCTGAGATAGATGTCTGGCCTGAGTTCCAGAATCTTACTGGAGATGTT ATCTCAAGAACTGCGTTTGGGAGCAACTATCAAGAAGGGAGGAGAATTTTCGAGCTGCAAGGAG T^ACTAGCTGAACGCCTCATCCAATCTGTTCAGACAATATTTATCCCAGGCTATTGGTTCTTGCC CACCAAAAACAACAGAAGGATGAGAGCGATCGATGTAGAGATCCGCAAAATTCTCCGTGAAATA ATTGGGAAGAGAGAGAAGGATACTAAAAACAGAGAAACAAATAACGACGACTTGCTGGGCTTAT TACTGGAGTCAAACACAAGGCAATCAAATGGAAATGCAAGCCTGGGATTGACAACAGAAGATGT GATTGAGGAATGCAAGTTATTTTACTTTGCAGGTATGGAGACAACATCAGTCCTTCTTACTTGG ACACTTATTGTGCTAAGCATGCACCCAGAATGGCAAGAGAGAGCAAGAGAAGAGGTTTTGAGCC ACTTTGGAAGAACCACACCGGATTATGATAGCTTGAGCCGCCTCAAGACTATAACCATGATTCT ACATGAGGTCCTTAGGTTGTACCCACCGGCAACCTTTCTAACAAGAAGAACTTATAAGGAAATG GAGCTCGGTGGAATCAAATATCCTGCAGGAGTTGACCTCCTTCTACCCGTCATCTTCATTCACC ATGATCCTGACATTTGGGGAAAAGACGCAAGCGAGTTCAACCCAGAAAGGTTTGCCAACGGCAT CTCCAGCGCAACCAGGCATCAGGCTGCTTTCTTTCCGTTCGGAGGGGGGCCTAGAATCTGCATC GGCCAGAGCTTTGCGTTGCTGGAAGCCAAGATGACGCTATGCACCATCCTCCAACGCTTCTCGT TCGAGCTCTCGCCATCCTACACCCACGCGCCGTACACCGTGATAACACTGCACCCTCAACATGG TGCTCAGATAAGGCTCAAAAAGCTTTCTCCGTGATGCTCCTTCTATGCTGCTACCGGACACTAC TTTCGTTACTGACCGCATATGTAGAAACGTATTTCTTATTTAGTATGTATTTTTTAGGATATAA ATAAAAAGATGGTGCATATTAATGGGAAATAAGTTCCCTTGTATGCATTGCGATGTAATTTTGG GAAGATTTGGCAAGGAACTTAATTATACAATATATGTATTG
SEQ ID NO: 3 CYP72A7: (Ath30-2) DNA
ATGTCTTTTTCAGTAGTAGCAGCTTTACCGGTGCTTGTAGCAGTAGTGGTACTGTGGACATGGC GGATCGTGAAGTGGGTCTGGATAAAACCAAAGATGCTTGAGAGTTCTTTGAAAAGACAGGGTCT TACCGGAACTCCTTACACTCCTCTCGTCGGAGATATAAAGAGGAATGTTGATATGATGATGGAA GCGAGATCTAAACCCATCAATGTAACGGATGATATCACCCCACGTCTCCTTCCTCTTGCCTTAA AGATGCTCAATTCTCACGGAAAGACTTTCTTCATATGGATTGGACCACTTCCAACGATTGTGAT AACGAATCCTGAGCAGATCAAGGAAGTCTTTAATAAAGTCAACGACTTTGAGAAAGCTTCTACA TTCCCTTTGATCAGATTGTTAGCAGGTGGGCTTGCAAGTTACAAGGGAGATAAATGGGCGAGTC ACAGGAGGATCATCAACCCGGCTTTTCACCTCGAAAAAATCAAGAACATGATCCCTGCGTTCTA CCATTGTTGCAGCGAGGTTGTCTGTCAATGGGAGAAGCTATTTACAGATAAAGAATCGCCTCTT GAAGTCGATGTTTGGCCTTGGCTTGTGAATATGACTGCGGATGTCATCTCACATACTGCTTTTG GAAGTAGCTATAAAGAAGGGCAGAGAATATTTCAACTACAAGGGGAATTGGCTGAGCTTATCGC ACAAGCTTTTAAGAAATCTTACATCCCTGGATCGAGGTTTTACCCAACAAAGAGCAATAGAAGG ATGAAAGCAATAGATAGAGAAGTAGACGTAATATTGAGAGGTATTGTGAGCAAACGGGAGAAAG CGAGAGAAGCTGGAGAACCAGCAAACGATGATTTGTTGGGGATATTGCTTGAATCCAATTCAGA GGAATCTCAAGGAAATGGAATGAGCGTAGAAGATGTGATGAAAGAGTGCAAGTTGTTTTATTTC GCGGGACAAGAGACAACTTCAGTACTTTTGGTGTGGACTATGGTTTTATTAAGCCATCACCAAG ACTGGCAAGCTCGCGCACGAGAGGAAGTGATGCAAGTACTCGGTGAAAATAATAAACCTGATAT GGAGTCCCTTAACAACCTTAAAGTCATGACTATGATCTTCAATGAGGTTTTGAGGCTATACCCT CCGGTGGCTCAGCTTAAACGAGTTGTCAACAAAGAAATGAAGCTCGGAGAGTTGACCCTTCCAG CTGGAATTCAAATTTACTTACCAACTATTCTTGTCCAGCGTGACACCGAGCTTTGGGGCGATGA TGCAGCGGATTTTAAACCCGAGCGGTTCAGAGACGGGCTCTCAAAGGCAACAAAGAACCAGGTC TCTTTCTTCCCCTTTGGATGGGGACCTAGGATTTGCATCGGTCAGAATTTTGCTATGTTGGAGG CAAAGATGGCAATGGCTTTGATTCTACAAAAGTTCTCCTTCGAGCTCTCTCCTTCTTATGTTCA CGCGCCTCAAACAGTCATGACCACTCGTCCCCAATTCGGAGCTCATCTAATTCTGCACAAGCTC TGA
SEQ ID NO: 4 CYP72A14: (Ath29-3) DNA ATGGAGATATCAGTTTCTTCGGTAACATTTTCACTAGCTGTAGTTGTTGTGTCTTGGTGGGTAT GGAGAACGTTAAAGTGGGTTTGGTTCACACCAAAGATGCTTGAGCGTTCCCTGAGAAGACAAGG TCTTTCCGGAACTTCTTACACGCCTCTAATCGGCGATTTTAAAAAGATGATCAGCATGTTCATT GAGGCAACATCCAAACCCATCAAACCAACAGATGATATCACCCCTCGTGTCATGCCTCATCCCT TGCAAATGCTCAAGACTCATGGAAGGACTAACTTAACATGGTTTGGACCAATACCAACAATCAC CATAATGGATCCTGAGCAAATCAAGGAAGTGTTCAACAAAGTCTATGACTTCCAGAAGGCGCAT ACGTTTCCTTTAAGCAAAATACTAGGCACGGGACTCGTTAGTTATGATGGCGATAAATGGGCGC AACACCGAAGAATCATCAATCCGGCTTTCCACCTTGAGAAGATCAAGAATATGGTACATGTGTT CCACGAAAGCTGCAGCGAGCTTGTTGGTGAGTGGGACAAGTTAGTCTCGGATAAAGGGTCCTCA TGTGAGGTGGACGTGTGGCCTGGGCTTACGAGTATGACTGCAGATGTGATCTCCCGTACTGCTT TTGGTAGCAGCTACAGAGAAGGACACAGGATATTTGAACTCCAGGCAGAACTAGCACAGCTAGT CATGCAAGCTTTTCAGAAATTTTTTATTCCCGGATATATTTATCTCCCAACAAAGGGTAATAGA AGGATGAAAACAGCAGCCAGAGAAATCCAAGATATACTGAGAGGGATCATTAACAAAAGGGAAA GGGCAAGAGAATCTGGAGAAGCACCAAGCGAGGATTTGCTAGGTATACTTCTTGAATCAAACTT GGGGCAAACGGAAGGGAATGGAATGAGTACCGAGGATATGATGGAAGAATGCAAGTTGTTCTAT TTGGCCGGGCAAGAGACAACATCAGTACTTCTGGTTTGGACAATGGTTCTGTTGAGCCAACACC AAGATTGGCAGGCTCGTGCACGAGAGGAAGTGAAGCAAGTTTTTGGCGATAAACAACCTGATAC AGAAGGCCTTAACCAACTCAAAGTTATGACGATGATATTATATGAGGTCCTTAGGCTTTATCCT CCTGTAGTCCAGCTGACCCGAGCCATTCACAAAGAGATGAAGCTCGGAGATCTGACTTTACCAG GCGGTGTTCAGATCAGTCTACCTGTTCTGCTTGTCCATCGCGACACGGAGCTGTGGGGAAACGA TGCAGGGGAGTTCAAGCCTGAGAGATTCAAAGACGGCCTCTCAAAAGCAACAAAGAACCAAGTC TCCTTCTTTCCCTTTGCGTGGGGACCAAGGATCTGCATTGGCCAGAATTTTACATTGCTTGAGG CAAAGATGGCAATGAGTTTGATTCTACAGAGATTCTCCTTCGAGCTTTCTCCTTCCTATGTTCA CGCGCCTTACACAATCATCACCCTTTACCCACAGTTCGGAGCTCATCTTATGCTGCACAAGCTC TAA
SEQ ID NO: 5
Sequence-translation of Ath30-2 Protein
MSFSWAALPVLVAVWLWT RIVKWV IKPKMLESSLKRQG TGTPYTPLVGDIKRNVD MMMEARSKPINVTDDITPR PLALKMLNSHGKTFFI IGP PTIVITNPEQIKEVFNKV NDFEKASTFPLIR LAGGLASYKGDKWASHRRIINPAFH EKIKNMIPAFYHCCSEλA/CQ WEKLFTDKESPLEVD PWLVNMTADVISHTAFGSSYKEGQRIFQLQGΞLAELIAQAFKK SYIPGSRFYPTKSNRRMKAIDREVDVILRGIVSKRΞKAREAGΞPANDDLLGILLESNSEE SQGNGMSVEDVMKECK FYFAGQETTSVL V TMVL SHHQD QARAREΞVMQVLGENNK PDMΞSLNNLKVMTMIFNEVLRLYPPVAQLKRWNKΞMK GELTLPAGIQIYLP 11-VQRD TEL GDDAADFKPERFRDGLSKATKNQVSFFPFGWGPRICIGQNFAMLEAKMAMA ILQK FSFELSPSYVHAPQTVMTTRPQFGAHLILHK -
SEQ ID NO : 6
Sequence- translation of Ath29-3
Protein
MEISVSSVTFSLAWWS V RTLKWVWFTPKMLERSLRRQGLSGTSYTPLIGDFKKMI SMFIEATSKPIKPTDDITPRVMPHPLQMLKTHGRTN T FGPIPTITIMDPEQIKEVFNK VYDFQKAHTFPLSKILGTG VSYDGDK AQHRRIINPAFH EKIKN VHVFHESCSELVG E DKLVSDKGSSCEVDVWPGLTSMTADVISRTAFGSSYREGHRIFΞLQAΞLAQLVMQAFQ KFFIPGYIYLPTKGNRRMKTAAREIQDILRGIINKRERARESGEAPSEDL GIL ESN G QTEGNGMSTEDMMEECKLFY AGQETTSVL TMVL SQHQDWQARAREΞVKQVFGDKQ PDTEGLNQLKVMTMI YEVLRLYPPWQLTRAIHKEMKLGDLTLPGGVQISLPVL VHRD TELWGNDAGEFKPERFKDGLSKATKNQVSFFPFA GPRICIGQNFTLLEAKMAMS ILQR FSFE SPSYVHAPYTIITLYPQFGAHLM HKL SEQ ID NO: 7 Synthetic DNA 5' CGTTGGAGGATGGTGCATAG 3'
SEQ ID NO: 8
Synthetic DNA
5' GCTCGGTGGAATCAAATATCC 3'
SEQ ID NO: 9
Synthetic DNA
5' GATTCCTGACCCAGAGTTAG 3'
SEQ ID NO: 10 Synthetic DNA
5' GCAAGGAGAACTAGCTGAAC 3'
SEQ ID NO: 11 Synthetic DNA 5' CCGGATTATGATAGCTTGAG 3'
SEQ ID NO: 12 Synthetic DNA 5' CCTGTGCTTTGCCCATT 3'
SEQ ID NO: 13
Synthetic DNA
5 ' CGCAACCAGGCATCAG 3'
SEQ ID NO: 14 Synthetic DNA 5 'ATGGATCCATGCTGCGGGAAGTCTCTC 3 '
SEQ ID NO: 15 Synthetic DNA
5' ACGATATCGTCCGGTAGCAGCATAGAAG 3' SEQ ID NO : 16
Synthetic DNA
5' ATCAGGATCCGTGAGAATCGGAGATGTC 3'
SEQ ID NO: 17 Synthetic DNA 5' TCGTGGTACCAAATCAGAGCTTGTGCAG 3'
SEQ ID NO: 18 Synthetic DNA
5' GTGGTACCATGGAGATATCAGTTTCTTCG 3 '
SEQ ID NO: 19 Synthetic DNA 5 ' CTGAATTCATGTGATTAGAGCTTGTGCAG 3'
SEQ ID NO: 20 Synthetic DNA
5 ' ACGTTAACATGCTGCGGGAAGTCTCTC 3 '
SEQ ID NO: 21
Synthetic DNA
5 'ACTCTAGACCGGTAGCAGCATAGAAGGA 3 '
SEQ ID NO: 22
Conserved motif (protein) EVLRLY
SEQ ID NO: 23 Conserved motif (protein) Dv S[KRH]XAFG
SEQ ID NO: 24
Conserved motif (protein) D [LI] LG [LIV] [ M] [VL] [EQK]

Claims

Claims:
1. Isolated and purified deoxyribonucleic acid (DNA), that encodes a protein having ABA hydroxylase activity, characterized in that said DNA comprises SEQ ID NO:2, or a sequence that encodes a protein having at least 50% identity to said protein encoded by SEQ ID NO:2
2. A protein exhibiting ABA hydroxylase activity, characterized in that said protein is encoded by SEQ ID NO: 2 or has at least 50% identity to the protein encoded by SEQ ID NO:2.
3. A protein according to claim 2, characterized in that said protein has a heme binding domain and has a conserved amino acid sequence comprising SEQ ID NO:22 about 80 amino acids N-terminal to said heme binding domain.
4. A protein according to claim 3, characterized in that said protein has a conserved amino acid sequence comprising SEQ ID NO:23 located about 240 to 250 amino acids N-terminal to said heme binding domain.
5. A vector for transformation of plant cells, characterized in that said vector contains a protein-encoding deoxyribonucleic acid (DNA) sequence according to SEQ ID NO:2 or a DNA sequence that encodes a protein having at least 50% identity to the protein encoded by SEQ ID NO:2.
6. A plant having a genome, characterized in that the genome includes an introduced protein-encoding nucleotide sequence of SEQ ID NO:2, or an introduced DNA sequence that encodes a protein having at least 50% identity to the protein encoded by SEQ ID NO:2.
7. Isolated and purified deoxyribonucleic acid (DNA), that encodes a protein having ABA hydroxylase activity, characterized in that said DNA comprises SEQ ID NO:3, or a sequence that encodes a protein having at least 50% identity to said protein encoded by SEQ ID NO:3.
8. A protein exhibiting ABA hydroxylase activity, characterized in that said protein is encoded by SEQ ID NO:3 or has at least 50% identity to the protein encoded by SEQ ID NO : 3.
9. A protein according to claim 8, characterized in that the protein has a heme binding domain and a conserved amino acid sequence of SEQ ID NO: 22 about 80 amino acids N-terminal to the heme binding domain.
10. A protein according to claim 9, characterized in that the protein comprises SEQ ID NO:23 located about 240 to 250 amino acids N- terminal to the heme binding domain.
11. A vector for transformation of plant cells, characterized in that said vector contains a protein-encoding deoxyribonucleic acid (DNA) sequence according to SEQ ID NO:3 or a DNA sequence that encodes a protein having at least 50% identity to the protein encoded by SEQ ID NO:3.
12. A plant having a genome, characterized in that the genome includes an introduced protein-encoding nucleotide sequence of SEQ ID NO:3, or an introduced DNA sequence that encodes a protein having at least 50% identity to the protein encoded by SEQ ID NO:3.
13. Isolated and purified deoxyribonucleic acid (DNA), that encodes a protein having ABA hydroxylase activity, characterized in that said DNA comprises SEQ ID NO:4, or a sequence that encodes a protein having at least 50% identity to said protein encoded by SEQ ID NO:4.
14. A protein exhibiting ABA hydroxylase activity, characterized in that said protein is encoded by SEQ ID NO:4 or has at least 50% identity to the protein encoded by SEQ ID NO:4.
15. A protein according to claim 14, characterized in that said protein has a heme binding domain and has a conserved amino acid sequence comprising SEQ ID NO:22 about 80 amino acids N-terminal to said heme binding domain.
16. A protein according to claim 15, characterized in that said protein has a conserved amino acid sequence comprising SEQ ID NO:23 located about 240 to 250 amino acids N-terminal to said heme binding domain.
17. A vector for transformation of plant cells, characterized in that said vector contains a protein-encoding deoxyribonucleic acid (DNA) sequence according to SEQ ID NO:4 or a DNA sequence that encodes a protein having at least 50% identity to the protein encoded by SEQ ID NO:4.
18. A plant having a genome, characterized in that the genome includes an introduced protein-encoding nucleotide sequence of SEQ ID NO:4, or an introduced DNA sequence that encodes a protein having at least 50% identity to the protein encoded by SEQ ID NO:4.
19. A method of producing a transgenic plant comprising the step of introducing a nucleotide sequence into a genome of the plant or part thereof, and carrying out plant growth and development, characterized in that said nucleotide sequence is SEQ ID NO:2 or a DNA sequence that encodes a protein with at least 50% identity to the protein encoded by
SEQ ID NO:2.
20. An isolated polynucleotide comprising a nucleotide sequence encoding a polypeptide selected from plant CYP72A P450 monooxygenases, characterized in that said plant CYP72A P450 monooxygenase has ABA hydroxylase activity.
21. An isolated polynucleotide according to claim 20, characterized in that the isolated polynucleotide is DNA.
22. An isolated polynucleotide according to claim 20, characterized in that the isolated polynucleotide is RNA.
23. An isolated polynucleotide according to claim 20, characterized in that said nucleotide sequence encodes an enzyme with ABA 7 '-hydroxylase activity.
24. An isolated polynucleotide according to claim 20, characterized in that said nucleotide sequence encodes an enzyme with ABA 8 '-hydroxylase activity.
25. An isolated polynucleotide conesponding to the complement of SEQ ID NO:l or the complement of SEQ ID NO:2.
26. A chimeric gene comprising a deoxyribonucleic acid (DNA) operably linked to a regulatory element, characterized in that said DNA comprises sequence SEQ ID NO:2 or a DNA sequence that encodes a protein with at least 50% identity to the protein encoded by SEQ ID NO:2.
27. A chimeric gene comprising a deoxyribonucleic acid (DNA) operably linked to a regulatory element, characterized in that said DNA comprises sequence SEQ ID NO: 3 or a DNA sequence that encodes a protein with at least 50% identity to the protein encoded by SEQ ID NO:3.
28. A chimeric gene comprising a deoxyribonucleic acid (DNA) operably linked to a regulatory element, characterized in that said DNA comprises sequence SEQ ID NO:4 or a DNA sequence that encodes a protein with at least 50% identity to the protein encoded by SEQ ID NO:4.
29. The chimeric gene of any one of claims 26 to 28, characterized in that said regulatory element is selected from constitutive, tissue selective and inducible promoters.
30. The chimeric gene of any one of claims 26 to 28, characterized in that said deoxyribonucleic acid is in an antisense orientation relative to the regulatory element.
31. The chimeric gene of any one of claims 26 to 28, characterized in that said deoxyribonucleic acid is in a sense orientation relative to the regulatory element.
32. A method of modifying catabolism of ABA in a plant, comprising: (a) introducing into a plant cell capable of being transformed and regenerated to a whole plant a genetic constmct comprising a DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in plant cells, a DNA sequence that comprises SEQ ID NO: 2 or a DNA sequence that encodes a protein with at least 50% identity to the protein encoded by SEQ ID NO:2, operably linked to a transcriptional regulatory region, and (b) recovery of a plant which contains said additional deoxyribonucleic acid.
33. A method of modifying catabolism of ABA in a plant, comprising: (a) introducing into a plant cell capable of being transformed and regenerated to a whole plant a genetic constmct comprising a DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in plant cells, a DNA sequence that comprises SEQ ID NO: 3 or a DNA sequence that encodes a protein with at least 50% identity to the protein encoded by SEQ ID NO:3, operably linked to a transcriptional regulatory region, and (b) recovery of a plant which contains said additional deoxyribonucleic acid.
34. A method of modifying catabolism of ABA in a plant, comprising: (a) introducing into a plant cell capable of being transformed and regenerated to a whole plant a genetic constmct comprising a DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in plant cells, a DNA sequence that comprises SEQ ID NO:4 or a DNA sequence that encodes a protein with at least 50% identity to the protein encoded by SEQ ID NO:4, operably linked to a transcriptional regulatory region, and (b) recovery of a plant which contains said additional deoxyribonucleic acid.
35. A method of modifying the catabolism of ABA analogs in a plant comprising: (a) introducing into a plant cell capable of being transformed and regenerated to a whole plant a genetic construct comprising a DNA expression cassette that comprises, in addition to the DNA sequences required for transformation and selection in plant cells, a DNA sequence that comprises SEQ ID NO:4 or a DNA sequence that encodes a protein with at least 50% identity to the protein encoded by SEQ ID NO:4, operably linked to a transcriptional regulatory region; (b) recovery of a plant which contains said additional DNA; and (c) treating the plant with an ABA analog to recover a plant that has a novel physiological response to said analog, when compared to a non- recombinant plant treated with said ABA analog.
36. A method according to any one of claims 32 to 35, characterized in that the plant is a dicotyledonous plant.
37. A method according to any one of claims 32 to 35, characterized in that the plant is a monocotyledonous plant.
38. Isolated and purified deoxyribonucleic acid (DNA), characterized in that said DNA includes SEQ ID NO:l, or a DNA that encodes a protein with at least 50% identity to the protein encoded by SEQ ID NO: 1.
39. An expression cassette comprising DNA, characterized in that said DNA comprises SEQ ID NO:2 or a sequence that encodes a protein with at least 50% identity to the protein encoded by SEQ ID NO:2, operably linked to a regulatory element.
40. An expression cassette comprising DNA, characterized in that said DNA comprises SEQ ID NO: 3 or a sequence that encodes a protein with at least 50% identity to the protein encoded by SEQ ID NO:3, operably linked to a regulatory element.
1. An expression cassette comprising DNA, characterized in that said DNA comprises SEQ ID NO:4 or a sequence that encodes a protein with at least 50% identity to the protein encoded by SEQ ID NO:4, operably linked to a regulatory element.
EP01999639A 2000-12-07 2001-12-06 Abscisic acid 8'- and 7'- hydroxylase genes and related sequences from plants Withdrawn EP1341916A2 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US25151800P 2000-12-07 2000-12-07
US251518P 2000-12-07
PCT/CA2001/001756 WO2002046377A2 (en) 2000-12-07 2001-12-06 Abscisic acid 8'- and 7'- hydroxylase genes and related sequences from plants

Publications (1)

Publication Number Publication Date
EP1341916A2 true EP1341916A2 (en) 2003-09-10

Family

ID=22952305

Family Applications (1)

Application Number Title Priority Date Filing Date
EP01999639A Withdrawn EP1341916A2 (en) 2000-12-07 2001-12-06 Abscisic acid 8'- and 7'- hydroxylase genes and related sequences from plants

Country Status (4)

Country Link
EP (1) EP1341916A2 (en)
AU (1) AU2002215744A1 (en)
CA (1) CA2436973A1 (en)
WO (1) WO2002046377A2 (en)

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1947925B1 (en) * 2005-10-20 2013-12-25 Commonwealth Scientific And Industrial Research Organisation Cereals with altered dormancy
CN110923249A (en) * 2019-10-15 2020-03-27 贵州省烟草科学研究院 Tobacco CyP71 and application thereof in regulation and control of plant epidermal hair development

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO0246377A3 *

Also Published As

Publication number Publication date
WO2002046377A3 (en) 2003-01-03
WO2002046377A9 (en) 2002-10-31
CA2436973A1 (en) 2002-06-13
WO2002046377A2 (en) 2002-06-13
AU2002215744A1 (en) 2002-06-18

Similar Documents

Publication Publication Date Title
EP0904290B1 (en) Nucleic acid encoding gai gene of arabidopsis thaliana
US8084668B2 (en) Gibberellin 2-oxidase
US7138567B2 (en) Ga20 oxidase from rice and uses thereof
JP3783777B2 (en) Gibberellin 2-oxidase gene having a new function and use thereof
EP1254958A1 (en) RICE-ORIGIN GIBBERELLIN 3 beta-HYDROXYLASE GENES AND UTILIZATION THEREOF
US20040103451A1 (en) Abscisic acid 8&#39;-and 7&#39;-hydroxylase genes and related sequences from plants
US7932434B2 (en) Late blight resistance gene from wild potato
WO2008157375A1 (en) Nitrate reductases from porphyra, compositions and methods of use thereof
WO2002046377A2 (en) Abscisic acid 8&#39;- and 7&#39;- hydroxylase genes and related sequences from plants
AU720590B2 (en) Novel plant steroid 5alpha reductase, DET2
JP3781622B2 (en) Rice-derived gibberellin 3β-hydroxylase gene and use thereof
AU2006319712B2 (en) Novel hydroxysteroid dehydrogenase gene for alteration of plant phenotype
WO1998059057A1 (en) Ga4 homologue dna, protein and methods of use
WO2006100573A1 (en) Method for producing plants with increased biomass
MXPA00012340A (en) Enzyme
NZ542731A (en) Manipulation of organic acid biosynthesis and secretion

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20030703

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE TR

AX Request for extension of the european patent

Extension state: AL LT LV MK RO SI

17Q First examination report despatched

Effective date: 20040105

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20040518