EP1313842A2 - Human n-acetyltransferase family member and uses thereof - Google Patents

Human n-acetyltransferase family member and uses thereof

Info

Publication number
EP1313842A2
EP1313842A2 EP01984016A EP01984016A EP1313842A2 EP 1313842 A2 EP1313842 A2 EP 1313842A2 EP 01984016 A EP01984016 A EP 01984016A EP 01984016 A EP01984016 A EP 01984016A EP 1313842 A2 EP1313842 A2 EP 1313842A2
Authority
EP
European Patent Office
Prior art keywords
conat
nucleic acid
polypeptide
protein
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP01984016A
Other languages
German (de)
French (fr)
Inventor
Rosana Kapeller-Libermann
Mark Williamson
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Millennium Pharmaceuticals Inc
Original Assignee
Millennium Pharmaceuticals Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Millennium Pharmaceuticals Inc filed Critical Millennium Pharmaceuticals Inc
Publication of EP1313842A2 publication Critical patent/EP1313842A2/en
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1025Acyltransferases (2.3)
    • C12N9/1029Acyltransferases (2.3) transferring groups other than amino-acyl groups (2.3.1)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • Acetyltransferases are the enzymes that catalyze the acetylation of protein substrates, and as such, are important regulators of a broad range of cellular processes including, but not limited to, gene expression, cellular metabolism (e.g., drug metabolism), neurotransmitter synthesis, intracellular movement (e.g., mitotic spindle and chromosome movement during cell division), and vesicular transport (Darnell, Lodish and Baltimore. Molecular Cell Biology, Scientific American Books, Inc., ⁇ 1990).
  • the acetylation of histones is an important transcriptional regulatory mechanism, and may be important in long range chromatin structures such as heterochromatin, locus control regions, and chromosome inactivation.
  • Histone acetylation is ubiquitous, although steady state levels of acetylation vary in between genomic loci, due to the dynamic balance between acetyltransferases and deacetylases.
  • the acetylation of internal conserved amino terminal lysine residues of core histones is associated with transcriptional activation, and acetyltransferase activity is associated with coactivator complexes (Struhl, K. Genes Develop. 12:599-606).
  • Transcriptional regulatory proteins e.g., the TAFE250 subunit of TFIID, have been identified that possess intrinsic histone acetyltransferase activity, thus linking histone acetylation with transcriptional control (Mizzen, C.A.
  • Histone acetylation affects intrinsic chromatin structure and promotes access of the transcriptional machinery to cognate binding sites on DNA (Struhl, K. Genes Develop. 12:599-606).
  • transcriptional regulatory proteins such as TAFII250, PCAF (p300/CBP-associated factor), and p300/CBP are also capable of acetylating non-histone proteins, such as the basal transcription machinery for RNA Pol II (Inhof, A. et al. (1997) Curr. Biol. 7:689-92), and transcription factors such as p53, suggesting that acetylation may also be used as a general mechanism to regulate protein activity within transcription complexes.
  • N-acetyltransferases catalyze the transfer of acetyl groups from Coenzyme A to the N-termini of most eukaryotic proteins.
  • Two N-acetyltransferases have been isolated from the yeast Saccharomyces cerevisiae, namely NAT1 and ARD1, and have been shown to encode the major N alpha-N-acetyltransferase, which acts on certain proteins having serine, glycine, and alanine amino termini but not methionine amino termini.
  • a third gene from S. cerevisiae, NAT2 is believed to act on proteins having methionine termini.
  • NAT1 and NAT2 have been identified having N- acetyltransferase activity (Kulkarni, M.S. et al. (1994) J Biol. Chem. 269:13141-13147, Blum, M. et al. (1990) Cell Biol. 9:193-203).
  • N-acetylfransferases are essential for the activation and deactivation of aromatic and heterocyclic amine carcinogens.
  • Heterocyclic amines may be colorectal carcinogens. They also participate in the detoxification of hydrazine and arylamine drugs and are able to bioactivate several known carcinogens. Predisposition for colorectal cancer is connected to hereditary factors and genetic sensitivity to environmental carcinogens. In recent years the polymo ⁇ hism of genes encoding drag-metabolizing enzymes has been shown to be important. Several studies have shown a role for NAT1 and NAT2 acetylation polymo ⁇ hisms in cancer risk in human populations.
  • NAT1 and NAT2 acetylation polymo ⁇ hisms modify risk of developing urinary bladder, colorectal, breast, head and neck, lung, and possibly prostate cancers. Associations between rapid NAT2 acetylator genotypes and colorectal cancer are the most consistently reported (Minchin R.F. et al. (1993) Mutant Res. 290:35-42, Hein, D.W. et al. (2000) Toxicol. Lett. 15:112-113;349- 356). Several allelic variants of NAT1 and NAT2 have been detected. It is thought that some of them modify individual susceptibility to cancer.
  • the invention features an isolated nucleic acid molecule that includes the nucleotide sequence set forth in SEQ ID NO: 1, 3 or 5. In another embodiment, the invention features an isolated nucleic acid molecule that encodes a polypeptide including the amino acid sequence set forth in SEQ ID NO:2 or 4. In another embodiment, the invention features an isolated nucleic acid molecule that includes the nucleotide sequence contained in the plasmid deposited with ATCC® as Accession Number .
  • the invention features isolated nucleic acid molecules including nucleotide sequences that are substantially identical (e.g., 75% identical) to the nucleotide sequence set forth as SEQ ID NO:l, 3 or 5.
  • the invention further features isolated nucleic acid molecules including at least 30 contiguous nucleotides of the nucleotide sequence set forth as SEQ ID NO: 1 , 3 or 5.
  • the invention features isolated nucleic acid molecules which encode a polypeptide including an amino acid sequence that is substantially identical (e.g., 15% identical) to the amino acid sequence set forth as SEQ ID NO:2 or 4.
  • the present invention also features nucleic acid molecules which encode fragments, for example biologically active or antigenic fragments, of the full- length polypeptides of the present invention (e.g., fragments including at least 10 contiguous amino acid residues of the amino acid sequence of SEQ ID NO:2 or 4).
  • the invention features nucleic acid molecules that are complementary to, are antisense to, or hybridize under stringent conditions to the isolated nucleic acid molecules described herein.
  • the invention provides vectors including the isolated nucleic acid molecules described herein (e.g., CONAT-1 -encoding nucleic acid molecules). Such vectors can optionally include nucleotide sequences encoding heterologous polypeptides. Also featured are host cells including such vectors (e.g., host cells including vectors suitable for producing CONAT-1 nucleic acid molecules and polypeptides).
  • the invention features isolated CONAT-1 polypeptides and/or biologically active or antigenic fragments thereof.
  • Exemplary embodiments feature a polypeptide including the amino acid sequence set forth as SEQ ID NO:2 or 4, a polypeptide including an amino acid sequence at least 75% identical to the amino acid sequence set forth as SEQ ID NO:2 or 4, a polypeptide encoded by a nucleic acid molecule including a nucleotide sequence at least 75% identical to the nucleotide sequence set forth as SEQ ID NO:l, 3 or 5.
  • fragments of the full- length polypeptides described herein e.g., fragments including at least 10 contiguous amino acid residues of the sequence set forth as SEQ ID NO:2 or 4
  • CONAT-1 polypeptides and/or biologically active or antigenic fragments thereof are useful, for example, as reagents or targets in assays applicable to treatment and/or diagnosis of CONAT-1 mediated or related disorders.
  • a CONAT-1 polypeptide or fragment thereof has a CONAT-1 activity.
  • a CONAT-1 polypeptide or fragment thereof has an N-acetyltransferase domain and optionally, has a CONAT-1 activity.
  • the invention features antibodies (e.g., antibodies which specifically bind to any one of the polypeptides, as described herein) as well as fusion polypeptides including all or a fragment of a polypeptide described herein.
  • the present invention further features methods for detecting CONAT-1 polypeptides and/or CONAT-1 nucleic acid molecules, such methods featuring, for example, a probe, primer or antibody described herein. Also featured are kits for the detection of CONAT-1 polypeptides and/or CONAT-1 nucleic acid molecules. In a related aspect, the invention features methods for identifying compounds which bind to and/or modulate the activity of a CONAT-1 polypeptide or CONAT-1 nucleic acid molecule described herein. Further featured are methods for modulating a CONAT-1 activity.
  • Figure I depicts the nucleotide sequence of human CONAT-1 cDNA and corresponding predicted amino acid sequence.
  • the nucleotide sequence corresponds to nucleic acids 390 to 806 of SEQ ID NO:l.
  • the amino acid sequence corresponds to amino acids 1 to 139 of SEQ ID NO: 2.
  • the coding region for the predicted amino acid sequence is set forth as SEQ ID NO:3.
  • Figure 2 depicts the cDNA sequence and predicted amino acid sequence of a second CONAT-1 translation product (CONAT-lb).
  • the nucleotide sequence corresponds to nucleic acids 3 to 806 of SEQ ID NO: 1.
  • the amino acid sequence corresponds to amino acids 1 to 268 of SEQ ID NO:4.
  • the coding region of this second predicted amino acid sequence is set forth as SEQ ID NO: 5
  • the present invention is based, at least in part, on the discovery of novel acetyltransferase family members, referred to herein as "Colon Cancer-Related N- Acetyltransferase-1" or "CONAT-1" nucleic acid and protein molecules.
  • family when referring to the protein and nucleic acid molecules of the invention is intended to mean two or more proteins or nucleic acid molecules having a common structural domain or motif and having sufficient amino acid or nucleotide sequence homology as defined herein.
  • family members can be naturally or non- naturally occurring and can be from either the same or different species.
  • a family can contain a first protein of human origin as well as other distinct proteins of human origin or alternatively, can contain homologues of non-human origin, e.g., rat or mouse proteins. Members of a family can also have common functional characteristics. Members of the CONAT-1 family of proteins, for example, include at least one "acetyltransferase domain" in the protein or corresponding nucleic acid molecule.
  • acetyltransferase domain includes a protein domain having at least about 108-158 amino acid residues and has a bit score for the alignment of the sequence to an acetyltransferase (HMM) (e.g., the Pfam acetyltransferase HMM having Accession Number PF00583) of at least 40. More preferably, an acetyltransferase domain includes at least about 128-138, or typically about 131-135 amino acid residues, and has a bit score for the alignment of the sequence to an acetyltransferase (HMM) of at least 45, 50, 55, 60 or greater.
  • HMM acetyltransferase
  • an acetyltransferase domain has an acetyltransferase activity (e.g., catalyzes the acetylation of a substrate, for example, a protein substrate or target molecule).
  • the amino acid sequence of the protein is searched against a database of HMMs (e.g., the Pfam database, release 5.3) using the default parameters (www.sanger.ac.uk/Software/Pfarn/HMM_search).
  • HMMs e.g., the Pfam database, release 5.3
  • the search can be performed using the hmmsf program (family specific) using the default parameters (e.g., a threshold score of 15) for determining a hit.
  • hmmsf is available as part of the HMMER package of search programs (HMMER 2.1.1, Dec. 1998) which is freely distributed by the Washington University School of Medicine.
  • the threshold score for determining a hit can be lowered (e.g., to 8 bits).
  • a search was performed against the HMM database resulting in the identification of an acetyltransferase domain in the amino acid sequence of human CONAT-1 at about residues 1-116 of SEQ ID NO:2 (see Appendix A3), and in human CONAT-1 at about residues 122-245 of SEQ ID NO:4 (see Appendix A7).
  • Isolated proteins of the present invention preferably CONAT-1 proteins, have an amino acid sequence sufficiently homologous to the amino acid sequence of SEQ ID NO:2 or 4, or are encoded by a nucleotide sequence sufficiently homologous to SEQ ID NO:l, 3, or 5.
  • the term "sufficiently homologous" refers to a first amino acid or nucleotide sequence which contains a sufficient or minimum number of identical or equivalent (e.g., an amino acid residue which has a similar side chain) amino acid residues or nucleotides to a second amino acid or nucleotide sequence such that the first and second amino acid or nucleotide sequences share common structural domains or motifs and/or a common functional activity.
  • amino acid or nucleotide sequences which share common structural domains having at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more homology or identity across the amino acid sequences of the domains and contain at least one and preferably two structural domains or motifs, are defined herein as sufficiently homologous.
  • amino acid or nucleotide sequences which share at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more homology or identity and share a common functional activity are defined herein as sufficiently homologous.
  • a CONAT-1 protein includes at least one acetyltransferase domain, and has an amino acid sequence at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more homologous or identical to the amino acid sequence of SEQ ID NO:2, or the amino acid sequence encoded by the DNA insert of the plasmid deposited with ATCC as Accession Number .
  • a CONAT-1 protein includes at least one acetyltransferase domain, and is encoded by a nucleic acid molecule having a nucleotide sequence which hybridizes under stringent hybridization conditions to a complement of a nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO:l or SEQ ID NO:3 or SEQ ID NO:5.
  • a CONAT- 1 protein includes at least one acetyltransferase domain, and has a CONAT-1 activity.
  • an “isolated” or “purified” protein or biologically active portion thereof is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the CONAT-1 protein is derived, or substantially free from chemical precursors or other chemicals when chemically synthesized.
  • the language “substantially free of cellular material” includes preparations of CONAT-1 protein in which the protein is separated from cellular components of the cells from which it is isolated or recombinantly produced.
  • the language “substantially free of chemical precursors or other chemicals” includes preparations of CONAT-1 protein in which the protein is separated from chemical precursors or other chemicals which are involved in the synthesis of the protein.
  • the language “substantially free of chemical precursors or other chemicals” includes preparations of CONAT-1 protein having less than about 30% > (by dry weight) of chemical precursors or non-CONAT-1 chemicals, more preferably less than about 20% chemical precursors or non-CONAT-1 chemicals, still more preferably less than about 10% chemical precursors or non-CONAT-1 chemicals, and most preferably less than about 5% chemical precursors or non-CONAT-1 chemicals.
  • a "biologically active portion" of a CONAT-1 protein includes a fragment of a CONAT-1 protein which participates in an interaction between a CONAT-1 molecule and a non-CONAT-1 molecule (e.g., a CONAT-1 substrate).
  • Biologically active portions of a CONAT-1 protein include peptides comprising amino acid sequences sufficiently homologous to or derived from the CONAT-1 amino acid sequences, e.g. , the amino acid sequences shown in SEQ ID NO:2 or 4, which include sufficient amino acid residues to exhibit at least one activity of a CONAT-1 protein.
  • a fragment comprises at least 5 amino acids (e.g., contiguous or consecutive amino acids) of the amino acid sequence of SEQ ID NO:2 or 4, or an amino acid sequence encoded by the DNA insert of the plasmid deposited with the ATCC as
  • the sequences are aligned for optimal comparison pu ⁇ oses (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
  • amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
  • a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein amino acid or nucleic acid "identity” is equivalent to amino acid or nucleic acid "homology”).
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
  • cell based assays can be exploited to analyze a variegated CONAT-1 library.
  • a library of expression vectors can be transfected into a cell line, e.g., a cardiomyocyte cell line, which ordinarily responds to CONAT-1 in a particular CONAT-1 substrate-dependent manner.
  • the transfected cells are then contacted with CONAT-1 and the effect of the expression of the mutant on signaling by the CONAT-1 substrate can be detected, e.g., by measuring levels of gene transcription, and/or cell growth and differentiation.
  • Plasmid DNA can then be recovered from the cells which score for inhibition, or alternatively, potentiation of signaling by the CONAT-1 substrate, and the individual clones further characterized.
  • Preferred epitopes encompassed by the antigenic peptide are regions of CONAT- 1 that are located on the surface of the protein, e.g., hydrophilic regions, as well as regions with high antigenicity (see, for example, Appendices A2 and A5).
  • antibody refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site which specifically binds (immunoreacts with) an antigen, such as CONAT-1.
  • immunologically active portions of immunoglobulin molecules include F(ab) and F(ab')2 fragments which can be generated by treating the antibody with an enzyme such as pepsin.
  • the invention provides polyclonal and monoclonal antibodies that bind CONAT-1.
  • Polyclonal anti-CONAT-1 antibodies can be prepared as described above by immunizing a suitable subject with a CONAT-1 immunogen.
  • the anti-CONAT-1 antibody titer in the immunized subject can be monitored over time by standard techniques, such as with an enzyme linked immunosorbent assay (ELISA) using immobilized CONAT-1.
  • ELISA enzyme linked immunosorbent assay
  • the antibody molecules directed against CONAT-1 can be isolated from the mammal (e.g., from the blood) and further purified by well known techniques, such as protein A chromatography to obtain the IgG fraction.
  • antibody-producing cells can be obtained from the subject and used to prepare monoclonal antibodies by standard techniques, such as the hybridoma technique originally described by Kohler and Milstein (1975) Nature 256:495-497) (see also, Brown et al. (1981) J Immunol. 127:539-46; Brown et al. (1980) J. Biol. Chem .255:4980-83; Yeh et al. (1976) Proc. Natl. Acad. Sci. USA 76:2927-31; and Yeh et al. (1982) Int. J.
  • an immortal cell line typically a myeloma
  • lymphocytes typically splenocytes
  • the culture supernatants of the resulting hybridoma cells are screened to identify a hybridoma producing a monoclonal antibody that binds CONAT-1.
  • murine hybridomas can be made by fusing lymphocytes from a mouse immunized with an immunogenic preparation of the present invention with an immortalized mouse cell line.
  • Preferred immortal cell ' lines are mouse myeloma cell lines that are sensitive to culture medium containing hypoxanthine, aminopterin and thymidine ("HAT medium").
  • HAT medium culture medium containing hypoxanthine, aminopterin and thymidine
  • Any of a number of myeloma cell lines can be used as a fusion partner according to standard techniques, e.g., the P3-NSl/l-Ag4-l, P3-x63-Ag8.653 or Sp2/O-Agl4 myeloma lines. These myeloma lines are available from ATCC.
  • plasmid and "vector” can be used interchangeably as the plasmid is the most commonly used form of vector.
  • the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retro viruses, adeno viruses and adeno- associated viruses), which serve equivalent functions.
  • viral vectors e.g., replication defective retro viruses, adeno viruses and adeno- associated viruses
  • the recombinant expression vectors of the invention comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory sequences, selected on the basis of the host cells to be used for expression, which is operatively linked to the nucleic acid sequence to be expressed.
  • "operably linked" is intended to mean that the nucleotide sequence of interest is linked to the regulatory sequence(s) in a manner which allows for expression of the nucleotide sequence (e.g., in an in vitro transcription translation system or in a host cell when the vector is introduced into the host cell).
  • the expression vectors of the invention can be introduced into host cells to thereby produce proteins or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., CONAT-1 proteins, mutant forms of CONAT-1 proteins, fusion proteins, and the like).
  • proteins or peptides including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., CONAT-1 proteins, mutant forms of CONAT-1 proteins, fusion proteins, and the like).
  • the recombinant expression vectors of the invention can be designed for expression of CONAT-1 proteins in prokaryotic or eukaryotic cells.
  • CONAT-1 proteins can be expressed in bacterial cells such as E. coli, insect cells (using baculovirus expression vectors) yeast cells or mammalian cells. Suitable host cells are discussed further in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1990).
  • the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase. Expression of proteins in prokaryotes is most often carried out in E.
  • Fusion vectors add a number of amino acids to a protein encoded therein, usually to the amino terminus of the recombinant protein.
  • Such fusion vectors typically serve three pu ⁇ oses: 1) to increase expression of recombinant protein; 2) to increase the solubility of the recombinant protein; and 3) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification.
  • GST glutathione S-transferase
  • Purified fusion proteins can be utilized in CONAT-1 activity assays, (e.g., direct assays or competitive assays described in detail below), or to generate antibodies specific for CONAT-1 proteins, for example.
  • a CONAT-1 fusion protein expressed in a retroviral expression vector of the present invention can be utilized to infect bone marrow cells which are subsequently transplanted into irradiated recipients. The pathology of the subject recipient is then examined after sufficient time has passed (e.g., six (6) weeks). Examples of suitable inducible non-fusion E.
  • coli expression vectors include pTrc (Amann et al., (1988) Gene 69:301-315) and pET 1 Id (Studier et al, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, California (1990) 60-89).
  • Target gene expression from the pTrc vector relies on host RNA polymerase transcription from a hybrid frp-lac fusion promoter.
  • Target gene expression from the pET l id vector relies on transcription from a T7 gnl 0-lac fusion promoter mediated by a coexpressed viral RNA polymerase (T7 gnl).
  • This viral polymerase is supplied by host strains BL21(DE3) or HMS174(DE3) from a resident prophage harboring a T7 gnl gene under the transcriptional control of the lacUV 5 promoter.
  • One strategy to maximize recombinant protein expression in E. coli is to express the protein in a host bacteria with an impaired capacity to proteolytically cleave the recombinant protein (Gottesman, S., Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, California (1990) 119-128).
  • Another strategy is to alter the nucleic acid sequence of the nucleic acid to be inserted into an expression vector so that the individual codons for each amino acid are those preferentially utilized in E. coli (Wada et al, (1992) Nucleic Acids Res. 20:2111-2118). Such alteration of nucleic acid sequences of the invention can be carried out by standard DNA synthesis techniques.
  • the CONAT-1 expression vector is a yeast expression vector.
  • yeast expression vectors for expression in yeast S. cerivisae include pYepSecl
  • CONAT-1 proteins can be expressed in insect cells using baculovirus expression vectors.
  • Baculovirus vectors available for expression of proteins in cultured insect cells include the pAc series (Smith et al. (1983) Mol. Cell Biol. 3:2156-2165) and the pVL series (Lucklow and Summers (1989) Virology 170:31-39).
  • the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid).
  • tissue-specific regulatory elements are known in the art.
  • suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert et al. (1987) Genes Dev. 1:268-277), lymphoid-specific promoters (Calame and Eaton (1988) Adv. Immunol. 43:235-275), in particular promoters of T cell receptors (Winoto and Baltimore (1989) EMBOJ.
  • the invention further provides a recombinant expression vector comprising a DNA molecule of the invention cloned into the expression vector in an antisense orientation. That is, the DNA molecule is operatively linked to a regulatory sequence in a manner which allows for expression (by transcription of the DNA molecule) of an RNA molecule which is antisense to CONAT-1 mRNA. Regulatory sequences operatively linked to a nucleic acid cloned in the antisense orientation can be chosen which direct the continuous expression of the antisense RNA molecule in a variety of cell types, for instance viral promoters and/or enhancers, or regulatory sequences can be chosen which direct constitutive, tissue specific or cell type specific expression of antisense RNA.
  • the antisense expression vector can be in the form of a recombinant plasmid, phagemid or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced.
  • a high efficiency regulatory region the activity of which can be determined by the cell type into which the vector is introduced.
  • Another aspect of the invention pertains to host cells into which a CONAT-1 nucleic acid molecule of the invention is introduced, e.g., a CONAT-1 nucleic acid molecule within a vector (e.g., a recombinant expression vector) or a CONAT-1 nucleic acid molecule containing sequences which allow it to homologously recombine into a specific site of the host cell's genome.
  • a CONAT-1 nucleic acid molecule of the invention e.g., a CONAT-1 nucleic acid molecule within a vector (e.g., a recombinant expression vector) or a CONAT-1 nucleic acid molecule containing sequences which allow it to homologously recombine into a specific site of the host cell's genome.
  • vector e.g., a recombinant expression vector
  • a host cell can be any prokaryotic or eukaryotic cell.
  • a CONAT-1 protein can be expressed in bacterial cells such as E. coli, insect cells, yeast or mammalian cells (such as Chinese hamster ovary cells (CHO) or COS cells). Other suitable host cells are known to those skilled in the art.
  • Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques.
  • transformation and transfection are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g., DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, or electroporation. Suitable methods for transforming or transfecting host cells can be found in Sambrook, et al. (Molecular Cloning: A Laboratory Manual. 2nd, ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989), and other laboratory manuals.
  • a gene that encodes a selectable marker (e.g., resistance to antibiotics) is generally introduced into the host cells along with the gene of interest.
  • selectable markers include those which confer resistance to drugs, such as G418, hygromycin and methotrexate.
  • Nucleic acid encoding a selectable marker can be introduced into a host cell on the same vector as that encoding a CONAT-1 protein or can be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drag selection (e.g., cells that have inco ⁇ orated the selectable marker gene will survive, while the other cells die).
  • a host cell of the invention such as a prokaryotic or eukaryotic host cell in culture, can be used to produce (i.e., express) a CONAT-1 protein.
  • the invention further provides methods for producing a CONAT-1 protein using the host cells of the invention.
  • the method comprises culturing the host cell of the invention (into which a recombinant expression vector encoding a CONAT-1 protein has been introduced) in a suitable medium such that a CONAT-1 protein is produced.
  • the method further comprises isolating a CONAT-1 protein from the medium or the host cell.
  • the host cells of the invention can also be used to produce non-human transgenic animals.
  • a host cell of the invention is a fertilized oocyte or an embryonic stem cell into which CONAT-1 -coding sequences have been introduced.
  • Such host cells can then be used to create non-human transgenic animals in which exogenous CONAT-1 sequences have been introduced into their genome or homologous recombinant animals in which endogenous CONAT-1 sequences have been altered.
  • Such animals are useful for studying the function and/or activity of a CONAT-1 protein and for identifying and/or evaluating modulators of CONAT-1 activity.
  • a "homologous recombinant animal” is a non-human animal, preferably a mammal, more preferably a mouse, in which an endogenous CONAT-1 gene has been altered by homologous recombination between the endogenous gene and an exogenous DNA molecule introduced into a cell of the animal, e.g., an embryonic cell of the animal, prior to development of the animal.
  • a transgenic animal of the invention can be created by introducing a CONAT-1 - encoding nucleic acid into the male pronuclei of a fertilized oocyte, e.g., by microinjection or retroviral infection, and allowing the oocyte to develop in a pseudopregnant female foster animal.
  • the CONAT-1 cDNA sequence of SEQ ID NO:l can be introduced as a transgene into the genome of a non-human animal.
  • a non-human homologue of a human CONAT-1 gene such as a rat or mouse CONAT-1 gene, can be used as a transgene.
  • a CONAT-1 gene homologue such as another CONAT-1 family member, can be isolated based on hybridization to the
  • Intronic sequences and polyadenylation signals can also be included in the transgene to increase the efficiency of expression of the transgene.
  • a tissue-specific regulatory sequence(s) can be operably linked to a CONAT-1 transgene to direct expression of a CONAT-1 protein to particular cells.
  • transgenic founder animal can be identified based upon the presence of a CONAT-1 transgene in its genome and/or expression of CONAT-1 mRNA in tissues or cells of the animals. A transgenic founder animal can then be used to breed additional animals carrying the transgene. Moreover, transgenic animals carrying a transgene encoding a CONAT-1 protein can further be bred to other transgenic animals carrying other transgenes.
  • a vector is prepared which contains at least a portion of a CONAT-1 gene into which a deletion, addition or substitution has been introduced to thereby alter, e.g., functionally disrupt, the CONAT-1 gene.
  • the CONAT-1 gene can be a human gene (e.g., the cDNA of SEQ ID NO:l, 3 or 5), but more preferably, is a non-human homologue of a human CONAT- 1 gene (e.g.
  • a mouse CONAT-1 gene can be used to construct a homologous recombination nucleic acid molecule, e.g., a vector, suitable for altering an endogenous CONAT-1 gene in the mouse genome.
  • the homologous recombination nucleic acid molecule is designed such that, upon homologous recombination, the endogenous CONAT-1 gene is functionally disrupted (i.e., no longer encodes a functional protein; also referred to as a "knock out" vector).
  • the altered portion of the CONAT-1 gene is flanked at its 5' and 3' ends by additional nucleic acid sequence of the CONAT-1 gene to allow for homologous recombination to occur between the exogenous CONAT- 1 gene carried by the homologous recombination nucleic acid molecule and an endogenous CONAT-1 gene in a cell, e.g., an embryonic stem cell.
  • the additional flanking CONAT-1 nucleic acid sequence is of sufficient length for successful homologous recombination with the endogenous gene.
  • homologous recombination nucleic acid molecule typically, several kilobases of flanking DNA (both at the 5' and 3' ends) are included in the homologous recombination nucleic acid molecule (see, e.g., Thomas, K.R. and Capecchi, M. R. (1987) Cell 51 :503 for a description of homologous recombination vectors).
  • the homologous recombination nucleic acid molecule is introduced into a cell, e.g., an embryonic stem cell line (e.g., by electroporation) and cells in which the introduced CONAT-1 gene has homologously recombined with the endogenous CONAT-1 gene are selected (see e.g., Li, E. et al.
  • the selected cells can then injected into a blastocyst of an animal (e.g., a mouse) to form aggregation chimeras (see e.g., Bradley, A. in Teratocarcinomas and Embryonic Stem Cells: A Practical Approach, E. J. Robertson, ed. (IRL, Oxford, 1987) pp. 113-152).
  • a chimeric embryo can then be implanted into a suitable pseudopregnant female foster animal and the embryo brought to term.
  • Progeny harboring the homologously recombined DNA in their germ cells can be used to breed animals in which all cells of the animal contain the homologously recombined DNA by germline transmission of the transgene.
  • homologous recombination nucleic acid molecules e.g., vectors, or homologous recombinant animals are described further in Bradley, A. (1991) Current Opinion in Biotechnology 2:823-829 and in PCT International Publication Nos.: WO 90/11354 by Le Mouellec et al.; WO 91/01140 by Smithies et al.; WO 92/0968 by Zijlstra et al.; and WO 93/04169 by Berns et al.
  • transgenic non-humans animals can be produced which contain selected systems which allow for regulated expression of the transgene.
  • a system is the cre/loxP recombinase system of bacteriophage PI .
  • cre/loxP recombinase system for a description of the cre/loxP recombinase system, see, e.g., Lakso et al. (1992) Proc. Natl. Acad. Sci. USA 89:6232-6236.
  • Another example of a recombinase system is the FLP recombinase system of Saccharomyces cerevisiae (O'Gorman et al. (1991) Science 251:1351-1355.
  • a cre/loxP recombinase system is used to regulate expression of the transgene
  • animals containing transgenes encoding both the Cre recombinase and a selected protein are required.
  • Such animals can be provided through the construction of "double" transgenic animals, e.g., by mating two transgenic animals, one containing a transgene encoding a selected protein and the other containing a transgene encoding a recombinase.
  • Clones of the non-human transgenic animals described herein can also be produced according to the methods described in Wilmut, I. et al. (1997) Nature 385:810- 813 and PCT International Publication Nos. WO 97/07668 and WO 97/07669.
  • a cell e.g., a somatic cell
  • the quiescent cell can then be fused, e.g., through the use of electrical pulses, to an enucleated oocyte from an animal of the same species from which the quiescent cell is isolated.
  • the reconstructed oocyte is then cultured such that it develops to morula or blastocyte and then transferred to pseudopregnant female foster animal.
  • the offspring borne of this female foster animal will be a clone of the animal from which the cell, e.g., the somatic cell, is isolated.
  • CONAT-1 nucleic acid molecules, of CONAT-1 proteins, fragments thereof, anti-CONAT-1 antibodies, and CONAT-1 modulators (also referred to herein as "active compounds") of the invention can be inco ⁇ orated into pharmaceutical compositions suitable for administration.
  • Such compositions typically comprise the nucleic acid molecule, protein, or antibody and a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable carrier is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and abso ⁇ tion delaying agents, and the like, compatible with pharmaceutical administration.
  • the use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be inco ⁇ orated into the compositions.
  • a pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration.
  • routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (topical), transmucosal, and rectal administration.
  • Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
  • the parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
  • compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • suitable carriers include physiological saline, bacteriostatic water, Cremophor ELTM (BASF, Parsippany, NJ) or phosphate buffered saline (PBS).
  • the composition must be sterile and should be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi.
  • the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol, and the like), and suitable mixtures thereof.
  • the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
  • isotonic agents for example, sugars, polyalcohols such as manitol, sorbitol, sodium chloride in the composition.
  • Prolonged abso ⁇ tion of the injectable compositions can be brought about by including in the composition an agent which delays abso ⁇ tion, for example, aluminum monostearate and gelatin.
  • Sterile injectable solutions can be prepared by inco ⁇ orating the active compound (e.g., a fragment of a CONAT-1 protein or an anti-CONAT-1 antibody) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
  • the active compound e.g., a fragment of a CONAT-1 protein or an anti-CONAT-1 antibody
  • dispersions are prepared by inco ⁇ orating the active compound into a sterile vehicle which contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • the preferred methods of preparation are vacuum drying and freeze-drying which yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the pu ⁇ ose of oral therapeutic administration, the active compound can be inco ⁇ orated with excipients and used in the form of tablets, troches, or capsules, oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition.
  • the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems.
  • a controlled release formulation including implants and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art. The materials can also be obtained commercially from Alza Co ⁇ oration and Nova
  • Liposomal suspensions can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Patent No. 4,522,811. It is especially advantageous to formulate oral or parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
  • Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
  • the specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.
  • Toxicity and therapeutic efficacy of such compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50%> of the population) and the ED50 (the dose therapeutically effective in 50% of the population).
  • the dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD50/ED50.
  • Compounds which exhibit large therapeutic indices are preferred. While compounds that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such compounds to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects.
  • the data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for use in humans.
  • the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity.
  • the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.
  • the therapeutically effective dose can be estimated initially from cell culture assays.
  • a dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the test compound which achieves a half-maximal inhibition of symptoms) as determined in cell culture.
  • IC50 i.e., the concentration of the test compound which achieves a half-maximal inhibition of symptoms
  • levels in plasma may be measured, for example, by high performance liquid chromatography.
  • a therapeutically effective amount of protein or polypeptide ranges from about 0.001 to 30 mg/kg body weight, preferably about 0.01 to 25 mg/kg body weight, more preferably about 0.1 to 20 mg/kg body weight, and even more preferably about 1 to 10 mg/kg, 2 to 9 mg/kg, 3 to 8 mg/kg, 4 to 7 mg/kg, or 5 to 6 mg/kg body weight.
  • an effective dosage ranges from about 0.001 to 30 mg/kg body weight, preferably about 0.01 to 25 mg/kg body weight, more preferably about 0.1 to 20 mg/kg body weight, and even more preferably about 1 to 10 mg/kg, 2 to 9 mg/kg, 3 to 8 mg/kg, 4 to 7 mg/kg, or 5 to 6 mg/kg body weight.
  • treatment of a subject with a therapeutically effective amount of a protein, polypeptide, or antibody can include a single treatment or, preferably, can include a series of treatments.
  • a subject is treated with antibody, protein, or polypeptide in the range of between about 0.1 to 20 mg/kg body weight, one time per week for between about 1 to 1.0 weeks, preferably between 2 to 8 weeks, more preferably between about 3 to 7 weeks, and even more preferably for about 4, 5, or 6 weeks.
  • the effective dosage of antibody, protein, or polypeptide used for treatment may increase or decrease over the course of a particular treatment. Changes in dosage may result and become apparent from the results of diagnostic assays as described herein.
  • the present invention encompasses agents which modulate expression or activity.
  • An agent may, for example, be a small molecule.
  • such small molecules include, but are not limited to, peptides, peptidomimetics, amino acids, amino acid analogs, polynucleotides, polynucleotide analogs, nucleotides, nucleotide analogs, organic or inorganic compounds (i.e,. including heteroorganic and organometallic compounds) having a molecular weight less than about 10,000 grams per mole, organic or inorganic compounds having a molecular weight less than about 5,000 grams per mole, organic or inorganic compounds having a molecular weight less than about 1,000 grams per mole, organic or inorganic compounds having a molecular weight less than about 500 grams per mole, and salts, esters, and other pharmaceutically acceptable forms of such compounds.
  • organic or inorganic compounds i.e,. including heteroorganic and organometallic compounds
  • doses of small molecule agents depends upon a number of factors within the ken of the ordinarily skilled physician, veterinarian, or researcher.
  • the dose(s) of the small molecule will vary, for example, depending upon the identity, size, and condition of the subject or sample being treated, further depending upon the route by which the composition is to be administered, if applicable, and the effect which the practitioner desires the small molecule to have upon the nucleic acid or polypeptide of the invention.
  • Exemplary doses include milligram or microgram amounts of the small molecule per kilogram of subject or sample weight (e.g., about 1 microgram per kilogram to about 500 milligrams per kilogram, about 100 micrograms per kilogram to about 5 milligrams per kilogram, or about 1 microgram per kilogram to about 50 micrograms per kilogram. It is furthermore understood that appropriate doses of a small molecule depend upon the potency of the small molecule with respect to the expression or activity to be modulated. Such appropriate doses may be determined using the assays described herein.
  • a physician, veterinarian, or researcher may, for example, prescribe a relatively low dose at first, subsequently increasing the dose until an appropriate response is obtained.
  • the specific dose level for any particular animal subject will depend upon a variety of factors including the activity of the specific compound employed, the age, body weight, general health, gender, and diet of the subject, the time of administration, the route of administration, the rate of excretion, any drug combination, and the degree of expression or activity to be modulated.
  • a modulator of CONAT- 1 activity is administered in combination with other agents (e.g., a small molecule), or in conjunction with another, complementary treatment regime.
  • a modulator of CONAT-1 activity is used to treat CONAT-1 associated disorder.
  • modulation of CONAT-1 activity may be used in conjunction with, for example, another agent used to treat the disorder, e.g., another known agent used to treat cancer, in particular, colon cancer.
  • an antibody (or fragment thereof) may be conjugated to a therapeutic moiety such as a cytotoxin, a therapeutic agent or a radioactive metal ion.
  • a cytotoxin or cytotoxic agent includes any agent that is detrimental to cells.
  • Examples include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorabicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs ' or homologs thereof.
  • the drug moiety can be used for modifying a given biological response, the drug moiety is not to be construed as limited to classical chemical therapeutic agents.
  • the drag moiety may be a protein or polypeptide possessing a desired biological activity.
  • proteins may include, for example, a toxin such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin; a protein such as tumor necrosis factor, alpha-interferon, beta-interferon, nerve growth factor, platelet derived growth factor, tissue plasminogen activator; or, biological response modifiers such as, for example, lymphokines, interleukin-1 ("IL-1"), interleukin-2 (“IL-2”), interleukin-6 (“IL-6”), granulocyte macrophase colony stimulating factor (“GM-CSF”), granulocyte colony stimulating factor (“G-CSF”), or other growth factors.
  • IL-1 interleukin-1
  • IL-2 interleukin-2
  • IL-6
  • the nucleic acid molecules of the invention can be inserted into vectors and used as gene therapy vectors.
  • Gene therapy vectors can be delivered to a subject by, for example, intravenous injection, local administration (see U.S. Patent 5,328,470) or by stereotactic injection (see e.g., Chen et al. (1994) Proc. Natl. Acad. Sci. USA 91:3054- 3057).
  • the pharmaceutical preparation of the gene therapy vector can include the gene therapy vector in an acceptable diluent, or can comprise a slow release matrix in which the gene delivery vehicle is imbedded.
  • the pharmaceutical preparation can include one or more cells which produce the gene delivery system.
  • compositions can be included in a container, pack, or dispenser together with instructions for administration.
  • nucleic acid molecules, proteins, protein homologues, and antibodies described herein can be used in one or more of the following methods: a) screening assays; b) predictive medicine (e.g., diagnostic assays, prognostic assays, monitoring clinical trials, and pharmacogenetics); and c) methods of treatment (e.g., therapeutic and prophylactic).
  • a CONAT-1 protein of the invention has one or more of the following activities: (1) interaction with a CONAT-1 substrate or target molecule; (2) conversion of a CONAT-1 substrate or target molecule to product (e.g., acetylation of the substrate or target molecule); (3) interaction with and/or modulation of a second non-CONAT-1 protein; (4) activation/deactivation of CONAT-1 substrates or target molecules (e.g., activation/deactivation of carcinogens, for example heterocyclic and/or aromatic amine carcinogens, e.g., colorectal carcinogens); (5) metabolism and/or detoxification of drags (e.g., hydrazine and/or arylamine drags); (6) modulation of cellular signaling and/or gene transcription (e.g., either directly or indirectly); and (7) modulation of cellular proliferation and/or differentiation.
  • activation/deactivation of CONAT-1 substrates or target molecules e.g., activation/deactivation of carcino
  • the isolated nucleic acid molecules of the invention can be used, for example, to express CONAT-1 protein (e.g., via a recombinant expression vector in a host cell in gene therapy applications), to detect CONAT-1 mRNA (e.g., in a biological sample) or a genetic alteration in a CONAT-1 gene, and to modulate CONAT-1 activity, as described further below.
  • CONAT-1 proteins can be used to treat disorders characterized by insufficient or excessive production of a CONAT-1 substrate or production of CONAT- 1 inhibitors.
  • CONAT-1 proteins can be used to screen for naturally occurring CONAT-1 substrates, to screen for drags or compounds which modulate CONAT-1 activity, as well as to treat disorders characterized by insufficient or excessive production of CONAT- 1 protein or production of CONAT- 1 protein forms which have decreased, aberrant or unwanted activity compared to CONAT-1 wild type protein (e.g., disorders characterized by aberrant gene expression, or cell proliferation and/or differentiation disorders).
  • the anti-CONAT-1 antibodies of the invention can be used to detect and isolate CONAT-1 proteins, regulate the bioavailability of CONAT-1 proteins, and modulate CONAT-1 activity.
  • the invention provides a method (also referred to herein as a "screening assay") for identifying modulators, i.e., candidate or test compounds or agents (e.g., peptides, peptidomimetics, small molecules or other drags) which bind to CONAT-1 proteins, have a stimulatory or inhibitory effect on, for example, CONAT-1 expression or CONAT-1 activity, or have a stimulatory or inhibitory effect on, for example, the expression or activity of a CONAT-1 substrate.
  • modulators i.e., candidate or test compounds or agents (e.g., peptides, peptidomimetics, small molecules or other drags) which bind to CONAT-1 proteins, have a stimulatory or inhibitory effect on, for example, CONAT-1 expression or CONAT-1 activity, or have a stimulatory or inhibitory effect on, for example, the expression or activity of a CONAT-1 substrate.
  • the invention provides assays for screening candidate or test compounds which are substrates of a CONAT-1 protein or polypeptide or biologically active portion thereof. In another embodiment, the invention provides assays for screening candidate or test compounds which bind to or modulate the activity of a CONAT-1 protein or polypeptide or biologically active portion thereof.
  • the test compounds of the present invention can be obtained using any of the numerous approaches in combinatorial library methods known in the art, including: biological libraries; spatially addressable parallel solid phase or solution phase libraries; synthetic library methods requiring deconvolution; the 'one-bead one-compound' library method; and synthetic library methods using affinity chromatography selection.
  • the biological library approach is limited to peptide libraries, while the other four approaches are applicable to peptide, non-peptide oligomer or small molecule libraries of compounds (Lam, K.S. (1997) Anticancer Drug Des. 12: 145).
  • an assay is a cell-based assay in which a cell which expresses a CONAT-1 protein or biologically active portion thereof is contacted with a test compound and the ability of the test compound to modulate CONAT-1 activity is determined. Determining the ability of the test compound to modulate CONAT-1 activity can be accomplished by monitoring, for example, acetylation of target substrates and on levels of gene transcription.
  • the cell for example, can be of mammalian origin.
  • the ability of the test compound to modulate CONAT-1 binding to a substrate or to bind to CONAT-1 can also be determined. Determining the ability of the test compound to modulate CONAT-1 binding to a substrate can be accomplished, for example, by coupling the CONAT-1 substrate with a radioisotope or enzymatic label such that binding of the CONAT-1 substrate to CONAT-1 can be determined by detecting the labeled CONAT-1 substrate in a complex. Alternatively, CONAT-1 could be coupled with a radioisotope or enzymatic label to monitor the ability of a test compound to modulate CONAT-1 binding to a CONAT-1 substrate in a complex.
  • Determining the ability of the test compound to bind CONAT-1 can be accomplished, for example, by coupling the compound with a radioisotope or enzymatic label such that binding of the compound to CONAT-1 can be determined by detecting the labeled CONAT-1 compound in a complex.
  • compounds e.g., CONAT-1 substrates
  • compounds can be enzymatically labeled with, for example, horseradish peroxidase, alkaline phosphatase, or luciferase, and the enzymatic label detected by determination of conversion of an appropriate substrate to product. It is also within the scope of this invention to determine the ability of a compound (e.g., a CONAT-1 substrate) to interact with CONAT-1 without the labeling of any of the interactants: For example, a microphysiometer can be used to detect the interaction of a compound with CONAT-1 without the labeling of either the compound or the CONAT-1. McConnell, H. M. et al. (1992) Science 257:1906-1912.
  • a “microphysiometer” e.g., Cytosensor
  • LAPS light-addressable potentiometric sensor
  • Determining the ability of the CONAT-1 protein or a biologically active fragment thereof, to bind to or interact with a CONAT-1 target molecule can be accomplished by one of the methods described above for determining direct binding. In a preferred embodiment, determining the ability of the CONAT-1 protein to bind to or interact with a CONAT-1 target molecule can be accomplished by determining the activity of the target molecule.
  • an assay of the present invention is a cell-free assay in which a CONAT-1 protein or biologically active portion thereof is contacted with a test compound and the ability of the test compound to bind to the CONAT-1 protein or biologically active portion thereof is determined.
  • Preferred biologically active portions of the CONAT-1 proteins to be used in assays of the present invention include fragments which participate in interactions with non-CONAT-1 molecules, e.g., fragments with high surface probability scores (see, for example, Appendices 1 A and 5 A). Binding of the test compound to the CONAT-1 protein can be determined either directly or indirectly as described above.
  • the assay includes contacting the CONAT-1 protein or biologically active portion thereof with a known compound which binds CONAT-1 to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with a CONAT-1 protein, wherein determining the ability of the test compound to interact with a CONAT-1 protein comprises determining the ability of the test compound to preferentially bind to CONAT-1 or biologically active portion thereof as compared to the known compound.
  • the assay is a cell-free assay in which a CONAT-1 protein or biologically active portion thereof is contacted with a test compound and the ability of the test compound to modulate (e.g., stimulate or inhibit) the activity of the CONAT-1 protein or biologically active portion thereof is determined.
  • Determining the ability of the test compound to modulate the activity of a CONAT-1 protein can be accomplished, for example, by determining the ability of the CONAT-1 protein to bind to a CONAT-1 target molecule by one of the methods described above for determining direct binding. Determining the ability of the CONAT-1 protein to bind to a CONAT-1 target molecule can also be accomplished using a technology such as real-time
  • determining the ability of the test compound to modulate the activity of a CONAT-1 protein can be accomplished by determining the ability of the CONAT-1 protein to further modulate the activity of a downstream effector of a CONAT-1 target molecule.
  • the activity of the effector molecule on an appropriate target can be determined or the binding of the effector to an appropriate target can be determined as previously described.
  • the cell-free assay involves contacting a CONAT-1 protein or biologically active portion thereof with a known compound which binds the CONAT-1 protein to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with the CONAT-1 protein, wherein determining the ability of the test compound to interact with the CONAT-1 protein comprises determining the ability of the CONAT-1 protein to preferentially bind to or modulate the activity of a CONAT-1 target molecule.
  • the cell-free assays of the present invention are amenable to use of both soluble and/or membrane-bound forms of isolated proteins (e.g., CONAT-1 proteins or biologically active portions thereof).
  • isolated proteins e.g., CONAT-1 proteins or biologically active portions thereof.
  • a solubilizing agent such that the membrane-bound form of the isolated protein is maintained in solution.
  • non-ionic detergents such as n-
  • a test compound to a CONAT-1 protein, or interaction of a CONAT-1 protein with a target molecule in the presence and absence of a candidate compound, can be accomplished in any vessel suitable for containing the reactants. Examples of such vessels include microtiter plates, test tubes, and micro-centrifuge tubes.
  • a fusion protein can be provided which adds a domain that allows one or both of the proteins to be bound to a matrix.
  • glutathione-S-transferase/CONAT-1 fusion proteins or glutathione-S-transferase/target fusion proteins can be adsorbed onto glutathione sepharose beads (Sigma Chemical, St. Louis, MO) or glutathione derivatized micrometer plates, which are then combined with the test compound or the test compound and either the non-adsorbed target protein or CONAT-1 protein, and the mixture incubated under conditions conducive to complex formation (e.g., at physiological conditions for salt and pH). Following incubation, the beads or microtiter plate wells are washed to remove any unbound components, the matrix immobilized in the case of beads, complex determined either directly or indirectly, for example, as described above. Alternatively, the complexes can be dissociated from the matrix, and the level of CONAT-1 binding or activity determined using standard techniques.
  • a CONAT-1 protein or a CONAT-1 target molecule can be immobilized utilizing conjugation of biotin and streptavidin.
  • Biotinylated CONAT-1 protein or target molecules can be prepared from biotin-NHS (N-hydroxy-succinimide) using techniques known in the art (e.g., biotinylation kit, Pierce Chemicals, Rockford, IL), and immobilized in the wells of streptavidin-coated 96 well plates (Pierce Chemical).
  • antibodies reactive with CONAT-1 protein or target molecules but which do not interfere with binding of the CONAT-1 protein to its target molecule can be derivatized to the wells of the plate, and unbound target or CONAT-1 protein trapped in the wells by antibody conjugation.
  • Methods for detecting such complexes include immunodetection of complexes using antibodies reactive with the CONAT-1 protein or target molecule, as well as enzyme-linked assays which rely on detecting an enzymatic activity associated with the CONAT-1 protein or target molecule.
  • modulators of CONAT-1 expression are identified in a method wherein a cell is contacted with a candidate compound and the expression of CONAT-1 mRNA or protein in the cell is determined.
  • CONAT-1 mRNA or protein in the presence of the candidate compound is compared to the level of expression of CONAT-1 mRNA or protein in the absence of the candidate compound.
  • the candidate compound can then be identified as a modulator of CONAT- 1 expression based on this comparison. For example, when expression of CONAT-1 mRNA or protein is greater (statistically significantly greater) in the presence of the candidate compound than in its absence, the candidate compound is identified as a stimulator of CONAT-1 mRNA or protein expression. Alternatively, when expression of CONAT-1 mRNA or protein is less (statistically significantly less) in the presence of the candidate compound than in its absence, the candidate compound is identified as an inhibitor of CONAT- 1 mRNA or protein expression.
  • the level of CONAT- 1 mRNA or protein expression in the cells can be determined by methods described herein for detecting CONAT-1 mRNA or protein.
  • the CONAT-1 proteins can be used as "bait proteins" in a two-hybrid assay or three-hybrid assay (see, e.g., U.S. Patent No. 5,283,317; Zervos et al. (1993) Cell 72:223-232; Madura et al. (1993) J Biol Chem. 268:12046-12054; Bartel et al. (1993) Biotechniques 14:920-924; Iwabuchi et al.
  • CONAT-1 -binding proteins bind to or interact with CONAT-1
  • CONAT-1-binding proteins bind to or interact with CONAT-1
  • CONAT-1 -binding proteins are also likely to be involved in the propagation of signals by the CONAT-1 proteins or CONAT-1 targets as, for example, downstream elements of a CONAT-1 -mediated signaling pathway.
  • CONAT-1 -binding proteins are likely to be CONAT-1 inhibitors.
  • the two-hybrid system is based on the modular nature of most transcription factors, which consist of separable DNA-binding and activation domains.
  • the assay utilizes two different DNA constructs.
  • the gene that codes for a CONAT- 1 protein is fused to a gene encoding the DNA binding domain of a known transcription factor (e.g., GAL-4).
  • a DNA sequence, from a library of DNA sequences, that encodes an unidentified protein (“prey" or "sample”) is fused to a gene that codes for the activation domain of the known transcription factor.
  • the DNA-binding and activation domains of the transcription factor are brought into close proximity. This proximity allows transcription of a reporter gene (e.g., LacZ) which is operably linked to a transcriptional regulatory site responsive to the transcription factor. Expression of the reporter gene can be detected and cell colonies containing the functional transcription factor can be isolated and used to obtain the cloned gene which encodes the protein which interacts with the CONAT-1 protein.
  • a reporter gene e.g., LacZ
  • Expression of the reporter gene can be detected and cell colonies containing the functional transcription factor can be isolated and used to obtain the cloned gene which encodes the protein which interacts with the CONAT-1 protein.
  • the invention pertains to a combination of two or more of the assays described herein.
  • a modulating agent can be identified using a cell- based or a cell free assay, and the ability of the agent to modulate the activity of a CONAT-1 protein can be confirmed in vivo, e.g., in an animal such as an animal model for cellular transformation and/or tumorigenesis.
  • This invention further pertains to novel agents identified by the above-described screening assays. Accordingly, it is within the scope of this invention to further use an agent identified as described herein in an appropriate animal model.
  • animal models of colon cancer include transplantable models (e.g., xenografts of colon tumors such as Co-3, AC3603 or WiDr, into immunocompromised mice such as SCID or nude mice), transgenic models (e.g., B66-Min/+ mouse), and chemical induction models (e.g., carcinogen (e.g., azoxymethane, 2-dimethylhydrazine) treated rats.
  • transplantable models e.g., xenografts of colon tumors such as Co-3, AC3603 or WiDr, into immunocompromised mice such as SCID or nude mice
  • transgenic models e.g., B66-Min/+ mouse
  • chemical induction models e.g., carcinogen (e.g., azoxymethane, 2-dimethylhydrazine) treated rats.
  • an agent identified as described herein e.g., a CONAT-1 modulating agent, an antisense CONAT-1 nucleic acid molecule, a CONAT-1 -specific antibody, or a CONAT-1 -binding partner
  • a CONAT-1 modulating agent e.g., an antisense CONAT-1 nucleic acid molecule, a CONAT-1 -specific antibody, or a CONAT-1 -binding partner
  • an agent identified as described herein can be used in an animal model to determine the mechanism of action of such an agent.
  • the invention features a method of treating a subject having a cellular proliferation or differentiation disorder that involves administering to the subject a CONAT-1 modulator such that treatment occurs.
  • the invention features a method of treating a subject having colon cancer that involves treating a subject with a CONAT-1 modulator such that treatment occurs.
  • CONAT-1 modulators include, but are not limited to, CONAT-1 proteins or biologically active fragments, CONAT-1 nucleic acid molecules, CONAT-1 antibodies, CONAT-1 ribozymes, and antisense oligonucleotides designed based on the CONAT-1 nucleotide sequences disclosed herein, as well as peptides, organic, and non-organic small molecules identified as being capable of modulating CONAT-1 expression and/or activity, for example, according to at least one of the screening assays described herein.
  • An exemplary method for detecting the presence or absence of CONAT-1 protein, polypeptide or nucleic acid in a biological sample involves obtaining a biological sample from a test subject and contacting the biological sample with a compound or an agent capable of detecting CONAT-1 protein, polypeptide or nucleic acid (e.g., mRNA, genomic DNA) that encodes CONAT-1 protein such that the presence of CONAT-1 protein or nucleic acid is detected in the biological sample.
  • the present invention provides a method for detecting the presence of CONAT-1 activity in a biological sample by contacting the biological sample with an agent capable of detecting an indicator of CONAT-1 activity such that the presence of CONAT-1 activity is detected in the biological sample.
  • a preferred agent for detecting CONAT-1 mRNA or genomic DNA is a labeled nucleic acid probe capable of hybridizing to CONAT-1 mRNA or genomic DNA.
  • the nucleic acid probe can be, for example, a full-length CONAT-1 nucleic acid, such as the nucleic acid of SEQ ID NO:l, 3, or 5, or the DNA insert of the plasmid deposited with ATCC as Accession Number , or a portion thereof, such as an oligonucleotide of at least 15, 30, 50, 100, 250 or
  • a preferred agent for detecting CONAT-1 protein is an antibody capable of binding to CONAT-1 protein, preferably an antibody with a detectable label.
  • Antibodies can be polyclonal, or more preferably, monoclonal. An intact antibody, or a fragment thereof (e.g., Fab or F(ab')2) can be used.
  • labeled with regard to the probe or antibody, is intended to encompass direct labeling of the probe or antibody by coupling (i.e., physically linking) a detectable substance to the probe or antibody, as well as indirect labeling of the probe or antibody by reactivity with another reagent that is directly labeled.
  • indirect labeling include detection of a primary antibody using a fluorescently labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently labeled streptavidin.
  • biological sample is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject.
  • the detection method of the invention can be used to detect CONAT-1 mRNA, protein, or genomic DNA in a biological sample in vitro as well as in vivo.
  • in vitro techniques for detection of CONAT-1 mRNA include Northern hybridizations and in situ hybridizations.
  • in vitro techniques for detection of CONAT-1 protein include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations and immunofluorescence.
  • In vitro techniques for detection of CONAT-1 genomic DNA include Southern hybridizations.
  • in vivo techniques for detection of a CONAT-1 protein include introducing into a subject a labeled anti-CONAT-1 antibody.
  • the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
  • the present invention also provides diagnostic assays for identifying the presence or absence of a genetic alteration characterized by at least one of (i) aberrant modification or mutation of a gene encoding a CONAT-1 protein; (ii) aberrant expression of a gene encoding a CONAT-1 protein; (iii) mis-regulation of the gene; and (iii) aberrant post-translational modification of a CONAT-1 protein, wherein a wild-type form of the gene encodes a protein with a CONAT-1 activity.
  • "Misexpression or aberrant expression” refers to a non-wild type pattern of gene expression, at the RNA or protein level.
  • Non-wild type levels e.g., over or under expression
  • a pattern of expression that differs from wild type in terms of the time or stage at which the gene is expressed e.g., increased or decreased expression (as compared with wild type) at a predetermined developmental period or stage
  • a pattern of expression that differs from wild type in terms of the effect of an environmental stimulus or extracellular stimulus on expression of the gene e.g., a pattern of increased or decreased expression (as compared with wild type) in the presence of an increase or decrease in the strength of the stimulus).
  • the biological sample contains protein molecules from the test subject.
  • the biological sample can contain mRNA molecules from the test subject or genomic DNA molecules from the test subject.
  • a preferred biological sample is a serum sample isolated by conventional means from a subject.
  • the assays described herein can be utilized to identify a subject having or at risk of developing a disorder associated with a misregulation in CONAT-1 protein activity or nucleic acid expression, such as a cell proliferation and/or differentiation disorder.
  • the prognostic assays can be utilized to identify a subject having or at risk for developing a disorder associated with a misregulation in CONAT-1 protein activity or nucleic acid expression, such as a cell proliferation and/or differentiation disorder.
  • the prognostic assays described herein can be used to determine whether a subject can be administered an agent (e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drag candidate) to treat a disease or disorder associated with aberrant or unwanted CONAT-1 expression or activity.
  • an agent e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drag candidate
  • agents e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drag candidate
  • agents e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drag candidate
  • such methods can be used to determine whether a subject can be effectively treated with an agent for a cell proliferation and/or differentiation disorder.
  • the present invention provides methods for determining whether a subject can be effectively treated with an agent for a disorder associated with aberrant or unwanted CONAT-1 expression or activity in which a test sample is obtained and CONAT-1 protein or nucleic acid expression or activity is detected (e.g., wherein the abundance of CONAT-1 protein or nucleic acid expression or activity is diagnostic for a subject that can be administered the agent to treat a disorder associated with aberrant or unwanted CONAT-1 expression or activity).
  • the methods of the invention can also be used to detect genetic alterations in a CONAT-1 gene, thereby determining if a subject with the altered gene is at risk for a disorder characterized by misregulation in CONAT-1 protein activity or nucleic acid expression, such as a cell proliferation and/or differentiation disorder.
  • the methods include detecting, in a sample of cells from the subject, the presence or absence of a genetic alteration characterized by at least one of an alteration affecting the integrity of a gene encoding a CONAT-1 -protein, or the mis-expression of the CONAT-1 gene.
  • a preferred biological sample is a tissue or serum sample isolated by conventional means from a subject.
  • a first hybridization array of probes can be used to scan through long stretches of DNA in a sample and control to identify base changes between the sequences by making linear arrays of sequential overlapping probes. This step allows the identification of point mutations. This step is followed by a second hybridization array that allows the characterization of specific mutations by using smaller, specialized probe arrays complementary to all variants or mutations detected. Each mutation array is composed of parallel probe sets, one complementary to the wild-type gene and the other complementary to the mutant gene.
  • any of a variety of sequencing reactions known in the art can be used to directly sequence the CONAT-1 gene and detect mutations by comparing the sequence of the sample CONAT-1 with the corresponding wild-type (control) sequence.
  • RNA/DNA duplexes can be treated with RNase and DNA/DNA hybrids treated with SI nuclease to enzymatically digesting the mismatched regions.
  • either DNA DNA or RNA/DNA duplexes can be treated with hydroxylamine or osmium tetroxide and with piperidine in order to digest mismatched regions. After digestion of the mismatched regions, the resulting material is then separated by size on denaturing polyacrylamide gels to determine the site of mutation. See, for example, Cotton et al. (1988) Proc. Natl Acad Sci USA 85:4397; Saleeba et al. (1992) Methods Enzymol. 217:286-295.
  • the control DNA or RNA can be labeled for detection.
  • alterations in electrophoretic mobility will be used to identify mutations in CONAT-1 genes.
  • single strand conformation polymo ⁇ hism may be used to detect differences in electrophoretic mobility between mutant and wild type nucleic acids (Orita et al. (1989) Proc Natl. Acad. Sci USA: 86:2166, see also Cotton (1993) Mutat. Res. 285:125-144; and Hayashi (1992) Genet. Anal. Tech. Appl. 9:73-79). Single-stranded DNA fragments of sample and control CONAT-1 nucleic acids will be denatured and allowed to renature.
  • the movement of mutant or wild-type fragments in polyacrylamide gels containing a gradient of denaturant is assayed using denaturing gradient gel electrophoresis (DGGE) (Myers et al. (1985) Nature 313:495).
  • DGGE denaturing gradient gel electrophoresis
  • DNA will be modified to insure that it does not completely denature, for example by adding a GC clamp of approximately 40 bp of high-melting GC-rich DNA by PCR.
  • a temperature gradient is used in place of a denaturing gradient to identify differences in the mobility of control and sample DNA (Rosenbaum and Reissner (1987) Biophys Chem 265:12753).
  • oligonucleotide primers may be prepared in which the known mutation is placed centrally and then hybridized to target DNA under conditions which permit hybridization only if a perfect match is found (Saiki et al. (1986) Nature 324:163); Saiki et al. (1989) Proc. Natl Acad. Sci USA 86:6230).
  • Such allele specific oligonucleotides are hybridized to PCR amplified target DNA or a number of different mutations when the oligonucleotides are attached to the hybridizing membrane and hybridized with labeled target DNA.
  • Oligonucleotides used as primers for specific amplification may carry the mutation of interest in the center of the molecule (so that amplification depends on differential hybridization) (Gibbs et al. (1989) Nucleic Acids Res. 17:2437-2448) or at the extreme 3' end of one primer where, under appropriate conditions, mismatch can prevent, or reduce polymerase extension (Prossner (1993) Tibtech 11 :238).
  • amplification may also be performed using Taq ligase for amplification (Barany (1991) Proc. Natl. Acad. Sci USA 88:189). In such cases, ligation will occur only if there is a perfect match at the 3' end of the 5' sequence making it possible to detect the presence of a known mutation at a specific site by looking for the presence or absence of amplification.
  • the methods described herein may be performed, for example, by utilizing prepackaged diagnostic kits comprising at least one probe nucleic acid or antibody reagent described herein, which may be conveniently used, e.g., in clinical settings to diagnose patients exhibiting symptoms or family history of a disease or illness involving a CONAT-1 gene.
  • CONAT-1 protein e.g., the modulation of gene expression, and or cell growth and differentiation mechanisms
  • CONAT-1 protein can be applied not only in basic drag screening, but also in clinical trials.
  • the effectiveness of an agent determined by a screening assay as described herein to increase CONAT-1 gene expression, protein levels, or upregulate CONAT-1 activity can be monitored in clinical trials of subjects exhibiting decreased CONAT-1 gene expression, protein levels, or downregulated CONAT-1 activity.
  • the effectiveness of an agent determined by a screening assay to decrease CONAT-1 gene expression, protein levels, or downregulate CONAT-1 activity can be monitored in clinical trials of subjects exhibiting increased CONAT-1 gene expression, protein levels, or upregulated CONAT-1 activity.
  • genes, including CONAT-1, that are modulated in cells by treatment with an agent (e.g. , compound, drug or small molecule) which modulates CONAT-1 activity can be identified.
  • agents e.g. , compound, drug or small molecule
  • CONAT-1 activity e.g., identified in a screening assay as described herein
  • cells can be isolated and RNA prepared and analyzed for the levels of expression of CONAT-1 and other genes implicated in the CONAT-1 -associated disorder, respectively.
  • the present invention provides a method for monitoring the effectiveness of treatment of a subject with an agent (e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drag candidate identified by the screening assays described herein) including the steps of (i) obtaining a pre-administration sample from a subject prior to administration of the agent; (ii) detecting the level of expression of a CONAT-1 protein, mRNA, or genomic DNA in the preadministration sample; (iii) obtaining one or more post-administration samples from the subject; (iv) detecting the level of expression or activity of the CONAT-1 protein, mRNA, or genomic DNA in the post-administration samples; (v) comparing the level of expression or activity of the CONAT-1 protein, mRNA, or genomic DNA in the pre-administration sample with the CONAT-1 protein, mRNA, or genomic DNA in the post administration sample or samples; and (vi) altering the administration of the agent to the subject accordingly.
  • an agent e.g
  • increased administration of the agent may be desirable to increase the expression or activity of CONAT-1 to higher levels than detected, i.e., to increase the effectiveness of the agent.
  • decreased administration of the agent may be desirable to decrease expression or activity of CONAT-1 to lower levels than detected, i.e. to decrease the effectiveness of the agent.
  • CONAT-1 expression or activity may be used as an indicator of the effectiveness of an agent, even in the absence of an observable phenotypic response.
  • the present invention provides for both prophylactic and therapeutic methods of treating a subject at risk of (or susceptible to) a disorder or having a disorder associated with aberrant or unwanted CONAT-1 expression or activity, e.g. a CONAT-1 associated or CONAT-1 related disorder, for example, a cell growth, differentiation, migration, or apoptosis disorder, for example, in the colon.
  • a CONAT-1 associated or CONAT-1 related disorder for example, a cell growth, differentiation, migration, or apoptosis disorder, for example, in the colon.
  • Such treatments may be specifically tailored or modified, based on knowledge obtained from the field of pharmacogenomics.
  • “Pharmacogenomics” refers to the application of genomics technologies such as gene sequencing, statistical genetics, and gene expression analysis to drugs in clinical development and on the market.
  • the invention provides a method for preventing in a subject, a disease or condition associated with an aberrant or unwanted CONAT-1 expression or activity, by administering to the subject a CONAT-1 or an agent which modulates CONAT-1 expression or at least one CONAT-1 activity.
  • Subjects at risk for a disease which is caused or contributed to by aberrant or unwanted CONAT-1 expression or activity can be identified by, for example, any or a combination of diagnostic or prognostic assays as described herein.
  • Administration of a prophylactic agent can occur prior to the manifestation of symptoms characteristic of the CONAT-1 aberrancy, such that a disease or disorder is prevented or, alternatively, delayed in its progression.
  • a CONAT-1, CONAT-1 agonist or CONAT-1 antagonist agent can be used for treating the subject. The appropriate agent can be determined based on screening assays described herein. 2.
  • the modulatory method of the invention involves contacting a cell capable of expressing CONAT-1 with an agent that modulates one or more of the activities of CONAT-1 protein activity associated with the cell, such that CONAT-1 activity in the cell is modulated.
  • An agent that modulates CONAT-1 protein activity can be an agent as described herein, such as a nucleic acid or a protein, a naturally-occurring target molecule of a CONAT-1 protein (e.g., a CONAT-1 substrate or ligand), a CONAT-1 antibody, a CONAT-1 agonist or antagonist, a peptidomimetic of a CONAT-1 agonist or antagonist, or other small molecule.
  • the agent stimulates one or more CONAT-1 activities. Examples of such stimulatory agents include active CONAT-1 protein and a nucleic acid molecule encoding CONAT-1 that has been introduced into the cell.
  • the agent inhibits one or more CONAT-1 activities.
  • inhibitory agents include antisense CONAT-1 nucleic acid molecules, anti-CONAT-1 antibodies, and CONAT-1 inhibitors. These modulatory methods can be performed in vitro (e.g., by culturing the cell with the agent) or, alternatively, in vivo (e.g., by administering the agent to a subject).
  • the present invention provides methods of treating an individual afflicted with a disease or disorder characterized by aberrant or unwanted expression or activity of a CONAT-1 protein or nucleic acid molecule.
  • the method involves administering an agent (e.g., an agent identified by a screening assay described herein), or combination of agents that modulates (e.g., upregulates or downregulates) CONAT-1 expression or activity.
  • the method involves administering a CONAT-1 protein or nucleic acid molecule as therapy to compensate for reduced, aberrant, or unwanted CONAT-1 expression or activity.
  • Stimulation of CONAT-1 activity is desirable in situations in which CONAT-1 is abnormally downregulated and/or in which increased CONAT-1 activity is likely to have a beneficial effect.
  • stimulation of CONAT-1 activity is desirable in situations in which a CONAT-1 is downregulated and/or in which increased CONAT-1 activity is likely to have a beneficial effect.
  • inhibition of CONAT-1 activity is desirable in situations in which CONAT-1 is abnormally upregulated and/or in which decreased CONAT-1 activity is likely to have a beneficial effect.
  • CONAT-1 molecules of the present invention as well as agents, or modulators which have a stimulatory or inhibitory effect on CONAT-1 activity (e.g., CONAT-1 gene expression) as identified by a screening assay described herein can be administered to individuals to treat (prophylactically or therapeutically) CONAT- 1- associated disorders (e.g., disorders characterized by aberrant gene expression, or cell proliferation and/or differentiation disorders) associated with aberrant or unwanted CONAT-1 activity.
  • CONAT- 1- associated disorders e.g., disorders characterized by aberrant gene expression, or cell proliferation and/or differentiation disorders
  • pharmacogenomics i.e., the study of the relationship between an individual's genotype and that individual's response to a foreign compound or drag
  • pharmacogenomics i.e., the study of the relationship between an individual's genotype and that individual's response to a foreign compound or drag
  • a physician or clinician may consider applying knowledge obtained in relevant pharmacogenomics studies in determining whether to administer a CONAT-1 molecule or CONAT-1 modulator as well as tailoring the dosage and/or therapeutic regimen of treatment with a CONAT-1 molecule or CONAT-1 modulator.
  • Pharmacogenomics deals with clinically significant hereditary variations in the response to drags due to altered drag disposition and abnormal action in affected persons. See, for example, Eichelbaum, M. et al. (1996) Gin. Exp. Pharmacol. Physiol. 23(10-11) :983-985 and Linder, M.W. et al.
  • G6PD glucose-6-phosphate dehydrogenase deficiency
  • oxidant drugs anti-malarials, sulfonamides, analgesics, nitrofurans
  • a genome-wide association relies primarily on a high-resolution map of the human genome consisting of already known gene-related markers (e.g., a "bi-allelic” gene marker map which consists of 60,000-100,000 polymo ⁇ hic or variable sites on the human genome, each of which has two variants.)
  • gene-related markers e.g., a "bi-allelic” gene marker map which consists of 60,000-100,000 polymo ⁇ hic or variable sites on the human genome, each of which has two variants.
  • Such a high-resolution genetic map can be compared to a map of the genome of each of a statistically significant number of patients taking part in a Phase II/III drag trial to identify markers associated with a particular observed drag response or side effect.
  • such a high resolution map can be generated from a combination of some ten-million known single nucleotide polymo ⁇ hisms (SNPs) in the human genome.
  • SNP single nucleotide polymo ⁇ hisms
  • a "SNP" is a common alteration that occurs in a single nucleotide base in a stretch of DNA. For example, a SNP may occur once per every 1000 bases of DNA.
  • a SNP may be involved in a disease process, however, the vast majority may not be disease- associated.
  • individuals Given a genetic map based on the occurrence of such SNPs, individuals can be grouped into genetic categories depending on a particular pattern of SNPs in their individual genome. In such a manner, treatment regimens can be tailored to groups of genetically similar individuals, taking into account traits that may be common among such genetically similar individuals.
  • a method termed the "candidate gene approach” can be utilized to identify genes that predict drug response.
  • a gene that encodes a drag's target e.g., a CONAT-1 protein of the present invention
  • all common variants of that gene can be fairly easily identified in the population and it can be determined if having one version of the gene versus another is associated with a particular drag response.
  • the activity of drug metabolizing enzymes is a major determinant of both the intensity and duration of drag action.
  • the gene coding for CYP2D6 is highly polymo ⁇ hic and several mutations have been identified in PM, which all lead to the absence of functional CYP2D6. Poor metabolizers of CYP2D6 and CYP2C19 quite frequently experience exaggerated drag response and side effects when they receive standard doses. If a metabolite is the active therapeutic moiety, PM show no therapeutic response, as demonstrated for the analgesic effect of codeine mediated by its CYP2D6-formed metabolite mo ⁇ hine. The other extreme are the so called ultra-rapid metabolizers who do not respond to standard doses.
  • the CONAT-1 molecules of the invention are also useful as markers of disorders or disease states, as markers for precursors of disease states, as markers for predisposition of disease states, as markers of drag activity, or as markers of the pharmacogenomic profile of a subject.
  • the presence, absence and/or quantity of the CONAT-1 molecules of the invention may be detected, and may be correlated with one or more biological states in vivo.
  • the CONAT-1 molecules of the invention may serve as surrogate markers for one or more disorders or disease states or for conditions leading up to disease states.
  • the CONAT-1 molecules of the invention are also useful as pharmacodynamic markers.
  • a "pharmacodynamic marker” is an objective biochemical marker which correlates specifically with drug effects.
  • the presence or quantity of a pharmacodynamic marker is not related to the disease state or disorder for which the drug is being administered; therefore, the presence or quantity of the marker is indicative of the presence or activity of the drag in a subject.
  • a pharmacodynamic marker may be indicative of the concentration of the drug in a biological tissue, in that the marker is either expressed or transcribed or not expressed or transcribed in that tissue in relationship to the level of the drag. In this fashion, the distribution or uptake of the drag may be monitored by the pharmacodynamic marker.
  • a "pharmacogenomic marker” is an objective biochemical marker which correlates with a specific clinical drag response or susceptibility in a subject (see, e.g., McLeod et al (1999) Eur. J. Cancer 35(12): 1650-1652). The presence or quantity of the pharmacogenomic marker is related to the predicted response of the subject to a specific drag or class of drugs prior to administration of the drag.
  • the invention is based, at least in part, on the discovery of genes encoding novel members of the acetyltransferase family.
  • the nucleotide sequence encoding human CONAT-1 polypeptide is shown in
  • the CONAT-1 protein also includes a potential N-glycosylation site at about amino acid residues 103-106 of SEQ ID NO:2; potential protein kinase C phosphorylation sites at about amino acids 20-22 and 102-104 of SEQ ID NO:2; and potential N-myristoylation sites at about amino acids 43-48 and 74-79 of SEQ ID NO:2 (see Appendix A2).
  • This example describes the tissue distribution of CONAT-1 mRNA, as was determined by RT-PCR, in situ hybridization, and measured by quantitative PCR using the TaqmanTM procedure as described below.
  • RNA samples were frozen, sectioned, fixed, and probed using standard in situ hybridization methodologies.
  • CONAT-1 expression levels were measured in a variety of tissue and cell samples using the TaqmanTM procedure .
  • the TaqmanTM procedure is a quantitative, real-time PCR-based approach to detecting mRNA.
  • the RT-PCR reaction exploits the 5' nuclease activity of AmplTaq GoldTM DNA Polymerase to cleave a TaqManTM probe during PCR. Briefly, cDNA is generated from the samples of interest and serves as the starting materials for PCR amplification.
  • a gene-specific oligonucleotide probe (complementary to the region being amplified) is included in the reaction (i.e., the TaqmanTM probe).
  • the TaqManTM probe includes the oligonucleotide with a fluorescent reporter dye covalently linked to the 5' end of the probe (such as FAM (6-carboxyfluorescein), TET (6-carboxy-4,7,2',7'- tetrachlorofluorescein), JOE (6-carboxy-4,5-dichloro-2,7-dimethoxyfluorescein), or VIC) and a quencher dye (TAMRA (6-carboxy-N,N,N',N'-tetramethylrhodamine) at the 3' end of the probe.
  • a fluorescent reporter dye covalently linked to the 5' end of the probe
  • TET 6-carboxy-4,7,2',7'- tetrachlorofluorescein
  • JOE 6-
  • CONAT-1 may serve as a good tumor and/or metastatic marker.
  • inhibition of CONAT-1 activity may inhibit tumor progression.
  • CONAT-1 is expressed as a recombinant glutathione-S- transferase (GST) fusion polypeptide in E. coli and the fusion polypeptide is isolated and characterized.
  • GST glutathione-S- transferase
  • CONAT-1 is fused to GST and this fusion polypeptide is expressed in E. coli, e.g., strain PEB199.
  • Expression of the GST-CONAT-1 fusion protein in PEB199 is induced with IPTG.
  • the recombinant fusion polypeptide is purified from crude bacterial ly sates of the induced PEB199 strain by affinity chromatography on glutathione beads. Using polyacrylamide gel electrophoretic analysis of the polypeptide purified from the bacterial lysates, the molecular weight of the resultant fusion polypeptide is determined.
  • the pcDNA/Amp vector by Invitrogen Co ⁇ oration (San Diego, CA) is used.
  • This vector contains an SV40 origin of replication, an ampicillin resistance gene, an E. coli replication origin, a CMV promoter followed by a polylinker region, and an SV40 intron and polyadenylation site.
  • a DNA fragment encoding the entire CONAT-1 protein and an HA tag (Wilson et al. (1984) Cell 31:161) or a FLAG tag fused in-frame to its 3' end of the fragment is cloned into the polylinker region of the vector, thereby placing the expression of the recombinant protein under the control of the CMV promoter.
  • the CONAT- 1 DNA sequence is amplified by PCR using two primers.
  • the 5' primer contains the restriction site of interest followed by approximately twenty nucleotides of the CONAT-1 coding sequence starting from the initiation codon; the 3' end sequence contains complementary sequences to the other restriction site of interest, a translation stop codon, the HA tag or FLAG tag and the last 20 nucleotides of the CONAT-1 coding sequence.
  • the PCR amplified fragment and the pCDNA/Amp vector are digested with the appropriate restriction enzymes and the vector is dephosphorylated using the CIAP enzyme (New England Biolabs, Beverly, MA).
  • the two restriction sites chosen are different so that the CONAT-1 gene is inserted in the correct orientation.
  • the expression of the CONAT-1 polypeptide is detected by radiolabelling (3$S- methionine or 35s-cysteine available from NEN, Boston, MA, can be used) and immunoprecipitation (Harlow, E. and Lane, D. Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1988) using an HA specific monoclonal antibody. Briefly, the cells are labeled for 8 hours with ⁇ S-methionine (or 35s-cysteine). The culture media are then collected and the cells are lysed using detergents (RIPA buffer, 150 mM NaCl, 1% NP-40, 0.1% SDS, 0.5% DOC, 50 mM Tris, pH 7.5). Both the cell lysate and the culture media are precipitated with an HA specific monoclonal antibody. Precipitated polypeptides are then analyzed by SDS- PAGE.
  • DNA containing the CONAT-1 coding sequence is cloned directly into the poly linker of the pCDNA/Amp vector using the appropriate restriction sites.
  • the resulting plasmid is transfected into COS cells in the manner described above, and the expression of the CONAT-1 polypeptide is detected by radiolabelling and immunoprecipitation using a CONAT-1 specific monoclonal antibody.
  • HMMER is freely distributed under the GNU General Public License (GPL)
  • HMM file /prod/ddm/seqanal/PFAM/pfam5.3/Pf m
  • Sequence file /prod/ddm/ space/orfanal/oa-script .4542.seq
  • grlfweedGelvGyatlrpdddene e+vG + ++ d + ++++i+ +aVd++yr+ G+G+ L 26320 37 VGEECVGAIVCKLDiiHKKMfrRGYIAMLAVDSKYRRNGIGTNL 79

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Molecular Biology (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

The invention provides isolated nucleic acid molecules, designated CONAT-1 nucleic acid molecules, which encode novel acetyltransferase family members. The invention also provides antisense nucleic acid molecules, recombinant expression vectors containing CONAT-1 nucleic acid molecules, host cells into which the expression vectors have been introduced, and nonhuman transgenic animals in which a CONAT-1 gene has been introduced or disrupted. The invention still further provides isolated CONAT-1 proteins, fusion proteins, antigenic peptides and anti-CONAT-1 antibodies. Diagnostic methods utilizing compositions of the invention are also provided.

Description

26320, A NOVEL HUMAN N-ACETYLTRANSFERASE FAMILY MEMBER
AND USES THEREOF
Related Applications This application claims the benefit of prior-filed provisional patent application
Serial No. 60/212,439, filed June 16, 2000, entitled "26320, A Novel Human N- Acetyltransferase Family Member and Uses Thereof (pending). The entire content of the above-referenced application is incoφorated herein by this reference.
Background of the Invention
Acetyltransferases are the enzymes that catalyze the acetylation of protein substrates, and as such, are important regulators of a broad range of cellular processes including, but not limited to, gene expression, cellular metabolism (e.g., drug metabolism), neurotransmitter synthesis, intracellular movement (e.g., mitotic spindle and chromosome movement during cell division), and vesicular transport (Darnell, Lodish and Baltimore. Molecular Cell Biology, Scientific American Books, Inc., © 1990). For example, the acetylation of histones is an important transcriptional regulatory mechanism, and may be important in long range chromatin structures such as heterochromatin, locus control regions, and chromosome inactivation. Histone acetylation is ubiquitous, although steady state levels of acetylation vary in between genomic loci, due to the dynamic balance between acetyltransferases and deacetylases. The acetylation of internal conserved amino terminal lysine residues of core histones is associated with transcriptional activation, and acetyltransferase activity is associated with coactivator complexes (Struhl, K. Genes Develop. 12:599-606). Transcriptional regulatory proteins, e.g., the TAFE250 subunit of TFIID, have been identified that possess intrinsic histone acetyltransferase activity, thus linking histone acetylation with transcriptional control (Mizzen, C.A. et al. (1996) Cell 87:1261-70). This provides a mechanism by which histone acetyltransferase activity is targeted to promoters in order for the transcriptional machinery to gain access to transcriptionally repressed chromatin. Histone acetylation affects intrinsic chromatin structure and promotes access of the transcriptional machinery to cognate binding sites on DNA (Struhl, K. Genes Develop. 12:599-606). In addition, transcriptional regulatory proteins such as TAFII250, PCAF (p300/CBP-associated factor), and p300/CBP are also capable of acetylating non-histone proteins, such as the basal transcription machinery for RNA Pol II (Inhof, A. et al. (1997) Curr. Biol. 7:689-92), and transcription factors such as p53, suggesting that acetylation may also be used as a general mechanism to regulate protein activity within transcription complexes.
N-acetyltransferases catalyze the transfer of acetyl groups from Coenzyme A to the N-termini of most eukaryotic proteins. Two N-acetyltransferases have been isolated from the yeast Saccharomyces cerevisiae, namely NAT1 and ARD1, and have been shown to encode the major N alpha-N-acetyltransferase, which acts on certain proteins having serine, glycine, and alanine amino termini but not methionine amino termini. A third gene from S. cerevisiae, NAT2, is believed to act on proteins having methionine termini. In humans, two genes, NAT1 and NAT2, have been identified having N- acetyltransferase activity (Kulkarni, M.S. et al. (1994) J Biol. Chem. 269:13141-13147, Blum, M. et al. (1990) Cell Biol. 9:193-203).
N-acetylfransferases are essential for the activation and deactivation of aromatic and heterocyclic amine carcinogens. Heterocyclic amines may be colorectal carcinogens. They also participate in the detoxification of hydrazine and arylamine drugs and are able to bioactivate several known carcinogens. Predisposition for colorectal cancer is connected to hereditary factors and genetic sensitivity to environmental carcinogens. In recent years the polymoφhism of genes encoding drag-metabolizing enzymes has been shown to be important. Several studies have shown a role for NAT1 and NAT2 acetylation polymoφhisms in cancer risk in human populations. Studies suggest that the NAT1 and NAT2 acetylation polymoφhisms modify risk of developing urinary bladder, colorectal, breast, head and neck, lung, and possibly prostate cancers. Associations between rapid NAT2 acetylator genotypes and colorectal cancer are the most consistently reported (Minchin R.F. et al. (1993) Mutant Res. 290:35-42, Hein, D.W. et al. (2000) Toxicol. Lett. 15:112-113;349- 356). Several allelic variants of NAT1 and NAT2 have been detected. It is thought that some of them modify individual susceptibility to cancer. For example, slow NAT2 acetylation capacity is linked with decreased risk of colon cancer while increased NAT1 activity is associated with increased risk of bladder and colon cancer (Hirvonen A. (Publ. 1999) in Polymoφhic NATs and cancer predisposition, IARC Sci. Publ. 148:251- 270, Potter, J.D. (1999) in Colorectal cancer: molecules and population, Natl. Cancer Inst. 91 :916-932). Accordingly, there exists a need to identify additional human N- acetyltransferases, for example, for use as disease markers and as targets for identifying various therapeutic modulators.
Summary of the Invention
The present invention is based, at least in part, on the discovery of novel human N-acetyltransferase family members, referred to herein as "Colon Cancer-Related N- Acetyltransferase" or "CONAT-1" nucleic acid and protein molecules. The CONAT-1 nucleic acid and protein molecules of the present invention are useful as modulating agents in regulating a variety of cellular processes, e.g., gene expression, cell proliferation and differentiation, and cellular movement (e.g., intracellular transport). Accordingly, in one aspect, this invention provides isolated nucleic acid molecules encoding CONAT-1 proteins or biologically active portions thereof, as well as nucleic acid fragments suitable as primers or hybridization probes for the detection of CONAT- 1 -encoding nucleic acids.
In one embodiment, the invention features an isolated nucleic acid molecule that includes the nucleotide sequence set forth in SEQ ID NO: 1, 3 or 5. In another embodiment, the invention features an isolated nucleic acid molecule that encodes a polypeptide including the amino acid sequence set forth in SEQ ID NO:2 or 4. In another embodiment, the invention features an isolated nucleic acid molecule that includes the nucleotide sequence contained in the plasmid deposited with ATCC® as Accession Number .
In still other embodiments, the invention features isolated nucleic acid molecules including nucleotide sequences that are substantially identical (e.g., 75% identical) to the nucleotide sequence set forth as SEQ ID NO:l, 3 or 5. The invention further features isolated nucleic acid molecules including at least 30 contiguous nucleotides of the nucleotide sequence set forth as SEQ ID NO: 1 , 3 or 5. In another embodiment, the invention features isolated nucleic acid molecules which encode a polypeptide including an amino acid sequence that is substantially identical (e.g., 15% identical) to the amino acid sequence set forth as SEQ ID NO:2 or 4. Also features are nucleic acid molecules which encode allelic variants of the polypeptide having the amino acid sequence set forth as SEQ ID NO:2 or 4. In addition to isolated nucleic acid molecules encoding full- length polypeptides, the present invention also features nucleic acid molecules which encode fragments, for example biologically active or antigenic fragments, of the full- length polypeptides of the present invention (e.g., fragments including at least 10 contiguous amino acid residues of the amino acid sequence of SEQ ID NO:2 or 4). In still other embodiments, the invention features nucleic acid molecules that are complementary to, are antisense to, or hybridize under stringent conditions to the isolated nucleic acid molecules described herein.
In a related aspect, the invention provides vectors including the isolated nucleic acid molecules described herein (e.g., CONAT-1 -encoding nucleic acid molecules). Such vectors can optionally include nucleotide sequences encoding heterologous polypeptides. Also featured are host cells including such vectors (e.g., host cells including vectors suitable for producing CONAT-1 nucleic acid molecules and polypeptides).
In another aspect, the invention features isolated CONAT-1 polypeptides and/or biologically active or antigenic fragments thereof. Exemplary embodiments feature a polypeptide including the amino acid sequence set forth as SEQ ID NO:2 or 4, a polypeptide including an amino acid sequence at least 75% identical to the amino acid sequence set forth as SEQ ID NO:2 or 4, a polypeptide encoded by a nucleic acid molecule including a nucleotide sequence at least 75% identical to the nucleotide sequence set forth as SEQ ID NO:l, 3 or 5. Also featured are fragments of the full- length polypeptides described herein (e.g., fragments including at least 10 contiguous amino acid residues of the sequence set forth as SEQ ID NO:2 or 4) as well as fragments of allelic variants of the polypeptide having the amino acid sequence set forth as SEQ ID NO:2 or 4.
The CONAT-1 polypeptides and/or biologically active or antigenic fragments thereof, are useful, for example, as reagents or targets in assays applicable to treatment and/or diagnosis of CONAT-1 mediated or related disorders. In one embodiment, a CONAT-1 polypeptide or fragment thereof has a CONAT-1 activity. In another embodiment, a CONAT-1 polypeptide or fragment thereof has an N-acetyltransferase domain and optionally, has a CONAT-1 activity. In a related aspect, the invention features antibodies (e.g., antibodies which specifically bind to any one of the polypeptides, as described herein) as well as fusion polypeptides including all or a fragment of a polypeptide described herein. The present invention further features methods for detecting CONAT-1 polypeptides and/or CONAT-1 nucleic acid molecules, such methods featuring, for example, a probe, primer or antibody described herein. Also featured are kits for the detection of CONAT-1 polypeptides and/or CONAT-1 nucleic acid molecules. In a related aspect, the invention features methods for identifying compounds which bind to and/or modulate the activity of a CONAT-1 polypeptide or CONAT-1 nucleic acid molecule described herein. Further featured are methods for modulating a CONAT-1 activity.
Other features and advantages of the invention will be apparent from the following detailed description and claims.
Brief Description of the Drawings
Figure I depicts the nucleotide sequence of human CONAT-1 cDNA and corresponding predicted amino acid sequence. The nucleotide sequence corresponds to nucleic acids 390 to 806 of SEQ ID NO:l. The amino acid sequence corresponds to amino acids 1 to 139 of SEQ ID NO: 2. The coding region for the predicted amino acid sequence is set forth as SEQ ID NO:3.
Figure 2 depicts the cDNA sequence and predicted amino acid sequence of a second CONAT-1 translation product (CONAT-lb). The nucleotide sequence corresponds to nucleic acids 3 to 806 of SEQ ID NO: 1. The amino acid sequence corresponds to amino acids 1 to 268 of SEQ ID NO:4. The coding region of this second predicted amino acid sequence is set forth as SEQ ID NO: 5
Detailed Description of the Invention The present invention is based, at least in part, on the discovery of novel acetyltransferase family members, referred to herein as "Colon Cancer-Related N- Acetyltransferase-1" or "CONAT-1" nucleic acid and protein molecules. The term "family" when referring to the protein and nucleic acid molecules of the invention is intended to mean two or more proteins or nucleic acid molecules having a common structural domain or motif and having sufficient amino acid or nucleotide sequence homology as defined herein. Such family members can be naturally or non- naturally occurring and can be from either the same or different species. For example, a family can contain a first protein of human origin as well as other distinct proteins of human origin or alternatively, can contain homologues of non-human origin, e.g., rat or mouse proteins. Members of a family can also have common functional characteristics. Members of the CONAT-1 family of proteins, for example, include at least one "acetyltransferase domain" in the protein or corresponding nucleic acid molecule. As used herein, the term "acetyltransferase domain" includes a protein domain having at least about 108-158 amino acid residues and has a bit score for the alignment of the sequence to an acetyltransferase (HMM) (e.g., the Pfam acetyltransferase HMM having Accession Number PF00583) of at least 40. More preferably, an acetyltransferase domain includes at least about 128-138, or typically about 131-135 amino acid residues, and has a bit score for the alignment of the sequence to an acetyltransferase (HMM) of at least 45, 50, 55, 60 or greater. A search was performed against the HMM database resulting in the identification of an acetyltransferase domain in the amino acid sequence of human CONAT-1 at about residues 1-116 of SEQ ID NO:2 (see Appendix A3), and in human CONAT-lb at about residues 122-245 of SEQ ID NO:4 (see Appendix A7). Preferably, an acetyltransferase domain has an acetyltransferase activity (e.g., catalyzes the acetylation of a substrate, for example, a protein substrate or target molecule).
A description of the Pfam database can be found in Sonhammer et al. (1997) Proteins 28:405-420 and a detailed description of HMMs can be found, for example, in Gribskov et α/.(1990) Meth Enzymol 183:146-159; Gribskov et .(1987) Proc. Natl. Acad. Sci. USA 84:4355-4358; Krogh et /.(1994) J Mol. Biol. 235:1501-1531; and Stultz et α/.(1993) Protein Sci. 2:305-314, the contents of which are incoφorated herein by reference.
To identify the presence of an acetyltransferase domain, and make the determination that a protein of interest has a particular profile, the amino acid sequence of the protein is searched against a database of HMMs (e.g., the Pfam database, release 5.3) using the default parameters (www.sanger.ac.uk/Software/Pfarn/HMM_search). For example, the search can be performed using the hmmsf program (family specific) using the default parameters (e.g., a threshold score of 15) for determining a hit. hmmsf is available as part of the HMMER package of search programs (HMMER 2.1.1, Dec. 1998) which is freely distributed by the Washington University School of Medicine. Alternatively, the threshold score for determining a hit can be lowered (e.g., to 8 bits). A search was performed against the HMM database resulting in the identification of an acetyltransferase domain in the amino acid sequence of human CONAT-1 at about residues 1-116 of SEQ ID NO:2 (see Appendix A3), and in human CONAT-1 at about residues 122-245 of SEQ ID NO:4 (see Appendix A7). Isolated proteins of the present invention, preferably CONAT-1 proteins, have an amino acid sequence sufficiently homologous to the amino acid sequence of SEQ ID NO:2 or 4, or are encoded by a nucleotide sequence sufficiently homologous to SEQ ID NO:l, 3, or 5. As used herein, the term "sufficiently homologous" refers to a first amino acid or nucleotide sequence which contains a sufficient or minimum number of identical or equivalent (e.g., an amino acid residue which has a similar side chain) amino acid residues or nucleotides to a second amino acid or nucleotide sequence such that the first and second amino acid or nucleotide sequences share common structural domains or motifs and/or a common functional activity. For example, amino acid or nucleotide sequences which share common structural domains having at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more homology or identity across the amino acid sequences of the domains and contain at least one and preferably two structural domains or motifs, are defined herein as sufficiently homologous. Furthermore, amino acid or nucleotide sequences which share at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more homology or identity and share a common functional activity are defined herein as sufficiently homologous.
In a preferred embodiment, a CONAT-1 protein includes at least one acetyltransferase domain, and has an amino acid sequence at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more homologous or identical to the amino acid sequence of SEQ ID NO:2, or the amino acid sequence encoded by the DNA insert of the plasmid deposited with ATCC as Accession Number . In yet another preferred embodiment, a CONAT-1 protein includes at least one acetyltransferase domain, and is encoded by a nucleic acid molecule having a nucleotide sequence which hybridizes under stringent hybridization conditions to a complement of a nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO:l or SEQ ID NO:3 or SEQ ID NO:5. In another preferred embodiment, a CONAT- 1 protein includes at least one acetyltransferase domain, and has a CONAT-1 activity. As used interchangeably herein, an "CONAT-1 activity", "biological activity of CONAT-1" or "functional activity of CONAT-1", refers to an activity exerted by a CONAT-1 protein, polypeptide or nucleic acid molecule on a CONAT-1 responsive cell or on a CONAT-1 protein substrate, as determined in vivo or in vitro, according to standard techniques. In one embodiment, a CONAT-1 activity is a direct activity, such as an association with a CONAT-1 target molecule. As used herein, a "target molecule" or "binding partner" is a molecule with which a CONAT-1 protein binds or interacts in nature, such that CONAT-1 -mediated function is achieved. A CONAT-1 target molecule can be a non-CONAT-1 molecule or a CONAT-1 protein or polypeptide of the present invention. In an exemplary embodiment, a CONAT-1 target molecule is a CONAT-1 substrate or ligand. A CONAT-1 activity can also be an indirect activity, such as a cellular signaling activity mediated by interaction of the CONAT-1 protein with a CONAT-1 substrate or ligand.
In a preferred embodiment, a CONAT-1 activity is at least one of the following activities: (i) interaction with a CONAT-1 substrate or target molecule; (ii) conversion of a CONAT-1 substrate or target molecule to product (e.g., acetylation of the substrate or target molecule); (iii) interaction with and/or modulation of a second non-CONAT-1 protein; (iv) activation/deactivation of CONAT-1 substrates or target molecules (e.g., activation/deactivation of carcinogens, for example heterocyclic and/or aromatic amine carcinogens, e.g., colorectal carcinogens); (v) metabolism and/or detoxification of drags (e.g., hydrazine and/or arylamine drags); (vi) modulation of cellular signaling and/or gene transcription (e.g., either directly or indirectly); and (vii) modulation of cellular proliferation and/or differentiation.
Accordingly, another embodiment of the invention features isolated CONAT-1 proteins and polypeptides having a CONAT-1 activity. Preferred proteins are CONAT- 1 proteins including at least one acetyltransferase domain, and, preferably, having a CONAT-1 activity. Further preferred proteins include at least one acetyltransferase domain, and are, preferably, encoded by a nucleic acid molecule having a nucleotide sequence which hybridizes under stringent hybridization conditions to a complement of a nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO:l, 3, or 5. The nucleotide sequence of an isolated human CONAT-1 cDNA and the predicted amino acid sequence encoded by the CONAT-1 cDNA are shown in Figure 1 and in SEQ ID NOs:l and 2, respectively. A plasmid containing the human CONAT-1 cDNA was deposited with the American Type Culture Collection (ATCC), 10801
University Boulevard, Manassas, VA 20110-2209, on and assigned Accession
Number . This deposit will be maintained under the terms of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Puφoses of Patent Procedure. This deposit were made merely as a convenience for those of skill in the art and is not an admission that a deposit is required under 35 U.S.C. §112.
A second predicted potential amino acid sequence of the human CONAT-1 cDNA is shown in Figure 2 and in SEQ ID NO: 4. CONAT-1 mRNA expression has been detected in colon tumors, and thus, altered CONAT-1 expression may be involved in the regulation of gene expression associated with cell growth, differentiation, migration, and apoptosis in the colon and may result in perturbed cellular proliferation, which in turn can lead to cellular proliferative and/or differentiative disorders in colon tissues. As used herein, a "cellular proliferative disorder" includes a disorder, disease, or condition characterized by a deregulated, e.g., upregulated or downregulated, growth response. As used herein, a "cellular differentiative disorder" includes a disorder, disease, or condition characterized by aberrant cellular differentiation. Disorders involving the colon include, but are not limited to, congenital anomalies, such as atresia and stenosis, Meckel diverticulum, congenital aganglionic megacolon-Hirschsprang disease; enterocolitis, such as diarrhea and dysentery, infectious enterocolitis, including viral gastroenteritis, bacterial enterocolitis, necrotizing enterocolitis, antibiotic-associated colitis (pseudomembranous colitis), and collagenous and lymphocytic colitis, miscellaneous intestinal inflammatory disorders, including parasites and protozoa, acquired immunodeficiency syndrome, transplantation, drug-induced intestinal injury, radiation enterocolitis, neutropenic colitis (typhlitis), and diversion colitis; idiopathic inflammatory bowel disease, such as Crohn disease and ulcerative colitis; tumors of the colon, such as non-neoplastic polyps, adenomas, familial syndromes, colorectal carcinogenesis, colorectal carcinoma, and carcinoid tumors. Moreover, the CONAT-1 molecules may act as novel diagnostic targets and therapeutic agents for controlling a wide variety of cellular proliferative and/or differentiative disorders including but not limited to cancer, e.g., carcinoma, sarcoma, or leukemia, tumor angiogenesis and metastasis, and skeletal dysplasia; neurodegenerative disorders, e.g., Alzheimer's disease, dementias related to Alzheimer's disease (such as Pick's disease), Parkinson's and other Lewy diffuse body diseases, multiple sclerosis, amyotrophic lateral sclerosis, progressive supranuclear palsy, epilepsy, Creutzfeldt- Jakob disease, or AIDS related dementia; ischemic disease (e.g., arteriosclerosis); and chronic inflammatory diseases (e.g., rheumatoid arthritis).
Various aspects of the invention are described in further detail' in the following subsections:
I. Isolated Nucleic Acid Molecules
One aspect of the invention pertains to isolated nucleic acid molecules that encode CONAT-1 proteins or biologically active portions thereof, as well as nucleic acid fragments sufficient for use as hybridization probes to identify CONAT-1 -encoding nucleic acid molecules (e.g., CONAT-1 mRNA) and fragments for use as PCR primers for the amplification or mutation of CONAT-1 nucleic acid molecules. As used herein, the term "nucleic acid molecule" is intended to include DNA molecules (e.g., cDNA or genomic DNA) and RNA molecules (e.g., mRNA) and analogs of the DNA or RNA generated using nucleotide analogs. The nucleic acid molecule can be single-stranded or double-stranded, but preferably is double-stranded DNA. The term "isolated nucleic acid molecule" includes nucleic acid molecules which are separated from other nucleic acid molecules which are present in the natural source of the nucleic acid. For example, with regards to genomic DNA, the term "isolated" includes nucleic acid molecules which are separated from the chromosome with which the genomic DNA is naturally associated. Preferably, an "isolated" nucleic acid is free of sequences which naturally flank the nucleic acid (i. e. , sequences located at the 5' and 3' ends of the nucleic acid) in the genomic DNA of the organism from which the nucleic acid is derived. For example, in various embodiments, the isolated CONAT-1 nucleic acid molecule can contain less than about 5 kb, 4kb, 3kb, 2kb, 1 kb, 0.5 kb or 0.1 kb of nucleotide sequences which naturally flank the nucleic acid molecule in genomic DNA of the cell from which the nucleic acid is derived. Moreover, an "isolated" nucleic acid molecule, such as a cDNA molecule, can be substantially free of other cellular material, or culture medium when produced by recombinant techniques, or substantially free of chemical precursors or other chemicals when chemically synthesized.
A nucleic acid molecule of the present invention, e.g., a nucleic acid molecule having the nucleotide sequence of SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number , or a portion thereof, can be isolated using standard molecular biology techniques and the sequence information provided herein. Using all or a portion of the nucleic acid sequence of SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number , as hybridization probes,
CONAT-1 nucleic acid molecules can be isolated using standard hybridization and cloning techniques (e.g., as described in Sambrook, J., Fritsh, E. F., and Maniatis, T. Molecular Cloning: A Laboratory Manual. 2nd, ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989).
Moreover, a nucleic acid molecule encompassing all or a portion of SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number can be isolated by the polymerase chain reaction (PCR) using synthetic oligonucleotide primers designed based upon the sequence of SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number .
A nucleic acid of the invention can be amplified using cDNA, mRNA or alternatively, genomic DNA, as a template and appropriate oligonucleotide primers according to standard PCR amplification techniques. The nucleic acid so amplified can be cloned into an appropriate vector and characterized by DNA sequence analysis. Furthermore, oligonucleotides corresponding to CONAT-1 nucleotide sequences can be prepared by standard synthetic techniques, e.g., using an automated DNA synthesizer. In one embodiment, an isolated nucleic acid molecule of the invention comprises the nucleotide sequence shown in SEQ ID NO: 1. The sequence of SEQ ID NO: 1 corresponds to human CONAT-1 cDNA referred to herein as "26320". This cDNA comprises the coding region sequences of CONAT-1 (e.g., from nucleotides 390-806 of SEQ ID NO:l or, alternatively, from nucleotides 3-806 of SEQ ID NO:l), as well as 3' untranslated sequences (e.g., nucleotides 807-1591 of SEQ ID NO:l), and 5' untranslated regions (e.g., nucleotides 1-389 of SEQ ID NO:l). Alternatively, the nucleic acid molecule can comprise only the coding region sequences of SEQ ID NO: 1 (e.g., nucleotides 390-806, corresponding to SEQ ID NO:3, and nucleotides 3-806, corresponding to SEQ ID NO: 5). In yet another embodiment, the nucleic acid molecule consists of the nucleotide sequence set forth as SEQ ID NO:l or SEQ ID NO:5.
In still another embodiment, an isolated nucleic acid molecule of the invention comprises a nucleic acid molecule which is a complement of the nucleotide sequence shown in SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number , or a portion of any of these nucleotide sequences. A nucleic acid molecule which is complementary to the nucleotide sequence shown in SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number , is one which is sufficiently complementary to the nucleotide sequence shown in SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with
ATCC as Accession Number , such that it can hybridize to the nucleotide sequence shown in SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number , thereby forming a stable duplex.
In still another embodiment, an isolated nucleic acid molecule of the present invention comprises a nucleotide sequence which is at least about 75%, 80%>, 85%, 90%), 95%», 99.0% or more identical to the nucleotide sequence shown in SEQ ID NO:l, 3 or 5 (e.g. , to the entire length of the nucleotide sequence), or to the nucleotide sequence (e.g., the entire length of the nucleotide sequence) of the DNA insert of the plasmid deposited with ATCC as Accession Number , or a portion or complement of any of these nucleotide sequences. In one embodiment, a nucleic acid molecule of the present invention comprises a nucleotide sequence which is at least (or no greater than) 50-100, 100-250, 250-500, 500-750, 750-1000, 1000-1250, 1250-1500, or 1500 or more nucleotides in length and hybridizes under stringent hybridization conditions to a complement of a nucleic acid molecule of SEQ ID NO: 1 , 3 or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number
Moreover, the nucleic acid molecule of the invention can comprise only a portion of the nucleic acid sequence of SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number , for example, a fragment which can be used as a probe or primer or a fragment encoding a portion of a CONAT-1 protein, e.g., a biologically active portion of a CONAT-1 protein. The nucleotide sequence determined from the cloning of the CONAT-1 gene allows for the generation of probes and primers designed for use in identifying and/or cloning other CONAT-1 family members, as well as CONAT-1 homologues from other species. The probe/primer (e.g., oligonucleotide) typically comprises substantially purified oligonucleotide. The oligonucleotide typically comprises a region of nucleotide sequence that hybridizes under stringent conditions to at least about 12 or 15, preferably about 20 or 25, more preferably about 30, 35, 40, 45, 50, 55, 60, 65, or 75 consecutive nucleotides of a sense sequence of SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number , of an anti-sense sequence of SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number , or of a naturally occurring allelic variant or mutant of SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number
Exemplary probes or primers are at least (or no greater than) 12 or 15, 20 or 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75 or more nucleotides in length and/or comprise consecutive nucleotides of an isolated nucleic acid molecule described herein. Also included within the scope of the present invention are probes or primers comprising contiguous or consecutive nucleoitdes of an isolated nucleic acid molecule described herein, but for the difference of 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 bases within the probe or primer sequence. Probes based on the CONAT-1 nucleotide sequences can be used to detect (e.g., specifically detect) transcripts or genomic sequences encoding the same or homologous proteins. In preferred embodiments, the probe further comprises a label group attached thereto, e.g., the label group can be a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor. In another embodiment a set of primers is provided, e.g., primers suitable for use in a PCR, which can be used to amplify a selected region of a CONAT-1 sequence, e.g., a domain, region, site or other sequence described herein. The primers should be at least 5, 10, or 50 base pairs in length and less than 100, or less than 200, base pairs in length. The primers should be identical, or differs by no greater than 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 bases when compared to a sequence disclosed herein or to the sequence of a naturally occurring variant. Such probes can be used as a part of a diagnostic test kit for identifying cells or tissue which misexpress a CONAT-1 protein, such as by measuring a level of a CONAT-1 -encoding nucleic acid in a sample of cells from a subject e.g., detecting CONAT-1 mRNA levels or determining whether a genomic CONAT-1 gene has been mutated or deleted.
A nucleic acid fragment encoding a "biologically active portion of a CONAT-1 protein" can be prepared by isolating a portion of the nucleotide sequence of SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number , which encodes a polypeptide having a CONAT-1 biological activity (the biological activities of the CONAT-1 proteins are described herein), expressing the encoded portion of the CONAT-1 protein (e.g., by recombinant expression in vitro) and assessing the activity of the encoded portion of the CONAT-1 protein. In an exemplary embodiment, the nucleic acid molecule is at least 50-100, 100-250, 250-500, 500-700, 750-1000, 1000-1250, 1250-1500, 1500 or more nucleotides in length and encodes a protein having a CONAT-1 activity (as described herein).
The invention further encompasses nucleic acid molecules that differ from the nucleotide sequence shown in SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number , due to degeneracy of the genetic code and thus encode the same CONAT-1 proteins as those encoded by the nucleotide sequence shown in SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number . In another embodiment, an isolated nucleic acid molecule of the invention has a nucleotide sequence encoding a protein having an amino acid sequence which differs by at least 1 , but no greater than 5, 10, 20, 50 or 100 amino acid residues from the amino acid sequence shown in SEQ ID NO:2 or 4, or the amino acid sequence encoded by the DNA insert of the plasmid deposited with the ATCC as Accession Number . In yet another embodiment, the nucleic acid molecule encodes the amino acid sequence of human CONAT-1. If an alignment is needed for this comparison, the sequences should be aligned for maximum homology.
Nucleic acid variants can be naturally occurring, such as allelic variants (same locus), homologues (different locus), and orthologues (different organism) or can be non naturally occurring. Non-naturally occurring variants can be made by mutagenesis techniques, including those applied to polynucleotides, cells, or organisms. The variants can contain nucleotide substitutions, deletions, inversions and insertions. Variation can occur in either or both the coding and non-coding regions. The variations can produce both conservative and non-conservative amino acid substitutions (as compared in the encoded product).
Allelic variants result, for example, from DNA sequence polymoφhisms within a population (e.g., the human population) that lead to changes in the amino acid sequences of the CONAT-1 proteins. Such genetic polymoφhism in the CONAT-1 genes may exist among individuals within a population due to natural allelic variation. As used herein, the terms "gene" and "recombinant gene" refer to nucleic acid molecules which include an open reading frame encoding a CONAT-1 protein, preferably a mammalian CONAT-1 protein, and can further include non-coding regulatory sequences, and introns. Accordingly, in one embodiment, the invention features isolated nucleic acid molecules which encode a naturally occurring allelic variant of a polypeptide comprising the amino acid sequence of SEQ ID NO:2 or 4, or an amino acid sequence encoded by the DNA insert of the plasmid deposited with ATCC as Accession Number , wherein the nucleic acid molecule hybridizes to a complement of a nucleic acid molecule comprising SEQ ID NO:l, 3 or 5, for example, under stringent hybridization conditions.
Allelic variants of CONAT-1, e.g., human CONAT-1 include both functional and non-functional CONAT-1 proteins. Functional allelic variants are naturally occurring amino acid sequence variants of the CONAT-1 protein that maintain the ability to bind a CONAT-1 substrate or ligand, acetylate a CONAT-1 substrate, and/or modulate cellular gene expression. Functional allelic variants will typically contain only conservative substitution of one or more amino acids of SEQ ID NO:2 or 4, or substitution, deletion or insertion of non-critical residues in non-critical regions of the protein.
Non-functional allelic variants are naturally occurring amino acid sequence variants of the CONAT-1 protein, e.g., human CONAT-1, that do not have the ability to either bind a CONAT-1 substrate or ligand, acetylate a CONAT-1 substrate, or modulate cellular gene expression. Non-functional allelic variants will typically contain a non- conservative substitution, a deletion, or insertion, or premature truncation of the amino acid sequence of SEQ ID NO:2 or 4, or a substitution, insertion, or deletion in critical residues or critical regions of the protein. The present invention further provides non-human orthologues (e.g. , non-human orthologues of the human CONAT-1 protein). Orthologues of the human CONAT-1 protein are proteins that are isolated from non-human organisms and possess the same CONAT-1 substrate or ligand binding mechanisms, acetyltransferase activity, and/or modulation of cellular gene expression mechanisms of the human CONAT-1 protein. Orthologues of the human CONAT-1 protein can readily be identified as comprising an amino acid sequence that is substantially homologous to SEQ ID NO:2 or 4.
Moreover, nucleic acid molecules encoding other CONAT-1 family members and, thus, which have a nucleotide sequence which differs from the CONAT-1 sequences of SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number are intended to be within the scope of the invention. For example, another CONAT-1 cDNA can be identified based on the nucleotide sequence of human CONAT-1. Moreover, nucleic acid molecules encoding CONAT-1 proteins from different species, and which, thus, have a nucleotide sequence which differs from the CONAT-1 sequences of SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as
Accession Number are intended to be within the scope of the invention. For example, a mouse or monkey CONAT-1 cDNA can be identified based on the nucleotide sequence of a human CONAT-1.
Nucleic acid molecules corresponding to natural allelic variants and homologues of the CONAT-1 cDNAs of the invention can be isolated based on their homology to the CONAT-1 nucleic acids disclosed herein using the cDNAs disclosed herein, or a portion thereof, as a hybridization probe according to standard hybridization techniques under stringent hybridization conditions. Nucleic acid molecules corresponding to natural allelic variants and homologues of the CONAT-1 cDNAs of the invention can further be isolated by mapping to the same chromosome or locus as the CONAT-1 gene.
Orthologues, homologues and allelic variants can be identified using methods known in the art (e.g. , by hybridization to an isolated nucleic acid molecule of the present invention, for example, under stringent hybridization conditions). In one embodiment, an isolated nucleic acid molecule of the invention is at least 15, 20, 25, 30 or more nucleotides in length and hybridizes under stringent conditions to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as
Accession Number . In other embodiment, the nucleic acid is at least 30, 50, 100,
150, 200, 250, 253, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 900, 1000, 1100, 1200, 1300, 1400 or 1500 nucleotides in length.
As used herein, the term "hybridizes under stringent conditions" is intended to describe conditions for hybridization and washing under which nucleotide sequences that are significantly identical or homologous to each other remain hybridized to each other. Preferably, the conditions are such that sequences at least about 70%>, more preferably at least about 80%, even more preferably at least about 85% or 90% identical to each other remain hybridized to each other. Such stringent conditions are known to those skilled in the art and can be found in Current Protocols in Molecular Biology, Ausubel et al, eds., John Wiley & Sons, Inc. (1995), sections 2, 4 and 6. Additional stringent conditions can be found in Molecular Cloning: A Laboratory Manual, Sambrook et al, Cold Spring Harbor Press, Cold Spring Harbor, NY (1989), chapters 7, 9 and 11. A preferred, non-limiting example of stringent hybridization conditions includes hybridization in 4X sodium chloride/sodium citrate (SSC), at about 65-70°C (or alternatively hybridization in 4X SSC plus 50% formamide at about 42-50°C) followed by one or more washes in IX SSC, at about 65-70°C. A preferred, non-limiting example of highly stringent hybridization conditions includes hybridization in IX SSC, at about 65-70°C (or alternatively hybridization in IX SSC plus 50% formamide at about 42-50° C) followed by one or more washes in 0.3X SSC, at about 65-70°C. A preferred, non- limiting example of reduced stringency hybridization conditions includes hybridization in 4X SSC, at about 50-60°C (or alternatively hybridization in 6X SSC plus 50% formamide at about 40-45°C) followed by one or more washes in 2X SSC, at about 50- 60°C. Ranges intermediate to the above-recited values, e.g., at 65-70°C or at 42-50°C are also intended to be encompassed by the present invention. SSPE (lxSSPE is 0.15M NaCl, lOmM NaH2PO4, and 1.25mM EDTA, pH 7.4) can be substituted for SSC (lxSSC is 0.15M NaCl and 15mM sodium citrate) in the hybridization and wash buffers; washes are performed for 15 minutes each after hybridization is complete. The hybridization temperature for hybrids anticipated to be less than 50 base pairs in length should be 5- 10°C less than the melting temperature (Tm) of the hybrid, where Tm is determined according to the following equations. For hybrids less than 18 base pairs in length, Tm(°C) = 2(# of A + T bases) + 4(# of G + C bases). For hybrids between 18 and 49 base pairs in length, Tm(°C) = 81.5 + 16.6(log10[Na+]) + 0.41(%G+C) - (600/N), where N is the number of bases in the hybrid, and [Na+] is the concentration of sodium ions in the hybridization buffer ([Na+] for lxSSC = 0.165 M). It will also be recognized by the skilled practitioner that additional reagents may be added to hybridization and/or wash buffers to decrease non-specific hybridization of nucleic acid molecules to membranes, for example, nitrocellulose or nylon membranes, including but not limited to blocking agents (e.g., BSA or salmon or herring sperm carrier DNA), detergents (e.g., SDS), chelating agents (e.g., EDTA), FicoU, PVP and the like. When using nylon membranes, in particular, an additional preferred, non-limiting example of stringent hybridization conditions is hybridization in 0.25-0.5M NaH2PO4, 7%> SDS at about 65°C, followed by one or more washes at 0.02M NaH2PO4, 1% SDS at 65°C, see e.g., Church and Gilbert (1984) Proc. Natl. Acad. Sci. USA 81:1991-1995, (or alternatively 0.2X SSC, 1% SDS).
Preferably, an isolated nucleic acid molecule of the invention that hybridizes under stringent conditions to the sequence of SEQ ID NO:l, 3, or 5 corresponds to a naturally-occurring nucleic acid molecule. As used herein, a "naturally-occurring" nucleic acid molecule refers to an RNA or DNA molecule having a nucleotide sequence that occurs in nature (e.g., encodes a natural protein).
In addition to naturally-occurring allelic variants of the CONAT-1 sequences that may exist in the population, the skilled artisan will further appreciate that changes can be introduced by mutation into the nucleotide sequences of SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number , thereby leading to changes in the amino acid sequence of the encoded CONAT-1 proteins, without altering the functional ability of the CONAT-1 proteins. For example, nucleotide substitutions leading to amino acid substitutions at "non-essential" amino acid residues can be made in the sequence of SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number . A "non-essential" amino acid residue is a residue that can be altered from the wild-type sequence of CONAT-1 (e.g., the sequence of SEQ ID NO:2 or 4) without altering the biological activity, whereas an "essential" amino acid residue is required for biological activity. For example, amino acid residues that are conserved among the CONAT-1 proteins of the present invention, e.g., those present in acetyltransferase domain, are predicted to be particularly unamenable to alteration. Furthermore, additional amino acid residues that are conserved between the CONAT-1 proteins of the present invention and other members of the acetyltransferase family are not likely to be amenable to alteration.
Accordingly, another aspect of the invention pertains to nucleic acid molecules encoding CONAT-1 proteins that contain changes in amino acid residues that are not essential for activity. Such CONAT-1 proteins differ in amino acid sequence from SEQ ID NO:2 or 4, yet retain biological activity. In one embodiment, the isolated nucleic acid molecule comprises a nucleotide sequence encoding a protein, wherein the protein comprises an amino acid sequence at least about 75%, 80%, 85%, 90%o, 95%, 98% or more homologous to SEQ ID NO:2 or 4, e.g., to the entire length of SEQ ID NO:2 or 4.
An isolated nucleic acid molecule encoding a CONAT-1 protein homologous to the protein of SEQ ID NO:2 or 4 can be created by introducing one or more nucleotide substitutions, additions or deletions into the nucleotide sequence of SEQ ID NO:l, 3, or
5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number , such that one or more amino acid substitutions, additions or deletions are introduced into the encoded protein. Mutations can be introduced into SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number by standard techniques, such as site- directed mutagenesis and PCR-mediated mutagenesis. Preferably, conservative amino acid substitutions are made at one or more predicted non-essential amino acid residues. A "conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g. , alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, a predicted nonessential amino acid residue in a CONAT-1 protein is preferably replaced with another amino acid residue from the same side chain family. Alternatively, in another embodiment, mutations can be introduced randomly along all or part of a CONAT-1 coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for CONAT-1 biological activity to identify mutants that retain activity. Following mutagenesis of SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number , the encoded protein can be expressed recombinantly and the activity of the protein can be determined.
In a preferred embodiment, a mutant CONAT-1 protein can be assayed for the ability to (1) interact with a non-CONAT-1 protein molecule, e.g., a CONAT-1 substrate or ligand; (2) to acetylate a CONAT-1 substrate; (3) to regulate cellular gene transcription; (4) to activate a CONAT-1 -dependent signal transduction pathway; (5) to modulate cell proliferation, differentiation, and/or migration mechanisms.
In addition to the nucleic acid molecules encoding CONAT-1 proteins described above, another aspect of the invention pertains to isolated nucleic acid molecules which are antisense thereto. In an exemplary embodiment, the invention provides an isolated nucleic acid molecule which is antisense to a CONAT-1 nucleic acid molecule (e.g., is antisense to the coding strand of a CONAT-1 nucleic acid molecule). An "antisense" nucleic acid comprises a nucleotide sequence which is complementary to a "sense" nucleic acid encoding a protein, e.g., complementary to the coding strand of a double- stranded cDNA molecule or complementary to an mRNA sequence. Accordingly, an antisense nucleic acid can hydrogen bond to a sense nucleic acid. The antisense nucleic acid can be complementary to an entire CONAT-1 coding strand, or to only a portion thereof. In one embodiment, an antisense nucleic acid molecule is antisense to "coding region sequences" of the coding strand of a nucleotide sequence encoding CONAT-1. The term "coding region sequences" refers to the region of the nucleotide sequence comprising codons which are translated into amino acid residues (e.g., the coding region sequences of human CONAT-1 corresponding to SEQ ID NO:3 or SEQ ID NO:5). In another embodiment, the antisense nucleic acid molecule is antisense to a "noncoding region" of the coding strand of a nucleotide sequence encoding CONAT-1 (e.g., the 5' and/or 3' sequences which flank the coding region sequences that are not translated into amino acids (i.e., also referred to as 5' and 3' untranslated regions)).
Given the coding strand sequences encoding CONAT-1 disclosed herein (e.g., SEQ ID NO:3 or 5), antisense nucleic acids of the invention can be designed according to the rules of Watson and Crick base pairing. The antisense nucleic acid molecule can be complementary to coding region sequences of CONAT-1 mRNA, but more preferably is an oligonucleotide which is antisense to only a portion of the CONAT-1 mRNA. An antisense oligonucleotide can be, for example, about 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, or more nucleotides in length. An antisense nucleic acid of the invention can be constracted using chemical synthesis and enzymatic ligation reactions using procedures known in the art. For example, an antisense nucleic acid (e.g., an antisense oligonucleotide) can be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed between the antisense and sense nucleic acids, e.g., phosphorothioate derivatives and acridine substituted nucleotides can be used. Examples of modified nucleotides which can be used to generate the antisense nucleic acid include 5-fluorouracil, 5- bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xantine, 4-acetylcytosine, 5- (carboxyhydroxylmethyl) uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5- carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2- methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7- methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta- D-mannosylqueosine, 5'-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio- N6-isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5- methyluracil, uracil-5- oxyacetic acid methylester, uracil-5-oxyacetic acid (v), 5-methyl- 2-thiouracil, 3-(3-amino-3-N-2-carboxypropyl) uracil, (acp3)w, and 2,6-diaminopurine. Alternatively, the antisense nucleic acid can be produced biologically using an expression vector into which a nucleic acid has been subcloned in an antisense orientation (i.e., RNA transcribed from the inserted nucleic acid will be of an antisense orientation to a target nucleic acid of interest, described further in the following subsection).
The antisense nucleic acid molecules of the invention are typically administered to a subject or generated in situ such that they hybridize with or bind to cellular mRNA and/or genomic DNA encoding a CONAT-1 protein to thereby inhibit expression of the protein, e.g. , by inhibiting transcription and/or translation. The hybridization can be by conventional nucleotide complementarity to form a stable duplex, or, for example, in the case of an antisense nucleic acid molecule which binds to DNA duplexes, through specific interactions in the major groove of the double helix. An example of a route of administration of antisense nucleic acid molecules of the invention include direct injection at a tissue site. Alternatively, antisense nucleic acid molecules can be modified to target selected cells and then administered systemically. For example, for systemic administration, antisense molecules can be modified such that they specifically bind to receptors or antigens expressed on a selected cell surface, e.g., by linking the antisense nucleic acid molecules to peptides or antibodies which bind to cell surface receptors or antigens. The antisense nucleic acid molecules can also be delivered to cells using the vectors described herein. To achieve sufficient intracellular concentrations of the antisense molecules, vector constructs in which the antisense nucleic acid molecule is placed under the control of a strong pol II or pol III promoter are preferred. In yet another embodiment, the antisense nucleic acid molecule of the invention is an α-anomeric nucleic acid molecule. An α-anomeric nucleic acid molecule forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual β-units, the strands run parallel to each other (Gaultier et al. (1987) Nucleic Acids. Res. 15:6625-6641). The antisense nucleic acid molecule can also comprise a 2'-o- methylribonucleotide (Inoue et al. (1987) Nucleic Acids Res. 15:6131-6148) or a chimeric RNA-DNA analogue (Inoue et al. (1987) FEBSLett. 215:327-330). In still another embodiment, an antisense nucleic acid of the invention is a ribozyme. Ribozymes are catalytic RNA molecules with ribonuclease activity which are capable of cleaving a single-stranded nucleic acid, such as an mRNA, to which they have a complementary region. Thus, ribozymes (e.g., hammerhead ribozymes (described in Haselhoff and Gerlach (1988) Nature 334:585-591)) can be used to catalytically cleave CONAT-1 mRNA transcripts to thereby inhibit translation of CONAT-1 mRNA. A ribozyme having specificity for a CONAT-1 -encoding nucleic acid can be designed based upon the nucleotide sequence of a CONAT-1 cDNA disclosed herein (i.e., SEQ ID NO:l, 3, or 5, or the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number ). For example, a derivative of a Tetrahymena L-19 IVS RNA can be constracted in which the nucleotide sequence of the active site is complementary to the nucleotide sequence to be cleaved in a CONAT-1 -encoding mRNA. See, e.g., Cech et al. U.S. Patent No. 4,987,071; and Cech et al. U.S. Patent No. 5,116,742. Alternatively, CONAT-1 mRNA can be used to 'select a catalytic RNA having a specific ribonuclease activity from a pool of RNA molecules. See, e.g., Bartel, D. and Szostak, J.W. (1993) Science 261 :1411- 1418.
Alternatively, CONAT-1 gene expression can be inhibited by targeting nucleotide sequences complementary to the regulatory region of the CONAT-1 (e.g., the CONAT-1 promoter and/or enhancers) to form triple helical structures that prevent transcription of the CONAT-1 gene in target cells. See generally, Helene, C. (1991) Anticancer Drug Des. 6(6):569-84; Helene, C. et al. (1992) Ann. NY. Acad. Sci. 660:21- 36; and Maher, L.J. (1992) Bioassays 14(12):807-15.
In yet another embodiment, the CONAT-1 nucleic acid molecules of the present invention can be modified at the base moiety, sugar moiety or phosphate backbone to improve, e.g., the stability, hybridization, or solubility of the molecule. For example, the deoxyribose phosphate backbone of the nucleic acid molecules can be modified to generate peptide nucleic acids (see Hyrup B. et al. (1996) Bioorganic & Medicinal Chemistry 4 (1): 5-23). As used herein, the terms "peptide nucleic acids" or "PNAs" refer to nucleic acid mimics, e.g. , DNA mimics, in which the deoxyribose phosphate backbone is replaced by a pseudopeptide backbone and only the four natural nucleobases are retained. The neutral backbone of PNAs has been shown to allow for specific hybridization to DNA and RNA under conditions of low ionic strength. The synthesis of PNA oligomers can be performed using standard solid phase peptide synthesis protocols as described in Hyrup B. et al. (1996) supra; Perry-O'Keefe et al. Proc. Natl. Acad. Sci. 93: 14670-675. PNAs of CONAT-1 nucleic acid molecules can be used in therapeutic and diagnostic applications. For example, PNAs can be used as antisense or antigene agents for sequence-specific modulation of gene expression by, for example, inducing transcription or translation arrest or inhibiting replication. PNAs of CONAT-1 nucleic acid molecules can also be used in the analysis of single base pair mutations in a gene, (e.g. , by PNA-directed PCR clamping); as 'artificial restriction enzymes' when used in combination with other enzymes, (e.g., SI nucleases (Hyrup B. (1996) supra)); or as probes or primers for DNA sequencing or hybridization (Hyrup B. et al. (1996) supra; Perry-O'Keefe supra).
In another embodiment, PNAs of CONAT-1 can be modified, (e.g., to enhance their stability or cellular uptake), by attaching lipophilic or other helper groups to PNA, by the formation of PNA-DNA chimeras, or by the use of liposomes or other techniques of drug delivery known in the art. For example, PNA-DNA chimeras of CONAT-1 nucleic acid molecules can be generated which may combine the advantageous properties of PNA and DNA. Such chimeras allow DNA recognition enzymes, (e.g., RNase H and DNA polymerases), to interact with the DNA portion while the PNA portion would provide high binding affinity and specificity. PNA-DNA chimeras can be linked using linkers of appropriate lengths selected in terms of base stacking, number of bonds between the nucleobases, and orientation (Hyrup B. (1996) supra). The synthesis of PNA-DNA chimeras can be performed as described in Hyrup B. (1996) supra and Finn P.J. et al. (1996) Nucleic Acids Res. 24 (17): 3357-63. For example, a DNA chain can be synthesized on a solid support using standard phosphoramidite coupling chemistry and modified nucleoside analogs, e.g., 5'-(4-methoxytrityl)amino-5'-deoxy- thymidine phosphoramidite, can be used as a between the PNA and the 5' end of DNA (Mag, M. et al. (1989) Nucleic Acid Res. 17: 5973-88). PNA monomers are then coupled in a stepwise manner to produce a chimeric molecule with a 5' PNA segment and a 3' DNA segment (Finn P.J. et al. (1996) supra). Alternatively, chimeric molecules can be synthesized with a 5' DNA segment and a 3' PNA segment (Peterser, K.H. et al. (1975) Bioorganic Med. Chem. Lett. 5: 1119-11124).
In other embodiments, the oligonucleotide may include other appended groups such as peptides (e.g., for targeting host cell receptors in vivo), or agents facilitating transport across the cell membrane (see, e.g., Letsinger et al. (1989) Proc. Natl. Acad. Sci. USA 86:6553-6556; Lemaitre et al. (1987) Proc. Natl. Acad. Sci. USA 84:648-652; PCT Publication No. W088/09810) or the blood-brain barrier (see, e.g., PCT Publication No. W089/10134). In addition, oligonucleotides can be modified with hybridization- triggered cleavage agents (See, e.g., Krol et al. (1988) Bio-Techniques 6:958-976) or intercalating agents. (See, e.g., Zon (1988) Pharm. Res. 5:539-549). To this end, the oligonucleotide may be conjugated to another molecule, (e.g., a peptide, hybridization triggered cross-linking agent, transport agent, or hybridization-triggered cleavage agent).
II. Isolated CONAT-1 Proteins and Anti-CONAT-1 Antibodies One aspect of the invention pertains to isolated or recombinant CONAT-1 proteins and polypeptides, and biologically active portions thereof, as well as polypeptide fragments suitable for use as immunogens to raise anti-CO AT-1 antibodies. In one embodiment, native CONAT-1 proteins can be isolated from cells or tissue sources by an appropriate purification scheme using standard protein purification techniques. In another embodiment, CONAT-1 proteins are produced by recombinant DNA techniques. Alternative to recombinant expression, a CONAT-1 protein or polypeptide can be synthesized chemically using standard peptide synthesis techniques.
An "isolated" or "purified" protein or biologically active portion thereof is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the CONAT-1 protein is derived, or substantially free from chemical precursors or other chemicals when chemically synthesized. The language "substantially free of cellular material" includes preparations of CONAT-1 protein in which the protein is separated from cellular components of the cells from which it is isolated or recombinantly produced. In one embodiment, the language "substantially free of cellular material" includes preparations of CONAT-1 protein having less than about 30% (by dry weight) of non-CONAT-1 protein (also referred to herein as a "contaminating protein"), more preferably less than about 20% of non-CONAT-1 protein, still more preferably less than about 10% of non-CONAT-1 protein, and most preferably less than about 5% non-CONAT-1 protein. When the CONAT-1 protein or biologically active portion thereof is recombinantly produced, it is also preferably substantially free of culture medium, i.e., culture medium represents less than about 20%, more preferably less than about 10%), and most preferably less than about 5%> of the volume of the protein preparation.
The language "substantially free of chemical precursors or other chemicals" includes preparations of CONAT-1 protein in which the protein is separated from chemical precursors or other chemicals which are involved in the synthesis of the protein. In one embodiment, the language "substantially free of chemical precursors or other chemicals" includes preparations of CONAT-1 protein having less than about 30%> (by dry weight) of chemical precursors or non-CONAT-1 chemicals, more preferably less than about 20% chemical precursors or non-CONAT-1 chemicals, still more preferably less than about 10% chemical precursors or non-CONAT-1 chemicals, and most preferably less than about 5% chemical precursors or non-CONAT-1 chemicals.
As used herein, a "biologically active portion" of a CONAT-1 protein includes a fragment of a CONAT-1 protein which participates in an interaction between a CONAT-1 molecule and a non-CONAT-1 molecule (e.g., a CONAT-1 substrate). Biologically active portions of a CONAT-1 protein include peptides comprising amino acid sequences sufficiently homologous to or derived from the CONAT-1 amino acid sequences, e.g. , the amino acid sequences shown in SEQ ID NO:2 or 4, which include sufficient amino acid residues to exhibit at least one activity of a CONAT-1 protein. Typically, biologically active portions comprise a domain or motif with at least one activity of the CONAT-1 protein, e.g., acetyltransferase activity, modulating gene expression, and/or modulating cell growth and differentiation mechanisms. A biologically active portion of a CONAT-1 protein can be a polypeptide which is, for example, 10, 25, 50, 100, 200 or more amino acids in length. Biologically active portions of a CONAT-1 protein can be used as targets for developing agents which modulate a CONAT-1 mediated activity, e.g., cellular gene expression, or a cell growth or differentiation mechanism. In one embodiment, a biologically active portion of a CONAT-1 protein comprises at least one acetyltransferase domain. Moreover, other biologically active portions, in which other regions of the protein are deleted, can be prepared by recombinant techniques and evaluated for one or more of the functional activities of a native CONAT-1 protein.
Another aspect of the invention features fragments of the protein having the amino acid sequence of SEQ ID NO:2 or 4, for example, for use as immunogens. In one embodiment, a fragment comprises at least 5 amino acids (e.g., contiguous or consecutive amino acids) of the amino acid sequence of SEQ ID NO:2 or 4, or an amino acid sequence encoded by the DNA insert of the plasmid deposited with the ATCC as
Accession Number . In another embodiment, a fragment comprises at least 10, 15,
20, 25, 30, 35, 40, 45, 50 or more amino acids (e.g., contiguous or consecutive amino acids) of the amino acid sequence of SEQ ID NO:2 or 4, or an amino acid sequence encoded by the DNA insert of the plasmid deposited with the ATCC as Accession Number .
In a preferred embodiment, a CONAT-1 protein has an amino acid sequence shown in SEQ ID NO:2 or 4. In other embodiments, the CONAT-1 protein is substantially homologous to SEQ ID NO:2 or 4, and retains the functional activity of the protein of SEQ ID NO: 2 or 4, yet differs in amino acid sequence due to natural allelic variation or mutagenesis, as described in detail in subsection I above. In another embodiment, the CONAT-1 protein is a protein which comprises an amino acid sequence at least about 75%, 80%, 85%, 90%, 95%, 98% or more homologous to SEQ ID NO:2 or 4.
In another embodiment, the invention features a CONAT-1 protein which is encoded by a nucleic acid molecule consisting of a nucleotide sequence at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identical to a nucleotide sequence of SEQ ID NO: 1 , 3 or 5, or a complement thereof. This invention further features a CONAT-1 protein which is encoded by a nucleic acid molecule consisting of a nucleotide sequence which hybridizes under stringent hybridization conditions to a complement of a nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 1 , 3 or 5, or a complement thereof. To determine the percent identity of two amino acid sequences or of two nucleic acid sequences, the sequences are aligned for optimal comparison puφoses (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). In a preferred embodiment, the length of a reference sequence aligned for comparison puφoses is at least 30%, preferably at least 40%, more preferably at least 50%, even more preferably at least 60%, and even more preferably at least 70%, 80%, or 90%> of the length of the reference sequence (e.g., when aligning a second sequence to the CONAT-1 amino acid sequence of SEQ ID NO:2 having 139 amino acid residues, at least 42, preferably at least 56, more preferably at least 70, even more preferably at least 83, and even more preferably at least 97, 111 or 125 amino acid residues are aligned; when aligning a second sequence to the CONAT-lb amino acid sequence of SEQ ID NO:4 having 268 amino acid residues, at least 80, preferably at least 107, more preferably at least 134, even more preferably at least 160, and even more preferably at least 187, 214 or 241 amino acid residues are aligned). The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein amino acid or nucleic acid "identity" is equivalent to amino acid or nucleic acid "homology"). The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. In a preferred embodiment, the percent identity between two amino acid sequences is determined using the Needleman and Wunsch (J Mol. Biol. (48):444-453 (1970)) algorithm which has been incoφorated into the GAP program in the GCG software package (available at www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6. In yet another preferred embodiment, the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at www.gcg.com), using aNWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6. A preferred, non-limiting example of parameters to be used in conjunction with the GAP program include a Blosum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
In another embodiment, the percent identity between two amino acid or nucleotide sequences is determined using the algorithm of Meyers and Miller (Comput. Appl. Biosci., 4:11-17 (1988)) which has been incoφorated into the ALIGN program (version 2.0 or version 2.U), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
The nucleic acid and protein sequences of the present invention can further be used as a "query sequence" to perform a search against public databases to, for example, identify other family members or related sequences. Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J Mol. Biol. 215:403-10. BLAST nucleotide searches can be performed with the NBLAST program, score = 100, wordlength = 12 to obtain nucleotide sequences homologous to CONAT-1 nucleic acid molecules of the invention. BLAST protein searches can be performed with the XBLAST program, score = 50, wordlength = 3 to obtain amino acid sequences homologous to CONAT-1 protein molecules of the invention. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al, (1997) Nucleic Acids Res. 25(17):3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used. See www.ncbi .nlm.nih. go v. The invention also provides CONAT-1 chimeric or fusion proteins. As used herein, a CONAT-1 "chimeric protein" or "fusion protein" comprises a CONAT-1 polypeptide operatively linked to a non-CONAT-1 polypeptide. An "CONAT-1 polypeptide" refers to a polypeptide having an amino acid sequence corresponding to CONAT-1, whereas a "non-CONAT-1 polypeptide" refers to a polypeptide having an amino acid sequence corresponding to a protein which is not substantially homologous to the CONAT-1 protein, e.g., a protein which is different from the CONAT-1 protein and which is derived from the same or a different organism. Within a CONAT-1 fusion protein the CONAT-1 polypeptide can correspond to all or a portion of a CONAT-1 protein. In a preferred embodiment, a CONAT-1 fusion protein comprises at least one biologically active portion of a CONAT-1 protein. In another preferred embodiment, a CONAT-1 fusion protein comprises at least two biologically active portions of a CONAT-1 protein. Within the fusion protein, the term "operatively linked" is intended to indicate that the CONAT-1 polypeptide and the non-CONAT-1 polypeptide are fused in-frame to each other. The non-CONAT-1 polypeptide can be fused to the N-terminus or C-terminus of the CONAT-1 polypeptide.
For example, in one embodiment, the fusion protein is a GST-CONAT-1 fusion protein in which the CONAT-1 sequences are fused to the C-terminus of the GST sequences. Such fusion proteins can facilitate the purification of recombinant CONAT- 1. In another embodiment, the fusion protein is a CONAT-1 protein containing a heterologous signal sequence at its N-terminus. In certain host cells (e.g., mammalian host cells), expression and/or secretion of CONAT-1 can be increased through use of a heterologous signal sequence.
The CONAT-1 fusion proteins of the invention can be incoφorated into pharmaceutical compositions and administered to a subject in vivo. The CONAT-1 fusion proteins can be used to affect the bioavailability of a CONAT-1 substrate. Use of CONAT-1 fusion proteins may be useful therapeutically for the treatment of disorders caused by, for example, (i) aberrant modification or mutation of a gene encoding a CONAT-1 protein; (ii) mis-regulation of the CONAT-1 gene; and (iii) aberrant post- translational modification of a CONAT-1 protein.
Moreover, the CONAT-1 -fusion proteins of the invention can be used as immunogens to produce anti-CONAT-1 antibodies in a subject, to purify CONAT-1 ligands and in screening assays to identify molecules which inhibit the interaction of CONAT-1 with a CONAT-1 substrate.
Preferably, a CONAT-1 chimeric or fusion protein of the invention is produced by standard recombinant DNA techniques. For example, DNA fragments coding for the different polypeptide sequences are ligated together in-frame in accordance with conventional techniques, for example by employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation. In another embodiment, the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers. Alternatively, PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed and reamplified to generate a chimeric gene sequence (see, for example, Current Protocols in Molecular Biology, eds. Ausubel et al. John Wiley & Sons: 1992). Moreover, many expression vectors are commercially available that already encode a fusion moiety (e.g., a GST polypeptide). A CONAT-1 - encoding nucleic acid can be cloned into such an expression vector such that the fusion moiety is linked in-frame to the CONAT-1 protein.
The present invention also pertains to variants of the CONAT-1 proteins which function as either CONAT-1 agonists (mimetics) or as CONAT-1 antagonists. Variants of the CONAT-1 proteins can be generated by mutagenesis, e.g., discrete point mutation or truncation of a CONAT-1 protein. An agonist of the CONAT-1 proteins can retain substantially the same, or a subset, of the biological activities of the naturally occurring form of a CONAT-1 protein. An antagonist of a CONAT-1 protein can inhibit one or more of the activities of the naturally occurring form of the CONAT-1 protein by, for example, competitively modulating a CONAT-1 -mediated activity of a CONAT-1 protein. Thus, specific biological effects can be elicited by treatment with a variant of limited function. In one embodiment, treatment of a subject with a variant having a subset of the biological activities of the naturally occurring form of the protein has fewer side effects in a subject relative to treatment with the naturally occurring form of the CONAT-1 protein.
In one embodiment, variants of a CONAT-1 protein which function as either CONAT-1 agonists (mimetics) or as CONAT-1 antagonists can be identified by screening combinatorial libraries of mutants, e.g., truncation mutants, of a CONAT-1 protein for CONAT-1 protein agonist or antagonist activity. In one embodiment, a variegated library of CONAT-1 variants is generated by combinatorial mutagenesis at the nucleic acid level and is encoded by a variegated gene library. A variegated library of CONAT-1 variants can be produced by, for example, enzymatically ligating a mixture of synthetic oligonucleotides into gene sequences such that a degenerate set of potential CONAT-1 sequences is expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display) containing the set of CONAT-1 sequences therein. There are a variety of methods which can be used to produce libraries of potential CONAT-1 variants from a degenerate oligonucleotide sequence. Chemical synthesis of a degenerate gene sequence can be performed in an automatic DNA synthesizer, and the synthetic gene then ligated into an appropriate expression vector. Use of a degenerate set of genes allows for the provision, in one mixture, of all of the sequences encoding the desired set of potential CONAT-1 sequences. Methods for synthesizing degenerate oligonucleotides are known in the art (see, e.g., Narang, S.A. (1983) Tetrahedron 39:3; Itakura et al. (1984) Annu. Rev. Biochem. 53:323; Itakura et al. (1984) Science 198:1056; Ike et al. (1983) Nucleic Acid Res. 11:477.
In addition, libraries of fragments of a CONAT-1 protein coding sequence can be used to generate a variegated population of CONAT-1 fragments for screening and subsequent selection of variants of a CONAT-1 protein. In one embodiment, a library of coding sequence fragments can be generated by treating a double stranded PCR fragment of a CONAT-1 coding sequence with a nuclease under conditions wherein nicking occurs only about once per molecule, denaturing the double stranded DNA, renaturing the DNA to form double stranded DNA which can include sense/antisense pairs from different nicked products, removing single stranded portions from reformed duplexes by treatment with SI nuclease, and ligating the resulting fragment library into an expression vector. By this method, an expression library can be derived which encodes N-terminal, C-terminal and internal fragments of various sizes of the CONAT-1 protein.
Several techniques are known in the art for screening gene products of combinatorial libraries made by point mutations or truncation, and for screening cDNA libraries for gene products having a selected property. Such techniques are adaptable for rapid screening of the gene libraries generated by the combinatorial mutagenesis of CONAT-1 proteins. The most widely used techniques, which are amenable to high through-put analysis, for screening large gene libraries typically include cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates isolation of the vector encoding the gene whose product was detected. Recrasive ensemble mutagenesis (REM), a new technique which enhances the frequency of functional mutants in the libraries, can be used in combination with the screening assays to identify CONAT-1 variants (Arkin and Yourvan (1992) Proc. Natl. Acad. Sci. USA §9:7811-7815; Delgrave et al. (1993) Protein Engineering 6(3):327-331).
In one embodiment, cell based assays can be exploited to analyze a variegated CONAT-1 library. For example, a library of expression vectors can be transfected into a cell line, e.g., a cardiomyocyte cell line, which ordinarily responds to CONAT-1 in a particular CONAT-1 substrate-dependent manner. The transfected cells are then contacted with CONAT-1 and the effect of the expression of the mutant on signaling by the CONAT-1 substrate can be detected, e.g., by measuring levels of gene transcription, and/or cell growth and differentiation. Plasmid DNA can then be recovered from the cells which score for inhibition, or alternatively, potentiation of signaling by the CONAT-1 substrate, and the individual clones further characterized. An isolated CONAT-1 protein, or a portion or fragment thereof, can be used as an immunogen to generate antibodies that bind CONAT-1 using standard techniques for polyclonal and monoclonal antibody preparation. A full-length CONAT-1 protein can be used or, alternatively, the invention provides antigenic peptide fragments of CONAT- 1 for use as immunogens. The antigenic peptide of CONAT-1 comprises at least 8 amino acid residues of the amino acid sequence shown in SEQ ID NO:2 and encompasses an epitope of CONAT-1 such that an antibody raised against the peptide forms a specific immune complex with CONAT-1. Preferably, the antigenic peptide comprises at least 10 amino acid residues, more preferably at least 15 amino acid residues, even more preferably at least 20 amino acid residues, and most preferably at least 30 amino acid residues.
Preferred epitopes encompassed by the antigenic peptide are regions of CONAT- 1 that are located on the surface of the protein, e.g., hydrophilic regions, as well as regions with high antigenicity (see, for example, Appendices A2 and A5).
A CONAT-1 immunogen typically is used to prepare antibodies by immunizing a suitable subject, (e.g., rabbit, goat, mouse or other mammal) with the immunogen. An appropriate immunogenic preparation can contain, for example, recombinantly expressed CONAT-1 protein or a chemically synthesized CONAT-1 polypeptide. The preparation can further include an adjuvant, such as Freund's complete or incomplete adjuvant, or similar immunostimulatory agent. Immunization of a suitable subject with an immunogenic CONAT-1 preparation induces a polyclonal anti-CONAT-1 antibody response. Accordingly, another aspect of the invention pertains to anti-CONAT-1 antibodies. The term "antibody" as used herein refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site which specifically binds (immunoreacts with) an antigen, such as CONAT-1. Examples of immunologically active portions of immunoglobulin molecules include F(ab) and F(ab')2 fragments which can be generated by treating the antibody with an enzyme such as pepsin. The invention provides polyclonal and monoclonal antibodies that bind CONAT-1. The term "monoclonal antibody" or "monoclonal antibody composition", as used herein, refers to a population of antibody molecules that contain only one species of an antigen binding site capable of immunoreacting with a particular epitope of CONAT-1. A monoclonal antibody composition thus typically displays a single binding affinity for a particular CONAT-1 protein with which it immunoreacts.
Polyclonal anti-CONAT-1 antibodies can be prepared as described above by immunizing a suitable subject with a CONAT-1 immunogen. The anti-CONAT-1 antibody titer in the immunized subject can be monitored over time by standard techniques, such as with an enzyme linked immunosorbent assay (ELISA) using immobilized CONAT-1. If desired, the antibody molecules directed against CONAT-1 can be isolated from the mammal (e.g., from the blood) and further purified by well known techniques, such as protein A chromatography to obtain the IgG fraction. At an appropriate time after immunization, e.g., when the anti-CONAT-1 antibody titers are highest, antibody-producing cells can be obtained from the subject and used to prepare monoclonal antibodies by standard techniques, such as the hybridoma technique originally described by Kohler and Milstein (1975) Nature 256:495-497) (see also, Brown et al. (1981) J Immunol. 127:539-46; Brown et al. (1980) J. Biol. Chem .255:4980-83; Yeh et al. (1976) Proc. Natl. Acad. Sci. USA 76:2927-31; and Yeh et al. (1982) Int. J. Cancer 29:269-75), the more recent human B cell hybridoma technique (Kozbor et al. (1983) Immunol Today 4:72), the EBV-hybridoma technique (Cole et al. (1985), Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96) or trioma techniques. The technology for producing monoclonal antibody hybridomas is well known (see generally R. H. Kenneth, in Monoclonal Antibodies: A New Dimension In Biological Analyses, Plenum Publishing Coφ., New York, New York (1980); E. A. Lerner (1981) Yale J. Biol. Med, 54:387-402; M. L. Gefter et al. (1977) Somatic Cell Genet. 3:231-36). Briefly, an immortal cell line (typically a myeloma) is fused to lymphocytes (typically splenocytes) from a mammal immunized with a CONAT-1 immunogen as described above, and the culture supernatants of the resulting hybridoma cells are screened to identify a hybridoma producing a monoclonal antibody that binds CONAT-1.
Any of the many well known protocols used for fusing lymphocytes and immortalized cell lines can be applied for the pmpose of generating an anti-CONAT-1 monoclonal antibody (see, e.g., G. Galfre et al. (1977) Nature 266:55052; Gefter et al. Somatic Cell Genet., cited supra; Lerner, Yale J. Biol. Med., cited supra; Kenneth, Monoclonal Antibodies, cited supra). Moreover, the ordinarily skilled worker will appreciate that there are many variations of such methods which also would be useful. Typically, the immortal cell line (e.g., a myeloma cell line) is derived from the same mammalian species as the lymphocytes. For example, murine hybridomas can be made by fusing lymphocytes from a mouse immunized with an immunogenic preparation of the present invention with an immortalized mouse cell line. Preferred immortal cell' lines are mouse myeloma cell lines that are sensitive to culture medium containing hypoxanthine, aminopterin and thymidine ("HAT medium"). Any of a number of myeloma cell lines can be used as a fusion partner according to standard techniques, e.g., the P3-NSl/l-Ag4-l, P3-x63-Ag8.653 or Sp2/O-Agl4 myeloma lines. These myeloma lines are available from ATCC. Typically, HAT-sensitive mouse myeloma cells are fused to mouse splenocytes using polyethylene glycol ("PEG"). Hybridoma cells resulting from the fusion are then selected using HAT medium, which kills unfused and unproductively fused myeloma cells (unfused splenocytes die after several days because they are not transformed). Hybridoma cells producing a monoclonal antibody of the invention are detected by screening the hybridoma culture supernatants for antibodies that bind CONAT-1, e.g., using a standard ELISA assay. Alternative to preparing monoclonal antibody-secreting hybridomas, a monoclonal anti-CONAT-1 antibody can be identified and isolated by screening a recombinant combinatorial immunoglobulin library (e.g., an antibody phage display library) with CONAT-1 to thereby isolate immunoglobulin library members that bind CONAT-1. Kits for generating and screening phage display libraries are commercially available (e.g. , the Pharmacia Recombinant Phage Antibody System, Catalog No. 27- 9400-01; and the Stratagene SurfZAP™ Phage Display Kit, Catalog No. 240612). Additionally, examples of methods and reagents particularly amenable for use in generating and screening antibody display library can be found in, for example, Ladner et al. U.S. Patent No. 5,223,409; Kang et al. PCT International Publication No. WO 92/18619; Dower et al. PCT International Publication No. WO 91/17271; Winter et al. PCT International Publication WO 92/20791; Markland et al. PCT International Publication No. WO 92/15679; Breitling et al. PCT International Publication WO 93/01288; McCafferty et al. PCT International Publication No. WO 92/01047; Garrard et al. PCT International Publication No. WO 92/09690; Ladner et al. PCT International Publication No. WO 90/02809; Fuchs et al. (1991) Bio/Technology 9:1370-1372; Hay et al. (1992) Hum. Antibod. Hybridomas 3:81-85; Huse et al. (1989) Science 246:1275- 1281; Griffiths et al. (1993) EMBO J 12:125-134; Hawkins et al. (1992) J. Mol. Biol. 226:889-896; Clarkson et al. (1991) Nature 352:624-628; Gram et al. (1992) Proc. Natl. Acad. Sci. USA 89:3576-3580; Garrad et al. (1991) Bio/Technology 9:1373-1377; Hoogenboom et al. (1991) Nuc. Acid Res. 19:4133-4137; Barbas et al. (1991) Proc. Natl. Acad. Sci. USA 88:7978-7982; and McCafferty et al. Nature (1990) 348:552-554.
Additionally, recombinant anti-CONAT-1 antibodies, such as chimeric and humanized monoclonal antibodies, comprising both human and non-human portions, which can be made using standard recombinant DNA techniques, are within the scope of the invention. Such chimeric and humanized monoclonal antibodies can be produced by recombinant DNA techniques known in the art, for example using methods described in Robinson et al. International Application No. PCT/US86/02269; Akira, et al. European . Patent Application 184,187; Taniguchi, M., European Patent Application 171,496; Morrison et al. European Patent Application 173,494; Neuberger et al. PCT
International Publication No. WO 86/01533; Cabilly et al. U.S. Patent No. 4,816,567; Cabilly et al. European Patent Application 125,023; Better et al. (1988) Science 240:1041-1043; Liu et al. (1987) Proc. Natl. Acad. Sci. USA 84:3439-3443; Liu et al. (1987) J. Immunol 139:3521-3526; Sun et al. (1987) Proc. Natl. Acad. Sci. USA 84:214-218; Nishimura et al. (1987) Cane. Res. 47:999-1005; Wood et al. (1985) Nature 314:446-449; and Shaw et al. (1988) J Natl. Cancer Inst. 80:1553-1559); Morrison, S. L. (1985) Science 229:1202-1207; Oi et al. (1986) BioTechniques 4:214; Winter U.S. Patent 5,225,539; Jones et al. (1986) Nature 321 :552-525; Verhoeyan et al. (1988) Science 239:1534; and Beidler et al. (1988) J. Immunol. 141:4053-4060.
An anti-CONAT-1 antibody (e.g., monoclonal antibody) can be used to isolate CONAT-1 by standard techniques, such as affinity chromatography or immunoprecipitation. An anti-CONAT-1 antibody can facilitate the purification of natural CONAT-1 from cells and of recombinantly produced CONAT-1 expressed in host cells. Moreover, an anti-CONAT-1 antibody can be used to detect CONAT-1 protein (e.g., in a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression of the CONAT-1 protein. Anti-CONAT-1 antibodies can be used diagnostically to monitor protein levels in tissue as part of a clinical testing procedure, e.g., to, for example, determine the efficacy of a given treatment regimen. Detection can be facilitated by coupling (i.e., physically linking) the antibody to a detectable substance. Examples of detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, β-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin, and
I OC 1 -3 1 -3 C O examples of suitable radioactive material include I, I, S or H.
IE. Recombinant Expression Vectors and Host Cells Another aspect of the invention pertains to vectors, for example recombinant expression vectors, containing a CONAT-1 nucleic acid molecule or vectors containing a nucleic acid molecule which encodes a CONAT-1 protein (or a portion thereof). As used herein, the term "vector" refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a "plasmid", which refers to a circular double stranded DNA loop into which additional DNA segments can be ligated. Another type of vector is a viral vector, wherein additional DNA segments can be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as "expression vectors". In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, "plasmid" and "vector" can be used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retro viruses, adeno viruses and adeno- associated viruses), which serve equivalent functions.
The recombinant expression vectors of the invention comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory sequences, selected on the basis of the host cells to be used for expression, which is operatively linked to the nucleic acid sequence to be expressed. Within a recombinant expression vector, "operably linked" is intended to mean that the nucleotide sequence of interest is linked to the regulatory sequence(s) in a manner which allows for expression of the nucleotide sequence (e.g., in an in vitro transcription translation system or in a host cell when the vector is introduced into the host cell). The term "regulatory sequence" is intended to include promoters, enhancers and other expression control elements (e.g., poly adenylation signals). Such regulatory sequences are described, for example, in Goeddel; Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1990). Regulatory sequences include those which direct constitutive expression of a nucleotide sequence in many types of host cells and those which direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, and the like. The expression vectors of the invention can be introduced into host cells to thereby produce proteins or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., CONAT-1 proteins, mutant forms of CONAT-1 proteins, fusion proteins, and the like).
Accordingly, an exemplary embodiment provides a method for producing a protein, preferably a CONAT-1 protein, by culturing in a suitable medium a host cell of the invention (e.g., a mammalian host cell such as a non-human mammalian cell) containing a recombinant expression vector, such that the protein is produced.
The recombinant expression vectors of the invention can be designed for expression of CONAT-1 proteins in prokaryotic or eukaryotic cells. For example, CONAT-1 proteins can be expressed in bacterial cells such as E. coli, insect cells (using baculovirus expression vectors) yeast cells or mammalian cells. Suitable host cells are discussed further in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1990). Alternatively, the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase. Expression of proteins in prokaryotes is most often carried out in E. coli with vectors containing constitutive or inducible promoters directing the expression of either fusion or non-fusion proteins. Fusion vectors add a number of amino acids to a protein encoded therein, usually to the amino terminus of the recombinant protein. Such fusion vectors typically serve three puφoses: 1) to increase expression of recombinant protein; 2) to increase the solubility of the recombinant protein; and 3) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification. Often, in fusion expression vectors, a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein. Such enzymes, and their cognate recognition sequences, include Factor Xa, thrombin and enterokinase. Typical fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith, D.B. and Johnson, K.S. (1988) Gene 67:31-40), pMAL (New England Biolabs, Beverly, MA) and pRIT5 (Pharmacia, Piscataway, NJ) which fuse glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the target recombinant protein.
Purified fusion proteins can be utilized in CONAT-1 activity assays, (e.g., direct assays or competitive assays described in detail below), or to generate antibodies specific for CONAT-1 proteins, for example. In a preferred embodiment, a CONAT-1 fusion protein expressed in a retroviral expression vector of the present invention can be utilized to infect bone marrow cells which are subsequently transplanted into irradiated recipients. The pathology of the subject recipient is then examined after sufficient time has passed (e.g., six (6) weeks). Examples of suitable inducible non-fusion E. coli expression vectors include pTrc (Amann et al., (1988) Gene 69:301-315) and pET 1 Id (Studier et al, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, California (1990) 60-89). Target gene expression from the pTrc vector relies on host RNA polymerase transcription from a hybrid frp-lac fusion promoter. Target gene expression from the pET l id vector relies on transcription from a T7 gnl 0-lac fusion promoter mediated by a coexpressed viral RNA polymerase (T7 gnl). This viral polymerase is supplied by host strains BL21(DE3) or HMS174(DE3) from a resident prophage harboring a T7 gnl gene under the transcriptional control of the lacUV 5 promoter. One strategy to maximize recombinant protein expression in E. coli is to express the protein in a host bacteria with an impaired capacity to proteolytically cleave the recombinant protein (Gottesman, S., Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, California (1990) 119-128). Another strategy is to alter the nucleic acid sequence of the nucleic acid to be inserted into an expression vector so that the individual codons for each amino acid are those preferentially utilized in E. coli (Wada et al, (1992) Nucleic Acids Res. 20:2111-2118). Such alteration of nucleic acid sequences of the invention can be carried out by standard DNA synthesis techniques.
In another embodiment, the CONAT-1 expression vector is a yeast expression vector. Examples of vectors for expression in yeast S. cerivisae include pYepSecl
(Baldari, et al., (1987) Embo J. 6:229-234), pMFa (Kurjan and Herskowitz, (1982) Cell 30:933-943), pJRY88 (Schultz et al., (1987) Gene 54:113-123), pYES2 (Invitrogen Coφoration, San Diego, CA), and picZ (InVitrogen Coφ, San Diego, CA).
Alternatively, CONAT-1 proteins can be expressed in insect cells using baculovirus expression vectors. Baculovirus vectors available for expression of proteins in cultured insect cells (e.g., Sf 9 cells) include the pAc series (Smith et al. (1983) Mol. Cell Biol. 3:2156-2165) and the pVL series (Lucklow and Summers (1989) Virology 170:31-39).
In yet another embodiment, a nucleic acid of the invention is expressed in mammalian cells using a mammalian expression vector. Examples of mammalian expression vectors include pCDM8 (Seed, B. (1987) Nature 329:840) and pMT2PC (Kaufman et al. (1987) EMBO J. 6:187-195). When used in mammalian cells, the expression vector's control functions are often provided by viral regulatory elements. For example, commonly used promoters are derived from polyoma, Adenoviras 2, cytomegalovirus and Simian Virus 40. For other suitable expression systems for both prokaryotic and eukaryotic cells see chapters 16 and 17 of Sambrook, J., Fritsh, E. F., and Maniatis, T. Molecular Cloning: A Laboratory Manual. 2nd, ed, Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989.
In another embodiment, the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid). Tissue- specific regulatory elements are known in the art. Non-limiting examples of suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert et al. (1987) Genes Dev. 1:268-277), lymphoid-specific promoters (Calame and Eaton (1988) Adv. Immunol. 43:235-275), in particular promoters of T cell receptors (Winoto and Baltimore (1989) EMBOJ. 8:729-733) and immunoglobulins (Banerji et al. (1983) Cell 33:729-740; Queen and Baltimore (1983) Cell 33:741-748), neuron-specific promoters (e.g., the neurofilament promoter; Byrne and Ruddle (1989) Proc. Natl. Acad. Sci. USA 86:5473-5477), pancreas-specific promoters (Edlund et al. (1985) Science 230:912-916), and mammary gland-specific promoters (e.g. , milk whey promoter; U.S. Patent No. 4,873,316 and European Application Publication No. 264, 166). Developmentally- regulated promoters are also encompassed, for example the murine hox promoters (Kessel and Grass (1990) Science 249:374-379) and the α-fetoprotein promoter (Campes and Tilghman (1989) Genes Dev. 3:537-546).
The invention further provides a recombinant expression vector comprising a DNA molecule of the invention cloned into the expression vector in an antisense orientation. That is, the DNA molecule is operatively linked to a regulatory sequence in a manner which allows for expression (by transcription of the DNA molecule) of an RNA molecule which is antisense to CONAT-1 mRNA. Regulatory sequences operatively linked to a nucleic acid cloned in the antisense orientation can be chosen which direct the continuous expression of the antisense RNA molecule in a variety of cell types, for instance viral promoters and/or enhancers, or regulatory sequences can be chosen which direct constitutive, tissue specific or cell type specific expression of antisense RNA. The antisense expression vector can be in the form of a recombinant plasmid, phagemid or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced. For a discussion of the regulation of gene expression using antisense genes see Weintraub, H. et al., Antisense RNA as a molecular tool for genetic analysis, Reviews - Trends in Genetics, Vol. 1(1) 1986.
Another aspect of the invention pertains to host cells into which a CONAT-1 nucleic acid molecule of the invention is introduced, e.g., a CONAT-1 nucleic acid molecule within a vector (e.g., a recombinant expression vector) or a CONAT-1 nucleic acid molecule containing sequences which allow it to homologously recombine into a specific site of the host cell's genome. The terms "host cell" and "recombinant host cell" are used interchangeably herein. It is understood that such terms refer not only to the particular subject cell but to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
A host cell can be any prokaryotic or eukaryotic cell. For example, a CONAT-1 protein can be expressed in bacterial cells such as E. coli, insect cells, yeast or mammalian cells (such as Chinese hamster ovary cells (CHO) or COS cells). Other suitable host cells are known to those skilled in the art. Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. As used herein, the terms "transformation" and "transfection" are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g., DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, or electroporation. Suitable methods for transforming or transfecting host cells can be found in Sambrook, et al. (Molecular Cloning: A Laboratory Manual. 2nd, ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989), and other laboratory manuals. For stable transfection of mammalian cells, it is known that, depending upon the expression vector and transfection technique used, only a small fraction of cells may integrate the foreign DNA into their genome. In order to identify and select these integrants, a gene that encodes a selectable marker (e.g., resistance to antibiotics) is generally introduced into the host cells along with the gene of interest. Preferred selectable markers include those which confer resistance to drugs, such as G418, hygromycin and methotrexate. Nucleic acid encoding a selectable marker can be introduced into a host cell on the same vector as that encoding a CONAT-1 protein or can be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drag selection (e.g., cells that have incoφorated the selectable marker gene will survive, while the other cells die).
A host cell of the invention, such as a prokaryotic or eukaryotic host cell in culture, can be used to produce (i.e., express) a CONAT-1 protein. Accordingly, the invention further provides methods for producing a CONAT-1 protein using the host cells of the invention. In one embodiment, the method comprises culturing the host cell of the invention (into which a recombinant expression vector encoding a CONAT-1 protein has been introduced) in a suitable medium such that a CONAT-1 protein is produced. In another embodiment, the method further comprises isolating a CONAT-1 protein from the medium or the host cell.
The host cells of the invention can also be used to produce non-human transgenic animals. For example, in one embodiment, a host cell of the invention is a fertilized oocyte or an embryonic stem cell into which CONAT-1 -coding sequences have been introduced. Such host cells can then be used to create non-human transgenic animals in which exogenous CONAT-1 sequences have been introduced into their genome or homologous recombinant animals in which endogenous CONAT-1 sequences have been altered. Such animals are useful for studying the function and/or activity of a CONAT-1 protein and for identifying and/or evaluating modulators of CONAT-1 activity. As used herein, a "transgenic animal" is a non-human animal, preferably a mammal, more preferably a rodent such as a rat or mouse, in which one or more of the cells of the animal includes a transgene. Other examples of transgenic animals include non-human primates, sheep, dogs, cows, goats, chickens, amphibians, and the like. A transgene is exogenous DNA which is integrated into the genome of a cell from which a transgenic animal develops and which remains in the genome of the mature animal, thereby directing the expression of an encoded gene product in one or more cell types or tissues of the transgenic animal. As used herein, a "homologous recombinant animal" is a non-human animal, preferably a mammal, more preferably a mouse, in which an endogenous CONAT-1 gene has been altered by homologous recombination between the endogenous gene and an exogenous DNA molecule introduced into a cell of the animal, e.g., an embryonic cell of the animal, prior to development of the animal.
A transgenic animal of the invention can be created by introducing a CONAT-1 - encoding nucleic acid into the male pronuclei of a fertilized oocyte, e.g., by microinjection or retroviral infection, and allowing the oocyte to develop in a pseudopregnant female foster animal. The CONAT-1 cDNA sequence of SEQ ID NO:l can be introduced as a transgene into the genome of a non-human animal. Alternatively, a non-human homologue of a human CONAT-1 gene, such as a rat or mouse CONAT-1 gene, can be used as a transgene. Alternatively, a CONAT-1 gene homologue, such as another CONAT-1 family member, can be isolated based on hybridization to the
CONAT-1 cDNA sequences of SEQ ID NO: 1, 3, or 5, or the DNA insert of the plasmid deposited with ATCC as Accession Number (described further in subsection I above) and used as a transgene. Intronic sequences and polyadenylation signals can also be included in the transgene to increase the efficiency of expression of the transgene. A tissue-specific regulatory sequence(s) can be operably linked to a CONAT-1 transgene to direct expression of a CONAT-1 protein to particular cells. Methods for generating transgenic animals via embryo manipulation and microinjection, particularly animals such as mice, have become conventional in the art and are described, for example, in U.S. Patent Nos. 4,736,866 and 4,870,009, both by Leder et al., U.S. Patent No. 4,873,191 by Wagner et al. and in Hogan, B., Manipulating the Mouse Embryo, (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1986). Similar methods are used for production of other transgenic animals. A transgenic founder animal can be identified based upon the presence of a CONAT-1 transgene in its genome and/or expression of CONAT-1 mRNA in tissues or cells of the animals. A transgenic founder animal can then be used to breed additional animals carrying the transgene. Moreover, transgenic animals carrying a transgene encoding a CONAT-1 protein can further be bred to other transgenic animals carrying other transgenes.
To create a homologous recombinant animal, a vector is prepared which contains at least a portion of a CONAT-1 gene into which a deletion, addition or substitution has been introduced to thereby alter, e.g., functionally disrupt, the CONAT-1 gene. The CONAT-1 gene can be a human gene (e.g., the cDNA of SEQ ID NO:l, 3 or 5), but more preferably, is a non-human homologue of a human CONAT- 1 gene (e.g. , a cDNA isolated by stringent hybridization with the nucleotide sequence of SEQ ID NO:l), For example, a mouse CONAT-1 gene can be used to construct a homologous recombination nucleic acid molecule, e.g., a vector, suitable for altering an endogenous CONAT-1 gene in the mouse genome. In a preferred embodiment, the homologous recombination nucleic acid molecule is designed such that, upon homologous recombination, the endogenous CONAT-1 gene is functionally disrupted (i.e., no longer encodes a functional protein; also referred to as a "knock out" vector). Alternatively, the homologous recombination nucleic acid molecule can be designed such that, upon homologous recombination, the endogenous CONAT-1 gene is mutated or otherwise altered but still encodes functional protein (e.g., the upstream regulatory region can be altered to thereby alter the expression of the endogenous CONAT-1 protein). In the homologous recombination nucleic acid molecule, the altered portion of the CONAT-1 gene is flanked at its 5' and 3' ends by additional nucleic acid sequence of the CONAT-1 gene to allow for homologous recombination to occur between the exogenous CONAT- 1 gene carried by the homologous recombination nucleic acid molecule and an endogenous CONAT-1 gene in a cell, e.g., an embryonic stem cell. The additional flanking CONAT-1 nucleic acid sequence is of sufficient length for successful homologous recombination with the endogenous gene. Typically, several kilobases of flanking DNA (both at the 5' and 3' ends) are included in the homologous recombination nucleic acid molecule (see, e.g., Thomas, K.R. and Capecchi, M. R. (1987) Cell 51 :503 for a description of homologous recombination vectors). The homologous recombination nucleic acid molecule is introduced into a cell, e.g., an embryonic stem cell line (e.g., by electroporation) and cells in which the introduced CONAT-1 gene has homologously recombined with the endogenous CONAT-1 gene are selected (see e.g., Li, E. et al. (1992) Cell 69:915). The selected cells can then injected into a blastocyst of an animal (e.g., a mouse) to form aggregation chimeras (see e.g., Bradley, A. in Teratocarcinomas and Embryonic Stem Cells: A Practical Approach, E. J. Robertson, ed. (IRL, Oxford, 1987) pp. 113-152). A chimeric embryo can then be implanted into a suitable pseudopregnant female foster animal and the embryo brought to term. Progeny harboring the homologously recombined DNA in their germ cells can be used to breed animals in which all cells of the animal contain the homologously recombined DNA by germline transmission of the transgene. Methods for constructing homologous recombination nucleic acid molecules, e.g., vectors, or homologous recombinant animals are described further in Bradley, A. (1991) Current Opinion in Biotechnology 2:823-829 and in PCT International Publication Nos.: WO 90/11354 by Le Mouellec et al.; WO 91/01140 by Smithies et al.; WO 92/0968 by Zijlstra et al.; and WO 93/04169 by Berns et al.
In another embodiment, transgenic non-humans animals can be produced which contain selected systems which allow for regulated expression of the transgene. One example of such a system is the cre/loxP recombinase system of bacteriophage PI . For a description of the cre/loxP recombinase system, see, e.g., Lakso et al. (1992) Proc. Natl. Acad. Sci. USA 89:6232-6236. Another example of a recombinase system is the FLP recombinase system of Saccharomyces cerevisiae (O'Gorman et al. (1991) Science 251:1351-1355. If a cre/loxP recombinase system is used to regulate expression of the transgene, animals containing transgenes encoding both the Cre recombinase and a selected protein are required. Such animals can be provided through the construction of "double" transgenic animals, e.g., by mating two transgenic animals, one containing a transgene encoding a selected protein and the other containing a transgene encoding a recombinase. Clones of the non-human transgenic animals described herein can also be produced according to the methods described in Wilmut, I. et al. (1997) Nature 385:810- 813 and PCT International Publication Nos. WO 97/07668 and WO 97/07669. In brief, a cell, e.g., a somatic cell, from the transgenic animal can be isolated and induced to exit the growth cycle and enter G0 phase. The quiescent cell can then be fused, e.g., through the use of electrical pulses, to an enucleated oocyte from an animal of the same species from which the quiescent cell is isolated. The reconstructed oocyte is then cultured such that it develops to morula or blastocyte and then transferred to pseudopregnant female foster animal. The offspring borne of this female foster animal will be a clone of the animal from which the cell, e.g., the somatic cell, is isolated.
IV. Pharmaceutical Compositions
The CONAT-1 nucleic acid molecules, of CONAT-1 proteins, fragments thereof, anti-CONAT-1 antibodies, and CONAT-1 modulators (also referred to herein as "active compounds") of the invention can be incoφorated into pharmaceutical compositions suitable for administration. Such compositions typically comprise the nucleic acid molecule, protein, or antibody and a pharmaceutically acceptable carrier. As used herein the language "pharmaceutically acceptable carrier" is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absoφtion delaying agents, and the like, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incoφorated into the compositions.
A pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration. Examples of routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (topical), transmucosal, and rectal administration. Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
Pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor EL™ (BASF, Parsippany, NJ) or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as manitol, sorbitol, sodium chloride in the composition. Prolonged absoφtion of the injectable compositions can be brought about by including in the composition an agent which delays absoφtion, for example, aluminum monostearate and gelatin.
Sterile injectable solutions can be prepared by incoφorating the active compound (e.g., a fragment of a CONAT-1 protein or an anti-CONAT-1 antibody) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incoφorating the active compound into a sterile vehicle which contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying which yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the puφose of oral therapeutic administration, the active compound can be incoφorated with excipients and used in the form of tablets, troches, or capsules, oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition. The tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring. For administration by inhalation, the compounds are delivered in the form of an aerosol spray from pressured container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
Systemic administration can also be by transmucosal or transdermal means. For transmucosal or transdermal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives. Transmucosal administration can be accomplished through the use of nasal sprays or suppositories. For transdermal administration, the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art. The compounds can also be prepared in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
In one embodiment, the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art. The materials can also be obtained commercially from Alza Coφoration and Nova
Pharmaceuticals, Inc. Liposomal suspensions (including liposomes targeted to infected cells with monoclonal antibodies to viral antigens) can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Patent No. 4,522,811. It is especially advantageous to formulate oral or parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.
Toxicity and therapeutic efficacy of such compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50%> of the population) and the ED50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD50/ED50. Compounds which exhibit large therapeutic indices are preferred. While compounds that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such compounds to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects. The data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for use in humans. The dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration utilized. For any compound used in the method of the invention, the therapeutically effective dose can be estimated initially from cell culture assays. A dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the test compound which achieves a half-maximal inhibition of symptoms) as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. Levels in plasma may be measured, for example, by high performance liquid chromatography.
As defined herein, a therapeutically effective amount of protein or polypeptide (i.e., an effective dosage) ranges from about 0.001 to 30 mg/kg body weight, preferably about 0.01 to 25 mg/kg body weight, more preferably about 0.1 to 20 mg/kg body weight, and even more preferably about 1 to 10 mg/kg, 2 to 9 mg/kg, 3 to 8 mg/kg, 4 to 7 mg/kg, or 5 to 6 mg/kg body weight. The skilled artisan will appreciate that certain factors may influence the dosage required to effectively treat a subject, including but not limited to the severity of the disease or disorder, previous treatments, the general health and/or age of the subject, and other diseases present. Moreover, treatment of a subject with a therapeutically effective amount of a protein, polypeptide, or antibody can include a single treatment or, preferably, can include a series of treatments.
In a preferred example, a subject is treated with antibody, protein, or polypeptide in the range of between about 0.1 to 20 mg/kg body weight, one time per week for between about 1 to 1.0 weeks, preferably between 2 to 8 weeks, more preferably between about 3 to 7 weeks, and even more preferably for about 4, 5, or 6 weeks. It will also be appreciated that the effective dosage of antibody, protein, or polypeptide used for treatment may increase or decrease over the course of a particular treatment. Changes in dosage may result and become apparent from the results of diagnostic assays as described herein. The present invention encompasses agents which modulate expression or activity. An agent may, for example, be a small molecule. For example, such small molecules include, but are not limited to, peptides, peptidomimetics, amino acids, amino acid analogs, polynucleotides, polynucleotide analogs, nucleotides, nucleotide analogs, organic or inorganic compounds (i.e,. including heteroorganic and organometallic compounds) having a molecular weight less than about 10,000 grams per mole, organic or inorganic compounds having a molecular weight less than about 5,000 grams per mole, organic or inorganic compounds having a molecular weight less than about 1,000 grams per mole, organic or inorganic compounds having a molecular weight less than about 500 grams per mole, and salts, esters, and other pharmaceutically acceptable forms of such compounds. It is understood that appropriate doses of small molecule agents depends upon a number of factors within the ken of the ordinarily skilled physician, veterinarian, or researcher. The dose(s) of the small molecule will vary, for example, depending upon the identity, size, and condition of the subject or sample being treated, further depending upon the route by which the composition is to be administered, if applicable, and the effect which the practitioner desires the small molecule to have upon the nucleic acid or polypeptide of the invention.
Exemplary doses include milligram or microgram amounts of the small molecule per kilogram of subject or sample weight (e.g., about 1 microgram per kilogram to about 500 milligrams per kilogram, about 100 micrograms per kilogram to about 5 milligrams per kilogram, or about 1 microgram per kilogram to about 50 micrograms per kilogram. It is furthermore understood that appropriate doses of a small molecule depend upon the potency of the small molecule with respect to the expression or activity to be modulated. Such appropriate doses may be determined using the assays described herein. When one or more of these small molecules is to be administered to an animal (e.g., a human) in order to modulate expression or activity of a polypeptide or nucleic acid of the invention, a physician, veterinarian, or researcher may, for example, prescribe a relatively low dose at first, subsequently increasing the dose until an appropriate response is obtained. In addition, it is understood that the specific dose level for any particular animal subject will depend upon a variety of factors including the activity of the specific compound employed, the age, body weight, general health, gender, and diet of the subject, the time of administration, the route of administration, the rate of excretion, any drug combination, and the degree of expression or activity to be modulated.
In certain embodiments of the invention, a modulator of CONAT- 1 activity is administered in combination with other agents (e.g., a small molecule), or in conjunction with another, complementary treatment regime. For example, in one embodiment, a modulator of CONAT-1 activity is used to treat CONAT-1 associated disorder. Accordingly, modulation of CONAT-1 activity may be used in conjunction with, for example, another agent used to treat the disorder, e.g., another known agent used to treat cancer, in particular, colon cancer. Further, an antibody (or fragment thereof) may be conjugated to a therapeutic moiety such as a cytotoxin, a therapeutic agent or a radioactive metal ion. A cytotoxin or cytotoxic agent includes any agent that is detrimental to cells. Examples include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorabicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs ' or homologs thereof. Therapeutic agents include, but are not limited to, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thioepa chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU), cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin), anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorabicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)), and anti-mitotic agents (e.g., vincristine and vinblastine).
The conjugates of the invention can be used for modifying a given biological response, the drug moiety is not to be construed as limited to classical chemical therapeutic agents. For example, the drag moiety may be a protein or polypeptide possessing a desired biological activity. Such proteins may include, for example, a toxin such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin; a protein such as tumor necrosis factor, alpha-interferon, beta-interferon, nerve growth factor, platelet derived growth factor, tissue plasminogen activator; or, biological response modifiers such as, for example, lymphokines, interleukin-1 ("IL-1"), interleukin-2 ("IL-2"), interleukin-6 ("IL-6"), granulocyte macrophase colony stimulating factor ("GM-CSF"), granulocyte colony stimulating factor ("G-CSF"), or other growth factors.
Techniques for conjugating such therapeutic moiety to antibodies are well known, see, e.g. , Arnon et al. "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy" in Monoclonal Antibodies And Cancer Therapy, Reisfeld et al. (eds.), pp. 243-56 (Alan R. Liss, Inc. 1985); Hellsfrom et al. "Antibodies For Drug Delivery" in Controlled Drug Delivery (2nd Ed), Robinson et al. (eds.), pp. 623-53 (Marcel Dekker, Inc. 1987); Thoφe "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review" in Monoclonal Antibodies '84: Biological And Clinical
Applications, Pinchera et al. (eds.), pp. 475-506 (1985); "Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy" in Monoclonal Antibodies For Cancer Detection And Therapy, Baldwin et al (eds.), pp. 303-16 (Academic Press 1985); and Thoφe et al. "The Preparation And Cytotoxic Properties Of Antibody-Toxin Conjugates" Immunol. Rev. 62:119-58 (1982).
Alternatively, an antibody can be conjugated to a second antibody to form an antibody heteroconjugate as described by Segal in U.S. Patent No. 4,676,980.
The nucleic acid molecules of the invention can be inserted into vectors and used as gene therapy vectors. Gene therapy vectors can be delivered to a subject by, for example, intravenous injection, local administration (see U.S. Patent 5,328,470) or by stereotactic injection (see e.g., Chen et al. (1994) Proc. Natl. Acad. Sci. USA 91:3054- 3057). The pharmaceutical preparation of the gene therapy vector can include the gene therapy vector in an acceptable diluent, or can comprise a slow release matrix in which the gene delivery vehicle is imbedded. Alternatively, where the complete gene delivery vector can be produced intact from recombinant cells, e.g. , retroviral vectors, the pharmaceutical preparation can include one or more cells which produce the gene delivery system.
The pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration. V. Uses and Methods of the Invention
The nucleic acid molecules, proteins, protein homologues, and antibodies described herein can be used in one or more of the following methods: a) screening assays; b) predictive medicine (e.g., diagnostic assays, prognostic assays, monitoring clinical trials, and pharmacogenetics); and c) methods of treatment (e.g., therapeutic and prophylactic). As described herein, a CONAT-1 protein of the invention has one or more of the following activities: (1) interaction with a CONAT-1 substrate or target molecule; (2) conversion of a CONAT-1 substrate or target molecule to product (e.g., acetylation of the substrate or target molecule); (3) interaction with and/or modulation of a second non-CONAT-1 protein; (4) activation/deactivation of CONAT-1 substrates or target molecules (e.g., activation/deactivation of carcinogens, for example heterocyclic and/or aromatic amine carcinogens, e.g., colorectal carcinogens); (5) metabolism and/or detoxification of drags (e.g., hydrazine and/or arylamine drags); (6) modulation of cellular signaling and/or gene transcription (e.g., either directly or indirectly); and (7) modulation of cellular proliferation and/or differentiation.
The isolated nucleic acid molecules of the invention can be used, for example, to express CONAT-1 protein (e.g., via a recombinant expression vector in a host cell in gene therapy applications), to detect CONAT-1 mRNA (e.g., in a biological sample) or a genetic alteration in a CONAT-1 gene, and to modulate CONAT-1 activity, as described further below. The CONAT-1 proteins can be used to treat disorders characterized by insufficient or excessive production of a CONAT-1 substrate or production of CONAT- 1 inhibitors. In addition, the CONAT-1 proteins can be used to screen for naturally occurring CONAT-1 substrates, to screen for drags or compounds which modulate CONAT-1 activity, as well as to treat disorders characterized by insufficient or excessive production of CONAT- 1 protein or production of CONAT- 1 protein forms which have decreased, aberrant or unwanted activity compared to CONAT-1 wild type protein (e.g., disorders characterized by aberrant gene expression, or cell proliferation and/or differentiation disorders). Moreover, the anti-CONAT-1 antibodies of the invention can be used to detect and isolate CONAT-1 proteins, regulate the bioavailability of CONAT-1 proteins, and modulate CONAT-1 activity. A. Screening Assays:
The invention provides a method (also referred to herein as a "screening assay") for identifying modulators, i.e., candidate or test compounds or agents (e.g., peptides, peptidomimetics, small molecules or other drags) which bind to CONAT-1 proteins, have a stimulatory or inhibitory effect on, for example, CONAT-1 expression or CONAT-1 activity, or have a stimulatory or inhibitory effect on, for example, the expression or activity of a CONAT-1 substrate.
In one embodiment, the invention provides assays for screening candidate or test compounds which are substrates of a CONAT-1 protein or polypeptide or biologically active portion thereof. In another embodiment, the invention provides assays for screening candidate or test compounds which bind to or modulate the activity of a CONAT-1 protein or polypeptide or biologically active portion thereof. The test compounds of the present invention can be obtained using any of the numerous approaches in combinatorial library methods known in the art, including: biological libraries; spatially addressable parallel solid phase or solution phase libraries; synthetic library methods requiring deconvolution; the 'one-bead one-compound' library method; and synthetic library methods using affinity chromatography selection. The biological library approach is limited to peptide libraries, while the other four approaches are applicable to peptide, non-peptide oligomer or small molecule libraries of compounds (Lam, K.S. (1997) Anticancer Drug Des. 12: 145).
Examples of methods for the synthesis of molecular libraries can be found in the art, for example in: DeWitt et al. (1993) Proc. Natl Acad. Sci. U.S.A. 90:6909; Erb et al. (1994) Proc. Natl Acad. Sci. USA 91:11422; Zuckermann et al. (1994). J. Med. Chem. 37:2678; Cho et al. (1993) Science 261:1303; Carrell et al. (1994) Angew. Chem. Int. Ed. Engl. 33:2059; Carell et al. (1994) Angew. Chem. Int. Ed. Engl. 33:2061; and in Gallop et al. (1994) J Med. Chem. 37:1233.
Libraries of compounds may be presented in solution (e.g., Houghten (1992) Biotechniques 13:412-421), or on beads (Lam (1991) Nature 354:82-84), chips (Fodor (1993) Nature 364:555-556), bacteria (Ladner USP 5,223,409), spores (Ladner USP '409), plasmids (Cull et al. (1992) Proc Natl Acad Sci USA 89: 1865-1869) or on phage (Scott and Smith (1990) Science 249:386-390); (Devlin (1990) Science 249:404-406); (Cwirla et al. (1990) Proc. Natl. Acad. Sci. 87:6378-6382); (Felici (1991) J. Mol. Biol. 222 : 301 -310) ; (Ladner supra. ) .
In one embodiment, an assay is a cell-based assay in which a cell which expresses a CONAT-1 protein or biologically active portion thereof is contacted with a test compound and the ability of the test compound to modulate CONAT-1 activity is determined. Determining the ability of the test compound to modulate CONAT-1 activity can be accomplished by monitoring, for example, acetylation of target substrates and on levels of gene transcription. The cell, for example, can be of mammalian origin.
The ability of the test compound to modulate CONAT-1 binding to a substrate or to bind to CONAT-1 can also be determined. Determining the ability of the test compound to modulate CONAT-1 binding to a substrate can be accomplished, for example, by coupling the CONAT-1 substrate with a radioisotope or enzymatic label such that binding of the CONAT-1 substrate to CONAT-1 can be determined by detecting the labeled CONAT-1 substrate in a complex. Alternatively, CONAT-1 could be coupled with a radioisotope or enzymatic label to monitor the ability of a test compound to modulate CONAT-1 binding to a CONAT-1 substrate in a complex. Determining the ability of the test compound to bind CONAT-1 can be accomplished, for example, by coupling the compound with a radioisotope or enzymatic label such that binding of the compound to CONAT-1 can be determined by detecting the labeled CONAT-1 compound in a complex. For example, compounds (e.g., CONAT-1 substrates) can be labeled with 125^ 35ss 14^ or ^H, either directly or indirectly, and the radioisotope detected by direct counting of radioemmission or by scintillation counting. Alternatively, compounds can be enzymatically labeled with, for example, horseradish peroxidase, alkaline phosphatase, or luciferase, and the enzymatic label detected by determination of conversion of an appropriate substrate to product. It is also within the scope of this invention to determine the ability of a compound (e.g., a CONAT-1 substrate) to interact with CONAT-1 without the labeling of any of the interactants: For example, a microphysiometer can be used to detect the interaction of a compound with CONAT-1 without the labeling of either the compound or the CONAT-1. McConnell, H. M. et al. (1992) Science 257:1906-1912. As used herein, a "microphysiometer" (e.g., Cytosensor) is an analytical instrument that measures the rate at which a cell acidifies its environment using a light-addressable potentiometric sensor (LAPS). Changes in this acidification rate can be used as an indicator of the interaction between a compound and CONAT-1.
In another embodiment, an assay is a cell-based assay comprising contacting a cell expressing a CONAT-1 target molecule (e.g., a CONAT-1 substrate) with a test compound and determimng the ability of the test compound to modulate (e.g. stimulate or inhibit) the activity of the CONAT-1 target molecule. Determining the ability of the test compound to modulate the activity of a CONAT-1 target molecule can be accomplished, for example, by determining the ability of the CONAT-1 protein to bind to or interact with the CONAT-1 target molecule.
Determining the ability of the CONAT-1 protein or a biologically active fragment thereof, to bind to or interact with a CONAT-1 target molecule can be accomplished by one of the methods described above for determining direct binding. In a preferred embodiment, determining the ability of the CONAT-1 protein to bind to or interact with a CONAT-1 target molecule can be accomplished by determining the activity of the target molecule. For example, the activity of the target molecule can be determined by detecting induction of a cellular second messenger of the target (i.e., intracellular calcium or IP3), detecting catalytic/enzymatic activity of the target molecule upon an appropriate substrate, detecting the induction of a reporter gene (comprising a target-responsive regulatory element operatively linked to a nucleic acid encoding a detectable marker, e.g., luciferase), or detecting a target-regulated cellular response (i.e., cell growth or differentiation).
In yet another embodiment, an assay of the present invention is a cell-free assay in which a CONAT-1 protein or biologically active portion thereof is contacted with a test compound and the ability of the test compound to bind to the CONAT-1 protein or biologically active portion thereof is determined. Preferred biologically active portions of the CONAT-1 proteins to be used in assays of the present invention include fragments which participate in interactions with non-CONAT-1 molecules, e.g., fragments with high surface probability scores (see, for example, Appendices 1 A and 5 A). Binding of the test compound to the CONAT-1 protein can be determined either directly or indirectly as described above. In a preferred embodiment, the assay includes contacting the CONAT-1 protein or biologically active portion thereof with a known compound which binds CONAT-1 to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with a CONAT-1 protein, wherein determining the ability of the test compound to interact with a CONAT-1 protein comprises determining the ability of the test compound to preferentially bind to CONAT-1 or biologically active portion thereof as compared to the known compound.
In another embodiment, the assay is a cell-free assay in which a CONAT-1 protein or biologically active portion thereof is contacted with a test compound and the ability of the test compound to modulate (e.g., stimulate or inhibit) the activity of the CONAT-1 protein or biologically active portion thereof is determined. Determining the ability of the test compound to modulate the activity of a CONAT-1 protein can be accomplished, for example, by determining the ability of the CONAT-1 protein to bind to a CONAT-1 target molecule by one of the methods described above for determining direct binding. Determining the ability of the CONAT-1 protein to bind to a CONAT-1 target molecule can also be accomplished using a technology such as real-time
Biomolecular Interaction Analysis (BIA). Sjolander, S. and Urbaniczky, C. (1991) Anal. Chem. 63:2338-2345 and Szabo et al. (1995) Curr. Opin. Struct. Biol. 5:699-705. As used herein, "BIA" is a technology for studying biospecific interactions in real time, without labeling any of the interactants (e.g., BIAcore). Changes in the optical phenomenon of surface plasmon resonance (SPR) can be used as an indication of realtime reactions between biological molecules.
In an alternative embodiment, determining the ability of the test compound to modulate the activity of a CONAT-1 protein can be accomplished by determining the ability of the CONAT-1 protein to further modulate the activity of a downstream effector of a CONAT-1 target molecule. For example, the activity of the effector molecule on an appropriate target can be determined or the binding of the effector to an appropriate target can be determined as previously described.
In yet another embodiment, the cell-free assay involves contacting a CONAT-1 protein or biologically active portion thereof with a known compound which binds the CONAT-1 protein to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with the CONAT-1 protein, wherein determining the ability of the test compound to interact with the CONAT-1 protein comprises determining the ability of the CONAT-1 protein to preferentially bind to or modulate the activity of a CONAT-1 target molecule.
The cell-free assays of the present invention are amenable to use of both soluble and/or membrane-bound forms of isolated proteins (e.g., CONAT-1 proteins or biologically active portions thereof). In the case of cell-free assays in which a membrane-bound form of an isolated protein is used it may be desirable to utilize a solubilizing agent such that the membrane-bound form of the isolated protein is maintained in solution. Examples of such solubilizing agents include non-ionic detergents such as n-octylglucoside, n-dodecylglucoside, n-dodecylmaltoside, octanoyl- N-methylglucamide, decanoyl-N-methylglucamide, Triton® X- 100, Triton® X- 114, Thesit®, Isotridecypoly(ethylene glycol ether)n, 3-[(3- cholamidopropyl)dimethylarnminio]-l -propane sulfonate (CHAPS), 3-[(3- cholamidopropyl)dimethylamminio]-2-hydroxy-l -propane sulfonate (CHAPSO), orN- dodecyl=N,N-dimethyl-3-ammonio-l -propane sulfonate. In more than one embodiment of the above assay methods of the present invention, it may be desirable to immobilize either CONAT-1 or its target molecule to facilitate separation of complexed from uncomplexed forms of one or both of the proteins, as well as to accommodate automation of the assay. Binding of a test compound to a CONAT-1 protein, or interaction of a CONAT-1 protein with a target molecule in the presence and absence of a candidate compound, can be accomplished in any vessel suitable for containing the reactants. Examples of such vessels include microtiter plates, test tubes, and micro-centrifuge tubes. In one embodiment, a fusion protein can be provided which adds a domain that allows one or both of the proteins to be bound to a matrix. For example, glutathione-S-transferase/CONAT-1 fusion proteins or glutathione-S-transferase/target fusion proteins can be adsorbed onto glutathione sepharose beads (Sigma Chemical, St. Louis, MO) or glutathione derivatized micrometer plates, which are then combined with the test compound or the test compound and either the non-adsorbed target protein or CONAT-1 protein, and the mixture incubated under conditions conducive to complex formation (e.g., at physiological conditions for salt and pH). Following incubation, the beads or microtiter plate wells are washed to remove any unbound components, the matrix immobilized in the case of beads, complex determined either directly or indirectly, for example, as described above. Alternatively, the complexes can be dissociated from the matrix, and the level of CONAT-1 binding or activity determined using standard techniques.
Other techniques for immobilizing proteins on matrices can also be used in the screening assays of the invention. For example, either a CONAT-1 protein or a CONAT-1 target molecule can be immobilized utilizing conjugation of biotin and streptavidin. Biotinylated CONAT-1 protein or target molecules can be prepared from biotin-NHS (N-hydroxy-succinimide) using techniques known in the art (e.g., biotinylation kit, Pierce Chemicals, Rockford, IL), and immobilized in the wells of streptavidin-coated 96 well plates (Pierce Chemical). Alternatively, antibodies reactive with CONAT-1 protein or target molecules but which do not interfere with binding of the CONAT-1 protein to its target molecule can be derivatized to the wells of the plate, and unbound target or CONAT-1 protein trapped in the wells by antibody conjugation. Methods for detecting such complexes, in addition to those described above for the GST-immobilized complexes, include immunodetection of complexes using antibodies reactive with the CONAT-1 protein or target molecule, as well as enzyme-linked assays which rely on detecting an enzymatic activity associated with the CONAT-1 protein or target molecule.
In another embodiment, modulators of CONAT-1 expression are identified in a method wherein a cell is contacted with a candidate compound and the expression of CONAT-1 mRNA or protein in the cell is determined. The level of expression of
CONAT-1 mRNA or protein in the presence of the candidate compound is compared to the level of expression of CONAT-1 mRNA or protein in the absence of the candidate compound. The candidate compound can then be identified as a modulator of CONAT- 1 expression based on this comparison. For example, when expression of CONAT-1 mRNA or protein is greater (statistically significantly greater) in the presence of the candidate compound than in its absence, the candidate compound is identified as a stimulator of CONAT-1 mRNA or protein expression. Alternatively, when expression of CONAT-1 mRNA or protein is less (statistically significantly less) in the presence of the candidate compound than in its absence, the candidate compound is identified as an inhibitor of CONAT- 1 mRNA or protein expression. The level of CONAT- 1 mRNA or protein expression in the cells can be determined by methods described herein for detecting CONAT-1 mRNA or protein. In yet another aspect of the invention, the CONAT-1 proteins can be used as "bait proteins" in a two-hybrid assay or three-hybrid assay (see, e.g., U.S. Patent No. 5,283,317; Zervos et al. (1993) Cell 72:223-232; Madura et al. (1993) J Biol Chem. 268:12046-12054; Bartel et al. (1993) Biotechniques 14:920-924; Iwabuchi et al. (1993) Oncogene 8:1693-1696; and Brent WO94/10300), to identify other proteins, which bind to or interact with CONAT-1 ("CONAT-1 -binding proteins" or "CONAT-1- bp") and are involved in CONAT-1 activity. Such CONAT-1 -binding proteins are also likely to be involved in the propagation of signals by the CONAT-1 proteins or CONAT-1 targets as, for example, downstream elements of a CONAT-1 -mediated signaling pathway. Alternatively, such CONAT-1 -binding proteins are likely to be CONAT-1 inhibitors.
The two-hybrid system is based on the modular nature of most transcription factors, which consist of separable DNA-binding and activation domains. Briefly, the assay utilizes two different DNA constructs. In one construct, the gene that codes for a CONAT- 1 protein is fused to a gene encoding the DNA binding domain of a known transcription factor (e.g., GAL-4). In the other construct, a DNA sequence, from a library of DNA sequences, that encodes an unidentified protein ("prey" or "sample") is fused to a gene that codes for the activation domain of the known transcription factor. If the "bait" and the "prey" proteins are able to interact, in vivo, forming a CONAT- 1- dependent complex, the DNA-binding and activation domains of the transcription factor are brought into close proximity. This proximity allows transcription of a reporter gene (e.g., LacZ) which is operably linked to a transcriptional regulatory site responsive to the transcription factor. Expression of the reporter gene can be detected and cell colonies containing the functional transcription factor can be isolated and used to obtain the cloned gene which encodes the protein which interacts with the CONAT-1 protein. In another aspect, the invention pertains to a combination of two or more of the assays described herein. For example, a modulating agent can be identified using a cell- based or a cell free assay, and the ability of the agent to modulate the activity of a CONAT-1 protein can be confirmed in vivo, e.g., in an animal such as an animal model for cellular transformation and/or tumorigenesis. This invention further pertains to novel agents identified by the above-described screening assays. Accordingly, it is within the scope of this invention to further use an agent identified as described herein in an appropriate animal model. Examples of animal models of colon cancer include transplantable models (e.g., xenografts of colon tumors such as Co-3, AC3603 or WiDr, into immunocompromised mice such as SCID or nude mice), transgenic models (e.g., B66-Min/+ mouse), and chemical induction models (e.g., carcinogen (e.g., azoxymethane, 2-dimethylhydrazine) treated rats. For example, an agent identified as described herein (e.g., a CONAT-1 modulating agent, an antisense CONAT-1 nucleic acid molecule, a CONAT-1 -specific antibody, or a CONAT-1 -binding partner) can be used in an animal model to determine the efficacy, toxicity, or side effects of treatment with such an agent. Alternatively, an agent identified as described herein can be used in an animal model to determine the mechanism of action of such an agent.
Furthermore, this invention pertains to uses of novel agents identified by the above-described screening assays for treatments as described herein. In one embodiment, the invention features a method of treating a subject having a cellular proliferation or differentiation disorder that involves administering to the subject a CONAT-1 modulator such that treatment occurs. In another embodiment, the invention features a method of treating a subject having colon cancer that involves treating a subject with a CONAT-1 modulator such that treatment occurs. Preferred CONAT-1 modulators include, but are not limited to, CONAT-1 proteins or biologically active fragments, CONAT-1 nucleic acid molecules, CONAT-1 antibodies, CONAT-1 ribozymes, and antisense oligonucleotides designed based on the CONAT-1 nucleotide sequences disclosed herein, as well as peptides, organic, and non-organic small molecules identified as being capable of modulating CONAT-1 expression and/or activity, for example, according to at least one of the screening assays described herein.
B. Detection Assays
Portions or fragments of the cDNA sequences identified herein (and the corresponding complete gene sequences) can be used in numerous ways as polynucleotide reagents. For example, these sequences can be used to: (i) map their respective genes on a chromosome; and, thus, locate gene regions associated with genetic disease; (ii) identify an individual from a minute biological sample (tissue typing); and (iii) aid in forensic identification of a biological sample. These applications are described in the subsections below.
1. Chromosome Mapping
Once the sequence (or a portion of the sequence) of a gene has been isolated, this sequence can be used to map the location of the gene on a chromosome. This process is called chromosome mapping. Accordingly, portions or fragments of the CONAT-1 nucleotide sequences, described herein, can be used to map the location of the CONAT- 1 genes on a chromosome. The mapping of the CONAT-1 sequences to chromosomes is an important first step in correlating these sequences with genes associated with disease.
Briefly, CONAT-1 genes can be mapped to chromosomes by preparing PCR primers (preferably 15-25 bp in length) from the CONAT-1 nucleotide sequences. Computer analysis of the CONAT-1 sequences can be used to predict primers that do not span more than one exon in the genomic DNA, thus complicating the amplification process. These primers can then be used for PCR screening of somatic cell hybrids containing individual human chromosomes. Only those hybrids containing the human gene corresponding to the CONAT-1 sequences will yield an amplified fragment. Somatic cell hybrids are prepared by fusing somatic cells from different mammals (e.g., human and mouse cells). As hybrids of human and mouse cells grow and divide, they gradually lose human chromosomes in random order, but retain the mouse chromosomes. By using media in which mouse cells cannot grow, because they lack a particular enzyme, but human cells can, the one human chromosome that contains the gene encoding the needed enzyme, will be retained. By using various media, panels of hybrid cell lines can be established. Each cell line in a panel contains either a single human chromosome or a small number of human chromosomes, and a full set of mouse chromosomes, allowing easy mapping of individual genes to specific human chromosomes. (D'Eustachio P. et al. (1983) Science 220:919-924). Somatic cell hybrids containing only fragments of human chromosomes can also be produced by using human chromosomes with translocations and deletions. PCR mapping of somatic cell hybrids is a rapid procedure for assigning a particular sequence to a particular chromosome. Three or more sequences can be assigned per day using a single thermal cycler. Using the CONAT-1 nucleotide sequences to design oligonucleotide primers, sublocalization can be achieved with panels of fragments from specific chromosomes. Other mapping strategies which can similarly be used to map a CONAT-1 sequence to its chromosome include in situ hybridization (described in Fan, Y. et al. (1990) Proc. Natl. Acad. Sci. USA, 87:6223- 27), pre-screening with labeled flow-sorted chromosomes, and pre-selection by hybridization to chromosome specific cDNA libraries. Fluorescence in situ hybridization (FISH) of a DNA sequence to a metaphase chromosomal spread can further be used to provide a precise chromosomal location in one step. Chromosome spreads can be made using cells whose division has been blocked in metaphase by a chemical such as colcemid that disrupts the mitotic spindle. The chromosomes can be treated briefly with trypsin, and then stained with Giemsa. A pattern of light and dark bands develops on each chromosome, so that the chromosomes can be identified individually. The FISH technique can be used with a DNA sequence as short as 500 or 600 bases. However, clones larger than 1,000 bases have a higher likelihood of binding to a unique chromosomal location with sufficient signal intensity for simple detection. Preferably 1,000 bases, and more preferably 2,000 bases will suffice to get good results at a reasonable amount of time. For a review of this technique, see Verma et al., Human Chromosomes: A Manual of Basic Techniques (Pergamon Press, New York 1988).
Reagents for chromosome mapping can be used individually to mark a single chromosome or a single site on that chromosome, or panels of reagents can be used for marking multiple sites and/or multiple chromosomes. Reagents corresponding to noncoding regions of the genes actually are preferred for mapping puφoses. Coding sequences are more likely to be conserved within gene families, thus increasing the chance of cross hybridizations during chromosomal mapping.
Once a sequence has been mapped to a precise chromosomal location, the physical position of the sequence on the chromosome can be correlated with genetic map data. (Such data are found, for example, in V. McKusick, Mendelian Inheritance in Man, available on-line through Johns Hopkins University Welch Medical Library). The relationship between a gene and a disease, mapped to the same cliromosomal region, can then be identified through linkage analysis (co-inheritance of physically adjacent genes), described in, for example, Egeland, J. et al. (1987) Nature, 325:783-787.
Moreover, differences in the DNA sequences between individuals affected and unaffected with a disease associated with the CONAT-1 gene, can be determined. If a mutation is observed in some or all of the affected individuals but not in any unaffected individuals, then the mutation is likely to be the causative agent of the particular disease. Comparison of affected and unaffected individuals generally involves first looking for structural alterations in the chromosomes, such as deletions or translocations that are visible from chromosome spreads or detectable using PCR based on that DNA sequence. Ultimately, complete sequencing of genes from several individuals can be performed to confirm the presence of a mutation and to distinguish mutations from polymoφhisms.
2. Tissue Typing
The CONAT-1 sequences of the present invention can also be used to identify individuals from minute biological samples. The United States military, for example, is considering the use of restriction fragment length polymoφhism (RFLP) for identification of its personnel. In this technique, an individual's genomic DNA is digested with one or more restriction enzymes, and probed on a Southern blot to yield unique bands for identification. This method does not suffer from the current limitations of "Dog Tags" which can be lost, switched, or stolen, making positive identification difficult. The sequences of the present invention are useful as additional DNA markers for RFLP (described in U.S. Patent 5,272,057). Furthermore, the sequences of the present invention can be used to provide an alternative technique which determines the actual base-by-base DNA sequence of selected portions of an individual's genome. Thus, the CONAT-1 nucleotide sequences described herein can be used to prepare two PCR primers from the 5' and 3' ends of the sequences. These primers can then be used to amplify an individual's DNA and subsequently sequence it. Panels of corresponding DNA sequences from individuals, prepared in this manner, can provide unique individual identifications, as each individual will have a unique set of such DNA sequences due to allelic differences. The sequences of the present invention can be used to obtain such identification sequences from individuals and from tissue. The CONAT-1 nucleotide sequences of the invention uniquely represent portions of the human genome. Allelic variation occurs to some degree in the coding regions of these sequences, and to a greater degree in the noncoding regions. It is estimated that allelic variation between individual humans occurs with a frequency of about once per each 500 bases. Each of the sequences described herein can, to some degree, be used as a standard against which DNA from an individual can be compared for identification puφoses. Because greater numbers of polymoφhisms occur in the noncoding regions, fewer sequences are necessary to differentiate individuals. The noncoding sequences of SEQ ID NO:l can comfortably provide positive individual identification with a panel of perhaps 10 to 1,000 primers which each yield a noncoding amplified sequence of 100 bases. If predicted coding sequences, such as those in SEQ ID NO:3 or 5 are used, a more appropriate number of primers for positive individual identification would be 500-2,000.
If a panel of reagents from CONAT-1 nucleotide sequences described herein is used to generate a unique identification database for an individual, those same reagents can later be used to identify tissue from that individual. Using the unique identification database, positive identification of the individual, living or dead, can be made from extremely small tissue samples.
3. Use of Partial CONAT-1 Sequences in Forensic Biology DNA-based identification techniques can also be used in forensic biology.
Forensic biology is a scientific field employing genetic typing of biological evidence found at a crime scene as a means for positively- identifying, for example, a peφetrator of a crime. To make such an identification, PCR technology can be used to amplify DNA sequences taken from very small biological samples such as tissues, e.g., hair or skin, or body fluids, e.g., blood, saliva, or semen found at a crime scene. The amplified sequence can then be compared to a standard, thereby allowing identification of the origin of the biological sample. The sequences of the present invention can be used to provide polynucleotide reagents, e.g. , PCR primers, targeted to specific loci in the human genome, which can enhance the reliability of DNA-based forensic identifications by, for example, providing another "identification marker" (i.e. another DNA sequence that is unique to a particular individual). As mentioned above, actual base sequence information can be used for identification as an accurate alternative to patterns formed by restriction enzyme generated fragments. Sequences targeted to noncoding regions of SEQ ID NO:l are particularly appropriate for this use as greater numbers of polymoφhisms occur in the noncoding regions, making it easier to differentiate individuals using this technique. Examples of polynucleotide reagents include the CONAT-1 nucleotide sequences or portions thereof, e.g., fragments derived from the noncoding regions of SEQ ID NO:l having a length of at least 20 bases, preferably at least 30 bases.
The CONAT-1 nucleotide sequences described herein can further be used to provide polynucleotide reagents, e.g., labeled or labelable probes which can be used in, for example, an in situ hybridization technique, to identify a specific tissue, e.g., a tissue containing endothelial cells. This can be very useful in cases where a forensic pathologist is presented with a tissue of unknown origin. Panels of such CONAT-1 probes can be used to identify tissue by species and/or by organ type.
In a similar fashion, these reagents, e.g., CONAT-1 primers or probes can be used to screen tissue culture for contamination (i.e. screen for the presence of a mixture of different types of cells in a culture).
C. Predictive Medicine:
The present invention also pertains to the field of predictive medicine in which diagnostic assays, prognostic assays, and monitoring clinical trials are used for prognostic (predictive) puφoses to thereby treat an individual prophylactically. Accordingly, one aspect of the present invention relates to diagnostic assays for determining CONAT-1 protein and/or nucleic acid expression as well as CONAT-1 activity, in the context of a biological sample (e.g., blood, serum, cells, tissue) to thereby determine whether an individual is afflicted with a disease or disorder, or is at risk of developing a disorder, associated with aberrant or unwanted CONAT-1 expression or activity. The invention also provides for prognostic (or predictive) assays for determining whether an individual is at risk of developing a disorder associated with CONAT-1 protein, nucleic acid expression or activity. For example, mutations in a CONAT-1 gene can be assayed in a biological sample. Such assays can be used for prognostic or predictive puφose to thereby prophylactically treat an individual prior to the onset of a disorder characterized by or associated with CONAT-1 protein, nucleic acid expression or activity.
Another aspect of the invention pertains to monitoring the influence of agents (e.g., drugs, compounds) on the expression or activity of CONAT-1 in clinical trials. These and other agents are described in further detail in the following sections.
1. Diagnostic Assays
An exemplary method for detecting the presence or absence of CONAT-1 protein, polypeptide or nucleic acid in a biological sample involves obtaining a biological sample from a test subject and contacting the biological sample with a compound or an agent capable of detecting CONAT-1 protein, polypeptide or nucleic acid (e.g., mRNA, genomic DNA) that encodes CONAT-1 protein such that the presence of CONAT-1 protein or nucleic acid is detected in the biological sample. In another aspect, the present invention provides a method for detecting the presence of CONAT-1 activity in a biological sample by contacting the biological sample with an agent capable of detecting an indicator of CONAT-1 activity such that the presence of CONAT-1 activity is detected in the biological sample. A preferred agent for detecting CONAT-1 mRNA or genomic DNA is a labeled nucleic acid probe capable of hybridizing to CONAT-1 mRNA or genomic DNA. The nucleic acid probe can be, for example, a full-length CONAT-1 nucleic acid, such as the nucleic acid of SEQ ID NO:l, 3, or 5, or the DNA insert of the plasmid deposited with ATCC as Accession Number , or a portion thereof, such as an oligonucleotide of at least 15, 30, 50, 100, 250 or
500 nucleotides in length and sufficient to specifically hybridize under stringent conditions to CONAT-1 mRNA or genomic DNA. Other suitable probes for use in the diagnostic assays of the invention are described herein. A preferred agent for detecting CONAT-1 protein is an antibody capable of binding to CONAT-1 protein, preferably an antibody with a detectable label. Antibodies can be polyclonal, or more preferably, monoclonal. An intact antibody, or a fragment thereof (e.g., Fab or F(ab')2) can be used. The term "labeled", with regard to the probe or antibody, is intended to encompass direct labeling of the probe or antibody by coupling (i.e., physically linking) a detectable substance to the probe or antibody, as well as indirect labeling of the probe or antibody by reactivity with another reagent that is directly labeled. Examples of indirect labeling include detection of a primary antibody using a fluorescently labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently labeled streptavidin. The term "biological sample" is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject. That is, the detection method of the invention can be used to detect CONAT-1 mRNA, protein, or genomic DNA in a biological sample in vitro as well as in vivo. For example, in vitro techniques for detection of CONAT-1 mRNA include Northern hybridizations and in situ hybridizations. In vitro techniques for detection of CONAT-1 protein include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations and immunofluorescence. In vitro techniques for detection of CONAT-1 genomic DNA include Southern hybridizations. Furthermore, in vivo techniques for detection of a CONAT-1 protein include introducing into a subject a labeled anti-CONAT-1 antibody. For example, the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
The present invention also provides diagnostic assays for identifying the presence or absence of a genetic alteration characterized by at least one of (i) aberrant modification or mutation of a gene encoding a CONAT-1 protein; (ii) aberrant expression of a gene encoding a CONAT-1 protein; (iii) mis-regulation of the gene; and (iii) aberrant post-translational modification of a CONAT-1 protein, wherein a wild-type form of the gene encodes a protein with a CONAT-1 activity. "Misexpression or aberrant expression", as used herein, refers to a non-wild type pattern of gene expression, at the RNA or protein level. It includes, but is not limited to, expression at non-wild type levels (e.g., over or under expression); a pattern of expression that differs from wild type in terms of the time or stage at which the gene is expressed (e.g., increased or decreased expression (as compared with wild type) at a predetermined developmental period or stage); a pattern of expression that differs from wild type in terms of decreased expression (as compared with wild type) in a predetermined cell type or tissue type; a pattern of expression that differs from wild type in terms of the splicing size, amino acid sequence, post-transitional modification, or biological activity of the expressed polypeptide; a pattern of expression that differs from wild type in terms of the effect of an environmental stimulus or extracellular stimulus on expression of the gene (e.g., a pattern of increased or decreased expression (as compared with wild type) in the presence of an increase or decrease in the strength of the stimulus).
In one embodiment, the biological sample contains protein molecules from the test subject. Alternatively, the biological sample can contain mRNA molecules from the test subject or genomic DNA molecules from the test subject. A preferred biological sample is a serum sample isolated by conventional means from a subject.
In another embodiment, the methods further involve obtaining a control biological sample from a control subject, contacting the control sample with a compound or agent capable of detecting CONAT-1 protein, mRNA, or genomic DNA, such that the presence of CONAT- 1 protein, mRNA or genomic DNA is detected in the biological sample, and comparing the presence of CONAT-1 protein, mRNA or genomic DNA in the control sample with the presence of CONAT-1 protein, mRNA or genomic DNA in the test sample.
The invention also encompasses kits for detecting the presence of CONAT-1 in a biological sample. For example, the kit can comprise a labeled compound or agent capable of detecting CONAT-1 protein or mRNA in a biological sample; means for determining the amount of CONAT-1 in the sample; and means for comparing the amount of CONAT-1 in the sample with a standard. The compound or agent can be packaged in a suitable container. The kit can further comprise instructions for using the kit to detect CONAT-1 protein or nucleic acid.
2. Prognostic Assays
The diagnostic methods described herein can furthermore be utilized to identify subjects having or at risk of developing a disease or disorder associated with aberrant or unwanted CONAT-1 expression or activity. As used herein, the term "aberrant" includes a CONAT-1 expression or activity which deviates from the wild type CONAT- 1 expression or activity. Aberrant expression or activity includes increased or decreased expression or activity, as well as expression or activity which does not follow the wild type developmental pattern of expression or the subcellular pattern of expression. For example, aberrant CONAT-1 expression or activity is intended to include the cases in which a mutation in the CONAT-1 gene causes the CONAT-1 gene to be under- expressed or over-expressed and situations in which such mutations result in a nonfunctional CONAT-1 protein or a protein which does not function in a wild-type fashion, e.g., a protein which does not interact with a CONAT-1 substrate, or one which interacts with a non-CONAT-1 substrate. As used herein, the term "unwanted" includes an unwanted phenomenon involved in a biological response such as pain or deregulated cell proliferation. For example, the term unwanted includes a CONAT-1 expression or activity which is undesirable in a subject.
The assays described herein, such as the preceding diagnostic assays or the following assays, can be utilized to identify a subject having or at risk of developing a disorder associated with a misregulation in CONAT-1 protein activity or nucleic acid expression, such as a cell proliferation and/or differentiation disorder. Alternatively, the prognostic assays can be utilized to identify a subject having or at risk for developing a disorder associated with a misregulation in CONAT-1 protein activity or nucleic acid expression, such as a cell proliferation and/or differentiation disorder. Thus, the present invention provides a method for identifying a disease or disorder associated with aberrant or unwanted CONAT-1 expression or activity in which a test sample is obtained from a subject and CONAT-1 protein or nucleic acid (e.g., mRNA or genomic DNA) is detected, wherein the presence of CONAT-1 protein or nucleic acid is diagnostic for a subject having or at risk of developing a disease or disorder associated with aberrant or unwanted CONAT-1 expression or activity. As used herein, a "test sample" refers to a biological sample obtained from a subject of interest. For example, a test sample can be a biological fluid (e.g., serum), cell sample, or tissue.
Furthermore, the prognostic assays described herein can be used to determine whether a subject can be administered an agent (e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drag candidate) to treat a disease or disorder associated with aberrant or unwanted CONAT-1 expression or activity. For example, such methods can be used to determine whether a subject can be effectively treated with an agent for a cell proliferation and/or differentiation disorder. Thus, the present invention provides methods for determining whether a subject can be effectively treated with an agent for a disorder associated with aberrant or unwanted CONAT-1 expression or activity in which a test sample is obtained and CONAT-1 protein or nucleic acid expression or activity is detected (e.g., wherein the abundance of CONAT-1 protein or nucleic acid expression or activity is diagnostic for a subject that can be administered the agent to treat a disorder associated with aberrant or unwanted CONAT-1 expression or activity).
The methods of the invention can also be used to detect genetic alterations in a CONAT-1 gene, thereby determining if a subject with the altered gene is at risk for a disorder characterized by misregulation in CONAT-1 protein activity or nucleic acid expression, such as a cell proliferation and/or differentiation disorder. In preferred embodiments, the methods include detecting, in a sample of cells from the subject, the presence or absence of a genetic alteration characterized by at least one of an alteration affecting the integrity of a gene encoding a CONAT-1 -protein, or the mis-expression of the CONAT-1 gene. For example, such genetic alterations can be detected by ascertaining the existence of at least one of 1) a deletion of one or more nucleotides ' from a CONAT-1 gene; 2) an addition of one or more nucleotides to a CONAT-1 gene; 3) a substitution of one or more nucleotides of a CONAT-1 gene, 4) a chromosomal rearrangement of a CONAT-1 gene; 5) an alteration in the level of a messenger RNA transcript of a CONAT-1 gene, 6) aberrant modification of a CONAT-1 gene, such as of the methylation pattern of the genomic DNA, 7) the presence of a non-wild type splicing pattern of a messenger RNA transcript of a CONAT-1 gene, 8) a non-wild type level of a CONAT-1 -protein, 9) allelic loss of a CONAT-1 gene, and 10) inappropriate post- translational modification of a CONAT-1 -protein. As described herein, there are a large number of assays known in the art which can be used for detecting alterations in a
CONAT-1 gene. A preferred biological sample is a tissue or serum sample isolated by conventional means from a subject.
In certain embodiments, detection of the alteration involves the use of a probe/primer in a polymerase chain reaction (PCR) (see, e.g., U.S. Patent Nos. 4,683,195 and 4,683,202), such as anchor PCR or RACE PCR, or, alternatively, in a ligation chain reaction (LCR) (see, e.g., Landegran et al. (1988) Science 241:1077-1080; andNakazawa et al. (1994) Proc. Natl. Acad. Sci. USA 91:360-364), the latter of which can be particularly useful for detecting point mutations in the CONAT-1 -gene (see Abravaya et al. (1995) Nucleic Acids Res .23:675-682). This method can include the steps of collecting a sample of cells from a subject, isolating nucleic acid (e.g., genomic, mRNA or both) from the cells of the sample, contacting the nucleic acid sample with one or more primers which specifically hybridize to a CONAT-1 gene under conditions such that hybridization and amplification of the CONAT-1 -gene (if present) occurs, and detecting the presence or absence of an amplification product, or detecting the size of the amplification product and comparing the length to a control sample. It is anticipated that PCR and/or LCR may be desirable to use as a preliminary amplification step in conjunction with any of the techniques used for detecting mutations described herein. Alternative amplification methods include: self sustained sequence replication (Guatelli, J.C. et al., (1990) Proc. Natl. Acad. Sci. USA 87:1874-1878), transcriptional amplification system (Kwoh, D.Y. et al., (1989) Proc. Natl. Acad. Sci. USA 86:1173- 1177), Q-Beta Replicase (Lizardi, P.M. et al. (1988) Bio-Technology 6:1197), or any other nucleic acid amplification method, followed by the detection of the amplified molecules using techniques well known to those of skill in the art. These detection schemes are especially useful for the detection of nucleic acid molecules if such molecules are present in very low numbers.
In an alternative embodiment, mutations in a CONAT-1 gene from a sample cell can be identified by alterations in restriction enzyme cleavage patterns. For example, sample and control DNA is isolated, amplified (optionally), digested with one or more restriction endonucleases, and fragment length sizes are determined by gel electrophoresis and compared. Differences in fragment length sizes between sample and control DNA indicates mutations in the sample DNA. Moreover, the use of sequence specific ribozymes (see, for example, U.S. Patent No. 5,498,531) can be used to score for the presence of specific mutations by development or loss of a ribozyme cleavage site.
In other embodiments, genetic mutations in CONAT-1 can be identified by hybridizing a sample and control nucleic acids, e.g., DNA or RNA, to high density arrays containing hundreds or thousands of oligonucleotides probes (Cronin, M.T. et al. (1996) Human Mutation 7: 244-255; Kozal, M.J. et al. (1996) Nature Medicine 2: 753- 759). For example, genetic mutations in CONAT-1 can be identified in two dimensional arrays containing light-generated DNA probes as described in Cronin, M.T. et al. supra. Briefly, a first hybridization array of probes can be used to scan through long stretches of DNA in a sample and control to identify base changes between the sequences by making linear arrays of sequential overlapping probes. This step allows the identification of point mutations. This step is followed by a second hybridization array that allows the characterization of specific mutations by using smaller, specialized probe arrays complementary to all variants or mutations detected. Each mutation array is composed of parallel probe sets, one complementary to the wild-type gene and the other complementary to the mutant gene. In yet another embodiment, any of a variety of sequencing reactions known in the art can be used to directly sequence the CONAT-1 gene and detect mutations by comparing the sequence of the sample CONAT-1 with the corresponding wild-type (control) sequence. Examples of sequencing reactions include those based on techniques developed by Maxam and Gilbert ((1977) Proc. Natl. Acad. Sci. USA 74:560) or Sanger ((1977) Proc. Natl. Acad. Sci. USA 74:5463). It is also contemplated that any of a variety of automated sequencing procedures can be utilized when performing the diagnostic assays ((1995) Biotechniques 19:448), including sequencing by mass spectrometry (see, e.g., PCT International Publication No. WO 94/16101; Cohen et al. (1996) Adv. Chromatogr. 36:127-162; and Griffin et al. (1993) Appl. Biochem. Biotechnol. 38:147-159).
Other methods for detecting mutations in the CONAT-1 gene include methods in which protection from cleavage agents is used to detect mismatched bases in RNA/RNA or RNA/DNA heteroduplexes (Myers et al. (1985) Science 230:1242). In general, the art technique of "mismatch cleavage" starts by providing heteroduplexes formed by hybridizing (labeled) RNA or DNA containing the wild-type CONAT-1 sequence with potentially mutant RNA or DNA obtained from a tissue sample. The double-stranded duplexes are treated with an agent which cleaves single-stranded regions of the duplex such as which will exist due to basepair mismatches between the control and sample strands. For instance, RNA/DNA duplexes can be treated with RNase and DNA/DNA hybrids treated with SI nuclease to enzymatically digesting the mismatched regions. In other embodiments, either DNA DNA or RNA/DNA duplexes can be treated with hydroxylamine or osmium tetroxide and with piperidine in order to digest mismatched regions. After digestion of the mismatched regions, the resulting material is then separated by size on denaturing polyacrylamide gels to determine the site of mutation. See, for example, Cotton et al. (1988) Proc. Natl Acad Sci USA 85:4397; Saleeba et al. (1992) Methods Enzymol. 217:286-295. In a preferred embodiment, the control DNA or RNA can be labeled for detection.
In still another embodiment, the mismatch cleavage reaction employs one or more proteins that recognize mismatched base pairs in double-stranded DNA (so called "DNA mismatch repair" enzymes) in defined systems for detecting and mapping point mutations in CONAT-1 cDNAs obtained from samples of cells. For example, the mutY enzyme of E. coli cleaves A at G/A mismatches and the thymidine DNA glycosylase from HeLa cells cleaves T at G/T mismatches (Hsu et al. (1994) Carcinogenesis 15:1657-1662). According to an exemplary embodiment, a probe based on a CONAT-1 sequence, e.g., a wild-type CONAT-1 sequence, is hybridized to a cDNA or other DNA product from a test cell(s). The duplex is treated with a DNA mismatch repair enzyme, and the cleavage products, if any, can be detected from electrophoresis protocols or the like. See, for example, U.S. Patent No. 5,459,039.
In other embodiments, alterations in electrophoretic mobility will be used to identify mutations in CONAT-1 genes. For example, single strand conformation polymoφhism (SSCP) may be used to detect differences in electrophoretic mobility between mutant and wild type nucleic acids (Orita et al. (1989) Proc Natl. Acad. Sci USA: 86:2166, see also Cotton (1993) Mutat. Res. 285:125-144; and Hayashi (1992) Genet. Anal. Tech. Appl. 9:73-79). Single-stranded DNA fragments of sample and control CONAT-1 nucleic acids will be denatured and allowed to renature. The secondary stracture of single-stranded nucleic acids varies according to sequence, the resulting alteration in electrophoretic mobility enables the detection of even a single base change. The DNA fragments may be labeled or detected with labeled probes. The sensitivity of the assay may be enhanced by using RNA (rather than DNA), in which the secondary stracture is more sensitive to a change in sequence. In a preferred embodiment, the subject method utilizes heteroduplex analysis to separate double stranded heteroduplex molecules on the basis of changes in electrophoretic mobility (Keen et al. (1991) Trends Genet 7:5). In yet another embodiment the movement of mutant or wild-type fragments in polyacrylamide gels containing a gradient of denaturant is assayed using denaturing gradient gel electrophoresis (DGGE) (Myers et al. (1985) Nature 313:495). When DGGE is used as the method of analysis, DNA will be modified to insure that it does not completely denature, for example by adding a GC clamp of approximately 40 bp of high-melting GC-rich DNA by PCR. In a further embodiment, a temperature gradient is used in place of a denaturing gradient to identify differences in the mobility of control and sample DNA (Rosenbaum and Reissner (1987) Biophys Chem 265:12753).
Examples of other techniques for detecting point mutations include, but are not limited to, selective oligonucleotide hybridization, selective amplification, or selective primer extension. For example, oligonucleotide primers may be prepared in which the known mutation is placed centrally and then hybridized to target DNA under conditions which permit hybridization only if a perfect match is found (Saiki et al. (1986) Nature 324:163); Saiki et al. (1989) Proc. Natl Acad. Sci USA 86:6230). Such allele specific oligonucleotides are hybridized to PCR amplified target DNA or a number of different mutations when the oligonucleotides are attached to the hybridizing membrane and hybridized with labeled target DNA.
Alternatively, allele specific amplification technology which depends on selective PCR amplification may be used in conjunction with the instant invention. Oligonucleotides used as primers for specific amplification may carry the mutation of interest in the center of the molecule (so that amplification depends on differential hybridization) (Gibbs et al. (1989) Nucleic Acids Res. 17:2437-2448) or at the extreme 3' end of one primer where, under appropriate conditions, mismatch can prevent, or reduce polymerase extension (Prossner (1993) Tibtech 11 :238). In addition it may be desirable to introduce a novel restriction site in the region of the mutation to create cleavage-based detection (Gasparini et al. (1992) Mol. Cell Probes 6:1). It is anticipated that in certain embodiments amplification may also be performed using Taq ligase for amplification (Barany (1991) Proc. Natl. Acad. Sci USA 88:189). In such cases, ligation will occur only if there is a perfect match at the 3' end of the 5' sequence making it possible to detect the presence of a known mutation at a specific site by looking for the presence or absence of amplification. The methods described herein may be performed, for example, by utilizing prepackaged diagnostic kits comprising at least one probe nucleic acid or antibody reagent described herein, which may be conveniently used, e.g., in clinical settings to diagnose patients exhibiting symptoms or family history of a disease or illness involving a CONAT-1 gene.
Furthermore, any cell type or tissue in which CONAT-1 is expressed may be utilized in the prognostic assays described herein.
3. Monitoring of Effects During Clinical Trials Monitoring the influence of agents (e.g. , drags) on the expression or activity of a
CONAT-1 protein (e.g., the modulation of gene expression, and or cell growth and differentiation mechanisms) can be applied not only in basic drag screening, but also in clinical trials. For example, the effectiveness of an agent determined by a screening assay as described herein to increase CONAT-1 gene expression, protein levels, or upregulate CONAT-1 activity, can be monitored in clinical trials of subjects exhibiting decreased CONAT-1 gene expression, protein levels, or downregulated CONAT-1 activity. Alternatively, the effectiveness of an agent determined by a screening assay to decrease CONAT-1 gene expression, protein levels, or downregulate CONAT-1 activity, can be monitored in clinical trials of subjects exhibiting increased CONAT-1 gene expression, protein levels, or upregulated CONAT-1 activity. In such clinical trials, the expression or activity of a CONAT-1 gene, and preferably, other genes that have been implicated in, for example, a CONAT-1 -associated disorder can be used as a "read out" or markers of the phenotype of a particular cell.
For example, and not by way of limitation, genes, including CONAT-1, that are modulated in cells by treatment with an agent (e.g. , compound, drug or small molecule) which modulates CONAT-1 activity (e.g., identified in a screening assay as described herein) can be identified. Thus, to study the effect of agents on CONAT-1 -associated disorders (e.g., disorders characterized by deregulated gene expression, and/or cell growth and differentiation mechanisms), for example, in a clinical trial, cells can be isolated and RNA prepared and analyzed for the levels of expression of CONAT-1 and other genes implicated in the CONAT-1 -associated disorder, respectively. The levels of gene expression (e.g., a gene expression pattern) can be quantified by northern blot analysis or RT-PCR, as described herein, or alternatively by measuring the amount of protein produced, by one of the methods as described herein, or by measuring the levels of activity of CONAT-1 or other genes. In this way, the gene expression pattern can serve as a marker, indicative of the physiological response of the cells to the agent. Accordingly, this response state may be determined before, and at various points during treatment of the individual with the agent.
In a preferred embodiment, the present invention provides a method for monitoring the effectiveness of treatment of a subject with an agent (e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drag candidate identified by the screening assays described herein) including the steps of (i) obtaining a pre-administration sample from a subject prior to administration of the agent; (ii) detecting the level of expression of a CONAT-1 protein, mRNA, or genomic DNA in the preadministration sample; (iii) obtaining one or more post-administration samples from the subject; (iv) detecting the level of expression or activity of the CONAT-1 protein, mRNA, or genomic DNA in the post-administration samples; (v) comparing the level of expression or activity of the CONAT-1 protein, mRNA, or genomic DNA in the pre-administration sample with the CONAT-1 protein, mRNA, or genomic DNA in the post administration sample or samples; and (vi) altering the administration of the agent to the subject accordingly. For example, increased administration of the agent may be desirable to increase the expression or activity of CONAT-1 to higher levels than detected, i.e., to increase the effectiveness of the agent. Alternatively, decreased administration of the agent may be desirable to decrease expression or activity of CONAT-1 to lower levels than detected, i.e. to decrease the effectiveness of the agent. According to such an embodiment, CONAT-1 expression or activity may be used as an indicator of the effectiveness of an agent, even in the absence of an observable phenotypic response.
D. Methods of Treatment:
The present invention provides for both prophylactic and therapeutic methods of treating a subject at risk of (or susceptible to) a disorder or having a disorder associated with aberrant or unwanted CONAT-1 expression or activity, e.g. a CONAT-1 associated or CONAT-1 related disorder, for example, a cell growth, differentiation, migration, or apoptosis disorder, for example, in the colon. With regards to both prophylactic and therapeutic methods of treatment, such treatments may be specifically tailored or modified, based on knowledge obtained from the field of pharmacogenomics. "Pharmacogenomics", as used herein, refers to the application of genomics technologies such as gene sequencing, statistical genetics, and gene expression analysis to drugs in clinical development and on the market. More specifically, the term refers the study of how a patient's genes determine his or her response to a drug (e.g., a patient's "drug response phenotype", or "drag response genotype".) Thus, another aspect of the invention provides methods for tailoring an individual's prophylactic or therapeutic treatment with either the CONAT-1 molecules of the present invention or CONAT-1 modulators according to that individual's drag response genotype. Pharmacogenomics allows a clinician or physician to target prophylactic or therapeutic treatments to patients who will most benefit from the treatment and to avoid treatment of patients who will experience toxic drag-related side effects.
1. Prophylactic Methods
In one aspect, the invention provides a method for preventing in a subject, a disease or condition associated with an aberrant or unwanted CONAT-1 expression or activity, by administering to the subject a CONAT-1 or an agent which modulates CONAT-1 expression or at least one CONAT-1 activity. Subjects at risk for a disease which is caused or contributed to by aberrant or unwanted CONAT-1 expression or activity can be identified by, for example, any or a combination of diagnostic or prognostic assays as described herein. Administration of a prophylactic agent can occur prior to the manifestation of symptoms characteristic of the CONAT-1 aberrancy, such that a disease or disorder is prevented or, alternatively, delayed in its progression. Depending on the type of CONAT-1 aberrancy, for example, a CONAT-1, CONAT-1 agonist or CONAT-1 antagonist agent can be used for treating the subject. The appropriate agent can be determined based on screening assays described herein. 2. Therapeutic Methods
Another aspect of the invention pertains to methods of modulating CONAT-1 expression or activity for therapeutic puφoses. Accordingly, in an exemplary embodiment, the modulatory method of the invention involves contacting a cell capable of expressing CONAT-1 with an agent that modulates one or more of the activities of CONAT-1 protein activity associated with the cell, such that CONAT-1 activity in the cell is modulated. An agent that modulates CONAT-1 protein activity can be an agent as described herein, such as a nucleic acid or a protein, a naturally-occurring target molecule of a CONAT-1 protein (e.g., a CONAT-1 substrate or ligand), a CONAT-1 antibody, a CONAT-1 agonist or antagonist, a peptidomimetic of a CONAT-1 agonist or antagonist, or other small molecule. In one embodiment, the agent stimulates one or more CONAT-1 activities. Examples of such stimulatory agents include active CONAT-1 protein and a nucleic acid molecule encoding CONAT-1 that has been introduced into the cell. In another embodiment, the agent inhibits one or more CONAT-1 activities. Examples of such inhibitory agents include antisense CONAT-1 nucleic acid molecules, anti-CONAT-1 antibodies, and CONAT-1 inhibitors. These modulatory methods can be performed in vitro (e.g., by culturing the cell with the agent) or, alternatively, in vivo (e.g., by administering the agent to a subject). As such, the present invention provides methods of treating an individual afflicted with a disease or disorder characterized by aberrant or unwanted expression or activity of a CONAT-1 protein or nucleic acid molecule. In one embodiment, the method involves administering an agent (e.g., an agent identified by a screening assay described herein), or combination of agents that modulates (e.g., upregulates or downregulates) CONAT-1 expression or activity. In another embodiment, the method involves administering a CONAT-1 protein or nucleic acid molecule as therapy to compensate for reduced, aberrant, or unwanted CONAT-1 expression or activity.
Stimulation of CONAT-1 activity is desirable in situations in which CONAT-1 is abnormally downregulated and/or in which increased CONAT-1 activity is likely to have a beneficial effect. For example, stimulation of CONAT-1 activity is desirable in situations in which a CONAT-1 is downregulated and/or in which increased CONAT-1 activity is likely to have a beneficial effect. Likewise, inhibition of CONAT-1 activity is desirable in situations in which CONAT-1 is abnormally upregulated and/or in which decreased CONAT-1 activity is likely to have a beneficial effect.
3. Pharmacogenomics The CONAT-1 molecules of the present invention, as well as agents, or modulators which have a stimulatory or inhibitory effect on CONAT-1 activity (e.g., CONAT-1 gene expression) as identified by a screening assay described herein can be administered to individuals to treat (prophylactically or therapeutically) CONAT- 1- associated disorders (e.g., disorders characterized by aberrant gene expression, or cell proliferation and/or differentiation disorders) associated with aberrant or unwanted CONAT-1 activity. In conjunction with such treatment, pharmacogenomics (i.e., the study of the relationship between an individual's genotype and that individual's response to a foreign compound or drag) may be considered. Differences in metabolism of therapeutics can lead to severe toxicity or therapeutic failure by altering the relation between dose and blood concentration of the pharmacologically active drag. Thus, a physician or clinician may consider applying knowledge obtained in relevant pharmacogenomics studies in determining whether to administer a CONAT-1 molecule or CONAT-1 modulator as well as tailoring the dosage and/or therapeutic regimen of treatment with a CONAT-1 molecule or CONAT-1 modulator. Pharmacogenomics deals with clinically significant hereditary variations in the response to drags due to altered drag disposition and abnormal action in affected persons. See, for example, Eichelbaum, M. et al. (1996) Gin. Exp. Pharmacol. Physiol. 23(10-11) :983-985 and Linder, M.W. et al. (1997) Gin. Chem. 43(2):254-266. In general, two types of pharmacogenetic conditions can be differentiated. Genetic conditions transmitted as a single factor altering the way drugs act on the body (altered drug action) or genetic conditions transmitted as single factors altering the way the body acts on drugs (altered drag metabolism). These pharmacogenetic conditions can occur either as rare genetic defects or as naturally-occurring polymoφhisms. For example, glucose-6-phosphate dehydrogenase deficiency (G6PD) is a common inherited enzymopathy in which the main clinical complication is haemolysis after ingestion of oxidant drugs (anti-malarials, sulfonamides, analgesics, nitrofurans) and consumption of fava beans. One pharmacogenomics approach to identifying genes that predict drug response, known as "a genome-wide association", relies primarily on a high-resolution map of the human genome consisting of already known gene-related markers (e.g., a "bi-allelic" gene marker map which consists of 60,000-100,000 polymoφhic or variable sites on the human genome, each of which has two variants.) Such a high-resolution genetic map can be compared to a map of the genome of each of a statistically significant number of patients taking part in a Phase II/III drag trial to identify markers associated with a particular observed drag response or side effect. Alternatively, such a high resolution map can be generated from a combination of some ten-million known single nucleotide polymoφhisms (SNPs) in the human genome. As used herein, a "SNP" is a common alteration that occurs in a single nucleotide base in a stretch of DNA. For example, a SNP may occur once per every 1000 bases of DNA. A SNP may be involved in a disease process, however, the vast majority may not be disease- associated. Given a genetic map based on the occurrence of such SNPs, individuals can be grouped into genetic categories depending on a particular pattern of SNPs in their individual genome. In such a manner, treatment regimens can be tailored to groups of genetically similar individuals, taking into account traits that may be common among such genetically similar individuals.
Alternatively, a method termed the "candidate gene approach", can be utilized to identify genes that predict drug response. According to this method, if a gene that encodes a drag's target is known (e.g., a CONAT-1 protein of the present invention), all common variants of that gene can be fairly easily identified in the population and it can be determined if having one version of the gene versus another is associated with a particular drag response. As an illustrative embodiment, the activity of drug metabolizing enzymes is a major determinant of both the intensity and duration of drag action. The discovery of genetic polymoφhisms of drug metabolizing enzymes (e.g., N-acetyltransferase 2 (NAT 2) and cytochrome P450 enzymes CYP2D6 and CYP2C19) has provided an explanation as to why some patients do not obtain the expected drag effects or show exaggerated drug response and serious toxicity after taking the standard and safe dose of a drag. These polymoφhisms are expressed in two phenotypes in the population, the extensive metabohzer (EM) and poor metabohzer (PM). The prevalence of PM is different among different populations. For example, the gene coding for CYP2D6 is highly polymoφhic and several mutations have been identified in PM, which all lead to the absence of functional CYP2D6. Poor metabolizers of CYP2D6 and CYP2C19 quite frequently experience exaggerated drag response and side effects when they receive standard doses. If a metabolite is the active therapeutic moiety, PM show no therapeutic response, as demonstrated for the analgesic effect of codeine mediated by its CYP2D6-formed metabolite moφhine. The other extreme are the so called ultra-rapid metabolizers who do not respond to standard doses. Recently, the molecular basis of ultra-rapid metabolism has been identified to be due to CYP2D6 gene amplification. Alternatively, a method termed the "gene expression profiling", can be utilized to identify genes that predict drug response. For example, the gene expression of an animal dosed with a drug (e.g., a CONAT-1 molecule or CONAT-1 modulator of the present invention) can give an indication whether gene pathways related to toxicity have been turned on. Information generated from more than one of the above pharmacogenomics approaches can be used to determine appropriate dosage and treatment regimens for prophylactic or therapeutic treatment an individual. This knowledge, when applied to dosing or drug selection, can avoid adverse reactions or therapeutic failure and thus enhance therapeutic or prophylactic efficiency when treating a subject with a CONAT-1 molecule or CONAT-1 modulator, such as a modulator identified by one of the exemplary screening assays described herein.
4. Use of CONAT-1 Molecules as Surrogate Markers
The CONAT-1 molecules of the invention are also useful as markers of disorders or disease states, as markers for precursors of disease states, as markers for predisposition of disease states, as markers of drag activity, or as markers of the pharmacogenomic profile of a subject. Using the methods described herein, the presence, absence and/or quantity of the CONAT-1 molecules of the invention may be detected, and may be correlated with one or more biological states in vivo. For example, the CONAT-1 molecules of the invention may serve as surrogate markers for one or more disorders or disease states or for conditions leading up to disease states. As used herein, a "surrogate marker" is an objective biochemical marker which correlates with the absence or presence of a disease or disorder, or with the progression of a disease or disorder (e.g., with the presence or absence of a tumor). The presence or quantity of such markers is independent of the disease. Therefore, these markers may serve to indicate whether a particular -course of treatment is effective in lessening a disease state or disorder. Surrogate markers are of particular use when the presence or extent of a disease state or disorder is difficult to assess through standard methodologies (e.g., early stage tumors), or when an assessment of disease progression is desired before a potentially dangerous clinical endpoint is reached (e.g., an assessment of cardiovascular disease may be made using cholesterol levels as a surrogate marker, and an analysis of HIV infection may be made using HIV RNA levels as a surrogate marker, well in advance of the undesirable clinical outcomes of myocardial infarction or fully-developed AIDS). Examples of the use of surrogate markers in the art include: Koomen et al. (2000) J Mass. Spectrom. 35: 258-264; and James (1994) AIDS Treatment News Archive 209. The CONAT-1 molecules of the invention are also useful as pharmacodynamic markers. As used herein, a "pharmacodynamic marker" is an objective biochemical marker which correlates specifically with drug effects. The presence or quantity of a pharmacodynamic marker is not related to the disease state or disorder for which the drug is being administered; therefore, the presence or quantity of the marker is indicative of the presence or activity of the drag in a subject. For example, a pharmacodynamic marker may be indicative of the concentration of the drug in a biological tissue, in that the marker is either expressed or transcribed or not expressed or transcribed in that tissue in relationship to the level of the drag. In this fashion, the distribution or uptake of the drag may be monitored by the pharmacodynamic marker. Similarly, the presence or quantity of the pharmacodynamic marker may be related to the presence or quantity of the metabolic product of a drag, such that the presence or quantity of the marker is indicative of the relative breakdown rate of the drag in vivo. Pharmacodynamic markers are of particular use in increasing the sensitivity of detection of drag effects, particularly when the drug is administered in low doses. Since even a small amount of a drag may be sufficient to activate multiple rounds of marker (e.g., a CONAT-1 marker) transcription or expression, the amplified marker may be in a quantity which is more readily detectable than the drag itself. Also, the marker may be more easily detected due to the nature of the marker itself; for example, using the methods described herein, anti- CONAT-1 antibodies may be employed in an immune-based detection system for a CONAT-1 protein marker, or CONAT-1 -specific radiolabeled probes may be used to detect a CONAT-1 mRNA marker. Furthermore, the use of a pharmacodynamic marker may offer mechanism-based prediction of risk due to drag treatment beyond the range of possible direct observations. Examples of the use of pharmacodynamic markers in the art include: Matsuda et al. US 6,033,862; Hattis et al. (1991) Env. Health Perspect. 90: 229-238; Schentag (1999) Am. J. Health-Syst. Pharm. 56 Suppl. 3: S21-S24; and Nicolau (1999) Am, J. Health-Syst. Pharm. 56 Suppl. 3: S16-S20. The CONAT-1 molecules of the invention are also useful as pharmacogenomic markers. As used herein, a "pharmacogenomic marker" is an objective biochemical marker which correlates with a specific clinical drag response or susceptibility in a subject (see, e.g., McLeod et al (1999) Eur. J. Cancer 35(12): 1650-1652). The presence or quantity of the pharmacogenomic marker is related to the predicted response of the subject to a specific drag or class of drugs prior to administration of the drag." By assessing the presence or quantity of one or more pharmacogenomic markers in a subject, a drug therapy which is most appropriate for the subject, or which is predicted to have a greater degree of success, may be selected. For example, based on the presence or quantity of RNA, or protein (e.g., CONAT-1 protein or RNA) for specific tumor markers in a subject, a drag or course of treatment may be selected that is optimized for the treatment of the specific tumor likely to be present in the subject. Similarly, the presence or absence of a specific sequence mutation in CONAT-1 DNA may correlate CONAT-1 drug response. The use of pharmacogenomic markers therefore permits the application of the most appropriate treatment for each subject without having to administer the therapy.
This invention is further illustrated by the following examples which should not be construed as limiting. The contents of all references, patents and published patent applications cited throughout this application are incoφorated herein by reference. EXAMPLES
The content of the appendices and figures described herein are incoφorated in their entirety by this reference.
EXAMPLE 1: IDENTIFICATION AND CHARACTERIZATION OF
HUMAN CONAT-1 cDNA
In this example, the identification and characterization of the gene encoding human CONAT-1 (clone Fbh26320) is described.
Isolation of the human CONAT-1 cDNA
The invention is based, at least in part, on the discovery of genes encoding novel members of the acetyltransferase family. The nucleotide sequence encoding human CONAT-1 polypeptide is shown in
Figure 1 and is set forth as SEQ ID NO: 1. The CONAT-1 polypeptide encoded by this nucleic acid comprises about 139 amino acids and has the amino acid sequence shown in Figure 1 and set forth as SEQ ID NO:2. CONAT-1 coding region sequences of SEQ ID NO:l are set forth as SEQ ID NO:3. A second CONAT-1 polypeptide potentially encoded by this nucleic acid comprises about 268 amino acids and has the amino acid sequence shown in Figure 2 and set forth as SEQ ID NO:4 with coding region sequences set forth as SEQ ID NO:5. Clone Fbh26320 comprising the human CONAT-1 cDNA was deposited with the American Type Culture Collection (ATCC®), 10801 University Boulevard, Manassas, VA 20110-2209, on , and assigned Accession No. .
Analysis of the human CONAT-1 Molecules
A search using the polypeptide sequence of SEQ ID NO:2 was performed against the HMM database resulting in the identification of an acetyltransferase domain in the amino acid sequence of human CONAT-1 (SEQ ID NO:2) at about residues 1-116 of SEQ ID NO:2 (see Appendix A3). An acetyltransferase domain in the polypeptide sequence of SEQ ID NO:4 can be found at about residues 122-245 of SEQ ID NO:4 (see Appendix A7).
The CONAT-1 protein also includes a potential N-glycosylation site at about amino acid residues 103-106 of SEQ ID NO:2; potential protein kinase C phosphorylation sites at about amino acids 20-22 and 102-104 of SEQ ID NO:2; and potential N-myristoylation sites at about amino acids 43-48 and 74-79 of SEQ ID NO:2 (see Appendix A2).
The CONAT- lb protein also includes potential protein kinase C phosphorylation sites from about amino acid residues 102-104, 107-109, 118-120, 149-151, and 231-233 of SEQ ID NO:4; potential casein kinase II phosphorylation sites from about amino acid residues 13-16, 58-61, 79-82, and 107-110 of SEQ ID NO:4; potential N- myristoylation sites from about amino acid residues 26-31, 37-42, 74-79, 172-177, and 203-208 of SEQ ID:NO4; and a potential N-glycosylation site from about amino acid residues 232-235 of SEQ ID NO:4 (see Appendix A6). A BLAST search (Altschul et al. (1990) J. Mol. Biol. 215:403) of the protein sequences of human CONAT-1 revealed that CONAT-1 is similar to a Drosophila melanogaster N-acetyltransferase protein (Accession No. AL022018) having approximately 74% identity over amino acids 3-139 of CONAT-1 (SEQ ID NO:2) and over amino acids 132-268 of CONAT-lb (SEQ ID NO:4) (Identities were calculated using the BLAST algorithms of Altschul et al. (as described herein)).
Additional homologies to other acetyltransferase proteins from C. elegans, A. thaliana, and S. pombe were identified, as were homologies to the S. cerevisiae MAK 3 N-acetyltransferase and the RD 1 N-acetyltransferase complex, ARD1 subunit.
Expression Profile of CONAT-1 mRNA/cDNA
This example describes the tissue distribution of CONAT-1 mRNA, as was determined by RT-PCR, in situ hybridization, and measured by quantitative PCR using the Taqman™ procedure as described below.
For in situ analysis, various tissues were frozen, sectioned, fixed, and probed using standard in situ hybridization methodologies. CONAT-1 expression levels were measured in a variety of tissue and cell samples using the Taqman™ procedure . The Taqman™ procedure is a quantitative, real-time PCR-based approach to detecting mRNA. The RT-PCR reaction exploits the 5' nuclease activity of AmplTaq Gold™ DNA Polymerase to cleave a TaqMan™ probe during PCR. Briefly, cDNA is generated from the samples of interest and serves as the starting materials for PCR amplification. In addition to the 5' and 3' gene-specific primers, a gene-specific oligonucleotide probe (complementary to the region being amplified) is included in the reaction (i.e., the Taqman™ probe). The TaqMan™ probe includes the oligonucleotide with a fluorescent reporter dye covalently linked to the 5' end of the probe (such as FAM (6-carboxyfluorescein), TET (6-carboxy-4,7,2',7'- tetrachlorofluorescein), JOE (6-carboxy-4,5-dichloro-2,7-dimethoxyfluorescein), or VIC) and a quencher dye (TAMRA (6-carboxy-N,N,N',N'-tetramethylrhodamine) at the 3' end of the probe.
During the PCR reaction, cleavage of the probe separates the reporter dye and the quencher dye, resulting in increased fluorescence of the reporter. Accumulation of PCR products is detected directly by monitoring the increase in fluorescence of the reporter dye. When the probe is intact, the proximity of the reporter dye to the quencher dye results in suppression of the reporter fluorescence. During PCR, if the target of interest is present, the probe specifically anneals between the forward and reverse primer sites. The 5 '-3' nucleolytic activity of the AmpliTaq™ Gold DNA Polymerase cleaves the probe between the reporter and the quencher only if the probe hybridizes to the target. The probe fragments are then displaced from the target, and polymerization of the strand continues. The 3' end of the probe is blocked to prevent extension of the probe during PCR. This process occurs in every cycle and does not interfere with the exponential accumulation of product.
Using these assays, it was determined that CONAT-1 mRNA was expressed at least in fetal liver, Hepa2 cells and osteoblasts. Increased CONAT-1 expression was also detected in 5/7 clinical colon tumors in comparison to 2/3 clinical normal colon tissues. Moderate to low expression was detected in colon primary tumor cells (2/3) and liver metastasis cells (2/2), but not normal colon cells (0/2). In the lung, little or no expression was seen in tumor cells (2/5 tumor, 0/3 normal). In breast, little or no expression was seen in tumor epithelium (1/3 tumor, 0/3 normal). According to expression profiling (e.g., HMPGv2) analysis, increased expression of human CONAT- 1 was detected in APCmιn adenomas as compared to normal small intestine. These data reveal that there exists a correlation between tumors (e.g., colon tumors) and CONAT-1 expression. Moreover, according to a cDNA library array analysis, high expression of CONAT-1 was detected in U937, HL60 and K563 cells.
These data reveal a significant upregulation of CONAT-1 mRNA in at least colon tumors. Given that the mRNA for CONAT-1 is expressed in a variety of tumors, it is believed that CONAT-1 may serve as a good tumor and/or metastatic marker. Moreover, inhibition of CONAT-1 activity may inhibit tumor progression.
EXAMPLE 2: EXPRESSION OF RECOMBINANT CONAT-1 PROTEIN I
BACTERIAL CELLS
In this example, CONAT-1 is expressed as a recombinant glutathione-S- transferase (GST) fusion polypeptide in E. coli and the fusion polypeptide is isolated and characterized. Specifically, CONAT-1 is fused to GST and this fusion polypeptide is expressed in E. coli, e.g., strain PEB199. Expression of the GST-CONAT-1 fusion protein in PEB199 is induced with IPTG. The recombinant fusion polypeptide is purified from crude bacterial ly sates of the induced PEB199 strain by affinity chromatography on glutathione beads. Using polyacrylamide gel electrophoretic analysis of the polypeptide purified from the bacterial lysates, the molecular weight of the resultant fusion polypeptide is determined.
EXAMPLE 3: EXPRESSION OF RECOMBINANT CONAT-1 PROTEIN IN
COS CELLS
To express the CONAT-1 gene in COS cells, the pcDNA/Amp vector by Invitrogen Coφoration (San Diego, CA) is used. This vector contains an SV40 origin of replication, an ampicillin resistance gene, an E. coli replication origin, a CMV promoter followed by a polylinker region, and an SV40 intron and polyadenylation site. A DNA fragment encoding the entire CONAT-1 protein and an HA tag (Wilson et al. (1984) Cell 31:161) or a FLAG tag fused in-frame to its 3' end of the fragment is cloned into the polylinker region of the vector, thereby placing the expression of the recombinant protein under the control of the CMV promoter.
To construct the plasmid, the CONAT- 1 DNA sequence is amplified by PCR using two primers. The 5' primer contains the restriction site of interest followed by approximately twenty nucleotides of the CONAT-1 coding sequence starting from the initiation codon; the 3' end sequence contains complementary sequences to the other restriction site of interest, a translation stop codon, the HA tag or FLAG tag and the last 20 nucleotides of the CONAT-1 coding sequence. The PCR amplified fragment and the pCDNA/Amp vector are digested with the appropriate restriction enzymes and the vector is dephosphorylated using the CIAP enzyme (New England Biolabs, Beverly, MA). Preferably the two restriction sites chosen are different so that the CONAT-1 gene is inserted in the correct orientation. The ligation mixture is transformed into E. coli cells (strains HB101, DH5α, SURE, available from Stratagene Cloning Systems, La JoUa, CA, can be used), the transformed culture is plated on ampicillin media plates, and resistant colonies are selected. Plasmid DNA is isolated from transformants and examined by restriction analysis for the presence of the correct fragment.
COS cells are subsequently transfected with the CONAT- 1-pcDN A/Amp plasmid DNA using the calcium phosphate or calcium chloride co-precipitation methods, DEAE-dextran-mediated transfection, lipofection, or electroporation. Other suitable methods for transfecting host cells can be found in Sambrook, J., Fritsh, E. F., and Maniatis, T. Molecular Cloning: A Laboratory Manual 2nd, ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989. The expression of the CONAT-1 polypeptide is detected by radiolabelling (3$S- methionine or 35s-cysteine available from NEN, Boston, MA, can be used) and immunoprecipitation (Harlow, E. and Lane, D. Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1988) using an HA specific monoclonal antibody. Briefly, the cells are labeled for 8 hours with ^^S-methionine (or 35s-cysteine). The culture media are then collected and the cells are lysed using detergents (RIPA buffer, 150 mM NaCl, 1% NP-40, 0.1% SDS, 0.5% DOC, 50 mM Tris, pH 7.5). Both the cell lysate and the culture media are precipitated with an HA specific monoclonal antibody. Precipitated polypeptides are then analyzed by SDS- PAGE.
Alternatively, DNA containing the CONAT-1 coding sequence is cloned directly into the poly linker of the pCDNA/Amp vector using the appropriate restriction sites. The resulting plasmid is transfected into COS cells in the manner described above, and the expression of the CONAT-1 polypeptide is detected by radiolabelling and immunoprecipitation using a CONAT-1 specific monoclonal antibody.
Equivalents Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.
Analysis of 26320 (139 aa)
PFA"ι no Htlrfi'-terttei- ranst"
I I I
N9I9
I ' I ' I !
41 M 1?1
>26320
MPDI RLITKDLSEPYSIYTYRYFIHN PQLCFLAMVGEECVGAIVCKLDMHKKMFRRGY IAMLAVDSKYRRNGIGTNLVKKAIYAMVEGDCDEVVLETEITNKSALKLYENLGFVRDKR LFRYYLNGVDALRLKL R
Prosite Pattern Matches for 26320
Prosite version: Release 12.2 ofFebruary 1995
>PSO0Ql PDOCOOOOl ASN GLYCOSYIATION N-glycosylation site Query: 103 NKSA 106
>PS00Q5 PDQCQ0O05 PKC PHOSPHO SITE Protein kinase Claim phosphorylation site Query: 20 TYR 22
Query: 102 TNK 104
>PS00O8 PDQCOOOQ8 MYRISTYL N-myristoylation site Query: 43 ' GAIVCK 48 Query: 74 GIGTNL 79
Protein Family Domain Matches, HMMer version 2
Searching for complete domains in PFAM hmmpfam -search a single seg against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL)
HMM file: /prod/ddm/seqanal/PFAM/pfam5.3/Pf m Sequence file: /prod/ddm/ space/orfanal/oa-script .4542.seq
Query: 26320
Scores for sequence family classification (score includes all domains) Model Description Score E-value N
Acetyltransf Acetyltransferase (GNAT) family 43.9 3.7e-9 1
Parsed for domains :
Model Domain seq-f seq-t hmm-f hmm-t score E-value
Acetyltransf l/l 1 116 1 133.. 43.9 3.7e-9
Alignments of top-scoring domains:
Acetyltransf: domain 1 of 1, from 1 to 116: score 43.9, E = 3.7e-9
*->irrvteeDlpallellreafaeeyleekkypdedeledpvkkiiaaa +p++ +1++++ e+y + +++ + +p ++a 26320 1 MPDIMRLITKDLSEPYS--IYTYRYFIHNWPQLCFLAM- 36
grlfweedGelvGyatlrpdddene..vaeieriaVdpdyrgkGlGkkL e+vG + ++ d + ++++i+ +aVd++yr+ G+G+ L 26320 37 VGEECVGAIVCKLDiiHKKMfrRGYIAMLAVDSKYRRNGIGTNL 79
lealieqarevrgasgiylvtdegNepAialYeklGFt<~* ++++i + e ++++ l+t+ +N+ A++lYe 1GF+ 26320 80 VKAIYAMVE-GDCDEVVLETEIΩrøSALKLYENLGFV 116
ProDom Matches
View prodom 47662 [Boxer] [Snowing matcn | Go!
>47662 p99.2 (1) O46309_DROMΞ // EG:8D8.6 PROTEIN Length = 24
Score = 122 (48.0 bits). Expect =7e-08. P = 3.7e-08 Identities = 23/24 (95%) . positives = 23/24 (95%)
Query 116 VRDKRLFRYYLNGVDALRLKLWLR 139
VRDKRLFRYYLNGVDALRLKLW R Sbjct 1 VRDKRLFRYYLNGVDALRLKLWFR 24
View prodom 122 |Boxer| isnowmg matcn*" Go!
>122 p99.2 (255) ATDA(6) AAC6(4) ARDH(3) // PROTEIN TRANSFERASE
ACETYLTRANSFERASE ACYLTRANSFERASE AMINOGLYCOSIDE INTERGENIC REGION
PLASMID
RESISTANCE ANTIBIOTIC
Length = 162
Score = 111 (44.1 bits), Expect = 5.4e-07, P = 5.4e-07 Identities = 28/76 (36%) , Positives = 43/76 (56%)
Query: 50 DMHKKMFRRGYIAMLAVDSKYRRNGIGTNLVK1XAIY-AIWEGDCDEVVIJE--T^ 106
+ HK+ YI +AV +YR GIG L+++A+ AM + V+L T +N++A Sbjct: 87 ESHKQAGNTAYIESIAVSPEYRGKGIGKKLLQQALEEAMAKEQAKSVMLAVTTAESNEAA 146
Query: 107 LKLYENLGFVRDKRLF 122
++ YE LGF KR F Sbjct: 147 IRFYEKLGF-EQKRSF 161 View prodom 63449 iBoxerj isnowmg matcn | Go! >63449 p99.2 (1) MAK3_YEAST // L-A VIRUS GAG PROTEIN N- ACETYLTRANSFERASE EC
2.3.1- TRANSFERASE ACETYLTRANSFERASE
Length = 42
Score = 87 (35.7 bits). Expect = 0.00019, P = 0.00019 Identities = 16/23 (69%) , Positives = 19/23 (82%)
Query: 4 IMRLITKDLSEPYSIYTYRYFIH 26
I +LI DLSEPYSIY YRYF++ Sbjct: 19 IKKLIDADLSEPYSIYVYRYFLN 41
Analysis of 26320 (268 aa)
PFflH no Win h i : 5 fl=ety 1 -trar.sf
l M 1 I 1 . 1 , 1 j | I I 1 , I 1 41 81 121 161 201 241
>26320
KLAAASLPRVRLSVAEVAATTATPDGGPRATATKGAGVHSGERPPHSLSSNARTAVPSPV EAAAASDPAAARNGLAEGTEQEEEEEDEQVRLLSSSLTADCSLRSPSGREVEPGEDRTIR YVRYESELQMPDIMRLITKDLSEPYSIYTYRYFIHN PQLCFLAMVGEECVGAIVCKLDM HKKMFRRGYIAMLAVDSKYRRNGIGTNLVKKAIYAMVEGDCDEVVLETEITNKSALKLYE NLGFVRDKRLFRYYLNGVDALRLKLWLR
98
SUBSTITUTE SHEET (RULE 26} Prosite Pattern Matches for 26320
Prositeversion: Release 12.2 ofFebruary 1995
>PS0OQl PDOCOOOOl ASN GLYCOSYIATION N-glycosylation site Query: 232 NKSA 235
>PS00Q5 PDQCO0OQ5 PKC PHOSPHO SITE Protein kinase Claim phosphorylation site
Query: 102 SLR 104
Query: 107 SGR 109
Query: 118 TIR 120
Query: 149 TYR 151
Query: 231 TNK 233
>PS0OQ6 PDQCOOOQ6 CK2 PHOSPHO SITE Casein kinase II phosphorylation site Query: 13 SVAE 16
Query: 58 SPVE 61
Query: 79 TEQE 82
Query: 107 SGRE 110
>PS00Q8 PDOCOOQOδ MYRISTYL N-myristoylation site
Query: 26 GGPRAT 31
Query: 37 GVHSGE 42
Query: 74 GLAEGT 79
Query: 172 GAIVCK 177
Query: 203 GIGTNL 208
99
SUBSπTUTE SHEET (RULE 26) Protein Family Domain Matches, HMMer version 2
Searching for complete domains in PFAM hmmpfam -search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL)
HMM file: /prod/ddm/seqanal/PFAM/pfam5.3/Pfam
Sequence file: /prod/ddm/wspace/orfanal/oa-script.4408.seq
Query: 26320
Scores for sequence family classification (score incl des all domains) Model Description Score E-value N
Acetyltransf Acetyltransferase (GNAT) family 63.6 4.2e-15
Parsed for domains :
Model Domain seq-f seq-t hmm-f hmm-t score E-value
Acetyltransf 1/1 122 2.45.. 1 133 tl 63.6 4.2e-15
Alignments of top-scoring domains:
Acetyltransf: domain 1 of 1, from 122 to 245: score 63.6, E = 4.2e-15
*->irrvteeDlpallellreafaeeyleekkypdedeledpvkkiiaaa +r +e ++p++ +1++++ e+y + +++ + +p ++a 26320 122 VRYESΞLQMPDIMRLITKDLSEPYS--IYTYRYFIHNWPQLCFLAM- 165
grlfweedGelvGyatlrpdddene ..vaeieriaVdpdyrgkGlGkkL e+vG + ++ d + ++++i+ +aVd++yr+ G+G+ L 26320 166 VGEECVGAIVCKLDMHKKMfrRGYIAMLAVDSKYRRNGIGTNL 208
lealieqarevrgasgiylvtdegNepAialYeklGFt<-* ++++i + e ++++ l+t+ +N+ A++lYe 1GF+ 26320 209 VKKAIYAMVE-GDCDΞVVLETΞITNKSALKLΫENLGFV 245 ProDom Matches
View prodom 47662 |Boxer| isnowmq matcn" Go!
>47662 p99.2 (1) 046309_DROME II EG:8D8.6 PROTEIN Length = 24
Score = 122 (48.0 bits), Expect = 8.1e-08, P =8.1e-08 Identities = 23/24 (95%) , Positives = 23/24 (95%)
Query: 245 VRDKRLFRYYLNGVDALRLKLWLR 268
VRDKRLFRYYLNGVDALRLKLW R Subjt: 1 VRDKRLFRYYLNGVDALRLKLWFR 24
View prodom 122 |Boxerj istiowinq matcn 1 Go!
>122 p99.2 (255) ATDA(6) AAC6(4) ARDH(3) II PROTEIN TRANSFERASE
ACETYLTRANSFERASE ACYLTRANSFERASE AMINOGLYCOSIDΞ INTERGENIC REGION PLASMID RESISTANCE ANTIBIOTIC
Length = 162
Score = 111 (44.1 bits), Expect = 1.6e-05, P = 1.6e-05 Identities = 28/76 (36%) , Positives = 43/76 (56%)
Query 179 DMHKKMFRR-YIAMLAVDSKYPRNGIGTNLVK.KAIY-AMVEGDCDEVVLE--TE 235
+ HK+ YI +AV +YR GIG L+++A+ AM + V+L T +N+4-A
Sbjct 87 ESHKQAGNTAYIESIAVSPEYRGKGIGKKLLQQALEEAMAKΞQAKSVMLAVTTAESNEAA
146
Query 236 LKLYENLGFVRDKRLF 251
++ YE LGF KR F Sbjct 147 IRFYΞKLGF-EQKRSF 161
View prodom 63449 |Boxerj isnowmg matcn | Go!
>63449 p99.2 (1) MAK3_YΞAST II L-A VIRUS GAG PROTEIN N-ACETYLTRANSFERASE EC 2 .3 .1 .-TRANSFERASE ACYLTRANSFERASE Length = 42
Score = 94 (38.1 bits), Expect = 0.00011, P = 0.00011 Identities = 18/30 (60%), positives = 22/30 (73%)
Query: 126 SELQMPDIMRLITKDLSEPYSIYTYRYFIH 155
+E Q I +LI ' DLSEPYSIY YRYF++ Sbjct: 12 NEEQFASIKKLIDADLSEPYSIYVYRYFLN 41
View prodom 65940 moxeri [Snowing matcn | Go!
>65940 p99. 2 (l) 080438_ARATH II PUTATIVE ACYLTRANSFERASE TRANSFERASE ACYLTRANSFERASE Length = 46
Score = 86 (35.3 bits), Expect = 0.00089, P = 0.00089 Identities = 19/40 (47%) , Positives = 25/40 (62%)
Query: 110 EVEPGEDRTIRYVRYESELQMPDIMRLITKDLSEPYS1YT 149
E + GE I Y Y E +P 1M L+ ++LSEPYSI4-T Sbjct: 10 EFDEGE IEYTSYAGEHHLPLIMSLVDQELSEPYSIFT 46

Claims

What is claimed:
1. An isolated nucleic acid molecule selected from the group consisting of:
(a) a nucleic acid molecule comprising the nucleotide sequence set forth in SEQ ID NO:l, or a complement thereof;
(b) a nucleic acid molecule comprising the nucleotide sequence set forth in SEQ ID NO:3, or a complement thereof; and (c) a nucleic acid molecule comprising the nucleotide sequence set forth in SEQ ID NO:5, or a complement thereof.
2. An isolated nucleic acid molecule which encodes a polypeptide selected from the group consisting of:
(a) a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 2, or a complement thereof; and
(b) a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 4, or a complement thereof.
3. An isolated nucleic acid molecule comprising the nucleotide sequence contained in the plasmid deposited with ATCC® as Accession Number
4. An isolated nucleic acid molecule which encodes a polypeptide selected from the group consisting of:
(a) a naturally occurring allelic variant of a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 2, or a complement thereof; and
(b) a naturally occurring allelic variant of a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 4, or a complement thereof.
103
SUBSΗTUTE SHEET (RULE 26)
5. An isolated nucleic acid molecule selected from the group consisting of:
(a) a nucleic acid molecule comprising a nucleotide sequence which is at least 75% identical to the nucleotide sequence of SEQ ID NO: 1, 3, or 5, or a complement thereof;
(b) a nucleic acid molecule comprising a fragment of at least 30 nucleotides of a nucleic acid comprising the nucleotide sequence of SEQ ID NO:l, 3, or 5, or a complement thereof;
(c) a nucleic acid molecule which encodes a polypeptide comprising an amino acid sequence at least about 75% identical to the amino acid sequence of SEQ ID
NO:2 or 4; and
(d) a nucleic acid molecule which encodes a fragment of a polypeptide comprising the amino acid sequence of SEQ ID NO:2 or 4, wherein the fragment comprises at least 10 contiguous amino acid residues of the amino acid sequence of SEQ ID NO:2 or 4.
6. An isolated nucleic acid molecule which hybridizes to a complement of the nucleic acid molecule of any one of claims 1, 2, 3, , or 5 under stringent conditions.
7. An isolated nucleic acid molecule comprising a nucleotide sequence which is complementary to the nucleotide sequence of the nucleic acid molecule of any one of claims 1, 2, 3, 4, or 5.
8. An isolated nucleic acid molecule comprising the nucleic acid molecule of any one of claims 1 , 2, , 4, or 5, and a nucleotide sequence encoding a heterologous polypeptide.
9. A vector comprising the nucleic acid molecule of any one of claims 1 , 2, 3, , or 5.
10. The vector of claim 9, which is an expression vector.
11. A host cell transfected with the expression vector of claim 10.
12. A method of producing a polypeptide comprising culturing the host cell of claim 11 in an appropriate culture medium to, thereby, produce the polypeptide.
13. An isolated polypeptide selected from the group consisting of:
a) a fragment of a polypeptide comprising the amino acid sequence of SEQ ID NO:2 or 4, wherein the fragment comprises at least 10 contiguous amino acids of SEQ ID NO:2 or 4; b) a naturally occurring allelic variant of a polypeptide comprising the arnino acid sequence of SEQ ID NO:2 or 4, wherein the polypeptide is encoded by a nucleic acid molecule which hybridizes to a nucleic acid molecule consisting of SEQ ID NO:l, 3, or 5 under stringent conditions; c) a polypeptide which is encoded by a nucleic acid molecule comprising a nucleotide sequence which is at least 75 % identical to a nucleic acid comprising the nucleotide sequence of SEQ ID NO:l, 3, or 5; and d) a polypeptide comprising an amino acid sequence which is at least 75% identical to the amino acid sequence of SEQ ID NO:2 or 4.
14. The isolated polypeptide of claim 13 comprising the amino acid sequence ofSEQ ID NO:2 or 4.
15. The polypeptide of claim 13, further comprising heterologous amino acid sequences.
16. An antibody which selectively binds to a polypeptide of claim 13.
17. A method for detecting the presence of a polypeptide of claim 13 in a sample comprising: a) contacting the sample with a compound which selectively binds to the polypeptide; and b) determining whether the compound binds to the polypeptide in the sample to thereby detect the presence of a polypeptide of claim 13 in the sample.
18. The method of claim 17, wherein the compound which binds to the polypeptide is an antibody.
19. A kit comprising a compound which selectively binds to a polypeptide of claim 12 and instructions for use.
20. A method for detecting the presence of a nucleic acid molecule of any one of claims 1, 2, 3, 4, or 5 in a sample comprising: a) contacting the* sample with a nucleic acid probe or primer which selectively hybridizes to the nucleic acid molecule; and b) determining whether the nucleic acid probe or primer binds to a nucleic acid molecule in the sample to thereby detect the presence of a nucleic acid molecule of any one of claims 1, 2, 3, 4, or 5 in the sample.
21. The method of claim 20, wherein the sample comprises mRNA molecules and is contacted with a nucleic acid probe.
22. A kit comprising a compound which selectively hybridizes to a nucleic acid molecule of any one of claims 1, 2, 3, 4, or 5 and instructions for use.
23. A method for identifying a compound which binds to a polypeptide of claim 13 comprising: a) contacting the polypeptide, or a cell expressing the polypeptide with a test compound; and b) determimng whether the polypeptide binds to the test compound.
24. The method of claim 23 , wherein the binding of the test compound to the polypeptide is detected by a method selected from the group consisting of: a) detection of binding by direct detection of test compound/polypeptide binding; b) detection of binding using a competition binding assay; and c) detection of binding using an assay for CONAT-1 activity.
25. A method for modulating the activity of a polypeptide of claim 13 comprising contacting the polypeptide or a cell expressing the polypeptide with a compound which binds to the polypeptide in a sufficient concentration to modulate the activity of the polypeptide.
26. A method for identifying a compound which modulates the activity of a polypeptide of claim 13 comprising: a) contacting a polypeptide of claim 13 with a test compound; and b) determining the effect of the test compound on the activity of the polypeptide to thereby identify a compound which modulates the activity of the polypeptide.
27. A method for identifying a compound capable of treating a colon disorder comprising assaying the ability of the compound or agent to modulate CONAT-1 expression or activity, thereby identifying a compound capable of treating a colon disorder.
28. The method of claim 27, wherein the disorder is colon cancer.
29. A method for determining if a subject is at risk for a colon disorder comprising detecting aberrant or abnormal CONAT-1 expression or activity in a sample of cells from the subject, thereby determining if a subject is at risk for a colon disorder.
30. The method of claim 29, wherein the disorder is colon cancer.
31. A method for identifying a subject suffering from a colon disorder comprising obtaining a biological sample from the subject, and detecting in the sample aberrant or abnormal CONAT-1 expression or activity, thereby identifying a subject suffering from a colon disorder.
32. The method of claim 31 , wherein the disorder is colon cancer.
33. A method for treating a subject having a cellular proliferation or differentiation disorder comprising administering to the subject an agent selected from the group consisting of an isolated CONAT-1 nucleic acid molecule, a CONAT-1 protein or biologically active portion thereof, a CONAT-1 antibody, a CONAT-1 ribozyme, a CONAT-1 antisense oligonucleotide, a CONAT-1 modulatory peptide, and a CONAT-1 modulatory small molecule, such that treatment occurs.
34. A method for treating a subject having colon cancer comprising administering to the subject an agent selected from the group consisting of an isolated CONAT-1 nucleic acid molecule, a CONAT-1 protein or biologically active portion thereof, a CONAT-1 antibody, a CONAT-1 ribozyme, a CONAT-1 antisense oligonucleotide, a CONAT-1 modulatory peptide, and a CONAT-1 modulatory small molecule, such that treatment occurs.
35. Use of the compound identified in the method of claim 26 to treat a cellular proliferation or differentiation disorder.
EP01984016A 2000-06-16 2001-06-18 Human n-acetyltransferase family member and uses thereof Withdrawn EP1313842A2 (en)

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
US21243900P 2000-06-16 2000-06-16
US212439P 2000-06-16
US64492900A 2000-08-23 2000-08-23
US644929 2000-08-23
PCT/US2001/041043 WO2001096548A2 (en) 2000-06-16 2001-06-18 Human n-acetyltransferase family member and uses thereof

Publications (1)

Publication Number Publication Date
EP1313842A2 true EP1313842A2 (en) 2003-05-28

Family

ID=26907145

Family Applications (1)

Application Number Title Priority Date Filing Date
EP01984016A Withdrawn EP1313842A2 (en) 2000-06-16 2001-06-18 Human n-acetyltransferase family member and uses thereof

Country Status (3)

Country Link
EP (1) EP1313842A2 (en)
AU (1) AU2002213598A1 (en)
WO (1) WO2001096548A2 (en)

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2004514416A (en) * 2000-07-07 2004-05-20 インサイト・ゲノミックス・インコーポレイテッド Drug metabolizing enzymes

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO0196548A2 *

Also Published As

Publication number Publication date
AU2002213598A1 (en) 2001-12-24
WO2001096548A2 (en) 2001-12-20
WO2001096548A3 (en) 2003-02-06

Similar Documents

Publication Publication Date Title
US6500657B1 (en) 33167, a novel human hydrolase and uses therefor
EP1372690A2 (en) 93870, a human g-protein coupled receptor and uses therefor
WO2002018556A9 (en) 8797, a human galactosyltransferase and uses thereof
US20020068348A1 (en) 42755, a novel human methyltransferase family member and uses thereof
WO2001090321A2 (en) 55158, a novel human carbonic anhydrase and uses thereof
US20020123098A1 (en) 55063, a novel human NMDA family member and uses thereof
US20020090705A1 (en) 62088, a novel human nucleoside phosphatase family member and uses thereof
US20020123094A1 (en) 57250, a novel human sugar transporter family member and uses thereof
US20020119466A1 (en) 46863, a novel human methyltransferase and uses thereof
US20020042098A1 (en) 32253 transferase family members and uses therefor
US20020132298A1 (en) 67118, 67067, and 62092, human proteins and methods of use thereof
WO2001096548A2 (en) Human n-acetyltransferase family member and uses thereof
US20020107192A1 (en) 23686, a novel human aminotransferase and uses therefor
US20020132332A1 (en) 50566, a novel human glyoxalase II related factor and uses thereof
US20030050441A1 (en) 49938, a novel human phospholipid transporter and uses therefor
US20020077462A1 (en) 33556, a novel human transporter and uses thereof
WO2001081559A2 (en) 26335, a novel human serine/threonine dehydratase and uses thereof
US20030049727A1 (en) 25658, a novel human calcium channel subunit and uses thereof
US20020177148A1 (en) FBH58295FL, a novel human amino acid transporter and uses thereof
US20020127680A1 (en) 62112, a novel human dehydrogenase and uses thereof
US20020147323A1 (en) 16224 and 69611, novel human kinases and uses thereof
WO2002006325A2 (en) 32529, a human guanine nucleotide exchange factor family member and uses thereof
WO2001075106A1 (en) 32591, A NOVEL HUMAN GTPase ACTIVATING MOLECULE AND USES THEREFOR
WO2001090324A2 (en) 32263, a putative human biotin transcarboxylase and uses thereof
WO2000017236A2 (en) Apoptosis related protein and uses therefor

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

AK Designated contracting states

Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE TR

AX Request for extension of the european patent

Extension state: AL LT LV MK RO SI

17P Request for examination filed

Effective date: 20030707

17Q First examination report despatched

Effective date: 20050802

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20061220