EP1309686A2 - Slgp protein and nucleic acid molecules and uses therefor - Google Patents
Slgp protein and nucleic acid molecules and uses thereforInfo
- Publication number
- EP1309686A2 EP1309686A2 EP01952313A EP01952313A EP1309686A2 EP 1309686 A2 EP1309686 A2 EP 1309686A2 EP 01952313 A EP01952313 A EP 01952313A EP 01952313 A EP01952313 A EP 01952313A EP 1309686 A2 EP1309686 A2 EP 1309686A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- slgp
- seq
- ofthe
- nucleic acid
- protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 150000007523 nucleic acids Chemical class 0.000 title claims abstract description 289
- 102000039446 nucleic acids Human genes 0.000 title claims abstract description 277
- 108020004707 nucleic acids Proteins 0.000 title claims abstract description 277
- 108090000623 proteins and genes Proteins 0.000 title abstract description 583
- 102000004169 proteins and genes Human genes 0.000 title abstract description 446
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 74
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 64
- 230000000692 anti-sense effect Effects 0.000 claims abstract description 47
- 239000013604 expression vector Substances 0.000 claims abstract description 45
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 claims abstract description 38
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 claims abstract description 38
- 239000000203 mixture Substances 0.000 claims abstract description 32
- 210000004027 cell Anatomy 0.000 claims description 205
- 238000000034 method Methods 0.000 claims description 204
- 230000000694 effects Effects 0.000 claims description 169
- 125000003729 nucleotide group Chemical group 0.000 claims description 162
- 239000002773 nucleotide Substances 0.000 claims description 159
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 147
- 230000014509 gene expression Effects 0.000 claims description 142
- 150000001875 compounds Chemical class 0.000 claims description 108
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 92
- 238000012360 testing method Methods 0.000 claims description 61
- 206010028980 Neoplasm Diseases 0.000 claims description 58
- 229920001184 polypeptide Polymers 0.000 claims description 57
- 239000013598 vector Substances 0.000 claims description 48
- 210000002889 endothelial cell Anatomy 0.000 claims description 44
- 239000012634 fragment Substances 0.000 claims description 42
- 230000005012 migration Effects 0.000 claims description 42
- 238000013508 migration Methods 0.000 claims description 42
- 230000033115 angiogenesis Effects 0.000 claims description 41
- 230000004663 cell proliferation Effects 0.000 claims description 40
- 230000024245 cell differentiation Effects 0.000 claims description 35
- 230000010261 cell growth Effects 0.000 claims description 33
- 230000000295 complement effect Effects 0.000 claims description 33
- 201000011510 cancer Diseases 0.000 claims description 31
- 230000001105 regulatory effect Effects 0.000 claims description 30
- 230000001594 aberrant effect Effects 0.000 claims description 27
- 230000008569 process Effects 0.000 claims description 24
- 230000001965 increasing effect Effects 0.000 claims description 12
- 108090000994 Catalytic RNA Proteins 0.000 claims description 11
- 102000053642 Catalytic RNA Human genes 0.000 claims description 11
- 230000003247 decreasing effect Effects 0.000 claims description 11
- 108091092562 ribozyme Proteins 0.000 claims description 11
- 150000003384 small molecules Chemical group 0.000 claims description 9
- 238000001415 gene therapy Methods 0.000 claims description 6
- 238000012258 culturing Methods 0.000 claims description 5
- 239000001963 growth medium Substances 0.000 claims description 5
- 238000009472 formulation Methods 0.000 claims description 4
- 230000009762 endothelial cell differentiation Effects 0.000 claims description 3
- 230000010595 endothelial cell migration Effects 0.000 claims 2
- 241001465754 Metazoa Species 0.000 abstract description 48
- 102000037865 fusion proteins Human genes 0.000 abstract description 31
- 108020001507 fusion proteins Proteins 0.000 abstract description 31
- 230000009261 transgenic effect Effects 0.000 abstract description 19
- 238000003259 recombinant expression Methods 0.000 abstract description 15
- 230000000890 antigenic effect Effects 0.000 abstract description 5
- 238000002405 diagnostic procedure Methods 0.000 abstract description 3
- 235000018102 proteins Nutrition 0.000 description 435
- 108020004414 DNA Proteins 0.000 description 139
- 241000282414 Homo sapiens Species 0.000 description 80
- 239000003795 chemical substances by application Substances 0.000 description 80
- 208000035475 disorder Diseases 0.000 description 79
- 210000001519 tissue Anatomy 0.000 description 69
- 239000000523 sample Substances 0.000 description 63
- 201000010099 disease Diseases 0.000 description 62
- 238000003556 assay Methods 0.000 description 59
- 239000003446 ligand Substances 0.000 description 56
- 239000013612 plasmid Substances 0.000 description 51
- 208000007135 Retinal Neovascularization Diseases 0.000 description 48
- 108020004999 messenger RNA Proteins 0.000 description 48
- 108091028043 Nucleic acid sequence Proteins 0.000 description 45
- 235000001014 amino acid Nutrition 0.000 description 45
- 239000003814 drug Substances 0.000 description 44
- 150000001413 amino acids Chemical class 0.000 description 41
- 229940024606 amino acid Drugs 0.000 description 40
- 230000035772 mutation Effects 0.000 description 40
- 125000000539 amino acid group Chemical group 0.000 description 39
- 241000699666 Mus <mouse, genus> Species 0.000 description 35
- 229940079593 drug Drugs 0.000 description 34
- 238000009396 hybridization Methods 0.000 description 31
- 238000011282 treatment Methods 0.000 description 30
- 102000012545 EGF-like domains Human genes 0.000 description 29
- 108050002150 EGF-like domains Proteins 0.000 description 29
- 239000012472 biological sample Substances 0.000 description 29
- 239000002299 complementary DNA Substances 0.000 description 29
- 208000028867 ischemia Diseases 0.000 description 26
- 208000031225 myocardial ischemia Diseases 0.000 description 26
- 206010003246 arthritis Diseases 0.000 description 25
- 230000027455 binding Effects 0.000 description 25
- 238000001514 detection method Methods 0.000 description 24
- 230000002207 retinal effect Effects 0.000 description 24
- 102000004316 Oxidoreductases Human genes 0.000 description 22
- 108090000854 Oxidoreductases Proteins 0.000 description 22
- FKUYMLZIRPABFK-UHFFFAOYSA-N Plastoquinone 9 Natural products CC(C)=CCCC(C)=CCCC(C)=CCCC(C)=CCCC(C)=CCCC(C)=CCCC(C)=CCCC(C)=CCCC(C)=CCC1=CC(=O)C(C)=C(C)C1=O FKUYMLZIRPABFK-UHFFFAOYSA-N 0.000 description 22
- 210000000349 chromosome Anatomy 0.000 description 22
- 239000013615 primer Substances 0.000 description 22
- 229940035936 ubiquinone Drugs 0.000 description 22
- 102000027257 transmembrane receptors Human genes 0.000 description 21
- 108091008578 transmembrane receptors Proteins 0.000 description 21
- 102000004190 Enzymes Human genes 0.000 description 20
- 108090000790 Enzymes Proteins 0.000 description 20
- 108700019146 Transgenes Proteins 0.000 description 20
- 230000000875 corresponding effect Effects 0.000 description 20
- -1 e.g. Proteins 0.000 description 20
- 229940088598 enzyme Drugs 0.000 description 20
- 238000003752 polymerase chain reaction Methods 0.000 description 20
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 19
- 108091034117 Oligonucleotide Proteins 0.000 description 19
- 108091026890 Coding region Proteins 0.000 description 18
- 230000004044 response Effects 0.000 description 18
- 230000001225 therapeutic effect Effects 0.000 description 18
- 230000003993 interaction Effects 0.000 description 17
- 238000007423 screening assay Methods 0.000 description 17
- 238000003199 nucleic acid amplification method Methods 0.000 description 16
- 102000005962 receptors Human genes 0.000 description 16
- 108020003175 receptors Proteins 0.000 description 16
- 239000000126 substance Substances 0.000 description 16
- 230000003321 amplification Effects 0.000 description 15
- 238000004458 analytical method Methods 0.000 description 15
- 230000001413 cellular effect Effects 0.000 description 15
- 230000004927 fusion Effects 0.000 description 15
- 238000000338 in vitro Methods 0.000 description 15
- 238000002360 preparation method Methods 0.000 description 15
- 238000012216 screening Methods 0.000 description 15
- 108091006027 G proteins Proteins 0.000 description 14
- 102000030782 GTP binding Human genes 0.000 description 14
- 108091000058 GTP-Binding Proteins 0.000 description 14
- 230000004075 alteration Effects 0.000 description 14
- 230000015572 biosynthetic process Effects 0.000 description 14
- 238000002744 homologous recombination Methods 0.000 description 14
- 230000006801 homologous recombination Effects 0.000 description 14
- 230000003834 intracellular effect Effects 0.000 description 14
- 239000003153 chemical reaction reagent Substances 0.000 description 13
- 238000005516 engineering process Methods 0.000 description 13
- 230000006870 function Effects 0.000 description 13
- 239000000463 material Substances 0.000 description 13
- 239000002609 medium Substances 0.000 description 13
- 239000000047 product Substances 0.000 description 13
- 230000004071 biological effect Effects 0.000 description 12
- 210000004408 hybridoma Anatomy 0.000 description 12
- 238000001727 in vivo Methods 0.000 description 12
- 230000002974 pharmacogenomic effect Effects 0.000 description 12
- 230000019491 signal transduction Effects 0.000 description 12
- 238000006467 substitution reaction Methods 0.000 description 12
- 102000053602 DNA Human genes 0.000 description 11
- MMWCIQZXVOZEGG-HOZKJCLWSA-N [(1S,2R,3S,4S,5R,6S)-2,3,5-trihydroxy-4,6-diphosphonooxycyclohexyl] dihydrogen phosphate Chemical compound O[C@H]1[C@@H](O)[C@H](OP(O)(O)=O)[C@@H](OP(O)(O)=O)[C@H](O)[C@H]1OP(O)(O)=O MMWCIQZXVOZEGG-HOZKJCLWSA-N 0.000 description 11
- 210000004924 lung microvascular endothelial cell Anatomy 0.000 description 11
- IVOMOUWHDPKRLL-KQYNXXCUSA-N Cyclic adenosine monophosphate Chemical compound C([C@H]1O2)OP(O)(=O)O[C@H]1[C@@H](O)[C@@H]2N1C(N=CN=C2N)=C2N=C1 IVOMOUWHDPKRLL-KQYNXXCUSA-N 0.000 description 10
- IVOMOUWHDPKRLL-UHFFFAOYSA-N UNPD107823 Natural products O1C2COP(O)(=O)OC2C(O)C1N1C(N=CN=C2N)=C2N=C1 IVOMOUWHDPKRLL-UHFFFAOYSA-N 0.000 description 10
- 230000004913 activation Effects 0.000 description 10
- 210000004899 c-terminal region Anatomy 0.000 description 10
- 229940095074 cyclic amp Drugs 0.000 description 10
- 238000004519 manufacturing process Methods 0.000 description 10
- 230000000069 prophylactic effect Effects 0.000 description 10
- 238000013518 transcription Methods 0.000 description 10
- 230000035897 transcription Effects 0.000 description 10
- CNWINRVXAYPOMW-FCNJXWMTSA-N 1-stearoyl-2-arachidonoyl-sn-glycero-3-phospho-1D-myo-inositol 4,5-biphosphate Chemical compound CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(=O)O[C@H](COC(=O)CCCCCCCCCCCCCCCCC)COP(O)(=O)O[C@@H]1[C@H](O)[C@H](O)[C@@H](OP(O)(O)=O)[C@H](OP(O)(O)=O)[C@H]1O CNWINRVXAYPOMW-FCNJXWMTSA-N 0.000 description 9
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 9
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 9
- 239000005557 antagonist Substances 0.000 description 9
- 239000012707 chemical precursor Substances 0.000 description 9
- 238000003776 cleavage reaction Methods 0.000 description 9
- 238000012217 deletion Methods 0.000 description 9
- 230000037430 deletion Effects 0.000 description 9
- 230000002068 genetic effect Effects 0.000 description 9
- 210000002216 heart Anatomy 0.000 description 9
- 210000003917 human chromosome Anatomy 0.000 description 9
- 238000003786 synthesis reaction Methods 0.000 description 9
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 8
- 206010019280 Heart failures Diseases 0.000 description 8
- 206010035226 Plasma cell myeloma Diseases 0.000 description 8
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 8
- 239000000556 agonist Substances 0.000 description 8
- 210000004369 blood Anatomy 0.000 description 8
- 239000008280 blood Substances 0.000 description 8
- 230000002163 immunogen Effects 0.000 description 8
- 239000003550 marker Substances 0.000 description 8
- 239000011159 matrix material Substances 0.000 description 8
- 201000000050 myeloid neoplasm Diseases 0.000 description 8
- 230000007017 scission Effects 0.000 description 8
- 241000894007 species Species 0.000 description 8
- 238000010561 standard procedure Methods 0.000 description 8
- 206010007559 Cardiac failure congestive Diseases 0.000 description 7
- 108091033380 Coding strand Proteins 0.000 description 7
- ACTIUHUUMQJHFO-UHFFFAOYSA-N Coenzym Q10 Natural products COC1=C(OC)C(=O)C(CC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)C)=C(C)C1=O ACTIUHUUMQJHFO-UHFFFAOYSA-N 0.000 description 7
- 241000588724 Escherichia coli Species 0.000 description 7
- 241000124008 Mammalia Species 0.000 description 7
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 7
- 108091023040 Transcription factor Proteins 0.000 description 7
- 102000040945 Transcription factor Human genes 0.000 description 7
- 210000000170 cell membrane Anatomy 0.000 description 7
- 235000017471 coenzyme Q10 Nutrition 0.000 description 7
- 238000011161 development Methods 0.000 description 7
- 230000018109 developmental process Effects 0.000 description 7
- 230000002255 enzymatic effect Effects 0.000 description 7
- 238000002372 labelling Methods 0.000 description 7
- 238000013507 mapping Methods 0.000 description 7
- 230000001404 mediated effect Effects 0.000 description 7
- 210000004379 membrane Anatomy 0.000 description 7
- 239000012528 membrane Substances 0.000 description 7
- 230000004060 metabolic process Effects 0.000 description 7
- 210000000287 oocyte Anatomy 0.000 description 7
- 239000008194 pharmaceutical composition Substances 0.000 description 7
- 230000035755 proliferation Effects 0.000 description 7
- NPCOQXAVBJJZBQ-UHFFFAOYSA-N reduced coenzyme Q9 Natural products COC1=C(O)C(C)=C(CC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)C)C(O)=C1OC NPCOQXAVBJJZBQ-UHFFFAOYSA-N 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 210000001082 somatic cell Anatomy 0.000 description 7
- 238000013519 translation Methods 0.000 description 7
- 230000014616 translation Effects 0.000 description 7
- 108010070675 Glutathione transferase Proteins 0.000 description 6
- 102000005720 Glutathione transferase Human genes 0.000 description 6
- 108060003951 Immunoglobulin Proteins 0.000 description 6
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 6
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 6
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 6
- 239000000427 antigen Substances 0.000 description 6
- 108091007433 antigens Proteins 0.000 description 6
- 102000036639 antigens Human genes 0.000 description 6
- 238000013459 approach Methods 0.000 description 6
- 230000033077 cellular process Effects 0.000 description 6
- 238000006243 chemical reaction Methods 0.000 description 6
- 230000002759 chromosomal effect Effects 0.000 description 6
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 6
- 230000001086 cytosolic effect Effects 0.000 description 6
- 230000007423 decrease Effects 0.000 description 6
- 102000018358 immunoglobulin Human genes 0.000 description 6
- 230000002401 inhibitory effect Effects 0.000 description 6
- 210000004962 mammalian cell Anatomy 0.000 description 6
- 238000012544 monitoring process Methods 0.000 description 6
- 238000002703 mutagenesis Methods 0.000 description 6
- 231100000350 mutagenesis Toxicity 0.000 description 6
- 108091008146 restriction endonucleases Proteins 0.000 description 6
- 238000012163 sequencing technique Methods 0.000 description 6
- 239000002904 solvent Substances 0.000 description 6
- 238000003860 storage Methods 0.000 description 6
- 239000000758 substrate Substances 0.000 description 6
- 230000007306 turnover Effects 0.000 description 6
- 102000014914 Carrier Proteins Human genes 0.000 description 5
- 108020004635 Complementary DNA Proteins 0.000 description 5
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 5
- 108010076504 Protein Sorting Signals Proteins 0.000 description 5
- 108020004511 Recombinant DNA Proteins 0.000 description 5
- 108010091086 Recombinases Proteins 0.000 description 5
- 102000018120 Recombinases Human genes 0.000 description 5
- 108090000820 Rhodopsin Proteins 0.000 description 5
- 230000009471 action Effects 0.000 description 5
- 108060000200 adenylate cyclase Proteins 0.000 description 5
- 102000030621 adenylate cyclase Human genes 0.000 description 5
- 230000002491 angiogenic effect Effects 0.000 description 5
- 238000010171 animal model Methods 0.000 description 5
- 238000003491 array Methods 0.000 description 5
- 239000011324 bead Substances 0.000 description 5
- 108091008324 binding proteins Proteins 0.000 description 5
- 230000033228 biological regulation Effects 0.000 description 5
- 238000000423 cell based assay Methods 0.000 description 5
- 238000004113 cell culture Methods 0.000 description 5
- 230000008859 change Effects 0.000 description 5
- 210000000805 cytoplasm Anatomy 0.000 description 5
- 239000003937 drug carrier Substances 0.000 description 5
- 210000001671 embryonic stem cell Anatomy 0.000 description 5
- 230000005714 functional activity Effects 0.000 description 5
- 230000004077 genetic alteration Effects 0.000 description 5
- 231100000118 genetic alteration Toxicity 0.000 description 5
- 230000012010 growth Effects 0.000 description 5
- 210000004754 hybrid cell Anatomy 0.000 description 5
- 210000001161 mammalian embryo Anatomy 0.000 description 5
- 239000000816 peptidomimetic Substances 0.000 description 5
- 230000002062 proliferating effect Effects 0.000 description 5
- 238000000746 purification Methods 0.000 description 5
- 230000010076 replication Effects 0.000 description 5
- 208000024891 symptom Diseases 0.000 description 5
- 229940124597 therapeutic agent Drugs 0.000 description 5
- 230000003612 virological effect Effects 0.000 description 5
- NCYCYZXNIZJOKI-IOUUIBBYSA-N 11-cis-retinal Chemical compound O=C/C=C(\C)/C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C NCYCYZXNIZJOKI-IOUUIBBYSA-N 0.000 description 4
- 108020005544 Antisense RNA Proteins 0.000 description 4
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 4
- 241000894006 Bacteria Species 0.000 description 4
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 4
- 239000003155 DNA primer Substances 0.000 description 4
- 238000002965 ELISA Methods 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 241000238631 Hexapoda Species 0.000 description 4
- 241000282412 Homo Species 0.000 description 4
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 4
- 101710163270 Nuclease Proteins 0.000 description 4
- 108091005461 Nucleic proteins Proteins 0.000 description 4
- 102000004330 Rhodopsin Human genes 0.000 description 4
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 4
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 4
- 108010090804 Streptavidin Proteins 0.000 description 4
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 4
- 238000007792 addition Methods 0.000 description 4
- 239000003242 anti bacterial agent Substances 0.000 description 4
- 230000001580 bacterial effect Effects 0.000 description 4
- 229960002685 biotin Drugs 0.000 description 4
- 235000020958 biotin Nutrition 0.000 description 4
- 239000011616 biotin Substances 0.000 description 4
- 230000000747 cardiac effect Effects 0.000 description 4
- 239000003184 complementary RNA Substances 0.000 description 4
- 230000008878 coupling Effects 0.000 description 4
- 238000010168 coupling process Methods 0.000 description 4
- 238000005859 coupling reaction Methods 0.000 description 4
- 239000006185 dispersion Substances 0.000 description 4
- 210000003527 eukaryotic cell Anatomy 0.000 description 4
- 239000012530 fluid Substances 0.000 description 4
- 239000000499 gel Substances 0.000 description 4
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 4
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 4
- 230000003053 immunization Effects 0.000 description 4
- 238000007901 in situ hybridization Methods 0.000 description 4
- 239000004615 ingredient Substances 0.000 description 4
- 230000005764 inhibitory process Effects 0.000 description 4
- 235000005772 leucine Nutrition 0.000 description 4
- 210000004698 lymphocyte Anatomy 0.000 description 4
- 238000002823 phage display Methods 0.000 description 4
- 229920001223 polyethylene glycol Polymers 0.000 description 4
- 102000040430 polynucleotide Human genes 0.000 description 4
- 108091033319 polynucleotide Proteins 0.000 description 4
- 239000002157 polynucleotide Substances 0.000 description 4
- 239000002987 primer (paints) Substances 0.000 description 4
- 210000001236 prokaryotic cell Anatomy 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 238000002560 therapeutic procedure Methods 0.000 description 4
- 231100000419 toxicity Toxicity 0.000 description 4
- 230000001988 toxicity Effects 0.000 description 4
- 238000001890 transfection Methods 0.000 description 4
- 235000002374 tyrosine Nutrition 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 3
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 208000024172 Cardiovascular disease Diseases 0.000 description 3
- 102000000844 Cell Surface Receptors Human genes 0.000 description 3
- 108010001857 Cell Surface Receptors Proteins 0.000 description 3
- 102100025680 Complement decay-accelerating factor Human genes 0.000 description 3
- 108091035707 Consensus sequence Proteins 0.000 description 3
- 108010001237 Cytochrome P-450 CYP2D6 Proteins 0.000 description 3
- 230000004568 DNA-binding Effects 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 3
- UXDDRFCJKNROTO-UHFFFAOYSA-N Glycerol 1,2-diacetate Chemical compound CC(=O)OCC(CO)OC(C)=O UXDDRFCJKNROTO-UHFFFAOYSA-N 0.000 description 3
- SQUHHTBVTRBESD-UHFFFAOYSA-N Hexa-Ac-myo-Inositol Natural products CC(=O)OC1C(OC(C)=O)C(OC(C)=O)C(OC(C)=O)C(OC(C)=O)C1OC(C)=O SQUHHTBVTRBESD-UHFFFAOYSA-N 0.000 description 3
- 101000856022 Homo sapiens Complement decay-accelerating factor Proteins 0.000 description 3
- 206010020772 Hypertension Diseases 0.000 description 3
- CIPFCGZLFXVXBG-FTSGZOCFSA-N Inositol 1,3,4,5-tetraphosphate Chemical compound O[C@H]1C(OP(O)(O)=O)[C@H](O)[C@@H](OP(O)(O)=O)C(OP(O)(O)=O)[C@H]1OP(O)(O)=O CIPFCGZLFXVXBG-FTSGZOCFSA-N 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- 108060001084 Luciferase Proteins 0.000 description 3
- 239000005089 Luciferase Substances 0.000 description 3
- 206010027476 Metastases Diseases 0.000 description 3
- 108091092724 Noncoding DNA Proteins 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- 102000003923 Protein Kinase C Human genes 0.000 description 3
- 108090000315 Protein Kinase C Proteins 0.000 description 3
- 108700008625 Reporter Genes Proteins 0.000 description 3
- 108010083644 Ribonucleases Proteins 0.000 description 3
- 102000006382 Ribonucleases Human genes 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 108090000190 Thrombin Proteins 0.000 description 3
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 3
- 239000002671 adjuvant Substances 0.000 description 3
- 239000000074 antisense oligonucleotide Substances 0.000 description 3
- 238000012230 antisense oligonucleotides Methods 0.000 description 3
- 238000003782 apoptosis assay Methods 0.000 description 3
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 3
- 210000004556 brain Anatomy 0.000 description 3
- 230000004715 cellular signal transduction Effects 0.000 description 3
- 238000012512 characterization method Methods 0.000 description 3
- 238000003200 chromosome mapping Methods 0.000 description 3
- 238000010367 cloning Methods 0.000 description 3
- 239000013068 control sample Substances 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- 238000013461 design Methods 0.000 description 3
- 150000001982 diacylglycerols Chemical class 0.000 description 3
- 230000004069 differentiation Effects 0.000 description 3
- 239000002612 dispersion medium Substances 0.000 description 3
- 230000003511 endothelial effect Effects 0.000 description 3
- 239000003623 enhancer Substances 0.000 description 3
- 230000001747 exhibiting effect Effects 0.000 description 3
- 238000001476 gene delivery Methods 0.000 description 3
- 208000005017 glioblastoma Diseases 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 229960000367 inositol Drugs 0.000 description 3
- 238000003780 insertion Methods 0.000 description 3
- 230000037431 insertion Effects 0.000 description 3
- 235000014705 isoleucine Nutrition 0.000 description 3
- 239000002207 metabolite Substances 0.000 description 3
- 230000009401 metastasis Effects 0.000 description 3
- 244000005700 microbiome Species 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 238000010369 molecular cloning Methods 0.000 description 3
- 235000016709 nutrition Nutrition 0.000 description 3
- 230000003287 optical effect Effects 0.000 description 3
- 229910052760 oxygen Inorganic materials 0.000 description 3
- 239000001301 oxygen Substances 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- 235000008729 phenylalanine Nutrition 0.000 description 3
- 235000021317 phosphate Nutrition 0.000 description 3
- 150000003905 phosphatidylinositols Chemical class 0.000 description 3
- 230000004481 post-translational protein modification Effects 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 230000005522 programmed cell death Effects 0.000 description 3
- CDAISMWEOUEBRE-UHFFFAOYSA-N scyllo-inosotol Natural products OC1C(O)C(O)C(O)C(O)C1O CDAISMWEOUEBRE-UHFFFAOYSA-N 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 210000004988 splenocyte Anatomy 0.000 description 3
- 230000004936 stimulating effect Effects 0.000 description 3
- 230000000638 stimulation Effects 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- 229960004072 thrombin Drugs 0.000 description 3
- 231100000331 toxic Toxicity 0.000 description 3
- 230000002588 toxic effect Effects 0.000 description 3
- 230000009466 transformation Effects 0.000 description 3
- 238000011269 treatment regimen Methods 0.000 description 3
- 230000001960 triggered effect Effects 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- 241000701447 unidentified baculovirus Species 0.000 description 3
- 230000007998 vessel formation Effects 0.000 description 3
- 239000013603 viral vector Substances 0.000 description 3
- 210000005253 yeast cell Anatomy 0.000 description 3
- QHGUCRYDKWKLMG-QMMMGPOBSA-N (R)-octopamine Chemical compound NC[C@H](O)C1=CC=C(O)C=C1 QHGUCRYDKWKLMG-QMMMGPOBSA-N 0.000 description 2
- RFLVMTUMFYRZCB-UHFFFAOYSA-N 1-methylguanine Chemical compound O=C1N(C)C(N)=NC2=C1N=CN2 RFLVMTUMFYRZCB-UHFFFAOYSA-N 0.000 description 2
- YSAJFXWTVFGPAX-UHFFFAOYSA-N 2-[(2,4-dioxo-1h-pyrimidin-5-yl)oxy]acetic acid Chemical compound OC(=O)COC1=CNC(=O)NC1=O YSAJFXWTVFGPAX-UHFFFAOYSA-N 0.000 description 2
- FZWGECJQACGGTI-UHFFFAOYSA-N 2-amino-7-methyl-1,7-dihydro-6H-purin-6-one Chemical compound NC1=NC(O)=C2N(C)C=NC2=N1 FZWGECJQACGGTI-UHFFFAOYSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- OVONXEQGWXGFJD-UHFFFAOYSA-N 4-sulfanylidene-1h-pyrimidin-2-one Chemical compound SC=1C=CNC(=O)N=1 OVONXEQGWXGFJD-UHFFFAOYSA-N 0.000 description 2
- OIVLITBTBDPEFK-UHFFFAOYSA-N 5,6-dihydrouracil Chemical compound O=C1CCNC(=O)N1 OIVLITBTBDPEFK-UHFFFAOYSA-N 0.000 description 2
- ZLAQATDNGLKIEV-UHFFFAOYSA-N 5-methyl-2-sulfanylidene-1h-pyrimidin-4-one Chemical compound CC1=CNC(=S)NC1=O ZLAQATDNGLKIEV-UHFFFAOYSA-N 0.000 description 2
- 108700028369 Alleles Proteins 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- 206010003225 Arteriospasm coronary Diseases 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 2
- 241000282472 Canis lupus familiaris Species 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- 208000031229 Cardiomyopathies Diseases 0.000 description 2
- 108091006146 Channels Proteins 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 208000003890 Coronary Vasospasm Diseases 0.000 description 2
- 108010026925 Cytochrome P-450 CYP2C19 Proteins 0.000 description 2
- 102100029363 Cytochrome P450 2C19 Human genes 0.000 description 2
- 102100021704 Cytochrome P450 2D6 Human genes 0.000 description 2
- 102000004127 Cytokines Human genes 0.000 description 2
- 108090000695 Cytokines Proteins 0.000 description 2
- 239000003298 DNA probe Substances 0.000 description 2
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 2
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 2
- 108091029865 Exogenous DNA Proteins 0.000 description 2
- 230000035519 G0 Phase Effects 0.000 description 2
- 208000025499 G6PD deficiency Diseases 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 206010018444 Glucose-6-phosphate dehydrogenase deficiency Diseases 0.000 description 2
- 108010024636 Glutathione Proteins 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 108091027305 Heteroduplex Proteins 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 101000945995 Latrodectus hasselti Alpha-latrotoxin-Lh1a Proteins 0.000 description 2
- 101000945994 Latrodectus hesperus Alpha-latrotoxin-Lhe1a Proteins 0.000 description 2
- 101000945997 Latrodectus mactans Alpha-latrotoxin-Lm1a Proteins 0.000 description 2
- 101000945996 Latrodectus tredecimguttatus Alpha-latrotoxin-Lt1a Proteins 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 101710193418 Myosin light chain 1 Proteins 0.000 description 2
- 102100030740 Myosin light chain 1/3, skeletal muscle isoform Human genes 0.000 description 2
- HYVABZIGRDEKCD-UHFFFAOYSA-N N(6)-dimethylallyladenine Chemical compound CC(C)=CCNC1=NC=NC2=C1N=CN2 HYVABZIGRDEKCD-UHFFFAOYSA-N 0.000 description 2
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 2
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 2
- QHGUCRYDKWKLMG-MRVPVSSYSA-N Octopamine Natural products NC[C@@H](O)C1=CC=C(O)C=C1 QHGUCRYDKWKLMG-MRVPVSSYSA-N 0.000 description 2
- 206010030124 Oedema peripheral Diseases 0.000 description 2
- 108700020796 Oncogene Proteins 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- 108091093037 Peptide nucleic acid Proteins 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- 238000002105 Southern blotting Methods 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 230000000844 anti-bacterial effect Effects 0.000 description 2
- 230000003466 anti-cipated effect Effects 0.000 description 2
- 229940121375 antifungal agent Drugs 0.000 description 2
- 239000003429 antifungal agent Substances 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 235000010323 ascorbic acid Nutrition 0.000 description 2
- 229960005070 ascorbic acid Drugs 0.000 description 2
- 239000011668 ascorbic acid Substances 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 239000013060 biological fluid Substances 0.000 description 2
- 230000005540 biological transmission Effects 0.000 description 2
- 210000002459 blastocyst Anatomy 0.000 description 2
- 210000004204 blood vessel Anatomy 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 230000003197 catalytic effect Effects 0.000 description 2
- 230000036755 cellular response Effects 0.000 description 2
- 210000003837 chick embryo Anatomy 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 210000003711 chorioallantoic membrane Anatomy 0.000 description 2
- 239000013611 chromosomal DNA Substances 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- OROGSEYTTFOCAN-DNJOTXNNSA-N codeine Chemical compound C([C@H]1[C@H](N(CC[C@@]112)C)C3)=C[C@H](O)[C@@H]1OC1=C2C3=CC=C1OC OROGSEYTTFOCAN-DNJOTXNNSA-N 0.000 description 2
- 238000002742 combinatorial mutagenesis Methods 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 208000029078 coronary artery disease Diseases 0.000 description 2
- 201000011634 coronary artery vasospasm Diseases 0.000 description 2
- 239000012228 culture supernatant Substances 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 238000003935 denaturing gradient gel electrophoresis Methods 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 239000003599 detergent Substances 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 230000003292 diminished effect Effects 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- 231100000676 disease causative agent Toxicity 0.000 description 2
- 229940000406 drug candidate Drugs 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 210000004602 germ cell Anatomy 0.000 description 2
- 208000008605 glucosephosphate dehydrogenase deficiency Diseases 0.000 description 2
- 229960003180 glutathione Drugs 0.000 description 2
- 235000011187 glycerol Nutrition 0.000 description 2
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical class O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 238000001114 immunoprecipitation Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 239000007951 isotonicity adjuster Substances 0.000 description 2
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- 230000031864 metaphase Effects 0.000 description 2
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 2
- OSWPMRLSEDHDFF-UHFFFAOYSA-N methyl salicylate Chemical compound COC(=O)C1=CC=CC=C1O OSWPMRLSEDHDFF-UHFFFAOYSA-N 0.000 description 2
- 238000000520 microinjection Methods 0.000 description 2
- 230000033607 mismatch repair Effects 0.000 description 2
- 210000000472 morula Anatomy 0.000 description 2
- 239000002853 nucleic acid probe Substances 0.000 description 2
- 230000035764 nutrition Effects 0.000 description 2
- 229960001576 octopamine Drugs 0.000 description 2
- 239000002674 ointment Substances 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 239000000825 pharmaceutical preparation Substances 0.000 description 2
- 239000012071 phase Substances 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 229920002401 polyacrylamide Polymers 0.000 description 2
- 230000008488 polyadenylation Effects 0.000 description 2
- 235000013930 proline Nutrition 0.000 description 2
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 2
- 230000004952 protein activity Effects 0.000 description 2
- 108020001580 protein domains Proteins 0.000 description 2
- 235000021251 pulses Nutrition 0.000 description 2
- 239000012857 radioactive material Substances 0.000 description 2
- 230000009257 reactivity Effects 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 230000001177 retroviral effect Effects 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 238000007910 systemic administration Methods 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 235000008521 threonine Nutrition 0.000 description 2
- 229940104230 thymidine Drugs 0.000 description 2
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 230000001131 transforming effect Effects 0.000 description 2
- 230000005945 translocation Effects 0.000 description 2
- 230000032258 transport Effects 0.000 description 2
- 230000004614 tumor growth Effects 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 235000014393 valine Nutrition 0.000 description 2
- 230000002792 vascular Effects 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- NNJPGOLRFBJNIW-HNNXBMFYSA-N (-)-demecolcine Chemical compound C1=C(OC)C(=O)C=C2[C@@H](NC)CCC3=CC(OC)=C(OC)C(OC)=C3C2=C1 NNJPGOLRFBJNIW-HNNXBMFYSA-N 0.000 description 1
- YMXHPSHLTSZXKH-RVBZMBCESA-N (2,5-dioxopyrrolidin-1-yl) 5-[(3as,4s,6ar)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]pentanoate Chemical compound C([C@H]1[C@H]2NC(=O)N[C@H]2CS1)CCCC(=O)ON1C(=O)CCC1=O YMXHPSHLTSZXKH-RVBZMBCESA-N 0.000 description 1
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- NLEBIOOXCVAHBD-YHBSTRCHSA-N (2r,3r,4s,5s,6r)-2-[(2r,3s,4r,5r,6s)-6-dodecoxy-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound O[C@@H]1[C@@H](O)[C@@H](OCCCCCCCCCCCC)O[C@H](CO)[C@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 NLEBIOOXCVAHBD-YHBSTRCHSA-N 0.000 description 1
- MMGQOGIGTXBSIC-YTLIFORHSA-N (2s)-2-aminobutanedioic acid;(2s)-2-amino-5-(diaminomethylideneamino)pentanoic acid;(2s)-2-amino-3-(4-hydroxyphenyl)propanoic acid Chemical group OC(=O)[C@@H](N)CC(O)=O.OC(=O)[C@@H](N)CCCNC(N)=N.OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 MMGQOGIGTXBSIC-YTLIFORHSA-N 0.000 description 1
- WJNGQIYEQLPJMN-IOSLPCCCSA-N 1-methylinosine Chemical compound C1=NC=2C(=O)N(C)C=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O WJNGQIYEQLPJMN-IOSLPCCCSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- HLYBTPMYFWWNJN-UHFFFAOYSA-N 2-(2,4-dioxo-1h-pyrimidin-5-yl)-2-hydroxyacetic acid Chemical compound OC(=O)C(O)C1=CNC(=O)NC1=O HLYBTPMYFWWNJN-UHFFFAOYSA-N 0.000 description 1
- SGAKLDIYNFXTCK-UHFFFAOYSA-N 2-[(2,4-dioxo-1h-pyrimidin-5-yl)methylamino]acetic acid Chemical compound OC(=O)CNCC1=CNC(=O)NC1=O SGAKLDIYNFXTCK-UHFFFAOYSA-N 0.000 description 1
- XMSMHKMPBNTBOD-UHFFFAOYSA-N 2-dimethylamino-6-hydroxypurine Chemical compound N1C(N(C)C)=NC(=O)C2=C1N=CN2 XMSMHKMPBNTBOD-UHFFFAOYSA-N 0.000 description 1
- SMADWRYCYBUIKH-UHFFFAOYSA-N 2-methyl-7h-purin-6-amine Chemical compound CC1=NC(N)=C2NC=NC2=N1 SMADWRYCYBUIKH-UHFFFAOYSA-N 0.000 description 1
- FUBFWTUFPGFHOJ-UHFFFAOYSA-N 2-nitrofuran Chemical class [O-][N+](=O)C1=CC=CO1 FUBFWTUFPGFHOJ-UHFFFAOYSA-N 0.000 description 1
- GYJNVSAUBGJVLV-UHFFFAOYSA-N 3-(dimethylazaniumyl)propane-1-sulfonate Chemical compound CN(C)CCCS(O)(=O)=O GYJNVSAUBGJVLV-UHFFFAOYSA-N 0.000 description 1
- KOLPWZCZXAMXKS-UHFFFAOYSA-N 3-methylcytosine Chemical compound CN1C(N)=CC=NC1=O KOLPWZCZXAMXKS-UHFFFAOYSA-N 0.000 description 1
- GJAKJCICANKRFD-UHFFFAOYSA-N 4-acetyl-4-amino-1,3-dihydropyrimidin-2-one Chemical compound CC(=O)C1(N)NC(=O)NC=C1 GJAKJCICANKRFD-UHFFFAOYSA-N 0.000 description 1
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 1
- MQJSSLBGAQJNER-UHFFFAOYSA-N 5-(methylaminomethyl)-1h-pyrimidine-2,4-dione Chemical compound CNCC1=CNC(=O)NC1=O MQJSSLBGAQJNER-UHFFFAOYSA-N 0.000 description 1
- WPYRHVXCOQLYLY-UHFFFAOYSA-N 5-[(methoxyamino)methyl]-2-sulfanylidene-1h-pyrimidin-4-one Chemical compound CONCC1=CNC(=S)NC1=O WPYRHVXCOQLYLY-UHFFFAOYSA-N 0.000 description 1
- LQLQRFGHAALLLE-UHFFFAOYSA-N 5-bromouracil Chemical compound BrC1=CNC(=O)NC1=O LQLQRFGHAALLLE-UHFFFAOYSA-N 0.000 description 1
- VKLFQTYNHLDMDP-PNHWDRBUSA-N 5-carboxymethylaminomethyl-2-thiouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=S)NC(=O)C(CNCC(O)=O)=C1 VKLFQTYNHLDMDP-PNHWDRBUSA-N 0.000 description 1
- ZFTBZKVVGZNMJR-UHFFFAOYSA-N 5-chlorouracil Chemical compound ClC1=CNC(=O)NC1=O ZFTBZKVVGZNMJR-UHFFFAOYSA-N 0.000 description 1
- KSNXJLQDQOIRIP-UHFFFAOYSA-N 5-iodouracil Chemical compound IC1=CNC(=O)NC1=O KSNXJLQDQOIRIP-UHFFFAOYSA-N 0.000 description 1
- KELXHQACBIUYSE-UHFFFAOYSA-N 5-methoxy-1h-pyrimidine-2,4-dione Chemical compound COC1=CNC(=O)NC1=O KELXHQACBIUYSE-UHFFFAOYSA-N 0.000 description 1
- DCPSTSVLRXOYGS-UHFFFAOYSA-N 6-amino-1h-pyrimidine-2-thione Chemical compound NC1=CC=NC(S)=N1 DCPSTSVLRXOYGS-UHFFFAOYSA-N 0.000 description 1
- CJIJXIFQYOPWTF-UHFFFAOYSA-N 7-hydroxycoumarin Natural products O1C(=O)C=CC2=CC(O)=CC=C21 CJIJXIFQYOPWTF-UHFFFAOYSA-N 0.000 description 1
- MSSXOMSJDRHRMC-UHFFFAOYSA-N 9H-purine-2,6-diamine Chemical compound NC1=NC(N)=C2NC=NC2=N1 MSSXOMSJDRHRMC-UHFFFAOYSA-N 0.000 description 1
- 102000012440 Acetylcholinesterase Human genes 0.000 description 1
- 108010022752 Acetylcholinesterase Proteins 0.000 description 1
- 102000010825 Actinin Human genes 0.000 description 1
- 108010063503 Actinin Proteins 0.000 description 1
- 206010067484 Adverse reaction Diseases 0.000 description 1
- 108010000239 Aequorin Proteins 0.000 description 1
- 102100027211 Albumin Human genes 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102100023635 Alpha-fetoprotein Human genes 0.000 description 1
- 206010002383 Angina Pectoris Diseases 0.000 description 1
- 208000036490 Arterial inflammations Diseases 0.000 description 1
- 206010003210 Arteriosclerosis Diseases 0.000 description 1
- 108020005224 Arylamine N-acetyltransferase Proteins 0.000 description 1
- 102100038110 Arylamine N-acetyltransferase 2 Human genes 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 206010003658 Atrial Fibrillation Diseases 0.000 description 1
- 206010003662 Atrial flutter Diseases 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 102100039705 Beta-2 adrenergic receptor Human genes 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 101150010738 CYP2D6 gene Proteins 0.000 description 1
- 102000055006 Calcitonin Human genes 0.000 description 1
- 108010001789 Calcitonin Receptors Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 102000003922 Calcium Channels Human genes 0.000 description 1
- 108090000312 Calcium Channels Proteins 0.000 description 1
- BHPQYMZQTOCNFJ-UHFFFAOYSA-N Calcium cation Chemical compound [Ca+2] BHPQYMZQTOCNFJ-UHFFFAOYSA-N 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 240000001432 Calendula officinalis Species 0.000 description 1
- 235000005881 Calendula officinalis Nutrition 0.000 description 1
- 244000025254 Cannabis sativa Species 0.000 description 1
- 208000005623 Carcinogenesis Diseases 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 206010007572 Cardiac hypertrophy Diseases 0.000 description 1
- 208000006029 Cardiomegaly Diseases 0.000 description 1
- 208000005590 Choroidal Neovascularization Diseases 0.000 description 1
- 206010060823 Choroidal neovascularisation Diseases 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108020004394 Complementary RNA Proteins 0.000 description 1
- 206010056370 Congestive cardiomyopathy Diseases 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 229920000742 Cotton Polymers 0.000 description 1
- 108010051219 Cre recombinase Proteins 0.000 description 1
- 108700020473 Cyclic AMP Receptor Proteins 0.000 description 1
- 102000008130 Cyclic AMP-Dependent Protein Kinases Human genes 0.000 description 1
- 108010049894 Cyclic AMP-Dependent Protein Kinases Proteins 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 108020001738 DNA Glycosylase Proteins 0.000 description 1
- 108020003215 DNA Probes Proteins 0.000 description 1
- 230000004544 DNA amplification Effects 0.000 description 1
- 102000028381 DNA glycosylase Human genes 0.000 description 1
- 101710177611 DNA polymerase II large subunit Proteins 0.000 description 1
- 101710184669 DNA polymerase II small subunit Proteins 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 230000006820 DNA synthesis Effects 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- XPDXVDYUQZHFPV-UHFFFAOYSA-N Dansyl Chloride Chemical compound C1=CC=C2C(N(C)C)=CC=CC2=C1S(Cl)(=O)=O XPDXVDYUQZHFPV-UHFFFAOYSA-N 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- NNJPGOLRFBJNIW-UHFFFAOYSA-N Demecolcine Natural products C1=C(OC)C(=O)C=C2C(NC)CCC3=CC(OC)=C(OC)C(OC)=C3C2=C1 NNJPGOLRFBJNIW-UHFFFAOYSA-N 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 238000009007 Diagnostic Kit Methods 0.000 description 1
- 241000168726 Dictyostelium discoideum Species 0.000 description 1
- 201000010046 Dilated cardiomyopathy Diseases 0.000 description 1
- SNRUBQQJIBEYMU-UHFFFAOYSA-N Dodecane Natural products CCCCCCCCCCCC SNRUBQQJIBEYMU-UHFFFAOYSA-N 0.000 description 1
- 241000255601 Drosophila melanogaster Species 0.000 description 1
- 206010013971 Dyspnoea exertional Diseases 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 241000792859 Enema Species 0.000 description 1
- 108010013369 Enteropeptidase Proteins 0.000 description 1
- 102100029727 Enteropeptidase Human genes 0.000 description 1
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 1
- 108010046276 FLP recombinase Proteins 0.000 description 1
- 108010074860 Factor Xa Proteins 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 102000027582 GPCRs class B Human genes 0.000 description 1
- 108091008883 GPCRs class B Proteins 0.000 description 1
- 108091008881 GPCRs class D Proteins 0.000 description 1
- 108010001515 Galectin 4 Proteins 0.000 description 1
- 102100039556 Galectin-4 Human genes 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 206010071602 Genetic polymorphism Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 102100035172 Glucose-6-phosphate 1-dehydrogenase Human genes 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 108010001483 Glycogen Synthase Proteins 0.000 description 1
- 206010018910 Haemolysis Diseases 0.000 description 1
- 101000884399 Homo sapiens Arylamine N-acetyltransferase 2 Proteins 0.000 description 1
- 241000701109 Human adenovirus 2 Species 0.000 description 1
- AVXURJPOCDRRFD-UHFFFAOYSA-N Hydroxylamine Chemical compound ON AVXURJPOCDRRFD-UHFFFAOYSA-N 0.000 description 1
- 108091008585 IP3 receptors Proteins 0.000 description 1
- 208000026350 Inborn Genetic disease Diseases 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 102000007640 Inositol 1,4,5-Trisphosphate Receptors Human genes 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- FFFHZYDWPBMWHY-VKHMYHEASA-N L-homocysteine Chemical compound OC(=O)[C@@H](N)CCS FFFHZYDWPBMWHY-VKHMYHEASA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 1
- 206010049694 Left Ventricular Dysfunction Diseases 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 244000246386 Mentha pulegium Species 0.000 description 1
- 235000016257 Mentha pulegium Nutrition 0.000 description 1
- 235000004357 Mentha x piperita Nutrition 0.000 description 1
- 108010010914 Metabotropic glutamate receptors Proteins 0.000 description 1
- 102000016193 Metabotropic glutamate receptors Human genes 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 206010073734 Microembolism Diseases 0.000 description 1
- 101100018717 Mus musculus Il1rl1 gene Proteins 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 108010021466 Mutant Proteins Proteins 0.000 description 1
- 102000008300 Mutant Proteins Human genes 0.000 description 1
- 108091005975 Myofilaments Proteins 0.000 description 1
- SGSSKEDGVONRGC-UHFFFAOYSA-N N(2)-methylguanine Chemical compound O=C1NC(NC)=NC2=C1N=CN2 SGSSKEDGVONRGC-UHFFFAOYSA-N 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- 125000000729 N-terminal amino-acid group Chemical group 0.000 description 1
- 108010057466 NF-kappa B Proteins 0.000 description 1
- 102000003945 NF-kappa B Human genes 0.000 description 1
- 201000005118 Nephrogenic diabetes insipidus Diseases 0.000 description 1
- 102000008763 Neurofilament Proteins Human genes 0.000 description 1
- 108010088373 Neurofilament Proteins Proteins 0.000 description 1
- 208000032234 No therapeutic response Diseases 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 102000003982 Parathyroid hormone Human genes 0.000 description 1
- 108090000445 Parathyroid hormone Proteins 0.000 description 1
- 208000000733 Paroxysmal Hemoglobinuria Diseases 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010067902 Peptide Library Proteins 0.000 description 1
- 102100036050 Phosphatidylinositol N-acetylglucosaminyltransferase subunit A Human genes 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 108010004729 Phycoerythrin Proteins 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 101710170204 Protein bride of sevenless Proteins 0.000 description 1
- 108010066717 Q beta Replicase Proteins 0.000 description 1
- 206010063837 Reperfusion injury Diseases 0.000 description 1
- 206010038748 Restrictive cardiomyopathy Diseases 0.000 description 1
- 208000017442 Retinal disease Diseases 0.000 description 1
- 208000007014 Retinitis pigmentosa Diseases 0.000 description 1
- 206010038923 Retinopathy Diseases 0.000 description 1
- 206010038997 Retroviral infections Diseases 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 101150006985 STE2 gene Proteins 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 108010086019 Secretin Proteins 0.000 description 1
- 102100037505 Secretin Human genes 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 208000032023 Signs and Symptoms Diseases 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- DWAQJAXMDSEUJJ-UHFFFAOYSA-M Sodium bisulfite Chemical compound [Na+].OS([O-])=O DWAQJAXMDSEUJJ-UHFFFAOYSA-M 0.000 description 1
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 1
- 241000251131 Sphyrna Species 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 208000001871 Tachycardia Diseases 0.000 description 1
- 241000223892 Tetrahymena Species 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical group OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- 208000007536 Thrombosis Diseases 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 102000013394 Troponin I Human genes 0.000 description 1
- 108010065729 Troponin I Proteins 0.000 description 1
- 102000004987 Troponin T Human genes 0.000 description 1
- 108090001108 Troponin T Proteins 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 102000014384 Type C Phospholipases Human genes 0.000 description 1
- 108010079194 Type C Phospholipases Proteins 0.000 description 1
- 108090000643 Vasopressin Receptors Proteins 0.000 description 1
- 208000033774 Ventricular Remodeling Diseases 0.000 description 1
- ZVNYJIZDIRKMBF-UHFFFAOYSA-N Vesnarinone Chemical compound C1=C(OC)C(OC)=CC=C1C(=O)N1CCN(C=2C=C3CCC(=O)NC3=CC=2)CC1 ZVNYJIZDIRKMBF-UHFFFAOYSA-N 0.000 description 1
- 240000006677 Vicia faba Species 0.000 description 1
- 235000010749 Vicia faba Nutrition 0.000 description 1
- 235000002098 Vicia faba var. major Nutrition 0.000 description 1
- 108020000999 Viral RNA Proteins 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 239000005862 Whey Substances 0.000 description 1
- 102000007544 Whey Proteins Human genes 0.000 description 1
- 108010046377 Whey Proteins Proteins 0.000 description 1
- MMWCIQZXVOZEGG-NCGNNJKGSA-N [(1r,2s,3s,4r,5r,6r)-2,3,5-trihydroxy-4,6-diphosphonooxycyclohexyl] dihydrogen phosphate Chemical compound O[C@H]1[C@H](O)[C@@H](OP(O)(O)=O)[C@H](OP(O)(O)=O)[C@H](O)[C@@H]1OP(O)(O)=O MMWCIQZXVOZEGG-NCGNNJKGSA-N 0.000 description 1
- DLYSYXOOYVHCJN-UDWGBEOPSA-N [(2r,3s,5r)-2-[[[(4-methoxyphenyl)-diphenylmethyl]amino]methyl]-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-3-yl]oxyphosphonamidous acid Chemical compound C1=CC(OC)=CC=C1C(C=1C=CC=CC=1)(C=1C=CC=CC=1)NC[C@@H]1[C@@H](OP(N)O)C[C@H](N2C(NC(=O)C(C)=C2)=O)O1 DLYSYXOOYVHCJN-UDWGBEOPSA-N 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 230000035508 accumulation Effects 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 150000001242 acetic acid derivatives Chemical class 0.000 description 1
- 229940022698 acetylcholinesterase Drugs 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 125000000641 acridinyl group Chemical group C1(=CC=CC2=NC3=CC=CC=C3C=C12)* 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 229960000643 adenine Drugs 0.000 description 1
- 230000006838 adverse reaction Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 108010026331 alpha-Fetoproteins Proteins 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- 230000000202 analgesic effect Effects 0.000 description 1
- 229940035676 analgesics Drugs 0.000 description 1
- 239000002870 angiogenesis inducing agent Substances 0.000 description 1
- 239000000730 antalgic agent Substances 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000000078 anti-malarial effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 210000000628 antibody-producing cell Anatomy 0.000 description 1
- 239000003430 antimalarial agent Substances 0.000 description 1
- 229940033495 antimalarials Drugs 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 125000000637 arginyl group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 1
- 206010003119 arrhythmia Diseases 0.000 description 1
- 230000006793 arrhythmia Effects 0.000 description 1
- 238000010420 art technique Methods 0.000 description 1
- 230000004872 arterial blood pressure Effects 0.000 description 1
- 208000011775 arteriosclerosis disease Diseases 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-L aspartate group Chemical group N[C@@H](CC(=O)[O-])C(=O)[O-] CKLJMWTZIZZHCS-REOHCLBHSA-L 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 230000000923 atherogenic effect Effects 0.000 description 1
- 230000001746 atrial effect Effects 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000003385 bacteriostatic effect Effects 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 238000005452 bending Methods 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- DZBUGLKDJFMEHC-UHFFFAOYSA-N benzoquinolinylidene Chemical group C1=CC=CC2=CC3=CC=CC=C3N=C21 DZBUGLKDJFMEHC-UHFFFAOYSA-N 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- 108010014499 beta-2 Adrenergic Receptors Proteins 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 239000003833 bile salt Substances 0.000 description 1
- 229940093761 bile salts Drugs 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 229920000249 biocompatible polymer Polymers 0.000 description 1
- 230000006287 biotinylation Effects 0.000 description 1
- 238000007413 biotinylation Methods 0.000 description 1
- 210000001109 blastomere Anatomy 0.000 description 1
- 230000008499 blood brain barrier function Effects 0.000 description 1
- 230000017531 blood circulation Effects 0.000 description 1
- 210000001218 blood-brain barrier Anatomy 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 210000002798 bone marrow cell Anatomy 0.000 description 1
- 230000036471 bradycardia Effects 0.000 description 1
- 208000006218 bradycardia Diseases 0.000 description 1
- 210000000424 bronchial epithelial cell Anatomy 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 1
- BBBFJLBPOGFECG-VJVYQDLKSA-N calcitonin Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1 BBBFJLBPOGFECG-VJVYQDLKSA-N 0.000 description 1
- 229960004015 calcitonin Drugs 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 229910001424 calcium ion Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 230000003185 calcium uptake Effects 0.000 description 1
- 230000036952 cancer formation Effects 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 229910002092 carbon dioxide Inorganic materials 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 230000022900 cardiac muscle contraction Effects 0.000 description 1
- 210000000748 cardiovascular system Anatomy 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 230000012292 cell migration Effects 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 230000004700 cellular uptake Effects 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 230000035605 chemotaxis Effects 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 230000008711 chromosomal rearrangement Effects 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 150000001860 citric acid derivatives Chemical class 0.000 description 1
- 238000012411 cloning technique Methods 0.000 description 1
- 238000000975 co-precipitation Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 229960004126 codeine Drugs 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 229940075614 colloidal silicon dioxide Drugs 0.000 description 1
- 238000012875 competitive assay Methods 0.000 description 1
- 230000009918 complex formation Effects 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 238000013270 controlled release Methods 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 210000004351 coronary vessel Anatomy 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 239000003431 cross linking reagent Substances 0.000 description 1
- 210000005220 cytoplasmic tail Anatomy 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 238000013500 data storage Methods 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 239000003398 denaturant Substances 0.000 description 1
- 229960002086 dextran Drugs 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 230000000857 drug effect Effects 0.000 description 1
- 230000036267 drug metabolism Effects 0.000 description 1
- 238000007877 drug screening Methods 0.000 description 1
- 230000001819 effect on gene Effects 0.000 description 1
- 230000002500 effect on skin Effects 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 230000013020 embryo development Effects 0.000 description 1
- 210000002308 embryonic cell Anatomy 0.000 description 1
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 1
- 239000007920 enema Substances 0.000 description 1
- 229940079360 enema for constipation Drugs 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- RTZKZFJDLAIYFH-UHFFFAOYSA-N ether Substances CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- 238000010195 expression analysis Methods 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- IECPWNUMDGFDKC-MZJAQBGESA-N fusidic acid Chemical class O[C@@H]([C@@H]12)C[C@H]3\C(=C(/CCC=C(C)C)C(O)=O)[C@@H](OC(C)=O)C[C@]3(C)[C@@]2(C)CC[C@@H]2[C@]1(C)CC[C@@H](O)[C@H]2C IECPWNUMDGFDKC-MZJAQBGESA-N 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 230000004545 gene duplication Effects 0.000 description 1
- 238000011223 gene expression profiling Methods 0.000 description 1
- 238000012252 genetic analysis Methods 0.000 description 1
- 230000009395 genetic defect Effects 0.000 description 1
- 208000016361 genetic disease Diseases 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 235000004554 glutamine Nutrition 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- 101150036612 gnl gene Proteins 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 230000035876 healing Effects 0.000 description 1
- 208000019622 heart disease Diseases 0.000 description 1
- 230000004217 heart function Effects 0.000 description 1
- 210000003709 heart valve Anatomy 0.000 description 1
- 230000008588 hemolysis Effects 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 235000001050 hortel pimenta Nutrition 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- OROGSEYTTFOCAN-UHFFFAOYSA-N hydrocodone Natural products C1C(N(CCC234)C)C2C=CC(O)C3OC2=C4C1=CC=C2OC OROGSEYTTFOCAN-UHFFFAOYSA-N 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 230000001969 hypertrophic effect Effects 0.000 description 1
- 208000022368 idiopathic cardiomyopathy Diseases 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000003100 immobilizing effect Effects 0.000 description 1
- 238000010166 immunofluorescence Methods 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- CDAISMWEOUEBRE-GPIVLXJGSA-N inositol Chemical compound O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@@H]1O CDAISMWEOUEBRE-GPIVLXJGSA-N 0.000 description 1
- 238000012482 interaction analysis Methods 0.000 description 1
- 239000000138 intercalating agent Substances 0.000 description 1
- 230000008611 intercellular interaction Effects 0.000 description 1
- 230000031146 intracellular signal transduction Effects 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 208000012947 ischemia reperfusion injury Diseases 0.000 description 1
- 150000002520 isoleucines Chemical class 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 230000033001 locomotion Effects 0.000 description 1
- 208000004731 long QT syndrome Diseases 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- HWYHZTIRURJOHG-UHFFFAOYSA-N luminol Chemical compound O=C1NNC(=O)C2=C1C(N)=CC=C2 HWYHZTIRURJOHG-UHFFFAOYSA-N 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 230000007257 malfunction Effects 0.000 description 1
- 210000005075 mammary gland Anatomy 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 230000013011 mating Effects 0.000 description 1
- 108010082117 matrigel Proteins 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 235000006109 methionine Nutrition 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- IZAGSTRIDUNNOY-UHFFFAOYSA-N methyl 2-[(2,4-dioxo-1h-pyrimidin-5-yl)oxy]acetate Chemical compound COC(=O)COC1=CNC(=O)NC1=O IZAGSTRIDUNNOY-UHFFFAOYSA-N 0.000 description 1
- STZCRXQWRGQSJD-GEEYTBSJSA-M methyl orange Chemical compound [Na+].C1=CC(N(C)C)=CC=C1\N=N\C1=CC=C(S([O-])(=O)=O)C=C1 STZCRXQWRGQSJD-GEEYTBSJSA-M 0.000 description 1
- 229940012189 methyl orange Drugs 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 229960001047 methyl salicylate Drugs 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 210000003632 microfilament Anatomy 0.000 description 1
- 210000004925 microvascular endothelial cell Anatomy 0.000 description 1
- 210000004088 microvessel Anatomy 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 230000000394 mitotic effect Effects 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 239000002324 mouth wash Substances 0.000 description 1
- 229940051866 mouthwash Drugs 0.000 description 1
- 101150029137 mutY gene Proteins 0.000 description 1
- 208000010125 myocardial infarction Diseases 0.000 description 1
- ZTLGJPIZUOVDMT-UHFFFAOYSA-N n,n-dichlorotriazin-4-amine Chemical compound ClN(Cl)C1=CC=NN=N1 ZTLGJPIZUOVDMT-UHFFFAOYSA-N 0.000 description 1
- XJVXMWNLQRTRGH-UHFFFAOYSA-N n-(3-methylbut-3-enyl)-2-methylsulfanyl-7h-purin-6-amine Chemical compound CSC1=NC(NCCC(C)=C)=C2NC=NC2=N1 XJVXMWNLQRTRGH-UHFFFAOYSA-N 0.000 description 1
- UMWKZHPREXJQGR-XOSAIJSUSA-N n-methyl-n-[(2s,3r,4r,5r)-2,3,4,5,6-pentahydroxyhexyl]decanamide Chemical compound CCCCCCCCCC(=O)N(C)C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO UMWKZHPREXJQGR-XOSAIJSUSA-N 0.000 description 1
- SBWGZAXBCCNRTM-CTHBEMJXSA-N n-methyl-n-[(2s,3r,4r,5r)-2,3,4,5,6-pentahydroxyhexyl]octanamide Chemical compound CCCCCCCC(=O)N(C)C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO SBWGZAXBCCNRTM-CTHBEMJXSA-N 0.000 description 1
- 239000007922 nasal spray Substances 0.000 description 1
- 239000006218 nasal suppository Substances 0.000 description 1
- 239000006199 nebulizer Substances 0.000 description 1
- 210000000653 nervous system Anatomy 0.000 description 1
- 210000005044 neurofilament Anatomy 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 231100000956 nontoxicity Toxicity 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 238000011330 nucleic acid test Methods 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 150000003833 nucleoside derivatives Chemical class 0.000 description 1
- HEGSGKPQLMEBJL-RKQHYHRCSA-N octyl beta-D-glucopyranoside Chemical compound CCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O HEGSGKPQLMEBJL-RKQHYHRCSA-N 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 239000012285 osmium tetroxide Substances 0.000 description 1
- 229910000489 osmium tetroxide Inorganic materials 0.000 description 1
- 239000007800 oxidant agent Substances 0.000 description 1
- 230000001590 oxidative effect Effects 0.000 description 1
- 230000020477 pH reduction Effects 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 239000000199 parathyroid hormone Substances 0.000 description 1
- 229960001319 parathyroid hormone Drugs 0.000 description 1
- 201000003045 paroxysmal nocturnal hemoglobinuria Diseases 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 238000011170 pharmaceutical development Methods 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- 230000009120 phenotypic response Effects 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 150000008300 phosphoramidites Chemical class 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 108091008695 photoreceptors Proteins 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 230000006461 physiological response Effects 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 230000036470 plasma concentration Effects 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 230000010287 polarization Effects 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 239000008389 polyethoxylated castor oil Substances 0.000 description 1
- 239000004633 polyglycolic acid Substances 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 102000054765 polymorphisms of proteins Human genes 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 230000030786 positive chemotaxis Effects 0.000 description 1
- 230000002028 premature Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 239000003380 propellant Substances 0.000 description 1
- 229940076376 protein agonist Drugs 0.000 description 1
- 229940076372 protein antagonist Drugs 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 239000000376 reactant Substances 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000014493 regulation of gene expression Effects 0.000 description 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 1
- 238000007634 remodeling Methods 0.000 description 1
- 208000037803 restenosis Diseases 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 1
- 229940081974 saccharin Drugs 0.000 description 1
- 235000019204 saccharin Nutrition 0.000 description 1
- 239000000901 saccharin and its Na,K and Ca salt Substances 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000003345 scintillation counting Methods 0.000 description 1
- 229960002101 secretin Drugs 0.000 description 1
- OWMZNFCDEHGFEP-NFBCVYDUSA-N secretin human Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(N)=O)[C@@H](C)O)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)C1=CC=CC=C1 OWMZNFCDEHGFEP-NFBCVYDUSA-N 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 210000000582 semen Anatomy 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 235000004400 serine Nutrition 0.000 description 1
- 231100000004 severe toxicity Toxicity 0.000 description 1
- 210000001013 sinoatrial node Anatomy 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 210000000329 smooth muscle myocyte Anatomy 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 235000010267 sodium hydrogen sulphite Nutrition 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000006104 solid solution Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 238000003153 stable transfection Methods 0.000 description 1
- 238000012409 standard PCR amplification Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 150000005846 sugar alcohols Polymers 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 229940124530 sulfonamide Drugs 0.000 description 1
- 150000003456 sulfonamides Chemical class 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000002511 suppository base Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 230000006794 tachycardia Effects 0.000 description 1
- 230000002123 temporal effect Effects 0.000 description 1
- 208000001608 teratocarcinoma Diseases 0.000 description 1
- 238000012956 testing procedure Methods 0.000 description 1
- 231100001274 therapeutic index Toxicity 0.000 description 1
- 238000011285 therapeutic regimen Methods 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 238000003161 three-hybrid assay Methods 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 238000012085 transcriptional profiling Methods 0.000 description 1
- 230000002463 transducing effect Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 125000000430 tryptophan group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C2=C([H])C([H])=C([H])C([H])=C12 0.000 description 1
- 230000005747 tumor angiogenesis Effects 0.000 description 1
- 230000005740 tumor formation Effects 0.000 description 1
- 238000003160 two-hybrid assay Methods 0.000 description 1
- 238000010396 two-hybrid screening Methods 0.000 description 1
- 150000003668 tyrosines Chemical class 0.000 description 1
- ORHBXUUXSCNDEV-UHFFFAOYSA-N umbelliferone Chemical compound C1=CC(=O)OC2=CC(O)=CC=C21 ORHBXUUXSCNDEV-UHFFFAOYSA-N 0.000 description 1
- HFTAFOQKODTIJY-UHFFFAOYSA-N umbelliferone Natural products Cc1cc2C=CC(=O)Oc2cc1OCC=CC(C)(C)O HFTAFOQKODTIJY-UHFFFAOYSA-N 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 238000009777 vacuum freeze-drying Methods 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 230000002861 ventricular Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000008215 water for injection Substances 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- WCNMEQDMUYVWMJ-JPZHCBQBSA-N wybutoxosine Chemical compound C1=NC=2C(=O)N3C(CC([C@H](NC(=O)OC)C(=O)OC)OO)=C(C)N=C3N(C)C=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O WCNMEQDMUYVWMJ-JPZHCBQBSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- GPCRs G-protein coupled receptors
- proteins that have seven transmembrane domains. Upon binding of a ligand to an extracellular portion of a GPCR, a signal is transduced within the cell that results in a change in a biological or physiological property ofthe cell.
- G protein-coupled receptors GPCRs
- G-proteins and effectors intracellular enzymes and channels which are modulated by G-proteins
- GPCRs G protein-coupled receptors
- the GPCR protein superfamily now contains over 250 types of paralogues, receptors that represent variants generated by gene duplications or other processes (as opposed to orthologues, the same receptor from different species and homologues, different forms of a receptor isolated from a single organism).
- the superfamily can be broken down into five families: Family I, receptors typified by rhodopsin and the beta2- adrenergic receptor and currently represented by over 200 unique members (reviewed by Dohlman et al, (1991) Annu. Rev. Biochem. 60:653-688); Family II, the recently characterized parathyroid hormone/calcitonin/secretin receptor family (Juppner et al. (1991) Science 254:1024-1026; Lin et al.
- Drosophila express a photoreceptor-specific protein bride of sevenless (boss), a seven- transmembrane-segment protein which has been extensively studied and does not show evidence of being a GPCR (Hart et al. (1993) Proc. Natl. Acad. Sci. USA 90:5047- 5051 ).
- the gene frizzled (fz) in Drosophila is also thought to be a protein with seven transmembrane segments. Like boss, fz has not been shown to couple to G-proteins (Vinson et al, Nature 338:263-264 (1989)).
- G proteins represent a family of heterotrimeric proteins composed of ⁇ , ⁇ and ⁇ subunits, which bind guanine nucleotides. These proteins are usually linked to cell surface receptors, e.g., receptors containing seven transmembrane domains. Following ligand binding to the GPCR, a conformational change is transmitted to the G protein, which causes the ⁇ -subunit to exchange a bound GDP molecule for a GTP molecule and to dissociate from the ⁇ -subunits.
- the GTP-bound form ofthe ⁇ -subunit typically functions as an effector-modulating moiety, leading to the production of second messengers, such as cyclic AMP (e.g., by activation of adenylate cyclase), diacylglycerol or inositol phosphates.
- second messengers such as cyclic AMP (e.g., by activation of adenylate cyclase), diacylglycerol or inositol phosphates.
- cyclic AMP e.g., by activation of adenylate cyclase
- diacylglycerol diacylglycerol
- inositol phosphates inositol phosphates.
- G proteins are described extensively in Lodish H. et al. Molecular Cell Biology, (Scientific American Books Inc., New York, N.Y., 1995).
- GPCRs are a major target for drug
- the present invention is based, at least in part, on the discovery of novel G- protein coupled receptor (GPCR) family members, referred to herein as "SLGP” nucleic acid and protein molecules.
- GPCR G- protein coupled receptor
- the human SLGP molecules ofthe invention are also referred to herein as “1983" nucleic acid and protein molecules.
- the mouse SLGP molecules ofthe invention are also referred to herein as "12231” or “ml983" nucleic acid and protein molecules.
- this invention provides isolated nucleic acid molecules encoding SLGP proteins or biologically active portions thereof, as well as nucleic acid fragments suitable as primers or hybridization probes for the detection of SLGP-encoding nucleic acids.
- the present invention is also based at least in part, on the discovery that the discovery that the
- SLGP molecules ofthe present invention are involved in the modulation of angiogenesis in endothelial cells (e.g., tumor endothelial cells) and that, therefore, they are useful as targets and therapeutic agents for the modulation of endothelial cell (e.g., tumor endothelial cell) proliferation, growth, differentiation, or migration.
- endothelial cell e.g., tumor endothelial cell
- the SLGP molecules ofthe present invention are also useful as targets and therapeutic agents for cellular proliferation, growth, differentiation, or migration disorders (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia).
- an SLGP nucleic acid molecule ofthe invention is at least 40%, 42%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or more identical to the nucleotide sequence (e.g., to the entire length ofthe nucleotide sequence) shown in SEQ ID NOT, SEQ ID NO:3, SEQ ID NO:17, SEQ ID NO:19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or a complement thereof.
- the isolated nucleic acid molecule includes the nucleotide sequence shown SEQ ID NOT, SEQ ID NO:3, SEQ ID NO:17, SEQ ID NO: 19, or a complement thereof.
- the nucleic acid molecule includes SEQ ID NO:3 and nucleotides 1-19 of SEQ ID NOT.
- the nucleic acid molecule includes SEQ ID NO:3 and nucleotides 2090-2987 of SEQ ID NOT.
- the nucleic acid molecule includes SEQ ID NO: 19 and nucleotides 1-69 of SEQ ID NO:17.
- the nucleic acid molecule includes SEQ ID NO: 19 and nucleotides 2139-3952 of SEQ ID NO: 17.
- the nucleic acid molecule consists ofthe nucleotide sequence shown in SEQ ID NO: 1,3, 17, or 19. In another preferred embodiment, the nucleic acid molecule includes a fragment of at least 749 nucleotides ofthe nucleotide sequence of SEQ ID NOT, SEQ ID NO:3, or a complement thereof.
- an SLGP nucleic acid molecule includes a nucleotide sequence encoding a protein having an amino acid sequence sufficiently homologous to the amino acid sequence of SEQ ID NO:2, SEQ ID NOT 8, or an amino acid sequence encoded by the DNA insert ofthe plasmid deposited with ATCC as Accession Number .
- an SLGP nucleic acid molecule includes a nucleotide sequence encoding a protein having an amino acid sequence at least 28%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or more identical to the amino acid sequence of SEQ ID NO:2, SEQ ID NOT 8, or the amino acid sequence encoded by the DNA insert ofthe plasmid deposited with ATCC as
- an isolated nucleic acid molecule encodes the amino acid sequence of human SLGP. In another preferred embodiment, an isolated nucleic acid molecule encodes the amino acid sequence of mouse SLGP. In yet another preferred embodiment, the nucleic acid molecule includes a nucleotide sequence encoding a protein having the amino acid sequence of SEQ ID NO:2, SEQ DI NOT 8, or the amino acid sequence encoded by the DNA insert ofthe plasmid deposited with ATCC as Accession Number . In yet another preferred embodiment, the nucleic acid molecule is at least 3952 nucleotides in length. In a further preferred embodiment, the nucleic acid molecule is at least 3952 nucleotides in length and encodes a protein having an SLGP activity (as described herein).
- nucleic acid molecules preferably SLGP nucleic acid molecules, which specifically detect SLGP nucleic acid molecules relative to nucleic acid molecules encoding non-SLGP proteins.
- a nucleic acid molecule is at least 1930, 1900-2000, 1700-2200, 1500-2400, 1300-2600, 1100-2800 or more nucleotides in length and hybridizes under stringent conditions to a nucleic acid molecule comprising the nucleotide sequence shown in SEQ ID NOT or SEQ ID NO: 17, the nucleotide sequence ofthe DNA insert of the plasmid deposited with ATCC as Accession Number , or a complement thereof.
- the nucleic acid molecules are at least 15 (e.g., contiguous) nucleotides in length and hybridize under stringent conditions to nucleotides 1-569, 1058-1295, or 2044-2225 of SEQ ID NOT. In other preferred embodiments, the nucleic acid molecules comprise nucleotides 1-569, 1058-1295, or 2044-2225 of SEQ ID NOT.
- the nucleic acid molecule encodes a naturally occurring allelic variant of a polypeptide comprising the amino acid sequence of SEQ ID NO:2, SEQ ID NOT8, or an amino acid sequence encoded by the DNA insert ofthe plasmid deposited with ATCC as Accession Number , wherein the nucleic acid molecule hybridizes to a nucleic acid molecule comprising SEQ ID NO:l, SEQ ID NO:3, SEQ ID, SEQ ID NOT7, or SEQ ID NOT9 under stringent conditions.
- Another embodiment ofthe invention provides an isolated nucleic acid molecule which is antisense to an SLGP nucleic acid molecule, e.g., the coding strand of an SLGP nucleic acid molecule.
- Another aspect ofthe invention provides a vector comprising an SLGP nucleic acid molecule.
- the vector is a recombinant expression vector.
- the invention provides a host cell containing a vector ofthe invention.
- the invention also provides a method for producing a protein, preferably an SLGP protein, by culturing in a suitable medium, a host cell, e.g., a mammalian host cell such as a non-human mammalian cell, ofthe invention containing a recombinant expression vector, such that the protein is produced.
- a host cell e.g., a mammalian host cell such as a non-human mammalian cell
- a recombinant expression vector such that the protein is produced.
- an SLGP protein includes at least one transmembrane domain.
- the isolated protein preferably an SLGP protein includes seven transmembrane domains.
- an SLGP protein includes at least one transmembrane domain and has an amino acid sequence at least about 28%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%), 85%, 90%), 95%, 98% or more identical to the amino acid sequence of SEQ ID NO:2, SEQ ID NO: 18, or the amino acid sequence encoded by the DNA insert ofthe plasmid deposited with ATCC as Accession Number .
- the SLGP protein includes at least one transmembrane domain and plays a role in the mobilization of intracellular molecules that participate in a signal transduction pathway, e.g., phosphatidylinositol 4,5-bisphosphate (P1P2 inositol 1,4,5-triphosphate (IP3), or adenylate cyclase; the production or secretion of molecules; alteration in the structure of a cellular component; cell proliferation, e.g., synthesis of DNA; cell migration; cell differentiation; cell survival; or angiogenesis, e.g.
- a signal transduction pathway e.g., phosphatidylinositol 4,5-bisphosphate (P1P2 inositol 1,4,5-triphosphate (IP3), or adenylate cyclase
- P1P2 inositol 1,4,5-triphosphate IP3
- adenylate cyclase adenylate cyclase
- an SLGP protein includes at least one transmembrane domain and plays a role in the modulation of angiogenesis (e.g., angiogenesis in tumors).
- the protein preferably an SLGP protein, includes at least one transmembrane domain and is encoded by a nucleic acid molecule having a nucleotide sequence which hybridizes under stringent hybridization conditions to a nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 1 , SEQ ID NO:3, SEQ ID NO: 17, or SEQ ID NO: 19.
- the invention features fragments ofthe protein having the amino acid sequence of SEQ ID NO:2 or SEQ ID NO: 18, wherein the fragment comprises at least 15 amino acids (e.g., contiguous amino acids) ofthe amino acid sequence of SEQ ID NO:2, SEQ ID NO: 18, or an amino acid sequence encoded by the DNA insert ofthe plasmid deposited with the ATCC as Accession Number .
- the protein preferably an SLGP protein, has the amino acid sequence of SEQ ID NO:2 or SEQ ID NO: 18.
- the invention features an isolated protein, preferably an SLGP protein, which is encoded by a nucleic acid molecule consisting of a nucleotide sequence at least about 40%, 42%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or more identical to a nucleotide sequence of SEQ ID NOT, SEQ ID NO:3, SEQ ID NOT 7, SEQ ID NOT9, or a complement thereof.
- This invention further features an isolated protein which is encoded by a nucleic acid molecule consisting of a nucleotide sequence which hybridizes under stringent hybridization conditions to a nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 1 , SEQ ID NO:3, SEQ ID NOT7, SEQ ID NO:19, or a complement thereof.
- the proteins ofthe present invention or portions thereof, e.g., biologically active portions thereof, can be operatively linked to a non-SLGP polypeptide (e.g., heterologous amino acid sequences) to form fusion proteins.
- the invention further features antibodies, such as monoclonal or polyclonal antibodies, that specifically bind the SLGP proteins ofthe invention.
- the SLGP proteins or biologically active portions thereof can be incorporated into pharmaceutical compositions, which optionally include pharmaceutically acceptable carriers.
- the present invention provides a method for detecting the presence of an SLGP nucleic acid molecule, protein or polypeptide in a biological sample by contacting the biological sample with an agent capable of detecting an SLGP nucleic acid molecule, protein or polypeptide such that the presence of an SLGP nucleic acid molecule, protein or polypeptide is detected in the biological sample.
- the present invention provides a method for detecting the presence of SLGP activity in a biological sample by contacting the biological sample with an agent capable of detecting an indicator of SLGP activity such that the presence of SLGP activity is detected in the biological sample.
- the invention provides a method for modulating SLGP activity comprising contacting a cell capable of expressing SLGP with an agent that modulates SLGP activity such that SLGP activity in the cell is modulated.
- the agent inhibits SLGP activity.
- the agent stimulates SLGP activity.
- the agent is an antibody that specifically binds to an SLGP protein.
- the agent modulates expression of SLGP by modulating transcription of an SLGP gene or translation of an SLGP mRNA.
- the agent is a nucleic acid molecule having a nucleotide sequence that is antisense to the coding strand of an SLGP mRNA or an SLGP gene.
- the methods ofthe present invention are used to treat a subject having a disorder characterized by aberrant SLGP protein or nucleic acid expression or activity by administering an agent which is an SLGP modulator to the subject.
- the SLGP modulator is an SLGP protein.
- the SLGP modulator is an SLGP nucleic acid molecule.
- the SLGP modulator is a peptide, peptidomimetic, or other small molecule.
- the disorder characterized by aberrant SLGP protein or nucleic acid expression is a proliferative disorder, e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia.
- a proliferative disorder e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia.
- the present invention also provides a diagnostic assay for identifying the presence or absence of a genetic alteration characterized by at least one of (i) aberrant modification or mutation of a gene encoding an SLGP protein; (ii) mis-regulation ofthe gene; and (iii) aberrant post-translational modification of an SLGP protein, wherein a wild-type form ofthe gene encodes an protein with an SLGP activity.
- the invention provides a method for identifying a compound that binds to or modulates the activity of an SLGP protein, by providing an indicator composition comprising an SLGP protein having SLGP activity, contacting the indicator composition with a test compound, and determining the effect ofthe test compound on SLGP activity in the indicator composition to identify a compound that modulates the activity of an SLGP protein.
- Figure 1 depicts the cDNA sequence of human SLGP (also referred to herein as 1983).
- the nucleotide sequence corresponds to nucleic acids 1 to 2987 of SEQ ID NOT.
- Figure 2 depicts the predicted amino acid sequence of human SLGP.
- the amino acid sequence corresponds to amino acids 1 to 690 of SEQ ID NO:2.
- Figures 3 A and 3B depict the coding region ofthe cDNA sequence of human SLGP.
- the nucleotide sequence corresponds to amino acids 1 to 2070 of SEQ ID NO:3.
- Figures 4A and 4B depict an alignment ofthe amino acid sequences of human SLGP (SEQ ID NO:2) and human CD 97 (Accession No. U76764, SEQ ID NO: 15). This alignment were generated utilizing the ALIGN program with the following parameter setting: PAM120, gap penalties: -12/-4 (Myers, E. and Miller, W. (1988) "Optimal Alignments in Linear Space" CABIOS 4:11-17).
- Figures 5A-5F depict an alignment ofthe nucleotide sequences of human SLGP (SEQ ID NO:2) and human CD 97 (Accession No. U76764, SEQ ID NO: 16). This alignment were generated utilizing the ALIGN program with the following parameter setting: PAM120, gap penalties: -12/-4 (Myers, E. and Miller, W. (1988) "Optimal Alignments in Linear Space” CABIOS 4:11-17).
- Figures 6 A and 6B depict the cDNA sequence of mouse SLGP (also referred to herein as ml983 and 12231).
- the nucleotide sequence corresponds to nucleic acids 1 to 3,592 of SEQ ID NO.T 7.
- Figure 7 depicts the predicted amino acid sequence of mouse SLGP.
- the amino acid sequence corresponds to amino acids 1 to 689 of SEQ ID NO: 18.
- Figures 8 A and 8B depict the coding region ofthe cDNA sequence of mouse SLGP.
- the nucleotide sequence corresponds to amino acids 1 to 2067 of SEQ ID NO:19.
- Figure 9 is a graph depicting the results of a TaqManTM analysis of expression of human SLGP (1983) cDNA in HMVEC.
- Human SLGP (1983) is up-regulated in tube forming HMVEC and proliferating HMVEC as compared to arresting HMVEC.
- Figure 10 is a graph depicting human SLGP (1983) expression in HMVEC by transcripional profiling analysis. Human SLGP (1983) is up-regulated in proliferating HMVEC as compared to arresting HMVEC.
- Figure 11 is a graph depicting TaqManTM analysis of human SLGP (1983) expression in HMVEC. Human SLGP (1983) is up-regulated in proliferating HMVEC.
- Figure 12 is a graph depicting mouse SLGP (12231 or ml983) expression in VEGF -induced angiogenic xenograft plugs and parental xenografts by transcriptional profiling.
- Mouse SLGP (12231 or ml983) expression is up-regulated in VEGF-induced angiogenic xenograft plugs.
- Figure 13 is a graph depicting TaqManTM analysis of mouse SLGP (12231 or ml 983) expression in VEGF-induced angiogenic xenograft plugs and parental plugs.
- Mouse SLGP (12231 or ml983) expression is up-regulated in VEGF-induced angiogenic xenograft plugs.
- Figure 14 is a graph depicting TaqManTM analysis of human SLGP (1983) expression in glioblastomas and normal brains.
- Human SLGP (1983) expression is up- regulated in glioblastomas as compared to normal brains.
- the present invention is based, at least in part, on the discovery of novel G- protein coupled receptor (GPCR) family members, referred to herein as SLGP protein and nucleic acid molecules.
- GPCR G- protein coupled receptor
- the human SLGP molecules are also referred to as “1983” molecules and the mouse SLGP molecules are also referred to as “12231 or “ml983” molecules.
- the present invention also provides methods and compositions for the diagnosis and treatment of cellular proliferation, growth, differentiation, or migration disorders (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia).
- the present invention is also based, at least in part, on the discovery that the novel SLGP molecules ofthe present invention are upregulated in in vitro proliferating and tube forming Human Dermal Microvascular Endothelial Cells (HMVEC) (see Figures 9, 10, and 11), are expressed in endothelial cells of glioblastomas as compared to normal brains (see Figure 14), and are upregulated in VEGF-induced angiogenic xenograft plugs as compared to parental xenografts (see Figures 12 and 13). Therefore, the SLGP molecules ofthe present invention modulate angiogenesis by endothelial cells ' (e.g., tumor endothelial cells).
- HMVEC Human Dermal Microvascular Endothelial Cells
- the SLGP molecules ofthe present invention are useful as targets for developing modulating agents to regulate a variety of cellular processes including angiogenesis (e.g., the proliferation, elongation, and migration of endothelial cells, such as endothelial cells in tumors).
- Angiogenesis is responsible for the formation of new vessels in tumor sites. The new vessels provide the oxygen and nutritional supply to tumors. Therefore, the SLGP modulators ofthe invention can modulate tumor formation and growth by modulating angiogenesis.
- inhibition ofthe activity of an SLGP molecule can cause decreased angiogenesis, i.e., a decrease in cellular proliferation, elongation, and migration of endothelial cells and, thus, a decrease in the formation of new vessels, and a decrease in the supply of oxygen and nutrition to a tumor. Therefore, the SLGP modulators ofthe invention can be used to treat formation and growth of tumors, e.g., cancer, and other diseases characterized by excessive vessel formation such as arthritis and retinopathy. Additionally, increasing the activity of an SLGP molecule can cause increased angiogenesis and, therefore, increased vessel formation and can, thus, be used in treating diseases characterized by decreased vessel formation, e.g., tissue ischemia. Therefore, the SLGP molecules ofthe present invention are useful as targets and therapeutic agents for the modulation of diseases characterized by decreased angiogenesis, e.g., tissue ischemia, such as myocardial ischemia.
- the SLGP protein is a GPCR that participates in signaling pathways within cells, e.g., signaling pathways involved in proliferation or differentiation.
- a signaling pathway refers to the modulation (e.g., the stimulation or inhibition) of a cellular function/activity upon the binding of a ligand to the GPCR (SLGP protein).
- Examples of such functions include mobilization of intracellular molecules that participate in a signal transduction pathway, e.g., phosphatidylinositol 4,5-bisphosphate (PIP2), inositol 1,4,5-triphosphate (IP3) or adenylate cyclase; polarization ofthe plasma membrane; production or secretion of molecules; alteration in the structure of a cellular component; cell proliferation, e.g., synthesis of DNA and angiogenesis, e.g., proliferation, elongation, and migration of endothelial cells (e.g., tumor endothelial cells) to form new vessels (e.g., endothelial tubes); cell differentiation; and cell survival.
- a signal transduction pathway e.g., phosphatidylinositol 4,5-bisphosphate (PIP2), inositol 1,4,5-triphosphate (IP3) or adenylate cyclase
- PIP3 phosphatidy
- the SLGP protein interacts with a "G protein" to produce one or more secondary signals in a variety of intracellular signal transduction pathways, e.g., through phosphatidylinositol or cyclic AMP metabolism and turnover, in a cell.
- G proteins represent a family of heterotrimeric proteins composed of ⁇ , ⁇ and ⁇ subunits, which bind guanine nucleotides. These proteins are usually linked to cell surface receptors, e.g., receptors containing seven transmembrane domains, such as the ligand receptors.
- a conformational change is transmitted to the G protein, which causes the ⁇ -subunit to exchange a bound GDP molecule for a GTP molecule and to dissociate from the ⁇ -subunits.
- the GTP-bound form ofthe ⁇ -subunit typically functions as an effector-modulating moiety, leading to the production of second messengers, such as cyclic AMP (e.g., by activation of adenylate cyclase), diacylglycerol or inositol phosphates.
- second messengers such as cyclic AMP (e.g., by activation of adenylate cyclase), diacylglycerol or inositol phosphates.
- G proteins examples include Gi, Go, Gq, Gs and Gt. G proteins are described extensively in Lodish H. et al. Molecular Cell Biology, (Scientific American Books Inc., New York, N.Y., 1995), the contents of which are incorporated herein by reference.
- PIP2 phosphatidylinositol turnover and metabolism
- PIP2 is a phospholipid found in the cytosolic leaflet ofthe plasma membrane.
- IP3 1,2-diacylglycerol
- DAG 1,2-diacylglycerol
- IP3 inositol 1,4,5- triphosphate
- IP3 can also be phosphorylated by a specific kinase to form inositol 1,3,4,5-tetraphosphate (IP4), a molecule which can cause calcium entry into the cytoplasm from the extracellular medium.
- IP4 and IP4 can subsequently be hydrolyzed very rapidly to the inactive products inositol 1,4-biphosphate (IP2) and inositol 1,3,4-triphosphate, respectively.
- IP2 inositol 1,4-biphosphate
- IP2 inositol 1,3,4-triphosphate
- Protein kinase C is usually found soluble in the cytoplasm ofthe cell, but upon an increase in the intracellular calcium concentration, this enzyme can move to the plasma membrane where it can be activated by DAG.
- the activation of protein kinase C in different cells results in various cellular responses such as the phosphorylation of glycogen synthase, or the phosphorylation of various transcription factors, e.g., NF-kB.
- phosphatidylinositol activity includes an activity of PIP2 or one of its metabolites.
- cyclic AMP turnover and metabolism includes molecules involved in the turnover and metabolism of cyclic AMP (cAMP) as well as to the activities of these molecules.
- Cyclic AMP is a second messenger produced in response to ligand induced stimulation of certain G protein coupled receptors.
- binding of ligand to a ligand receptor can lead to the activation ofthe enzyme adenylate cyclase, which catalyzes the synthesis of cAMP.
- the newly synthesized cAMP can in turn activate a cAMP-dependent protein kinase.
- SLGP molecules ofthe present invention are involved in modulation of cellular proliferation, growth, differentiation, or migration processes.
- a "cellular proliferation, growth, differentiation, or migration process” includes a process by which a cell e.g., an endothelial cell, increases in number, size, or content; by which a cell develops a specialized set of characteristics which differ from that of other cells; or by which a cell moves closer to or further from a particular location or stimulus (e.g., angiogenesis).
- cellular proliferation, growth, differentiation, or migration disorders include cancer, e.g., carcinoma, sarcoma, or leukemia; tumor angiogenesis and metastasis; and other diseases which are characterized by increased or deceased angiogenesis, including, but not limited to arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia.
- cardiovascular disorders may also be implicated in cardiovascular disorders, congestive heart failure, or other cardiac cellular processes.
- cardiovascular disorder includes a disease, disorder, or state involving the cardiovascular system, e.g., the heart, the blood vessels, and/or the blood.
- a cardiovascular disorder can be caused by an imbalance in arterial pressure, a malfunction ofthe heart, or an occlusion of a blood vessel, e.g., by a thrombus.
- disorders include hypertension, atherosclerosis, coronary artery spasm, coronary artery disease, valvular disease, arrhythmias, cardiomyopathies (e.g., dilated cardiomyopathy, idiopathic cardiomyopathy), arteriosclerosis, ischemia reperfusion injury, restenosis, arterial inflammation, vascular wall remodeling, ventricular remodeling, rapid ventricular pacing, coronary microembolism, tachycardia, bradycardia, pressure overload, aortic bending, coronary artery ligation, vascular heart disease, atrial fibrilation, long-QT syndrome, congestive heart failure, sinus node disfunction, angina, heart failure, hypertension, atrial fibrillation, atrial flutter, myocardial infarction, cardiac hypertrophy, and coronary artery spasm.
- cardiomyopathies e.g., dilated cardiomyopathy, idiopathic cardiomyopathy
- arteriosclerosis ischemia reperfusion injury
- congestive heart failure includes a condition characterized by a diminished capacity ofthe heart to supply the oxygen demands ofthe body. Symptoms and signs of congestive heart failure include diminished blood flow to the various tissues ofthe body, accumulation of excess blood in the various organs, e.g., when the heart is unable to pump out the blood returned to it by the great veins, exertional dyspnea, fatigue, and/or peripheral edema, e.g., peripheral edema resulting from left ventricular dysfunction. Congestive heart failure may be- acute or chronic. The manifestation of congestive heart failure usually occurs secondary to a variety of cardiac or systemic disorders that share a temporal or permanent loss of cardiac function.
- disorders include hypertension, coronary artery disease, valvular disease, and cardiomyopathies, e.g., hypertrophic, dilative, or restrictive cardiomyopathies.
- Congestive heart failure is described in, for example, Cohn J.N. et al (1998) American Family Physician 57:1901-04, the contents of which are incorporated herein by reference.
- cardiac cellular processes includes intra-cellular or inter-cellular processes involved in the functioning ofthe heart.
- Cellular processes involved in the nutrition and maintenance ofthe heart, the development ofthe heart, or the ability ofthe heart to pump blood to the rest ofthe body are intended to be covered by this term. Such processes include, for example, cardiac muscle contraction, distribution and transmission of electrical impulses, and cellular processes involved in the opening and closing ofthe cardiac valves.
- the term “cardiac cellular processes” further includes processes such as the transcription, translation and post- translational modification of proteins involved in the functioning ofthe heart, e.g., myofilament specific proteins, such as troponin I, troponin T, myosin light chain 1 (MLC1), and ⁇ - actinin.
- myofilament specific proteins such as troponin I, troponin T, myosin light chain 1 (MLC1), and ⁇ - actinin.
- novel SLGP molecules ofthe present invention comprise a family of molecules having certain conserved structural and functional features.
- family when referring to the protein and nucleic acid molecules ofthe invention is intended to mean two or more proteins or nucleic acid molecules having a common structural domain or motif and having sufficient amino acid or nucleotide sequence homology as defined herein.
- family members can be naturally or non-naturally occurring and can be from either the same or different species.
- a family can contain a first protein of human origin, as well as other, distinct proteins of human origin or alternatively, can contain homologues of non-human origin.
- Members of a family may also have common functional characteristics.
- GPCRs G protein-coupled receptors
- the family of G protein-coupled receptors (GPCRs) comprise an N- terminal domain, seven transmembrane domains (also referred to as membrane-spanning domains), six loop domains, and a C-terminal cytoplasmic domain (also referred to as a cytoplasmic tail).
- GPCRs G protein-coupled receptors
- Members ofthe SLGP family also share certain conserved amino acid residues, some of which have been determined to be critical to receptor function and/or G protein signaling.
- GPCRs usually contain the following features: a conserved asparagine residue in the first transmembrane domain; a cysteine residue in the second loop which is believed to form a disulfide bond with a conserved cysteine residue in the fourth loop; a conserved leucine and aspartate residue in the second transmembrane domain; an aspartate-arginine-tyrosine motif (DRY motif) at the interface ofthe third transmembrane domain and the third loop of which the arginine residue is almost invariant (members ofthe rhodopsin subfamily of GPCRs comprise a histidine-arginine-methionine motif (HRM motif) as compared to a DRY motif); a conserved tryptophan and proline residue in the fourth transmembrane domain; and conserved phenylalanine and leucine residues in the seventh transmembrane domain.
- DRY motif aspartate-arginine-tyrosine motif
- Table I depicts an alignment ofthe transmembrane domain of 5 GPCRs. The conserved residues described herein are indicated by asterices. An alignment ofthe transmembrane domains of 44 representative GPCRs can be found at http://mgdkkl.nidll.nih.gov:8000/extended.html.
- thrombin (6. ) human P25116 rhodopsin (19.) human P08100 mlAC (21.) rat P08482 IL-8A (30.) human P25024 octopamine (40.) Drosophila melanogaster P22270
- thrombin (Accession No. P25116), rhodopsin (Accession No. P08100), mlACh (Accession No. P08482), IL-8A (Accession No. P25024), octopamine (Accession No. P22270), can be found as SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, respectively. Accordingly, GPCR-like proteins such as the SLGP proteins ofthe present invention contain a significant number of structural characteristics ofthe GPCR family.
- the SLGPs ofthe present invention contain conserved cysteines found in the first two loops (prior to the third and fifth transmembrane domains) of most GPCRs (cys490 and cys562 of SEQ ID NO:2).
- a highly conserved asparagine residue is present (asnl25 in SEQ ID NO:2).
- SLGP proteins contains a highly conserved leucine (leu 154 of SEQ ID NO:2). The two cysteine residues are believed to form a disulfide bond that stabilizes the functional protein structure.
- a highly conserved asparagine and arginine in the fourth transmembrane domain ofthe SLGP proteins is present (aspl 58 and arg218 of SEQ ID NO:2).
- proline residues in the fourth, fifth, sixth, and seventh transmembrane domains are thought to introduce kinks in the alpha-helices and may be important in the formation of the ligand binding pocket.
- a conserved tyrosine is present in the seventh transmembrane domain of SLGP-2 (tyr647 of SEQ ID NO :2) .
- the SLGP proteins ofthe present invention contain at least one, two, three, four, five, six, or preferably, seven transmembrane domains.
- transmembrane domain includes an amino acid sequence of about 15- 40 amino acid residues in length, more preferably, about 15-30 amino acid residues in length, and most preferably about 18-25 amino acid residues in length, which spans the plasma membrane. Transmembrane domains are rich in hydrophobic residues, and typically have an ⁇ -helical structure.
- At least 50%, 60%, 10%, 80%), 90%>, 95%) or more ofthe amino acids of a transmembrane domain are hydrophobic, e.g., leucines, isoleucines, tyrosines, or tryptophans.
- Transmembrane domains are described in, for example, Zaelles W.N. et al, (1996) Annual Rev.
- an SLGP protein ofthe present invention has more than one transmembrane domain, preferably 2, 3, 4, 5, 6, or 7 transmembrane domains.
- transmembrane domains can be found at about amino acids 433-452, 465-481, 500-524, 533-553, 570-594, 619-635, and 642-666 of SEQ ID NO:2.
- an SLGP protein ofthe present invention has 7 transmembrane domains.
- an SLGP is identified based on the presence of at least one Loop domain, also referred to herein as a 'loop'.
- the term "loop” includes an amino acid sequence having a length of at least about 4, preferably about 5- 10, preferably about 10-20, and more preferably about 20-30, 30-40, 40-50, 50-60, 60- 70, 70-80, 80-90, 90-100, or 100-150 amino acid residues, and has an amino acid sequence that connects two transmembrane domains within a protein or polypeptide.
- loop regions may be located either extracellularly or in the cytoplasm.
- the N-terminal amino acid of a loop is adjacent to a C-terminal amino acid of a transmembrane domain in a naturally-occurring SLGP or SLGP-like molecule
- the C-terminal amino acid of a loop is adjacent to an N-terminal amino acid of a transmembrane domain in a naturally-occurring SLGP or SLGP-like molecule.
- a "cytoplasmic loop” includes an amino acid sequence located within a cell or. within the cytoplasm of a cell.
- an extracellular loop includes an amino acid sequence located outside of a cell, or extracellularly.
- loop domains can be found at about amino acid residues 453-464, 482- 499,525-532, 554-569, 595-618, and 636-641 of SEQ ID NO:2.
- an SLGP is identified based on the presence of a "C-terminal domain", also referred to herein as a C-terminal tail, in the sequence ofthe protein.
- a "C-terminal domain” includes an amino acid sequence having a length of at least about 10, preferably about 10-25, more preferably about 25-50, more preferably about 50-75, even more preferably about 75-100, 100-150, 150-200, 200-250, 250-300, 300-400, 400-500, or 500-600 amino acid residues and is located within a cell or extracellularly. Accordingly, the N-terminal amino acid residue of a "C-terminal domain” is adjacent to a C-terminal amino acid residue of a transmembrane domain in a naturally-occurring SLGP or SLGP-like protein. For example, a C-terminal domain is found at about amino acid residues 667-690 of SEQ ID NO:2.
- an SLGP is identified based on the presence of an "N- terminal domain", also referred to herein as an N-terminal loop in the amino acid sequence ofthe protein.
- an "N-terminal domain” includes an amino acid sequence having about 1-500, preferably about 1-400, more preferably about 1-300, more preferably about 1-200, even more preferably about 1-100, and even more preferably about 1-50, " 1-25, or 1-10 amino acid residues in length and is located outside of a cell orintracellularly.
- the C-terminal amino acid residue of a "N-terminal domain” is adjacent to an N-te ⁇ ninal amino acid residue of a transmembrane domain in a naturally-occurring SLGP or SLGP-like protein.
- an N-terminal domain is found at about amino acid residues 1-432 of SEQ ID NO:2.
- an SLGP includes at least one, preferably 6 or 7, transmembrane domains and and/or at least one loop.
- the SLGP further includes an N-terminal domain and/or a C-terminal domain.
- the SLGP can include six transmembrane domains, three cytoplasmic loops, and two extracellular loops, or can include six transmembrane domains, three extracellular loops, and 2 cytoplasmic loops.
- the former embodiment can further include an N-terminal domain.
- the latter embodiment can further include a C-terminal domain.
- the SLGP can include seven transmembrane domains, three cytoplasmic loops, and three extracellular loops and can further include an N-terminal domain or a C-terminal domain.
- an SLGP is identified based on the presence of at least one "7 transmembrane receptor profile", also referred to as a "Secretin family sequence profile", in the protein or corresponding nucleic acid molecule.
- the term "7 transmembrane receptor profile” includes an amino acid sequence having at least about 50-350, preferably about 100-300, more preferably about 150-275 amino acid residues, or at least about 200-258 amino acids in length and having a bit score for the alignment ofthe sequence to the 7tm_l family Hidden Markov Model (HMM) of at least 20, preferably 20-30, more preferably 30-40, more preferably 40-50, or 50-75 or greater.
- HMM Hidden Markov Model
- the 7tm_l family HMM has been assigned the PFAM Accession PF00001 (http://pfam/wustl.edu/).
- the amino acid sequence ofthe protein is searched against a database of HMMs (e.g., the Pfam database, release 2.1) using the default parameters
- the hmmsf program which is available as part ofthe HMMER package of search programs, is a family specific default program for PF00001 and a score of 15 is the default threshold score for determining a hit.
- a search using the amino acid sequence of SEQ ID NO:2 was performed against the HMM database resulting in the identification of a 7 TM receptor profile in the amino acid sequence of SEQ ID NO:2. The results of the search are set forth below.
- an SLGP protein is a human SLGP protein having a 7 transmembrane receptor profile at about amino acids 421-678 of SEQ ID O:2.
- Such a 7 transmembrane receptor profile has the amino acid sequence:
- SLGP proteins having at least 20-30%, 30-49%, 40-50%, 50-60% homology, preferably about 60-70%>, more preferably about 70-80%, or about 80-90% homology with the 7 transmembrane receptor profile of human SLGP (e.g., SEQ ID NO:2) are within the scope ofthe invention.
- an SLGP is identified based on the presence of a "EGF-like domain" in the protein or corresponding nucleic acid molecule.
- the term "EGF-like domain” includes a protein domain having an amino acid sequence of about 55-90, preferably about 60-85, more preferably about 65-80 amino acid residues, or about 70-79 amino acids and having a bit score for the alignment ofthe sequence to the EGF-like domain (HMM) of at least 6, preferably 7-10, more preferably 10-30, more preferably 30-50, even more preferably 50-75, 75-100, 100-200 or greater.
- the EGF- like domain HMM has been assigned the PFAM Accession PF00008
- one or more cysteine residues in the EGF-like domain are conserved among SLGP family members or other proteins containing EGF- like domains (i.e., located in the same or similar position as the cysteine residues in other SLGP family members or other proteins containing EGF-like domains).
- an "EGF-like domain” has the consensus sequence C-X-C-X(5)- G-X(2)-C, the 3 C's are involved in disulfide bonds; corresponding to SEQ ID NOT 1.
- an "EGF-like domain” has the consensus sequence C- X-C-X(2)-[GP]-[FYW]-X(4,8)-C, the three C's are involved in disulfide bonds; corresponding to SEQ ID NO: 12.
- the amino acid sequence ofthe protein is searched against a database of HMMs (e.g., the Pfam database, release 2.1) using the default parameters
- the hmmsf program which is available as part ofthe HMMER package of search programs, is a family specific default program for PF00008 and a score of 15 is the default threshold score for determining a hit.
- the threshold score for detemiining a hit can be lowered (e.g., to 8 bits).
- a description ofthe Pfam database can be found in Sonhammer et al. (1997) Proteins 28(3)405-420 and a detailed description of HMMs can be found, for example, in Gribskov et ⁇ /.(1990) Meth.
- EGF-like domain has the following amino acid sequence:
- SLGP proteins having at least 50-60%> homology, preferably about 60- 70%), more preferably about 70-80%, or about 80-90%) homology with an EGF-like domain of human SLGP (e.g., SEQ ID NO.T3) are within the scope ofthe invention.
- an SLGP is identified based on the presence of a "NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain" in the protein or corresponding nucleic acid molecule.
- NADH- ubiquinone/plastoquinone oxidoreductase chain 4L domain includes a protein domain having an amino acid sequence of about 25-55, preferably about 30-50, more preferably about 35-45 amino acid residues, or about 40-43 amino acids and having a bit score for the alignment ofthe sequence to the NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain (HMM) of at least 6, preferably 7-10, more preferably 10-30, more preferably 30-50, even more preferably 50-75, 75-100, 100-200 or greater.
- HMM NADH- ubiquinone/plastoquinone oxidoreductase chain 4L domain
- the NADH- ubiquinone/plastoquinone oxidoreductase chain 4L domain HMM has been assigned the PFAM Accession PF00420 (http://pfam.wustl.edu/).
- the amino acid sequence ofthe protein is searched against a database of HMMs (e.g., the Pfam database, release 2.1) using the default parameters (http://www.sanger.ac.uk/Software/Pfam HMM_search).
- HMMs e.g., the Pfam database, release 2.1
- the default parameters http://www.sanger.ac.uk/Software/Pfam HMM_search.
- the hmmsf program which is available as part ofthe HMMER package of search programs, is a family specific default program for PF00420 and a score of 15 is the default threshold score for determining a hit.
- the threshold score for determining a hit can be lowered (e.g., to 8 bits).
- a description ofthe Pfam database can be found in Sonhammer et al (1997) Proteins 28(3)405-420 and a detailed description of HMMs can be found, for example, in Gribskov et ⁇ /.(1990) Meth. Enzymol 183:146-159; Gribskov et ⁇ Z. (1987) Proc. Natl. Acad. Sci. USA 84:4355-4358; Krogh et ⁇ /.(1994) J. Mol. Biol. 235:1501-1531; and Stultz et /.(1993) Protein Sci.
- NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain has the amino acid sequence:
- SLGP proteins having at least 50-60% homology, preferably about 60- 70%, more preferably about 70-80%, or about 80-90% homology with a NADH- ubiquinone/plastoquinone oxidoreductase chain 4L domain of human SLGP (e.g., SEQ ID NO:14) are within the scope of the invention.
- an SLGP protein includes at least an EGF-like domain. In another embodiment, an SLGP protein includes at least an NADH- ubiquinone/plastoquinone oxidoreductase chain 4L domain. In another embodiment, an SLGP protein includes at least a 7 transmembrane receptor profile. In another embodiment, an SLGP protein includes an EGF-like domain, and an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain. In another embodiment, an SLGP protein includes an EGF-like domain and a 7 transmembrane receptor profile.
- an SLGP protein in another embodiment, includes an EGF-like domain, and an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain, and a 7 transmembrane receptor profile. In another embodiment, an SLGP protein includes an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain and a 7 transmembrane receptor profile. In another embodiment, an SLGP protein is human SLGP which includes an EGF-like domain having about amino acids 22-100 of SEQ ID NO:2.
- an SLGP protein is human SLGP which includes an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain having about amino acids 475-517 of SEQ ID NO:2.
- an SLGP protein is human SLGP which includes a 7 transmembrane receptor profile having about amino acids 421-678 of SEQ ID NO:2.
- an SLGP protein is human SLGP which includes a an EGF-like domain having about amino acids 22- 100 of SEQ ID NO:2, an NADH- ubiquinone/plastoquinone oxidoreductase chain 4L domain having about amino acids 475- 517 of SEQ ID NO:2, and a 7 transmembrane receptor profile having about amino acids 421-678 of SEQ ID NO:2.
- Preferred SLGP molecules ofthe present invention have an amino acid sequence sufficiently homologous to the amino acid sequence of SEQ ID NO:2 or SEQ ID NO: 18.
- the term "sufficiently homologous” refers to a first amino acid or nucleotide sequence which contains a sufficient or minimum number of identical or equivalent (e.g., an amino acid residue which has a similar side chain) amino acid residues or nucleotides to a second amino acid or nucleotide sequence such that the first and second • amino acid or nucleotide sequences share common structural domains and/or a common functional activity.
- amino acid or nucleotide sequences which share common structural domains have at least about 50%> homology, preferably 60%) homology, more preferably 70%-80%, and even more preferably 90-95%> homology across the amino acid sequences ofthe domains and contain at least one and preferably two structural domains, are defined herein as sufficiently homologous.
- amino acid or nucleotide sequences which share at least 50%, preferably 60%, more preferably 70-80, or 90-95% homology and share a common functional activity are defined herein as sufficiently homologous.
- an "SLGP activity”, “biological activity of SLGP” o. "functional activity of SLGP”, refers to an activity exerted by an SLGP protein, polypeptide or nucleic acid molecule on an SLGP responsive cell as determined in vivo, or in vitro, according to standard techniques.
- an SLGP activity is a direct activity, such as an association with a SLGP-target molecule.
- a "target molecule” or “binding partner” is a molecule with which an SLGP protein binds or interacts in nature, sucl that SLGP-mediated function is achieved.
- An SLGP target molecule can be a non-SLGP molecule or an SLGP protein or polypeptide ofthe present invention.
- an SLGP target molecule is an SLGP ligand.
- an SLGP activity i an indirect activity, such as a cellular signaling activity mediated by interaction ofthe SLGP protein with an SLGP ligand.
- an SLGP activity is at least one or more ofthe following activities: (i) interaction of an SLGP protein with soluble SLGP ligand (e.g., CD55); (ii) interaction of an SLGP protein with a membrane-bound non-SLGP protein; (iii) interaction of an SLGP protein with an intracellular protein (e.g., an intracellular enzyme or signal transduction molecule); (iv) indirect interaction of an SLGP protein with an intracellular protein (e.g., a downstream signal transduction molecule); and (v) modulation of cellular proliferation, growth, differentiation, or migration.
- soluble SLGP ligand e.g., CD55
- interaction of an SLGP protein with a membrane-bound non-SLGP protein e.g., an intracellular enzyme or signal transduction molecule
- an intracellular protein e.g., an intracellular enzyme or signal transduction molecule
- indirect interaction of an SLGP protein with an intracellular protein e.g., a downstream signal transduction
- an SLGP activity is at least one or more ofthe following activities: (1) modulation of cellular signal transduction, either in vitro or in vivo; (2) regulation of activation in a cell expressing an SLGP protein exposure to alpha- latrotoxin); (3) regulation of inflammation; or (4) modulation of angiogenesis (e.g., proliferation, elongation, and migration of endothelial cells (e.g. tumor endothelial cells), to form new vessels).
- angiogenesis e.g., proliferation, elongation, and migration of endothelial cells (e.g. tumor endothelial cells), to form new vessels.
- SLGP proteins have at least one transmembrane domain and an SLGP activity.
- an SLGP protein has a 7 transmembrane receptor profile and an SLGP activity.
- an SLGP protein has an EGF-like domain and an SLGP activity.
- an SLGP protein has an NADH- ubiquinone/plastoquinone oxidoreductase chain 4L domain and an SLGP activity.
- an SLGP protein has a 7 transmembrane receptor profile, an EGF-like domain, and SLGP activity.
- an SLGP protein has a 7 transmembrane receptor profile, an EGF-like domain, and an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain and an SLGP activity.
- an SLGP protein has a 7 transmembrane receptor profile and an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain and an SLGP activity.
- an SLGP protein has an EGF-like domain and an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain and an SLGP activity.
- an SLGP protein has a 7 transmembrane receptor profile, an EGF-like domain, an SLGP activity, and an amino acid sequence sufficiently homologous to an amino acid sequence of SEQ ID NO:2 or SEQ ID NO: 18.
- the nucleotide sequence ofthe isolated human SLGP cDNA and the predicted amino acid sequence ofthe human SLGP polypeptide are shown in Figure 1 and in SEQ ID NOs.T and 2, respectively.
- the human SLGP cDNA which is approximately 2987 nucleotides in length, encodes a protein which is approximately 690 amino acid residues in length.
- the nucleotide sequence ofthe isolated mouse SLGP cDNA and the predicted amino acid sequence ofthe mouse SLGP polypeptide are shown in Figures 6A-B and 7 and in SEQ ID NOs:17 and 18, respectively.
- the mouse SLGP cDNA which is approximately 3952 nucleotides in length, encodes a protein which is approximately 689 amino acid residues in length.
- Plasmids containing the nucleotide sequence encoding human and mouse SLGP were deposited with the American Type Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA 20110-2209, on __ and assigned Accession Numbers and . This deposit will be maintained under the terms ofthe Budapest Treaty on the International Recognition ofthe Deposit of Microorganisms for the Purposes of Patent Procedure. These deposits were made merely as a convenience for those of skill in the art and is not an admission that a deposit is required under 35 U.S.C. ⁇ 112.
- nucleic acid molecules that encode SLGP proteins or biologically active portions thereof, as well as nucleic acid fragments sufficient for use as hybridization probes to identify SLGP-encoding nucleic acids (e.g., SLGP mRNA) and fragments for use as PCR primers for the amplification or mutation of SLGP nucleic acid molecules.
- nucleic acid molecule is intended to include DNA molecules (e.g., cDNA or genomic DNA) and RNA molecules (e.g., mRNA) and analogs ofthe DNA or RNA generated using nucleotide analogs.
- the nucleic acid molecule can be single-stranded or double- stranded, but preferably is double-stranded DNA.
- an “isolated” nucleic acid molecule is one which is separated from chromosomal DNA, e.g., other nucleic acid molecules which are present in the natural source ofthe nucleic acid.
- an “isolated” nucleic acid is free of sequences which naturally flank the nucleic acid (i.e., sequences located at the 5' and 3' ends ofthe nucleic acid) in the genomic DNA ofthe organism from which the nucleic acid is derived.
- the isolated SLGP nucleic acid molecule can contain less than about 5 kb, 4kb, 3kb, 2kb, 1 kb, 0.5 kb or 0.1 kb of nucleotide sequences which naturally flank the nucleic acid molecule in genomic DNA ofthe cell from which the nucleic acid is derived.
- an "isolated" nucleic acid molecule such as a cDNA molecule, can be substantially free of other cellular material, or culture medium when produced by recombinant techniques, or substantially free of chemical precursors or other chemicals when chemically synthesized.
- a nucleic acid molecule ofthe present invention e.g., a nucleic acid molecule having the nucleotide sequence of SEQ ID NOT or SEQ ID NO: 17, the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or a portion thereof, can be isolated using standard molecular biology techniques and the sequence information provided herein.
- nucleic acid sequence of SEQ ID NOT, SEQ ID NO: 17 the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with
- SLGP nucleic acid molecules can be isolated using standard hybridization and cloning techniques (e.g., as described in Sambrook, J., Fritsh, E. F., and Maniatis, T. Molecular Cloning: A Laboratory Manual. 2nd, ed, Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989).
- nucleic acid molecule encompassing all or a portion of SEQ ID NO : 1 , SEQ ID NO : 17, the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number , or the nucleotide sequence ofthe
- DNA insert ofthe plasmid deposited with ATCC as Accession Number can be isolated by the polymerase chain reaction (PCR) using synthetic oligonucleotide primers designed based upon the sequence of SEQ ID NOT, SEQ ID NOT 7, the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with
- a nucleic acid ofthe invention can be amplified using cDNA, mRNA or alternatively, genomic DNA, as a template and appropriate oligonucleotide primers according to standard PCR amplification techniques.
- the nucleic acid so amplified can be cloned into an appropriate vector and characterized by DNA sequence analysis.
- oligonucleotides corresponding to SLGP nucleotide sequences can be prepared by standard synthetic techniques, e.g., using an automated DNA synthesizer.
- an isolated nucleic acid molecule ofthe invention comprises the nucleotide sequence shown in SEQ ID NO: 1 or SEQ ID NO: 17. The sequence of SEQ ID NO corresponds to the human SLGP cDNA.
- This cDNA comprises sequences encoding the human SLGP protein (i.e., "the coding region”, from nucleotides 19-2090, as well as 5' untranslated sequences (nucleotides 1-19), and 3' untranslated sequences (nucleotides 2090-2987).
- the nucleic acid molecule can comprise only the coding region of SEQ ID NOT (e.g., nucleotides 19- 2090, corresponding to SEQ ID NO:3.
- the sequence of SEQ ID NO: 17 corresponds to the mouse SLGP cDNA.
- This cDNA comprises sequences encoding the mouse SLGP protein (i.e., "the coding region”, from nucleotides 70-2139, as well as 5' untranslated sequences (nucleotides 1-69), and 3' untranslated sequences (nucleotides 2140-3952).
- the nucleic acid molecule can comprise only the coding region of SEQ ID NO.T7 (e.g., nucleotides 70-2139, corresponding to SEQ ID NO.T9).
- an isolated nucleic acid molecule of the invention comprises a nucleic acid molecule which is a complement ofthe nucleotide sequence shown in SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as
- a nucleic acid molecule which is complementary to the nucleotide sequence shown in SEQ ID NOT, SEQ ID NO:3, SEQ ID NOT7, SEQ ID NOT9, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number is one which is sufficiently complementary to the nucleotide sequence shown in SEQ ID NO , SEQ ID NO:3, SEQ ID NOT7, SEQ ID NOT9, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , such that it can hybridize to the nucleotide sequence shown in SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , thereby forming a stable duplex.
- an isolated nucleic acid molecule ofthe present invention comprises a nucleotide sequence which is at least about 40%, 42%), 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or more homologous to the entire length ofthe nucleotide sequence shown in SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or the entire length ofthe nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or a portion of any of these nucleotide sequences.
- nucleic acid molecule of the invention can comprise only a portion ofthe nucleic acid sequence of SEQ ID NOT, SEQ ID NO:3, SEQ ID NO:17, SEQ ID NO: 19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with
- the nucleotide sequence determined from the cloning ofthe SLGP gene allows for the generation of probes and primers designed for use in identifying and/or cloning other SLGP family members, as well as SLGP homologues from other species.
- the probe/primer typically comprises substantially purified oligonucleotide.
- the oligonucleotide typically comprises a region of nucleotide sequence that hybridizes under stringent conditions to at least about 12 or 15, preferably about 20 or 25, more preferably about 30, 35, 40, 45, 50, 55, 60, 65, or 75 consecutive nucleotides of a sense sequence of SEQ ID NOT, SEQ ID NO:3, SEQ ID NOT7, SEQ ID NOT9, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as
- SEQ ID NO: 17 or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or of a naturally occurring allelic variant or mutant of SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or of a naturally occurring allelic variant or mutant of SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as
- a nucleic acid molecule ofthe present invention comprises a nucleotide sequence which is greater than 749, or more nucleotides in length and hybridizes under stringent hybridization conditions to a nucleic acid molecule of SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as
- Probes based on the SLGP nucleotide sequences can be used to detect transcripts or genomic sequences encoding the same or homologous proteins.
- the probe further comprises a label group attached thereto, e.g., the label group can be a radioisotope, a fluorescent compound, an enzyme, or an enzyme co- factor.
- Such probes can be used as a part of a diagnostic test kit for identifying cells or tissue which misexpress an SLGP protein, such as by measuring a level of an SLGP- encoding nucleic acid in a sample of cells from a subject e.g., detecting SLGP mRNA levels or determining whether a genomic SLGP gene has been mutated or deleted.
- a nucleic acid fragment encoding a "biologically active portion of an SLGP protein" can be prepared by isolating a portion ofthe nucleotide sequence of SEQ ID NOT, SEQ ID NO: 17, the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , which encodes a polypeptide having an SLGP biological activity (the biological activities of the SLGP proteins have previously been described), expressing the encoded portion of the SLGP protein (e.g., by recombinant expression in vitro) and assessing the activity of the encoded portion ofthe SLGP protein.
- the invention further encompasses nucleic acid molecules that differ from the nucleotide sequence shown in SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with
- an isolated nucleic acid molecule ofthe invention has a nucleotide sequence encoding a protein having an amino acid sequence shown in SEQ ID NO:2 or SEQ ID NO: 18.
- gene and “recombinant gene” refer to nucleic acid molecules isolated from chromosomal DNA, which include an open reading frame encoding an SLGP protein, preferably a mammalian SLGP protein.
- a gene includes coding DNA sequences, non- coding regulatory sequences, and introns.
- a gene refers to an isolated nucleic acid molecule, as defined herein.
- Allelic variants of human SLGP include both functional and non-functional SLGP proteins.
- Functional allelic variants are naturally occurring amino acid sequence variants ofthe human SLGP protein that maintain the ability to bind an SLGP ligand and/or modulate programmed cell death.
- Functional allelic variants will typically contain only conservative substitution of one or more amino acids of SEQ ID NO:2 or SEQ ID NO: 18 or substitution, deletion or insertion of non-critical residues in non- critical regions ofthe protein.
- Non-functional allelic variants are naturally occurring amino acid sequence variants ofthe human SLGP protein that do not have the ability to either bind an SLGP ligand and/or modulate programmed cell death.
- Non-functional allelic variants will typically contain a non-conservative substitution, a deletion, or insertion or premature truncation ofthe amino acid sequence of SEQ ID NO:2 or SEQ ID NO:18 or a substitution, insertion or deletion in critical residues or critical regions.
- the present invention further provides non-human orthologues ofthe human SLGP protein.
- Orthologues ofthe human SLGP protein are proteins that are isolated from non-human organisms and possess the same SLGP ligand binding and/or modulation of programmed cell death capabilities ofthe human SLGP protein.
- Orthologues ofthe human SLGP protein can readily be identified as comprising an amino acid sequence that is substantially homologous to SEQ ID NO:2.
- nucleic acid molecules encoding other GPCR family members e.g., other SLGP family members
- SLGP family members e.g., other SLGP family members
- nucleic acid molecules encoding other GPCR family members e.g., other SLGP family members
- SEQ ID NO:3 SEQ ID NO:17
- SEQ ID NO: 19 nucleotide sequence ofthe DNA insert ofthe plasmid deposited with
- another SLGP cDNA can be identified based on the nucleotide sequence of human SLGP.
- nucleic acid molecules encoding SLGP proteins from different species and which, thus, have a nucleotide sequence which differs from the SLGP sequences of SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as
- Nucleic acid molecules corresponding to natural allelic variants and homologues ofthe SLGP cDNAs ofthe invention can be isolated based on their homology to the SLGP nucleic acids disclosed herein using the cDNAs disclosed herein, or a portion thereof, as a hybridization probe according to standard hybridization techniques under stringent hybridization conditions.
- an isolated nucleic acid molecule ofthe invention is at least 15 nucleotides in length and hybridizes under stringent conditions to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NOT, SEQ ID NO:3, SEQ ID NOT7, SEQ ID NO: 19, the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number .
- the nucleic acid is at least 30, 50, 100, 150, 200, 250, 275, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, or 950 nucleotides in length.
- hybridizes under stringent conditions is intended to describe conditions for hybridization and washing under which nucleotide sequences at least 60%> homologous to each other typically remain hybridized to each other.
- the conditions are such that sequences at least about 70%>, more preferably at least about 80%, even more preferably at least about 85% or 90% homologous to each other typically remain hybridized to each other.
- stringent hybridization conditions are known to those skilled in the art and can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6.
- a preferred, non-limiting example of stringent hybridization conditions are hybridization in 6X sodium chloride/sodium citrate (SSC) at about 45°C, followed by one or more washes in 0.2 X SSC, 0.1% SDS at 50-65°C.
- an isolated nucleic acid molecule ofthe invention that hybridizes under stringent conditions to the sequence of SEQ ID NO: 1 , SEQ ID NO: 17, the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with
- ATCC as Accession Number corresponds to a naturally-occurring nucleic acid molecule.
- a "naturally-occurring" nucleic acid molecule refers to an RNA or DNA molecule having a nucleotide sequence that occurs in nature (e.g., encodes a natural protein).
- allelic variants of the SLGP sequences that may exist in the population, the skilled artisan will further appreciate that changes can be introduced by mutation into the nucleotide sequences of SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , thereby leading to changes in the amino acid sequence ofthe encoded SLGP proteins, without altering the functional ability ofthe SLGP proteins.
- nucleotide substitutions leading to amino acid substitutions at "non-essential" amino acid residues can be made in the sequence of SEQ ID NOT, SEQ ID NO:3, SEQ ID NOT7, SEQ ID NOT9, or the nucleotide sequence of • the DNA insert ofthe plasmid deposited with ATCC as Accession Number .
- a "non-essential" amino acid residue is a residue that can be altered from the wild-type sequence of SLGP (e.g., the sequence of SEQ ID NO:2 or SEQ ID NO: 18) without altering the biological activity, whereas an "essential" amino acid residue is required for biological activity.
- amino acid residues that are conserved among the SLGP proteins ofthe present invention are predicted to be particularly unamenable to alteration.
- additional amino acid residues that are conserved between the SLGP proteins ofthe present invention and other members ofthe GPCR families are not likely to be amenable to alteration.
- nucleic acid molecules encoding SLGP proteins that contain changes in amino acid residues that are not essential for activity. Such SLGP proteins differ in amino acid sequence from SEQ ID NO:2 or SEQ ID NO: 18, yet retain biological activity.
- the isolated nucleic acid molecule comprises a nucleotide sequence encoding a protein, wherein the protein comprises an amino acid sequence at least about 25%), 28%), 30%>, 35%>, 40%>, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or more homologous to SEQ ID NO:2 or SEQ ID NO:18.
- An isolated nucleic acid molecule encoding an SLGP protein homologous to the protein of SEQ ID NO:2 or SEQ ID NO: 18 can be created by introducing one or more nucleotide substitutions, additions or deletions into the nucleotide sequence of SEQ ID NOT, SEQ ID NO:3, SEQ ID NO:17, SEQ ID NOT9, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , such that one or more amino acid substitutions, additions or deletions are introduced into the encoded protein.
- Mutations can be introduced into SEQ ID NOT, SEQ ID NO:3, SEQ ID NOT7, SEQ ID NO.T9, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number by standard techniques, such as site- directed mutagenesis and PCR-mediated mutagenesis.
- conservative amino acid substitutions are made at one or more predicted non-essential amino acid residues.
- a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
- amino acids with basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid, glutamic acid
- uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine
- nonpolar side chains e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan
- beta- branched side chains e.g., threonine, valine, isoleucine
- aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
- a predicted nonessential amino acid residue in an SLGP protein is preferably replaced with another amino acid residue from the same side chain family.
- mutations can be introduced randomly along all or part of an SLGP coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for SLGP biological activity to identify mutants that retain activity.
- SEQ ID NO SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NOT 9, or the nucleotide sequence ofthe DNA insert of the plasmid deposited with ATCC as Accession Number
- the encoded protein can be expressed recombinantly and the activity ofthe protein can be determined.
- a mutant SLGP protein can be assayed for the ability to affect the (1) modulation of cellular signal transduction, either in vitro or in vivo; (2) regulation of activation in a cell expressing an SLGP protein; or (3) modulation of angiogenesis in endothelial cells (e.g., tumor endothelial cells).
- an antisense nucleic acid comprises a nucleotide sequence which is complementary to a "sense" nucleic acid encoding a protein, e.g., complementary to the coding strand of a double-stranded cDNA molecule or complementary to an mRNA sequence. Accordingly, an antisense nucleic acid can hydrogen bond to a sense nucleic acid.
- the antisense nucleic acid can be complementary to an entire SLGP coding strand, or to only a portion thereof.
- an antisense nucleic acid molecule is antisense to a "coding region" ofthe coding strand of a nucleotide sequence encoding SLGP.
- the term "coding region” refers to the region ofthe nucleotide sequence comprising codons which are translated into amino acid residues- (e.g., the coding region of human SLGP corresponds to SEQ ID NO:3 and the coding region of mouse SLGP corresponds to SEQ ID NOT9).
- the antisense nucleic acid molecule is antisense to a "noncoding region" of the coding strand of a nucleotide sequence encoding SLGP.
- noncoding region refers to 5' and 3' sequences which flank the coding region that are not translated into amino acids (i.e., also referred to as 5' and 3' untranslated regions).
- antisense nucleic acids ofthe invention can be designed according to the rules of Watson and Crick base pairing.
- the antisense nucleic acid molecule can be complementary to the entire coding region of SLGP mRNA, but more preferably is an oligonucleotide which is antisense to only a portion ofthe coding or noncoding region of SLGP mRNA.
- the antisense oligonucleotide can be complementary to the region surrounding the translation start site of SLGP mRNA.
- An antisense oligonucleotide can be, for example, about 5, 10, 15, 20, 25, 30, 35, 40, 45 or 50 nucleotides in length.
- An antisense nucleic acid ofthe invention can be constructed using chemical synthesis and enzymatic ligation reactions using procedures known in the art.
- an antisense nucleic acid e.g., an antisense oligonucleotide
- an antisense nucleic acid can be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides designed to increase the biological stability ofthe molecules or to increase the physical stability ofthe duplex formed between the antisense and sense nucleic acids, e.g., phosphorothioate derivatives and acridine substituted nucleotides can be used.
- modified nucleotides which can be used to generate the antisense nucleic acid include 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xantine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl) uracil, 5- carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1- methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2- methylguanine, 3-methylcytosine, 5-methyIcytosine, N6-adenine, 7-methylguanine, 5- methylaminomethyluracil, 5 -methoxyaminomethyl-2-thiouracil, beta-D- mannosylqueosine, 5
- the antisense nucleic acid can be produced biologically using an expression vector into which a nucleic acid has been subcloned in an antisense orientation (i.e., RNA transcribed from the inserted nucleic acid will be of an antisense orientation to a target nucleic acid of interest, described further in the following subsection).
- the antisense nucleic acid molecules ofthe invention are typically administered to a subject or generated in situ such that they hybridize with or bind to cellular mRNA and/or genomic DNA encoding an SLGP protein to thereby inhibit expression ofthe protein, e.g., by inhibiting transcription and/or translation.
- the hybridization can be by conventional nucleotide complementarity to form a stable duplex, or, for example, in the case of an antisense nucleic acid molecule which binds to DNA duplexes, through specific interactions in the major groove ofthe double helix.
- An example of a route of administration of antisense nucleic acid molecules ofthe invention include direct injection at a tissue site.
- antisense nucleic acid molecules can be modified to target selected cells and then administered systemically.
- antisense molecules can be modified such that they specifically bind to receptors or antigens expressed on a selected cell surface, e.g., by linking the antisense nucleic acid molecules to peptides or antibodies which bind to cell surface receptors or antigens.
- the antisense nucleic acid molecules can also be delivered to cells using the vectors described herein. To achieve sufficient intracellular concentrations ofthe antisense molecules, vector constructs in which the antisense nucleic acid molecule is placed under the control of a strong pol II or pol III promoter are preferred.
- the antisense nucleic acid molecule ofthe invention is an ⁇ -anomeric nucleic acid molecule.
- An ⁇ -anomeric nucleic acid molecule forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual ⁇ -units, the strands run parallel to each other (Gaultier et al. (1987) Nucleic Acids. Res. 15:6625-6641).
- the antisense nucleic acid molecule can also comprise a 2'-o- methylribonucleotide (Inoue et al. (1987) Nucleic Acids Res. 15:6131-6148) or a chimeric RNA-DNA analogue (Inoue et al (1987) FEBS Lett. 215:327-330).
- an antisense nucleic acid ofthe invention is a ribozyme.
- Ribozymes are catalytic RNA molecules with ribonuclease activity which are capable of cleaving a single-stranded nucleic acid, such as an mRNA, to which they have a complementary region.
- ribozymes e.g., hammerhead ribozymes (described in Haselhoff and Gerlach (1988) Nature 334:585-591)) can be used to catalytically cleave SLGP mRNA transcripts to thereby inhibit translation of SLGP mRNA.
- a ribozyme having specificity for an SLGP-encoding nucleic acid can be designed based upon the nucleotide sequence of an SLGP cDNA disclosed herein (i.e., SEQ ID NOT or SEQ ID NOT7).
- SEQ ID NOT a derivative of a Tetrahymena L-19 IVS RNA can be constructed in which the nucleotide sequence ofthe active site is complementary to the nucleotide sequence to be cleaved in an SLGP-encoding mRNA. See, e.g., Cech et al. U.S. Patent No. 4,987,071 ; and Cech et al. U.S. Patent No. 5,116,742.
- SLGP mRNA can be used to select a catalytic RNA having a specific ribonuclease activity from a pool of RNA molecules. See, e.g., Bartel, D. and Szostak, J.W. (1993) Science 261:1411-1418.
- SLGP gene expression can be inhibited by targeting nucleotide sequences complementary to the regulatory region ofthe SLGP (e.g., the SLGP promoter and/or enhancers) to form triple helical structures that prevent transcription of the SLGP gene in target cells.
- nucleotide sequences complementary to the regulatory region ofthe SLGP e.g., the SLGP promoter and/or enhancers
- SLGP promoter and/or enhancers nucleotide sequences complementary to the regulatory region ofthe SLGP
- the SLGP nucleic acid molecules ofthe present invention can be modified at the base moiety, sugar moiety or phosphate backbone to improve, e.g., the stability, hybridization, or solubility ofthe molecule.
- the deoxyribose phosphate backbone ofthe nucleic acid molecules can be modified to generate peptide nucleic acids (see Hyrup B. et al. (1996) Bioorganic & Medicinal Chemistry 4 (1): 5-23).
- peptide nucleic acids refer to nucleic acid mimics, e.g., DNA mimics, in which the deoxyribose phosphate backbone is replaced by a pseudopeptide backbone and only the four natural nucleobases are retained.
- the neutral backbone of PNAs has been shown to allow for specific hybridization to DNA and RNA under conditions of low ionic strength.
- the synthesis of PNA oligomers can be performed using standard solid phase peptide synthesis protocols as described in Hyrup B. et al (1996) supra; Perry-O'Keefe et al. PNAS 93: 14670-675.
- PNAs of SLGP nucleic acid molecules can be used in therapeutic and diagnostic applications.
- PNAs can be used as antisense or antigene agents for sequence-specific modulation of gene expression by, for example, inducing transcription or translation arrest or inhibiting replication.
- PNAs of SLGP nucleic acid molecules can also be used in the analysis of single base pair mutations in a gene, (e.g., by PNA- directed PCR clamping); as 'artificial restriction enzymes' when used in combination with other enzymes, (e.g., SI nucleases (Hyrup B. (1996) supra)); or as probes or primers for DNA sequencing or hybridization (Hyrup B. et al.
- PNAs of SLGP can be modified, (e.g., to enhance their stability or cellular uptake), by attaching lipophilic or other helper groups to PNA, by the formation of PNA-DNA chimeras, or by the use of liposomes or other techniques of drug delivery known in the art.
- PNA-DNA chimeras of SLGP nucleic acid molecules can be generated which may combine the advantageous properties of PNA and DNA.
- Such chimeras allow DNA recognition enzymes, (e.g., RNAse H and DNA polymerases), to interact with the DNA portion while the PNA portion would provide high binding affinity and specificity.
- PNA-DNA chimeras can be linked using linkers of appropriate lengths selected in terms of base stacking, number of bonds between the nucleobases, and orientation (Hyrup B. (1996) supra).
- the synthesis of PNA-DNA chimeras can be performed as described in Hyrup B. (1.996) supra and Finn P.J. et ⁇ l. (1996) Nucleic Acids Res. 24 (17): 3357-63.
- a DNA chain can be synthesized on a solid support using standard phosphoramidite coupling chemistry and modified nucleoside analogs, e.g., 5'-(4-methoxytrityl)amino-5'-deoxy-thymidine phosphoramidite, can be used as a between the PNA and the 5' end of DNA (Mag, M. et ⁇ l. (1989) Nucleic Acid Res. 17: 5973-88). PNA monomers are then coupled in a step wise manner to produce a chimeric molecule with a 5' PNA segment and a 3' DNA segment (Finn P.J. et ⁇ l. (1996) supra).
- modified nucleoside analogs e.g., 5'-(4-methoxytrityl)amino-5'-deoxy-thymidine phosphoramidite
- chimeric molecules can be synthesized with a 5' DNA segment and a 3' PNA segment (Peterser, K.H. et al. (1975) Bioorganic Med. Chem. Lett. 5: 1119-11124).
- the oligonucleotide may include other appended groups such as peptides (e.g., for targeting host cell receptors in vivo), or agents facilitating transport across the cell membrane (see, e.g., Letsinger et al. (1989) Proc. Natl. Acad. Sci. US. 86:6553-6556; Lemaitre et al (1981) Proc. Natl. Acad. Sci.
- oligonucleotides can be modified with hybridization-triggered cleavage agents (See, e.g., Krol et al. (1988) BioTechniques 6:958-976) or intercalating agents. (See, e.g., Zon (1988) Pharm. Res. 5:539-549).
- the oligonucleotide may be conjugated to another molecule, (e.g., a peptide, hybridization triggered cross-linking agent, transport agent, or hybridization-triggered cleavage agent).
- SLGP molecules ofthe present invention are in the screening for SLGP ligands (e.g., surrogate ligands) and/or SLGP modulators, it is intended that the following are also within the scope ofthe present invention: isolated nucleic acids which encode and SLGP ligands or SLGP modulators, probes and/or primers useful for identifying SLGP ligands or SLGP modulators based on the sequences of nucleic acids which encode and SLGP ligands or SLGP modulators, isolated nucleic acid molecules which are complementary or antisense to the sequences of nucleic acids which encode and SLGP ligands or SLGP modulators, isolated nucleic acid molecules which are at least about 60-65%>, preferably at least about 70-75%>, more preferable at least about 80-85%), and even more preferably at least about 90-95%> or more homologous to the sequences of nucleic acids which encode and SLGP ligands
- One aspect ofthe invention pertains to isolated SLGP proteins, and biologically active portions thereof, as well as polypeptide fragments suitable for use as immunogens to raise anti-SLGP antibodies.
- native SLGP proteins can be isolated from cells or tissue sources by an appropriate purification scheme using standard protein purification techniques.
- SLGP proteins are produced by recombinant DNA techniques.
- Alternative to recombinant expression, an SLGP protein or polypeptide can be synthesized chemically using standard peptide synthesis techniques.
- an “isolated” or “purified” protein or biologically active portion thereof is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the SLGP protein is derived, or substantially free from chemical precursors or other chemicals when chemically synthesized.
- the language “substantially free of cellular material” includes preparations of SLGP protein in which the protein is separated from cellular components ofthe cells from which it is isolated or recombinantly produced.
- the language "substantially free of cellular material” includes preparations of SLGP protein having less than about 30%) (by dry weight) of non-SLGP protein (also referred to herein as a "contaminating protein"), more preferably less than about 20%) of non-SLGP protein, still more preferably less than about 10%> of non-SLGP protein, and most preferably less than about 5%> non- SLGP protein.
- a contaminating protein also referred to herein as a "contaminating protein”
- the SLGP protein or biologically active portion thereof is recombinantly produced, it is also preferably substantially free of culture medium, i.e., culture medium represents less than about 20%>, more preferably less than about 10%>, and most preferably less than about 5%> ofthe volume ofthe protein preparation.
- the language “substantially free of chemical precursors or other chemicals” includes preparations of SLGP protein in which the protein is separated from chemical precursors or other chemicals which are involved in the synthesis ofthe protein.
- the language “substantially free of chemical precursors or other chemicals” includes preparations of SLGP protein having less than about 30% (by dry weight) of chemical precursors or non-SLGP chemicals, more preferably less than about 20%> chemical precursors or non-SLGP chemicals, still more preferably less than about 10% chemical precursors or non-SLGP chemicals, and most preferably less than about 5% chemical precursors or non-SLGP chemicals.
- Biologically active portions of an SLGP protein include peptides comprising amino acid sequences sufficiently homologous to or derived from the amino acid sequence ofthe SLGP protein, e.g., the amino acid sequence shown in SEQ ID NO:2 or SEQ ID NO: 18, which include less amino acids than the full length SLGP proteins, and exhibit at least one activity of an SLGP protein.
- biologically active portions comprise a domain or motif with at least one activity ofthe SLGP protein.
- a biologically active portion of an SLGP protein can be a polypeptide which is, for example, 10, 25, 50, 100 or more amino acids in length.
- a biologically active portion of an SLGP protein comprises at least a transmembrane domain. In another embodiment, a biologically active portion of an SLGP protein comprises at least one 7 transmembrane receptor profile. In another embodiment, a biologically active portion of an SLGP protein comprises at least an EGF-like domain. In another embodiment, a biologically active portion of an SLGP protein comprises at least an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L ⁇ domain. In another embodiment a biologically active portion of an SLGP protein comprises at least a 7 transmembrane receptor profile and an EGF-like domain.
- a biologically active portion of an SLGP protein comprises at least a 7 transmembrane receptor profile and an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain. In another embodiment a biologically active portion of an SLGP protein comprises at least a an EGF-like domain and an NADH- ubiquinone/plastoquinone oxidoreductase chain 4L domain. In another embodiment a biologically active portion of an SLGP protein comprises at least a 7 transmembrane receptor profile, an EGF-like domain and an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain.
- a preferred biologically active portion of an SLGP protein ofthe present invention may contain at least one ofthe above-identified structural domains and/or profiles.
- a more preferred biologically active portion of an SLGP protein may contain at least two ofthe above-identified structural domains and/or profiles.
- other biologically active portions, in which other regions ofthe protein are deleted can be prepared by recombinant techniques and evaluated for one or more of the functional activities of a native SLGP protein.
- the SLGP protein has an amino acid sequence shown in SEQ ID NO:2 or SEQ ID NO: 18.
- the SLGP protein is substantially homologous to SEQ ID NO:2 or SEQ ID NO: 18, and retains the functional activity ofthe protein of SEQ ID NO:2 or SEQ ID NO: 18, yet differs in amino acid sequence due to natural allelic variation or mutagenesis, as described in detail in subsection I above.
- the SLGP protein is a protein which comprises an amino acid sequence at least about 25%, 28%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or more homologous to SEQ ID NO:2 or SEQ ID NO: 18.
- the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
- the length of a reference sequence aligned for comparison purposes is at least 30%>, preferably at least 40%>, more preferably at least 50%>, even more preferably at least 60%>, and even more preferably at least 70%, 80%, or 90% ofthe length ofthe reference sequence (e.g., when aligning a second sequence to the SLGP amino acid sequence of SEQ ID NO:2 having 689 amino acid residues, at least 100, 200, preferably at least 300, more preferably at least 400, even more preferably at least 500, and even more preferably at least 600, 650 or 689 amino acid residues are aligned).
- the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
- amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid "homology”
- the percent identity between the two sequences is a function ofthe number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment ofthe two sequences.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
- the percent identity between two amino acid sequences is determined using the Needleman and Wunsch (J. Mol. Biol.
- the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
- the percent identity between two amino acid or nucleotide sequences is determined using the algorithm of E. Meyers and W. Miller (CABIOS, 4:11-17 (1989)) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- the nucleic acid and protein sequences ofthe present invention can further be used as a "query sequence" to perform a search against public databases to, for example, identify other family members or related sequences. Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J Mol. Biol. 215:403-10.
- Gapped BLAST can be utilized as described in Altschul et al, (1997) Nucleic Acids Res. 25(17):3389-3402.
- the default parameters ofthe respective programs e.g., XBLAST and NBLAST
- the default parameters ofthe respective programs e.g., XBLAST and NBLAST
- an SLGP "chimeric protein” or “fusion protein” comprises an SLGP polypeptide operatively linked to a non-SLGP polypeptide.
- a "SLGP polypeptide” refers to a polypeptide having an amino acid sequence corresponding to SLGP
- a non- SLGP polypeptide refers to a polypeptide having an amino acid sequence corresponding to a protein which is not substantially homologous to the SLGP protein, e.g., a protein which is different from the SLGP protein and which is derived from the same or a different organism.
- an SLGP fusion protein the SLGP polypeptide can correspond to all or a portion of an SLGP protein.
- an SLGP fusion protein comprises at least one biologically active portion of an SLGP protein.
- an SLGP fusion protein comprises at least two biologically active portions of an SLGP protein.
- the term "operatively linked" is intended to indicate that the SLGP polypeptide and the non- SLGP polypeptide are fused in-frame to each other.
- the non-SLGP polypeptide can be fused to the N-terminus or C-terminus ofthe SLGP polypeptide.
- the fusion protein is a GST-SLGP fusion protein in which the SLGP sequences are fused to the C-terminus ofthe GST sequences.
- Such fusion proteins can facilitate the purification of recombinant SLGP.
- the fusion protein is an SLGP protein containing a heterologous signal sequence at its N-terminus.
- a native SLGP signal sequence can be removed and replaced with a signal sequence from another protein.
- expression and/or secretion of SLGP can be increased through use of a heterologous signal sequence.
- the SLGP fusion proteins ofthe invention can be incorporated into pharmaceutical compositions and administered to a subject in vivo.
- the SLGP fusion proteins can be used to affect the bioavailability of an SLGP substrate. Use of SLGP fusion proteins may be useful therapeutically for the treatment of SLGP-related disorders (e.g., paroxysmal nocturnal hemoglobinuria). Moreover, the SLGP-fusion proteins ofthe invention can be used as immunogens to produce anti-SLGP antibodies in a subject, to purify SLGP ligands and in screening assays to identify molecules which inhibit the interaction of SLGP with an SLGP ligand.
- SLGP-fusion proteins ofthe invention can be used as immunogens to produce anti-SLGP antibodies in a subject, to purify SLGP ligands and in screening assays to identify molecules which inhibit the interaction of SLGP with an SLGP ligand.
- the SLGP-fusion proteins ofthe invention can be used as immunogens to produce anti-SLGP antibodies in a subject, to purify SLGP ligands and in screening assays to identify molecules which inhibit the interaction of SLGP with an SLGP substrate.
- an SLGP chimeric or fusion protein ofthe invention is produced by standard recombinant DNA techniques.
- DNA fragments coding for the different polypeptide sequences are ligated together in-frame in accordance with conventional techniques, for example by employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation.
- the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
- PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed and reamplified to generate a chimeric • gene sequence (see, for example, Current Protocols in Molecular Biology, eds. Ausubel et al John Wiley & Sons: 1992).
- anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed and reamplified to generate a chimeric • gene sequence
- many expression vectors are commercially available that already encode a fusion moiety (e.g., a GST polypeptide).
- An SLGP- encoding nucleic acid can be cloned into such an expression vector such that the fusion moiety is linked in-frame to the SLGP protein.
- the present invention also pertains to variants of the SLGP proteins which function as either SLGP agonists (mimetics) or as SLGP antagonists.
- Variants ofthe SLGP proteins can be generated by mutagenesis, e.g., discrete point mutation or truncation of an SLGP protein.
- An agonist ofthe SLGP proteins can retain substantially the same, or a subset, ofthe biological activities ofthe naturally occurring form of an SLGP protein.
- An antagonist of an SLGP protein can inhibit one or more ofthe activities ofthe naturally occurring form ofthe SLGP protein by, for example, competitively inhibiting the protease activity of an SLGP protein.
- specific biological effects can be elicited by treatment with a variant of limited function.
- treatment of a subject with a variant having a subset of the biological activities ofthe naturally occurring form ofthe protein has fewer side effects in a subject relative to treatment with the naturally occurring form ofthe SLGP protein.
- variants of an SLGP protein which function as either SLGP agonists (mimetics) or as SLGP antagonists can be identified by screening combinatorial libraries of mutants, e.g., truncation mutants, of an SLGP protein for SLGP protein agonist or antagonist activity.
- a variegated library of SLGP variants is generated by combinatorial mutagenesis at the nucleic acid level and is encoded by a variegated gene library.
- a variegated library of SLGP variants can be produced by, for example, enzymatically ligating a mixture of synthetic oligonucleotides into gene sequences such that a degenerate set of potential SLGP sequences is expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display) containing the set of SLGP sequences therein.
- a degenerate set of potential SLGP sequences is expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display) containing the set of SLGP sequences therein.
- methods which can be used to produce libraries of potential SLGP variants from a degenerate oligonucleotide sequence. Chemical synthesis of a degenerate gene sequence can be performed in an automatic DNA synthesizer, and the synthetic gene then ligated into an appropriate expression vector.
- degenerate set of genes allows for the provision, in one mixture, of all ofthe sequences encoding the desired set of potential SLGP sequences.
- Methods for synthesizing degenerate oligonucleotides are known in the art (see, e.g., Narang, S.A. (1983) Tetrahedron 39:3; Itakura et al. (1984) Annu. Rev. Biochem. 53:323; Itakura et al. (1984) Science 198:1056; Ike et al (1983) Nucleic Acid Res. 11:477.
- libraries of fragments of an SLGP protein coding sequence can be used to generate a variegated population of SLGP fragments for screening and subsequent selection of variants of an SLGP protein.
- a library of coding sequence fragments can be generated by treating a double stranded PCR fragment of an SLGP coding sequence with a nuclease under conditions wherein nicking occurs only about once per molecule, denaturing the double stranded DNA, renaturing the DNA to form double stranded DNA which can include sense/antisense pairs from different nicked products, removing single stranded portions from reformed duplexes by treatment with SI nuclease, and ligating the resulting fragment library into an expression vector.
- an expression library can be derived which encodes N-terminal, C-terminal and internal fragments of various sizes ofthe SLGP protein.
- REM Recursive ensemble mutagenesis
- cell based assays can be exploited to analyze a variegated SLGP library.
- a library of expression vectors can be transfected into a cell line which ordinarily synthesizes SLGP.
- the transfected cells are then cultured such that a particular mutant SLGP is expressed and the effect of expression ofthe mutant on SLGP activity in the cell can be detected, e.g., by any of a number of activity assays for native SLGP protein.
- Plasmid DNA can then be recovered from the cells which score for modulated SLGP activity, and the individual clones further characterized.
- An isolated SLGP protein, or a portion or fragment thereof, can be used as an immunogen to generate antibodies that bind SLGP using standard techniques for polyclonal and monoclonal antibody preparation.
- a full-length SLGP protein can be used or, alternatively, the invention provides antigenic peptide fragments of SLGP for use as immunogens.
- the antigenic peptide of SLGP comprises at least 8 amino acid residues ofthe amino acid sequence shown in SEQ ID NO: 2 or SEQ ID NO: 18 and encompasses an epitope of SLGP such that an antibody raised against the peptide forms a specific immune complex with SLGP.
- the antigenic peptide comprises at least 10 amino acid residues, more preferably at least 15 amino acid residues, even more preferably at least 20 amino acid residues, and most preferably at least 30 amino acid residues.
- Preferred epitopes encompassed by the antigenic peptide are regions of SLGP that are located on the surface ofthe protein, e.g., hydrophilic regions, as well as regions with high antigenicity.
- An SLGP immunogen typically is used to prepare antibodies by immunizing a suitable subject, (e.g., rabbit, goat, mouse or other mammal) with the immunogen.
- An appropriate immunogenic preparation can contain, for example, recombinantly expressed SLGP protein or a chemically synthesized SLGP polypeptide.
- the preparation can further include an adjuvant, such as Freund's complete or incomplete adjuvant, or similar immunostimulatory agent. Immunization of a suitable subject with an immunogenic SLGP preparation induces a polyclonal anti-SLGP antibody response. Accordingly, another aspect ofthe invention pertains to anti-SLGP antibodies.
- antibody refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site which specifically binds (immunoreacts with) an antigen, such as SLGP.
- immunologically active portions of immunoglobulin molecules include F(ab) and F(ab')2 fragments which can be generated by treating the antibody with an enzyme such as pepsin.
- the invention provides polyclonal and monoclonal antibodies that bind SLGP.
- monoclonal antibody or “monoclonal antibody composition”, as used herein, refers to a population of antibody molecules that contain only one species of an antigen binding site capable of immunoreacting with a particular epitope of SLGP.
- a monoclonal antibody composition thus typically displays a single binding affinity for a particular SLGP protein with which it immunoreacts.
- Polyclonal anti-SLGP antibodies can be prepared as described above by immunizing a suitable subject with an SLGP immunogen.
- the anti-SLGP antibody titer in the immunized subject can be monitored over time by standard techniques, such as with an enzyme linked immunosorbent assay (ELISA) using immobilized SLGP.
- ELISA enzyme linked immunosorbent assay
- the antibody molecules directed against SLGP can be isolated from the mammal (e.g., from the blood) and further purified by well known techniques, such as protein A chromatography to obtain the IgG fraction.
- antibody-producing cells can be obtained from the subject and used to prepare monoclonal antibodies by standard techniques, such as the hybridoma technique originally described by Kohler and Milstein (1975) Nature 256:495-497) (see also, Brown et al. (1981) J Immunol. 127:539-46; Brown et al. (1980) J. Biol Chem .255:4980-83; Yeh et al (1976) PNAS 76:2927-31; and Yeh et al. (1982) Int. J.
- an immortal cell line typically a myeloma
- lymphocytes typically splenocytes
- the immortal cell line e.g., a myeloma cell line
- the immortal cell line is derived from the same mammalian species as the lymphocytes.
- murine hybridomas can be made by fusing lymphocytes from a mouse immunized with an immunogenic preparation of the present invention with an immortalized mouse cell line.
- Preferred immortal cell lines are mouse myeloma cell lines that are sensitive to culture medium containing hypoxanthine, aminopterin and thymidine ("HAT medium").
- HAT medium culture medium containing hypoxanthine, aminopterin and thymidine
- Any of a number of myeloma cell lines can be used as a fusion partner according to standard techniques, e.g., the P3-NSl/l-Ag4-l, P3-x63-Ag8.653 or Sp2/O-Agl4 myeloma lines. These myeloma lines are available from ATCC.
- HAT-sensitive mouse myeloma cells are fused to mouse splenocytes using polyethylene glycol ("PEG").
- PEG polyethylene glycol
- Hybridoma cells resulting from the fusion are then selected using HAT medium, which kills unfused and unproductively fused myeloma cells (unfused splenocytes die after several days because they are not transformed).
- Hybridoma cells producing a monoclonal antibody ofthe invention are detected by screening the hybridoma culture supernatants for antibodies that bind STGP, e.g., using a standard ELISA assay.
- a monoclonal anti-SLGP antibody can be identified and isolated by screening a recombinant combinatorial immunoglobulin library (e.g., an antibody phage display library) with SLGP to thereby isolate immunoglobulin library members that bind SLGP.
- Kits for generating and screening phage display libraries are commercially available (e.g., the Pharmacia Recombinant Phage Antibody System, Catalog No. 27-9400-01; and the Stratagene SurfZAPTM Phage Display Kit, Catalog No. 240612). Additionally, examples of methods and reagents particularly amenable for use in generating and screening antibody display library can be found in, for example, Ladner et al U.S.
- recombinant anti-SLGP antibodies such as chimeric and humanized monoclonal antibodies, comprising both human and non-human portions, which can be made using standard recombinant DNA techniques, are within the scope of the invention.
- Such chimeric and humanized monoclonal antibodies can be produced by recombinant DNA techniques known in the art, for example using methods described in Robinson et al. International Application No. PCT/US86/02269; Akira, et al. European Patent Application 184,187; Taniguchi, M., European Patent Application 171,496; Morrison et al. European Patent Application 173,494; Neuberger et al PCT International Publication No. WO 86/01533; Cabilly et al. U.S. Patent No. 4,816,567; Cabilly et al. European Patent Application 125,023; Better et al. (1988) Science
- Patent 5,225,539 Jones et al. (1986) Nature 321 :552-525; Verhoeyan et al. (1988) Science 239:1534; and Beidler et al. (1988) J. Immunol 141:4053-4060.
- An anti-SLGP antibody (e.g., monoclonal antibody) can be used to isolate SLGP by standard techniques, such as affinity chromatography or immunoprecipitation.
- An anti-SLGP antibody can facilitate the purification of natural SLGP from cells and of recombinantly produced SLGP expressed in host cells.
- an anti-SLGP antibody can be used to detect SLGP protein (e.g., in a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression ofthe SLGP protein.
- Anti-SLGP antibodies can be used diagnostically to monitor protein levels in tissue as part of a clinical testing procedure, e.g., to, for example, determine the efficacy of a given treatment regimen.
- Detection can be facilitated by coupling (i.e., physically linking) the antibody to a detectable substance.
- detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials.
- suitable enzymes include horseradish peroxidase, alkaline phosphatase, -galactosidase, or acetylcholinesterase;
- suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin;
- suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin;
- an example of a luminescent material includes luminol;
- bioluminescent materials include luciferase, luciferin, and aequorin, and examples of suitable radioactive material include 125 I,
- SLGP molecules ofthe present invention are in the screening for SLGP ligands (e.g., surrogate ligands) and/or SLGP modulators, it is intended that the following are also within the scope ofthe present invention: "isolated” or “purified” SLGP ligands or SLGP modulators, biologically-active portions of SLGP ligands or SLGP modulators, chimeric or fusion proteins comprising all or a portion of an SLGP ligand or SLGP modulator, and antibodies comprising all or a portion of an SLGP ligand or SLGP modulator.
- vectors preferably expression vectors, containing a nucleic acid encoding an SLGP protein (or a portion thereof).
- vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- plasmid refers to a circular double stranded DNA loop into which additional DNA segments can be ligated.
- viral vector Another type of vector is a viral vector, wherein additional DNA segments can be ligated into the viral genome.
- Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- vectors e.g., non-episomal mammalian vectors
- Other vectors are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- certain vectors are capable of directing the expression of genes to which they are operatively linked.
- Such vectors are referred to herein as "expression vectors".
- expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
- plasmid and vector can be used interchangeably as the plasmid is the most commonly used form of vector.
- the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno- associated viruses), which serve equivalent functions.
- the recombinant expression vectors ofthe invention comprise a nucleic acid of the invention in a form suitable for expression ofthe nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory sequences, selected on the basis ofthe host cells to be used for expression, which is operatively linked to the nucleic acid sequence to be expressed.
- "operably linked" is intended to mean that the nucleotide sequence of interest is linked to the regulatory sequence(s) in a manner which allows for expression ofthe nucleotide sequence (e.g., in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell).
- regulatory sequence is intended to includes promoters, enhancers and other expression control elements (e.g., polyadenylation signals). Such regulatory sequences are described, for example, in Goeddel; Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1990). Regulatory sequences include those which direct constitutive expression of a nucleotide sequence in many types of host cell and those which direct expression ofthe nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). It will be appreciated by those skilled in the art that the design ofthe expression vector can depend on such factors as the choice ofthe host cell to be transformed, the level of expression of protein desired, etc.
- the expression vectors ofthe invention can be introduced into host cells to thereby produce proteins or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., SLGP proteins, mutant forms of SLGP proteins, fusion proteins, etc.).
- the recombinant expression vectors ofthe invention can be designed for expression of SLGP proteins in prokaryotic or eukaryotic cells.
- SLGP proteins can be expressed in bacterial cells such as E. coli, insect cells (using baculovirus expression vectors) yeast cells or mammalian cells. Suitable host cells are discussed further in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1990).
- the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.
- Fusion vectors add a number of amino acids to a protein encoded therein, usually to the amino terminus ofthe recombinant protein.
- Such fusion vectors typically serve three purposes: 1) to increase expression of recombinant protein; 2) to increase the solubility ofthe recombinant protein; and 3) to aid in the purification ofthe recombinant protein by acting as a ligand in affinity purification.
- a proteolytic cleavage site is introduced at the junction ofthe fusion moiety and the recombinant protein to enable separation ofthe recombinant protein from the fusion moiety subsequent to purification ofthe fusion protein.
- enzymes, and their cognate recognition sequences include Factor Xa, thrombin and enterokinase.
- Typical fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith, D.B. and Johnson, K.S.
- SLGP activity assays e.g., direct assays or competitive assays described in detail below
- an SLGP fusion protein expressed in a retro viral expression vector ofthe present invention can be utilized to infect bone marrow cells which are subsequently transplanted into irradiated recipients. The pathology ofthe subject recipient is then examined after sufficient time has passed (e.g., six (6) weeks).
- Suitable inducible non-fusion E. coli expression vectors include pTrc (Amann et al, (1988) Gene 69:301-315) and pET l id (Studier et al, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, California (1990) 60-89).
- Target gene expression from the pTrc vector relies on host RNA polymerase transcription from a hybrid trp-lac fusion promoter.
- Target gene expression from the pET l id vector relies on transcription from a T7 gnlO-lac fusion promoter mediated by a coexpressed viral RNA polymerase (T7 gnl). This viral polymerase is supplied by host strains BL21(DE3) or HMS174(DE3) from a resident prophage harboring a T7 gnl gene under the transcriptional control ofthe lacUV 5 promoter.
- the SLGP expression vector is a yeast expression vector.
- yeast expression vectors for expression in yeast S. cerivisae include pYepSecl (Baldari, et al. , (1987) Embo J. 6:229-234), pMFa (Kurjan and Herskowitz, (1982) Cell 30:933- 943), pJRY88 (Schultz et al, (1987) Gene 54:113-123), pYES2 (Invitrogen Corporation, San Diego, CA), and picZ (InVitrogen Corp, San Diego, CA).
- SLGP proteins can be expressed in insect cells using baculovirus expression vectors.
- Baculovirus vectors available for expression of proteins in cultured insect cells include the pAc series (Smith et al (1983) Mol Cell Biol. 3:2156-2165) and the pVL series (Lucklow and Summers (1989) Virology 170:31-39).
- a nucleic acid ofthe invention is expressed in mammalian cells using a mammalian expression vector.
- mammalian expression vectors include pCDM8 (Seed, B. (1987) Nature 329:840) and pMT2PC (Kaufman et al (1987) EMBO J. 6: 187- 195).
- the expression vector's control functions are often provided by viral regulatory elements.
- commonly used promoters are derived from polyoma, Adenovirus 2, cytomegalovirus and Simian Virus 40.
- suitable expression systems for both prokaryotic and eukaryotic cells see chapters 16 and 17 of Sambrook, J., Fritsh, E. F., and Maniatis, T. Molecular Cloning: A Laboratory Manual. 2nd, ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989.
- the recombinant mammalian expression vector is capable of directing expression ofthe nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid).
- tissue-specific regulatory elements are known in the art.
- suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert et al. (1987) Genes Dev. 1 :268-277), lymphoid-specific promoters (Calame and Eaton (1988) Adv. Immunol. 43:235-275), in particular promoters of T cell receptors (Winoto and Baltimore (1989) EMBO J.
- promoters are also encompassed, for example the murine hox promoters (Kessel and Grass (1990) Science 249:374-379) and the ⁇ -fetoprotein promoter (Campes and Tilghman (1989) Genes Dev. 3:537-546).
- the invention further provides a recombinant expression vector comprising a DNA molecule of the invention cloned into the expression vector in an antisense orientation. That is, the DNA molecule is operatively linked to a regulatory sequence in a manner which allows for expression (by transcription ofthe DNA molecule) of an RNA molecule which is antisense to SLGP mRNA. Regulatory sequences operatively linked to a nucleic acid cloned in the antisense orientation can be chosen which direct the continuous expression ofthe antisense RNA molecule in a variety of cell types, for instance viral promoters and/or enhancers, or regulatory sequences can be chosen which direct constitutive, tissue specific or cell type specific expression of antisense RNA.
- the antisense expression vector can be in the form of a recombinant plasmid, phagemid or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced.
- a high efficiency regulatory region the activity of which can be determined by the cell type into which the vector is introduced.
- Another aspect ofthe invention pertains to host cells into which an SLGP nucleic acid molecule ofthe invention is introduced, e.g., an SLGP nucleic acid molecule within a recombinant expression vector or an SLGP nucleic acid molecule containing sequences which allow it to homologously recombine into a specific site ofthe host cell's genome.
- the terms "host cell” and “recombinant host cell” are used interchangeably herein. It is understood that such terms refer not only to the particular subject cell but to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope ofthe term as used herein.
- a host cell can be any prokaryotic or eukaryotic cell.
- an SLGP protein can be expressed in bacterial cells such as E. coli, insect cells, yeast or mammalian cells (such as Chinese hamster ovary cells (CHO) or COS cells).
- bacterial cells such as E. coli, insect cells, yeast or mammalian cells (such as Chinese hamster ovary cells (CHO) or COS cells).
- mammalian cells such as Chinese hamster ovary cells (CHO) or COS cells.
- Other suitable host cells are known to those skilled in the art.
- Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques.
- transformation and “transfection” are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g., DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, D ⁇ A ⁇ -dextran-mediated transfection, lipofection, or electroporation. Suitable methods for transforming or transfecting host cells can be found in Sambrook, et al. (Molecular Cloning: A Laboratory Manual. 2nd, ed, Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989), and other laboratory manuals.
- a gene that encodes a selectable marker (e.g., resistance to antibiotics) is generally introduced into the host cells along with the gene of interest.
- selectable markers include those which confer resistance to drugs, such as G418, hygromycin and methotrexate.
- Nucleic acid encoding a selectable marker can be introduced into a host cell on the same vector as that encoding an SLGP protein or can be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die).
- a host cell ofthe invention such as a prokaryotic or eukaryotic host cell in culture, can be used to produce (i.e., express) an SLGP protein.
- the invention further provides methods for producing an SLGP protein using the host cells ofthe invention.
- the method comprises culturing the host cell of invention (into which a recombinant expression vector encoding an SLGP protein has been introduced) in a suitable medium such that an SLGP protein is produced.
- the method further comprises isolating an SLGP protein from the medium or the host cell.
- the host cells ofthe invention can also be used to produce nonhuman transgenic animals.
- a host cell ofthe invention is a fertilized oocyte or an embryonic stem cell into which SLGP-coding sequences have been introduced.
- Such host cells can then be used to create non-human transgenic animals in which exogenous SLGP sequences have been introduced into their genome or homologous recombinant animals in which endogenous SLGP sequences have been altered.
- Such animals are useful for studying the function and/or activity of an SLGP - and for identifying and/or evaluating modulators of SLGP activity.
- a "transgenic animal” is a non-human animal, preferably a mammal, more preferably a rodent such as a rat or mouse, in which one or more ofthe cells ofthe animal includes a transgene.
- Other examples of transgenic animals include non-human primates, sheep, dogs, cows, goats, chickens, amphibians, etc.
- a transgene is exogenous DNA which is integrated into the genome of a cell from which a transgenic animal develops and which remains in the genome ofthe mature animal, thereby directing the expression of an encoded gene product in one or more cell types or tissues of the.transgenic animal.
- a "homologous recombinant animal” is a non-human animal, preferably a mammal, more preferably a mouse, in which an endogenous SLGP gene has been altered by homologous recombination between the endogenous gene and an exogenous DNA molecule introduced into a cell ofthe animal, e.g., an embryonic cell of the animal, prior to development ofthe animal.
- a transgenic animal ofthe invention can be created by introducing an SLGP- encoding nucleic acid into the male pronuclei of a fertilized oocyte, e.g., by microinjection, retroviral infection, and allowing the oocyte to develop in a pseudopregnant female foster animal.
- the SLGP cDNA sequence of SEQ ID NOT can be introduced as a transgene into the genome of a non-human animal.
- a nonhuman homologue of a human SLGP gene such as a mouse or rat SLGP gene, can be used as a transgene.
- an SLGP gene homologue such as another GPCR family member, can be isolated based on hybridization to the SLGP cDNA sequences of SEQ ID NOT, SEQ ID NO:3, SEQ ID NOT7, SEQ ID NOT9, or the DNA insert ofthe plasmid deposited with ATCC as Accession Number (described further in subsection I above) and used as a transgene.
- Intronic sequences and polyadenylation signals can also be included in the transgene to increase the efficiency of expression of the transgene.
- a tissue-specific regulatory sequence(s) can be operably linked to an SLGP transgene to direct expression of an SLGP protein to particular cells.
- transgenic founder animal can be identified based upon the presence of an SLGP transgene in its genome and/or expression of SLGP mRNA in tissues or cells ofthe animals. A transgenic founder animal can then be used to breed additional animals carrying the transgene. Moreover, transgenic animals carrying a transgene encoding an SLGP protein can further be bred to other transgenic animals carrying other transgenes.
- a vector which contains at least a portion of an SLGP gene into which a deletion, addition or substitution has been introduced to thereby alter, e.g., functionally disrupt, the SLGP gene.
- the SLGP gene can be a human gene (e.g., the cDNA of SEQ ID NO:3), but more preferably, is a non-human homologue of a human SLGP gene (e.g., the cDNA of SEQ ID NOT9).
- the mouse SLGP gene can be used to construct a homologous recombination nucleic acid molecule, e.g., a vector, suitable for altering an endogenous SLGP gene in the mouse genome.
- the homologous recombination nucleic acid molecule is designed such that, upon homologous recombination, the endogenous SLGP gene is functionally disrupted (i.e., no longer encodes a functional protein; also referred to as a "knock out" vector).
- the homologous recombination nucleic acid molecule can be designed such that, upon homologous recombination, the endogenous SLGP gene is mutated or otherwise altered but still encodes functional protein (e.g., the upstream regulatory region can be altered to thereby alter the expression ofthe, endogenous SLGP protein).
- the altered portion ofthe SLGP gene is flanked at its 5' and 3' ends by additional nucleic acid sequence ofthe SLGP gene to allow for homologous recombination to occur between the exogenous SLGP gene carried by the homologous recombination nucleic acid molecule and an endogenous SLGP gene in a cell, e.g., an embryonic stem cell.
- the additional flanking STGP nucleic acid sequence is of sufficient length for successful homologous recombination with the endogenous gene.
- homologous recombination nucleic acid molecule typically, several kilobases of flanking DNA (both at the 5' and 3' ends) are included in the homologous recombination nucleic acid molecule (see, e.g., Thomas, K.R. and Capecchi, M. R. (1987) Cell 51 :503 for a description of homologous recombination vectors).
- the homologous recombination nucleic acid molecule is introduced into a cell, e.g., an embryonic stem cell line (e.g., by electroporation) and cells in which the introduced SLGP gene has homologously recombined with the endogenous SLGP gene are selected (see e.g., Li, E. et al.
- the selected cells can then injected into a blastocyst of an animal (e.g., a mouse) to form aggregation chimeras (see e.g., Bradley, A. in Teratocarcinomas and Embryonic Stem Cells: A Practical
- a chimeric embryo can then be implanted into a suitable pseudopregnant female foster animal and the embryo brought to term.
- Progeny harboring the homologously recombined DNA in their germ cells can be used to breed animals in which all cells ofthe animal contain the homologously recombined DNA by germline transmission ofthe transgene.
- Methods for constructing homologous recombination nucleic acid molecules, e.g., vectors, or homologous recombinant animals are described further in Bradley, A.
- transgenic non-humans animals can be produced which contain selected systems which allow for regulated expression ofthe transgene.
- One example of such a system is the cre/loxP recombinase system of bacteriophage PI .
- cre/loxP recombinase system For a description ofthe cre/loxP recombinase system, see, e.g., Lakso et al. (1992) PNAS 89:6232-6236. Another example of a recombinase system is the FLP recombinase system of Saccharomyces cerevisiae (O'Gorman et al. (1991) Science 251:1351-1355. If a cre/loxP recombinase system is used to regulate expression ofthe transgene, animals containing transgenes encoding both the Cre recombinase and a selected protein are required.
- Such animals can be provided through the construction of "double" transgenic animals, e.g., by mating two transgenic animals, one containing a transgene encoding a selected protein and the other containing a transgene encoding a recombinase.
- Clones ofthe non-human transgenic animals described herein can also be produced according to the methods described in Wilmut, I. et al. (1997) Nature 385:810- 813.
- a cell e.g., a somatic cell
- the quiescent cell can then be fused, e.g., through the use of electrical pulses, to an enucleated oocyte from an animal of the same species from which the quiescent cell is isolated.
- the reconstructed oocyte is then cultured such that it develops to morula or blastocyte and then transferred to pseudopregnant female foster animal.
- the offspring borne of this female foster animal will be a clone ofthe animal from which the cell, e.g., the somatic cell, is isolated.
- a cell e.g., an embryonic stem cell, from the inner cell mass of a developing embryo can be transformed with a preferred transgene.
- a cell, e.g., a somatic cell, from cell culture line can be transformed with a preferred transgene and induced to exit the growth cycle and enter G 0 phase.
- the cell can then be fused, e.g., through the use of electrical pulses, to an enucleated mammalian oocyte.
- the reconstructed oocyte is then cultured such that it develops to morula or blastocyst and then transferred to pseudopregnant female foster animal.
- the offspring borne of this female foster animal will be a clone ofthe animal from which the nuclear donor cell, e.g., the somatic cell, is isolated.
- compositions suitable for administration can be incorporated into pharmaceutical compositions suitable for administration.
- Such compositions typically comprise the nucleic acid molecule, protein, antibody, or modulatory compound and a pharmaceutically acceptable carrier.
- pharmaceutically acceptable carrier is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art.
- a pharmaceutical composition ofthe invention is formulated to be compatible with its intended route of administration.
- routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (topical), transmucosal, and rectal administration.
- Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
- a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents
- antibacterial agents such as benzyl alcohol or methyl parabens
- antioxidants
- compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
- suitable carriers include physiological saline, bacteriostatic water, Cremophor ELTM (BASF, Parsippany, NJ) or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringability exists.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol, and the like), and suitable mixtures thereof.
- the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance ofthe required particle size in the case of dispersion and by the use of surfactants.
- Prevention ofthe action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars, polyalcohols such as manitol, sorbitol, sodium chloride in the composition.
- Prolonged absorption ofthe injectable compositions can be brought about by including in the composition an agent which delays abso ⁇ tion, for example, aluminum monostearate and gelatin.
- Sterile injectable solutions can be prepared by inco ⁇ orating the active compound (e.g., an SLGP protein or anti-SLGP antibody) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
- the active compound e.g., an SLGP protein or anti-SLGP antibody
- dispersions are prepared by inco ⁇ orating the active compound into a sterile vehicle which contains a basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum drying and freeze-drying which yields a powder ofthe active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the pu ⁇ ose of oral therapeutic administration, the active compound can be inco ⁇ orated with excipients and used in the form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part ofthe composition.
- the tablets, pills, capsules, troches and the like can contain any ofthe following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
- a suitable propellant e.g., a gas such as carbon dioxide, or a nebulizer.
- Systemic administration can also be by transmucosal or transdermal means.
- penetrants appropriate to the barrier to be permeated are used in the formulation.
- penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives.
- Transmucosal administration can be accomplished through the use of nasal sprays or suppositories.
- the active compounds are formulated into ointments, salves, gels, or creams as generally known in • the art.
- the compounds can also be prepared in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
- the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid.
- Dosage unit form refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms ofthe invention are dictated by and directly dependent on the unique characteristics ofthe active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.
- Toxicity and therapeutic efficacy of such compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% ofthe population) and the ED50 (the dose therapeutically effective in 50%> ofthe population).
- the dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio
- LD50/ED50 Compounds which exhibit large therapeutic indices are preferred. While compounds that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such compounds to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects.
- the data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for use in humans.
- the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration utilized. For any compound used in the method ofthe invention, the therapeutically effective dose can be estimated initially from cell culture assays.
- a dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the test compound which achieves a half-maximal inhibition of symptoms) as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. Levels in plasma may be measured, for example, by high performance liquid chromatography.
- the nucleic acid molecules ofthe invention can be inserted into vectors and used as gene therapy vectors.
- Gene therapy vectors can be delivered to a subject by, for example, intravenous injection, local administration (see U.S. Patent 5,328,470) or by stereotactic injection (see e.g., Chen et al (1994) PNAS 91 :3054-3057).
- the pharmaceutical preparation ofthe gene therapy vector can include the gene therapy vector in an acceptable diluent, or can comprise a slow release matrix in which the gene delivery vehicle is imbedded.
- the pharmaceutical preparation can include one or more cells which produce the gene delivery system.
- compositions can be included in a container, pack, or dispenser together with instructions for administration.
- nucleic acid molecules, proteins, protein homologues, and antibodies described herein can be used in one or more ofthe following methods: a) screening assays; b) predictive medicine (e.g., diagnostic assays, prognostic assays, monitoring clinical trials, and pharmacogenetics); and c) methods of treatment (e.g., therapeutic and prophylactic).
- an SLGP protein ofthe invention has one or more of the following activities: (i) interaction of an SLGP protein with soluble SLGP ligand (e.g., CD55); (ii) interaction of an SLGP protein with a membrane-bound non-SLGP protein; (iii) interaction of an SLGP protein with an intracellular protein (e.g., an intracellular enzyme or signal transduction molecule); (iv) indirect interaction of an SLGP protein with an intracellular protein (e.g., a downstream signal transduction molecule); and (v) modulation of cellular proliferation, migration, and growth and thus can be used in, for example, (1) modulation of cellular signal transduction, either in vitro or in vivo; (2) regulation of activation in a cell expressing an SLGP protein exposure to alpha-latrotoxin); (3) regulation of inflammation; or (4) modulation of angiogenesis (e.g., proliferation, elongation, and migration of endothelial cells (e.g. tumor endo
- the isolated nucleic acid molecules ofthe invention can be used, for example, to express SLGP protein (e.g., via a recombinant expression vector in a host cell in gene therapy applications), to detect SLGP mRNA (e.g., in a biological sample) or a genetic alteration in an SLGP gene, and to modulate SLGP activity, as described further below.
- the SLGP proteins can be used to treat disorders characterized by insufficient or excessive production of an SLGP protein and/or SLGP ligand (e.g., cancer and diseases characterized by increased or decreased angiogenesis such as, for example arthritis, retinal and optic disk neovascularization, and tissue ischemia , such as myocardial ischemia).
- the SLGP proteins can be used to screen drugs or compounds which modulate the SLGP activity as well as to treat disorders characterized by insufficient or excessive production of SLGP protein or production of SLGP protein forms which have decreased or aberrant activity compared to SLGP wild type protein (e.g., cellular proliferation, growth, differentiation, or migration disorder (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia).
- the anti-SLGP antibodies ofthe invention can be used to detect and isolate SLGP proteins, regulate the bioavailability of SLGP proteins, and modulate SLGP activity.
- the invention provides a method (also referred to herein as a "screening assay") for identifying modulators, i.e., candidate or test compounds or agents (e.g., peptides, peptidomimetics, small molecules or other drugs) which bind to SLGP proteins, or have a stimulatory or inhibitory effect on, for example, SLGP expression or SLGP activity (e.g., angiogenesis).
- modulators i.e., candidate or test compounds or agents (e.g., peptides, peptidomimetics, small molecules or other drugs) which bind to SLGP proteins, or have a stimulatory or inhibitory effect on, for example, SLGP expression or SLGP activity (e.g., angiogenesis).
- Compounds identified using the assays described herein may be useful for treating diseases associated with aberrant angiogenesis (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia
- the invention provides assays for screening candidate or test compounds which bind to or modulate the activity of an SLGP protein or polypeptide or biologically active portion thereof.
- the test compounds ofthe present invention can be obtained using any ofthe numerous approaches in combinatorial library methods known in the art, including: biological libraries; spatially addressable parallel solid phase or solution phase libraries; synthetic library methods requiring deconvolution; the 'one- bead one-compound' library method; and synthetic library methods using affinity chromatography selection.
- the biological library approach is limited to peptide libraries, while the other four approaches are applicable to peptide, non-peptide oligomer or small molecule libraries of compounds (Lam, K.S. (1991) Anticancer Drug Des. 12:145).
- an assay is a cell-based assay in which a cell which expresses an SLGP protein on the cell surface is contacted with a test compound and the ability ofthe test compound to bind to the SLGP protein determined.
- the cell for example, can be of mammalian origin or a yeast cell. Determining the ability ofthe test compound to bind to an SLGP protein can be accomplished, for example, by coupling the test compound with a radioisotope or enzymatic label such that binding ofthe test compound to the SLGP protein can be determined by detecting the labeled compound in a complex.
- test compounds can be labeled with 125 I, 35 S, 14 C, or 3 H, either directly or indirectly, and the radioisotope detected by direct counting of radioemmission or by scintillation counting.
- test compounds can be enzymatically labeled with, for example, horseradish peroxidase, alkaline phosphatase, or luciferase, and the enzymatic label detected by determination of conversion of an appropriate substrate to product.
- a microphysiometer can be used to detect the interaction of a test compound with an SLGP protein without the labeling of either the test compound or the receptor. McConnell, H. M. et al. (1992) Science 257:1906-1912.
- a "microphysiometer” e.g., CytosensorTM
- LAPS light-addressable potentiometric sensor
- an assay is a cell-based assay comprising contacting a cell expressing an SLGP target molecule (e.g., an SLGP substrate) with a test compound and determining the ability ofthe test compound to modulate (e.g., stimulate or inhibit) the activity ofthe SLGP target molecule. Determining the ability ofthe test compound to modulate the activity of an SLGP target molecule can be accomplished, for example, by determining the ability ofthe SLGP protein to bind to or interact with the SLGP target molecule.
- an assay is a cell-based assay comprising contacting cells expressing an SLGP molecule with a test compound and determining the ability of the test compound to modulate (e.g., stimulate or inhibit) an SLGP activity, e.g., cellular proliferation, migration, growth or differentiation, and formation of vessels in endothelial tissues (e.g., angiogenesis).
- the cells can be of mammalian origin, e.g., an endothelial cell.
- Cellular models may also be used to identify modulators of SLGP activity (e.g., modulators of angiogenesis) and to determine the ability of test compounds to modulate the activity of an SLGP target molecule.
- Cellular models for the study of angiogenesis include models of endothelial cell differentiation on Matrigel (Baatout, S. et al. (1996) Rom. J. Intern. Med. 34:263-269; Benelli, R et al. (1999) Int. J. Biol. Markers 14:243- 246), the culture of microvessel fragments in physiological gels (Hoying, JB et al. (1996) In Vitro Cell Dev. Biol. Anim. 32: 409-419; US Patent No.
- the assay comprises contacting a cell which expresses an SLGP protein or biologically active portion thereof, on the cell surface with an SLGP ligand, to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability ofthe test compound to interact with the SLGP protein or biologically active portion thereof, wherein determining the ability ofthe test compound to interact with the SLGP protein or biologically active portion thereof, comprises determining the ability ofthe test compound to preferentially bind to the SLGP protein or biologically active portion thereof, as compared to the ability ofthe SLGP ligand to bind to the SLGP protein or biologically active portion thereof.
- Determining the ability ofthe SLGP ligand or SLGP modulator to bind to or interact with an SLGP protein or biologically active portion thereof can be accomplished by one ofthe methods described above for determining direct binding.
- determining the ability ofthe SLGP ligand or modulator to bind to or interact with an SLGP protein or biologically active portion thereof can be accomplished by determining the activity of an SLGP protein or of a downstream SLGP target molecule.
- the target molecule can be a cellular second messenger, and the activity ofthe target molecule can be determined by detecting induction ofthe target (i.e.
- a reporter gene comprising an SLGP-responsive regulatory element operatively linked to a nucleic acid encoding a detectable marker, e.g., luciferase
- a cellular response for example, a cellular proliferation, growth, differentiation, or migration response.
- the present invention involves a method of identifying a compound which modulates the activity of an SLGP protein, comprising contacting a cell which expresses an SLGP protein with a test compound, determining the ability of the test compound to modulate the activity the SLGP protein (e.g., angiogenesis), and identifying the compound as a modulator of SLGP activity.
- the present invention involves a method of identifying a compound which modulates the activity of an SLGP protein, comprising contacting a cell which expresses an SLGP protein with a test compound, determining the ability ofthe test compound to modulate the activity of a downstream SLGP target molecule, and identifying the compound as a modulator of SLGP activity.
- an assay ofthe present invention is a cell-free assay in which an SLGP protein or biologically active portion thereof is contacted with a test compound and the ability ofthe test compound to bind to the SLGP protein or biologically active portion thereof is determined. Binding ofthe test compound to the SLGP protein can be determined either directly or indirectly as described above. Binding ofthe test compound to the SLGP protein can also be accomplished using a technology such as real-time Biomolecular Interaction Analysis (BIA). Sjolander, S. and Urbaniczky, C. (1991) Anal. Chem. 63:2338-2345 and Szabo et al. (1995) Curr. Opin. Struct. Biol. 5:699-705.
- BIOA Biomolecular Interaction Analysis
- BIOA is a technology for studying biospecific interactions in real time, without labeling any ofthe interactants (e.g., BIAcoreTM). Changes in the optical phenomenon of surface plasmon resonance (SPR) can be used as an indication of real-time reactions between biological molecules.
- SPR surface plasmon resonance
- the assay includes contacting the SLGP protein or biologically active portion thereof with a known ligand which binds SLGP to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability ofthe test compound to interact with an SLGP protein, wherein determining the ability ofthe test compound to interact with an SLGP protein comprises determining the ability ofthe test compound to preferentially bind to SLGP or biologically active portion thereof as compared to the known ligand.
- the assay is a cell-free assay in which an SLGP protein or biologically active portion thereof is contacted with a test compound and the ability of the test compound to modulate (e.g., stimulate or inhibit) the activity ofthe SLGP protein or biologically active portion thereof is determined.
- the cell-free assay involves contacting an SLGP protein or biologically active portion thereof with a known ligand which binds the SLGP protein to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability ofthe test compound to interact with the SLGP protein, wherein determining the ability ofthe test compound to interact with the SLGP protein comprises determining the ability ofthe test compound to preferentially bind to or modulate the activity of an SLGP target molecule, as compared to the known ligand.
- the cell-free assays ofthe present invention are amenable to use of both soluble and/or membrane-bound forms of isolated proteins (e.g. SLGP proteins or biologically active portions thereof or SLGP proteins).
- isolated proteins e.g. SLGP proteins or biologically active portions thereof or SLGP proteins.
- a membrane-bound form an isolated protein e.g., an SLGP protein
- non-ionic detergents such as n-oc
- binding of a test compound to an SLGP protein, or interaction of an SLGP protein with a target molecule in the presence and absence of a candidate compound can be accomplished in any vessel suitable for containing the reactants. Examples of such vessels include microtitre plates, test tubes, and micro-centrifuge tubes.
- a fusion protein can be provided which adds a domain that allows one or both ofthe proteins to be bound to a matrix.
- glutathione-S -transferase/ SLGP fusion proteins or glutathione-S- transferase/target fusion proteins can be adsorbed onto glutathione sepharose beads (Sigma Chemical, St. Louis, MO) or glutathione derivatized microtitre plates, which are then combined with the test compound or the test compound and either the non-adsorbed target protein or SLGP protein, and the mixture incubated under conditions conducive to complex formation (e.g., at physiological conditions for salt and pH). Following incubation, the beads or microtitre plate wells are washed to remove any unbound components, the matrix immobilized in the case of beads, complex determined either directly or indirectly, for example, as described above. Alternatively, the complexes can be dissociated from the matrix, and the level of SLGP binding or activity determined using standard techniques.
- an SLGP protein or an SLGP target molecule can be immobilized utilizing conjugation of biotin and streptavidin.
- Biotinylated SLGP protein or target molecules can be prepared from biotin-NHS (N-
- hydroxy-succinimide using techniques well known in the art (e.g., biotinylation kit, Pierce Chemicals, Rockford, IL), and immobilized in the wells of streptavidin-coated 96 well plates (Pierce Chemical).
- biotinylation kit Pierce Chemicals, Rockford, IL
- streptavidin-coated 96 well plates Piereptavidin-coated 96 well plates
- antibodies reactive with SLGP protein or target molecules but which do not interfere with binding ofthe SLGP protein to its target molecule can be derivatized to the wells ofthe plate, and unbound target or SLGP protein trapped in the wells by antibody conjugation.
- Methods for detecting such complexes include immunodetection of complexes using antibodies reactive with the SLGP protein or target molecule, as well as enzyme-linked assays which rely on detecting an enzymatic activity associated with the SLGP protein or target molecule.
- modulators of SLGP expression are identified in a method wherein a cell is contacted with a candidate compound and the expression of SLGP mRNA or protein in the cell is determined. The level of expression of SLGP mRNA or protein in the presence ofthe candidate compound is compared to the level of expression of SLGP mRNA or protein in the absence ofthe candidate compound.
- the candidate compound can then be identified as a modulator of SLGP expression based on this comparison. For example, when expression of SLGP mRNA or protein is greater (statistically significantly greater) in the presence ofthe candidate compound than in its absence, the candidate compound is identified as a stimulator of SLGP mRNA or protein expression. Alternatively, when expression of SLGP mRNA or protein is less (statistically significantly less) in the presence ofthe candidate compound than in its absence, the candidate compound is identified as an inhibitor of SLGP mRNA or protein expression.
- the level of SLGP mRNA or protein expression in the cells can be determined by methods described herein for detecting SLGP mRNA or protein.
- the SLGP proteins can be used as "bait proteins" in a two-hybrid assay or three-hybrid assay (see, e.g., U.S. Patent No.
- SLGP-binding proteins proteins which bind to or interact with SLGP
- SLGP-binding proteins proteins which bind to or interact with SLGP
- Such SLGP-binding proteins are also likely to be involved in the propagation of signals by the SLGP proteins as, for example, downstream elements of an SLGP-mediated signaling pathway.
- SLGP-binding proteins are likely to be cell-surface molecules associated with non-SLGP expressing cells, wherein such SLGP-binding proteins are involved in chemoattraction.
- the two-hybrid system is based on the modular nature of most transcription factors, which consist of separable DNA-binding and activation domains. Briefly, the assay utilizes two different DNA constructs. In one construct, the gene that codes for an SLGP protein is fused to a gene encoding the DNA binding domain of a known transcription factor (e.g., GAL-4).
- a known transcription factor e.g., GAL-4
- a DNA sequence from a library of DNA sequences, that encodes an unidentified protein ("prey" or “sample") is fused to a gene that codes for the activation domain ofthe known transcription factor. If the "bait” and the “prey” proteins are able to interact, in vivo, forming an SLGP- dependent complex, the DNA-binding and activation domains ofthe transcription factor are brought into close proximity. This proximity allows transcription of a reporter gene (e.g., LacZ) which is operably linked to a transcriptional regulatory site responsive to the transcription factor.
- a reporter gene e.g., LacZ
- This invention further pertains to novel agents identified by the above-described screening assays. Accordingly, it is within the scope of this invention to further use an agent identified as described herein in an appropriate animal model.
- an agent identified as described herein e.g., an SLGP modulating agent, an antisense SLGP nucleic acid molecule, an SLGP-specific antibody, or an SLGP-binding partner
- an agent identified as described herein can be used in an animal model to determine the efficacy, toxicity, or side effects of treatment with such an agent.
- an agent identified as described herein can be used in an animal model to determine the mechanism of action of such an agent.
- this invention pertains to uses of novel agents identified by the above-described screening assays for treatments as described herein.
- Models for studying angiogenesis in vivo include, for example, tumor cell- induced angiogenesis and tumor metastasis (Hoffman, RM (1998-99) Cancer Metastasis Rev. 17:271-277; Holash, J et al. (1999) Oncogene 18:5356-5362; Li, CY et al. (2000) J. Natl Cancer Inst. 92:143-147), matrix induced angiogenesis (US Patent No. 5,382,514), the disc angiogenesis system (Kowalski, j. et al.
- cDNA sequences identified herein can be used in numerous ways as polynucleotide reagents. For example, these sequences can be used to: (i) map their respective genes on a chromosome; and, thus, locate gene regions associated with genetic disease; (ii) identify an individual from a minute biological sample (tissue typing); and (iii) aid in forensic identification of a biological sample. These applications are described in the subsections below.
- this sequence can be used to map the location ofthe gene on a chromosome. This process is called chromosome mapping. Accordingly, portions or fragments ofthe SLGP nucleotide sequences, described herein, can be used to map the location ofthe SLGP genes on a chromosome. The mapping ofthe SLGP sequences to chromosomes is an important first step in correlating these sequences with genes associated with disease.
- SLGP genes can be mapped to chromosomes by preparing PCR primers (preferably 15-25 bp in length) from the SLGP nucleotide sequences. Computer analysis ofthe SLGP sequences can be used to predict primers that do not span more than one exon in the genomic DNA, thus complicating the amplification process. These primers can then be used for PCR screening of somatic cell hybrids containing individual human chromosomes. Only those hybrids containing the human gene corresponding to the SLGP sequences will yield an amplified fragment.
- Somatic cell hybrids are prepared by fusing somatic cells from different mammals (e.g., human and mouse cells). As hybrids of human and mouse cells grow and divide, they gradually lose human chromosomes in random order, but retain the mouse chromosomes. By using media in which mouse cells cannot grow, because they lack a particular enzyme, but human cells can, the one human chromosome that contains the gene encoding the needed enzyme, will be retained. By using various media, panels of hybrid cell lines can be established. Each cell line in a panel contains either a single human chromosome or a small number of human chromosomes, and a full set of mouse chromosomes, allowing easy mapping of individual genes to specific human chromosomes. (D'Eustachio P.
- Somatic cell hybrids containing only fragments of human chromosomes can also be produced by using human chromosomes with translocations and deletions.
- PCR mapping of somatic cell hybrids is a rapid procedure for assigning a particular sequence to a particular chromosome. Three or more sequences can be assigned per day using a single thermal cycler. Using the SLGP nucleotide sequences to design oligonucleotide primers, sublocalization can be achieved with panels of fragments from specific chromosomes.
- Other mapping strategies which can similarly be used to map a 9o, lp, or lv sequence to its chromosome include in situ hybridization (described in Fan, Y.
- FISH Fluorescence in situ hybridization
- the FISH technique can be used with a DNA sequence as short as 500 or 600 bases. However, clones larger than 1,000 bases have a higher likelihood of binding to a unique chromosomal location with sufficient signal intensity for simple detection. Preferably 1,000 bases, and more preferably 2,000 bases will suffice to get good results at a reasonable amount of time. For a review of this technique, see Verma et al, Human Chromosomes: A Manual of Basic Techniques (Pergamon Press, New York 1988).
- Reagents for chromosome mapping can be used individually to mark a single chromosome or a single site on that chromosome, or panels of reagents can be used for marking multiple sites and/or multiple chromosomes. Reagents corresponding to noncoding regions ofthe genes actually are preferred for mapping pu ⁇ oses. Coding sequences are more likely to be conserved within gene families, thus increasing the chance of cross hybridizations during chromosomal mapping. Once a sequence has been mapped to a precise chromosomal location, the physical position ofthe sequence on the chromosome can be correlated with genetic map data. (Such data are found, for example, in V.
- differences in the DNA sequences between individuals affected and unaffected with a disease associated with the SLGP gene can be determined. If a mutation is observed in some or all ofthe affected individuals but not in any unaffected individuals, then the mutation is likely to be the causative agent ofthe particular disease. Comparison of affected and unaffected individuals generally involves first looking for structural alterations in the chromosomes, such as deletions or translocations that are visible from chromosome spreads or detectable using PCR based on that DNA sequence. Ultimately, complete sequencing of genes from several individuals can be performed to confirm the presence of a mutation and to distinguish mutations from polymo ⁇ hisms.
- the SLGP sequences ofthe present invention can also be used to identify individuals from minute biological samples.
- the United States military for example, is considering the use of restriction fragment length polymo ⁇ hism (RFLP) for identification of its personnel.
- RFLP restriction fragment length polymo ⁇ hism
- an individual's genomic DNA is digested with one or more restriction enzymes, and probed on a Southern blot to yield unique bands for identification. This method does not suffer from the current limitations of "Dog Tags" which can be lost, switched, or stolen, making positive identification difficult.
- the sequences ofthe present invention are useful as additional DNA markers for RFLP (described in U.S. Patent 5,272,057).
- sequences ofthe present invention can be used to provide an alternative technique which determines the actual base-by-base DNA sequence of selected portions of an individual's genome.
- the SLGP nucleotide sequences described herein can be used to prepare two PCR primers from the 5' and 3' ends ofthe sequences. These primers can then be used to amplify an individual's DNA and subsequently sequence it.
- Panels of corresponding DNA sequences from individuals, prepared in this manner, can provide unique individual identifications, as each individual will have a unique set of such DNA sequences due to allelic differences.
- the sequences ofthe present invention can be used to obtain such identification sequences from individuals and from tissue.
- the SLGP nucleotide sequences ofthe invention uniquely represent portions ofthe human genome. Allelic variation occurs to some degree in the coding regions of these sequences, and to a greater degree in the noncoding regions. It is estimated that allelic variation between individual humans occurs with a frequency of about once per each 500 bases.
- Each ofthe sequences described herein can, to some degree, be used as a standard against which DNA from an individual can be compared for identification pu ⁇ oses.
- noncoding sequences of SEQ ID NOT can comfortably provide positive individual identification with a panel of perhaps 10 to 1,000 primers which each yield a noncoding amplified sequence of 100 bases. If predicted coding sequences, such as those in SEQ ID NO: 3 are used, a more appropriate number of primers for positive individual identification would be 500-2,000.
- a panel of reagents from SLGP nucleotide sequences described herein is used to generate a unique identification database for an individual, those same reagents can later be used to identify tissue from that individual.
- positive identification ofthe individual, living or dead can be made from extremely small tissue samples.
- DNA-based identification techniques can also be used in forensic biology.
- Forensic biology is a scientific field employing genetic typing of biological evidence found at a crime scene as a means for positively identifying, for example, a pe ⁇ etrator of a crime.
- PCR technology can be used to amplify DNA sequences taken from very small biological samples such as tissues, e.g., hair or skin, or body fluids, e.g., blood, saliva, or semen found at a crime scene. The amplified sequence can then be compared to a standard, thereby allowing identification ofthe origin ofthe biological sample.
- sequences ofthe present invention can be used to provide polynucleotide reagents, e.g., PCR primers, targeted to specific loci in the human genome, which can enhance the reliability of DNA-based forensic identifications by, for example, providing another "identification marker" (i.e. another DNA sequence that is unique to a particular individual).
- an "identification marker” i.e. another DNA sequence that is unique to a particular individual.
- actual base sequence information can be used for identification as an accurate alternative to patterns formed by restriction enzyme generated fragments.
- Sequences targeted to noncoding regions of SEQ ID NOT are particularly appropriate for this use as greater numbers of polymo ⁇ hisms occur in the noncoding regions, making it easier to differentiate individuals using this technique.
- polynucleotide reagents include the SLGP nucleotide sequences or portions thereof, e.g., fragments derived from the noncoding regions of SEQ ID NOT, having a length of at least 20 bases, preferably at least 30 bases.
- the SLGP nucleotide sequences described herein can further be used to provide polynucleotide reagents, e.g., labeled or labelable probes which can be used in, for example, an in situ hybridization technique, to identify a specific tissue, e.g., HMVEC tissue. This can be very useful in cases where a forensic pathologist is presented with a tissue of unknown origin. Panels of such SLGP probes can be used to identify tissue by species and/or by organ type.
- these reagents e.g., SLGP primers or probes can be used to screen tissue culture for contamination (i. e. screen for the presence of a mixture of different types of cells in a culture).
- the present invention also pertains to the field of predictive medicine in which diagnostic assays, prognostic assays, and monitoring clinical trails are used for prognostic (predictive) pu ⁇ oses to thereby treat an individual prophylactically.
- diagnostic assays for determining SLGP protein and/or nucleic acid expression as well as SLGP activity in the context of a biological sample (e.g., blood, serum, cells, (e.g., endothelial cells, including endothelial cells in tumors), and tissue) to thereby determine whether an individual is afflicted with a disease or disorder, or is at risk of developing a disorder, associated with aberrant SLGP expression or activity (e.g., a cellular proliferation, growth, differentiation, or migration disorder, (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia)).
- a biological sample e.g., blood, serum, cells, (e.g.
- the invention also provides for prognostic (or predictive) assays for determining whether an individual is at risk of developing a disorder associated with SLGP protein, nucleic acid expression or activity. For example, mutations in an SLGP gene can be assayed in a biological sample. Such assays can be used for prognostic or predictive pu ⁇ ose to thereby phophylactically treat an individual prior to the onset of a disorder characterized by or associated with SLGP protein, nucleic acid expression or activity.
- Another aspect ofthe invention pertains to monitoring the influence of agents (e.g., drugs, compounds) on the expression or activity of SLGP in clinical trials.
- agents e.g., drugs, compounds
- An exemplary method for detecting the presence or absence of SLGP protein or nucleic acid in a biological sample involves obtaining a biological sample from a test subject and contacting the biological sample with a compound or an agent capable of detecting SLGP protein or nucleic acid (e.g., mRNA, genomic DNA) that encodes SLGP protein such that the presence of SLGP protein or nucleic acid is detected in the biological sample.
- a compound or an agent capable of detecting SLGP protein or nucleic acid e.g., mRNA, genomic DNA
- a preferred agent for detecting SLGP mRNA or genomic DNA is a labeled nucleic acid probe capable of hybridizing to SLGP mRNA or genomic DNA.
- the nucleic acid probe can be, for example, a full-length SLGP nucleic acid, such as the nucleic acid of SEQ ID NO: 1, SEQ ID NO: 17, or a fragment or portion of an SLGP nucleic acid such as an oligonucleotide of at least 15, 30, 50, 100, 250 or 500 nucleotides in length and sufficient to specifically hybridize under stringent conditions to SLGP mRNA or genomic DNA.
- a full-length SLGP nucleic acid such as the nucleic acid of SEQ ID NO: 1, SEQ ID NO: 17, or a fragment or portion of an SLGP nucleic acid such as an oligonucleotide of at least 15, 30, 50, 100, 250 or 500 nucleotides in length and sufficient to specifically hybridize under stringent conditions to SLGP mRNA or genomic DNA.
- Other suitable probes for use in the diagnostic assays ofthe invention are described herein.
- a preferred agent for detecting SLGP protein is an antibody capable of binding to SLGP protein, preferably an antibody with a detectable label.
- Antibodies can be polyclonal, or more preferably, monoclonal. An intact antibody, or a fragment thereof (e.g., Fab or F(ab')2) can be used.
- the term "labeled", with regard to the probe or antibody, is intended to encompass direct labeling ofthe probe or antibody by coupling (i.e., physically linking) a detectable substance to the probe or antibody, as well as indirect labeling ofthe probe or antibody by reactivity with another reagent that is directly labeled.
- Examples of indirect labeling include detection of a primary antibody using a fluorescently labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently labeled streptavidin.
- biological sample is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject. That is, the detection method ofthe invention can be used to detect SLGP mRNA, protein, or genomic DNA in a biological sample in vitro as well as in vivo.
- in vitro techniques for detection of SLGP mRNA include Northern hybridizations and in situ hybridizations.
- In vitro techniques for detection of SLGP protein include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations and immunofluorescence.
- In vitro techniques for detection of SLGP genomic DNA include Southern hybridizations.
- in vivo techniques for detection of SLGP protein include introducing into a subject a labeled anti-SLGP antibody.
- the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
- the biological sample contains protein molecules from the test subject.
- the biological sample can contain mRNA molecules from the test subject or genomic DNA molecules from the test subject.
- a preferred biological sample is a serum sample isolated by conventional means from a subject.
- the methods further involve obtaining a control biological sample from a control subject, contacting the control sample with a compound or agent capable of detecting SLGP protein, mRNA, or genomic DNA, such that the presence of SLGP protein, mRNA or genomic DNA is detected in the biological sample, and comparing the presence of SLGP protein, mRNA or genomic DNA in the control sample with the presence of SLGP protein, mRNA or genomic DNA in the test sample.
- kits for detecting the presence of SLGP in a biological sample can comprise a labeled compound or agent capable of detecting SLGP protein or mRNA in a biological sample; means for determining the amount of SLGP in the sample; and means for comparing the amount of SLGP in the sample with a standard.
- the compound or agent can be packaged in a suitable container.
- the kit can further comprise instructions for using the kit to detect SLGP protein or nucleic acid.
- the diagnostic methods described herein can furthermore be utilized to identify subjects having or at risk of developing a disease or disorder associated with aberrant SLGP expression or activity.
- aberrant includes an SLGP expression or activity which deviates from the wild type SLGP expression or activity.
- Aberrant expression or activity includes increased or decreased expression or activity, as well as expression or activity which does not follow the wild type developmental pattern of expression or the subcellular pattern of expression.
- aberrant SLGP expression or activity is intended to include the cases in which a mutation in the SLGP gene causes the SLGP gene to be under-expressed or over-expressed and situations in which such mutations result in a non-functional SLGP protein or a protein which does not function in a wild-type fashion, e.g., a protein which does not interact with an SLGP ligand or one which interacts with a non-SLGP ligand.
- the assays described herein can be utilized to identify subjects having or at risk of developing a disease or disorder associated with aberrant SLGP expression or activity, e.g., a cellular proliferation, growth, differentiation, or migration disorder such as cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia.
- a disease or disorder associated with aberrant SLGP expression or activity e.g., a cellular proliferation, growth, differentiation, or migration disorder such as cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia.
- the assays described herein can be utilized to identify a subject having or at risk of developing a disorder associated with SLGP protein, nucleic acid expression or activity such as a cellular proliferation, growth, differentiation, or migration disorder (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia).
- a cellular proliferation, growth, differentiation, or migration disorder e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia.
- the prognostic assays can be utilized to identify a subject having or at risk for developing a cellular proliferation, growth, differentiation, or migration disorder (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia).
- the present invention provides a method for identifying a disease or disorder associated with aberrant SLGP expression or activity in which a test sample is obtained from a subject and SLGP protein or nucleic acid (e.g., mRNA, genomic DNA) is detected, wherein the presence of SLGP protein or nucleic acid is diagnostic for a subject having or at risk of developing a disease or disorder associated with aberrant SLGP expression or activity (e.g., a cellular proliferation, growth, differentiation, or migration disorder, (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia)).
- a disease or disorder associated with aberrant SLGP expression or activity e.g., a cellular proliferation, growth, differentiation, or migration disorder, (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia)
- test sample refers to a biological sample obtained from a subject of interest.
- a test sample can be a biological fluid (e.g., serum), cell sample (e.g., endothelial cells or tumor endothelial cells), or tissue.
- the prognostic assays described herein can be used to determine whether a subject can be administered an agent (e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate) to treat a disease or disorder associated with aberrant SLGP expression or activity.
- an agent e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate
- such methods can be used to determine whether a subject can be effectively treated with an agent for a disorder, such as a cellular proliferation, growth, differentiation, or migration disorder, (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia).
- a disorder such as a cellular proliferation, growth, differentiation, or migration disorder
- such methods can be used to determine whether a subject can be effectively treated with an agent for a cellular proliferation, growth, differentiation, or migration disorder, (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia myocardial ischemia).
- the present invention provides methods for determining whether a subject can be effectively treated with an agent for a disorder associated with aberrant SLGP expression or activity in which a test sample is obtained and SLGP protein or nucleic acid expression or activity is detected (e.g., wherein the abundance of SLGP protein or nucleic acid expression or activity is diagnostic for a subject that can be administered the agent to treat a disorder associated with aberrant SLGP expression or activity (e.g., a cellular proliferation, growth, differentiation, or migration disorder, (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia)).
- a disorder associated with aberrant SLGP expression or activity e.g., a cellular proliferation, growth, differentiation, or migration disorder, (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia)
- the methods ofthe invention can also be used to detect genetic alterations
- the methods include detecting, in a sample of cells from the subject, the presence or absence of a genetic alteration characterized by at least one of an alteration affecting the integrity of a gene encoding an SLGP -protein, or the mis-expression ofthe SLGP gene.
- such genetic alterations can be detected by ascertaining the existence of at least one of 1) a deletion of one or more nucleotides from an SLGP gene; 2) an addition of one or more nucleotides to an SLGP gene; 3) a substitution of one or more nucleotides of an SLGP gene, 4) a chromosomal rearrangement of an SLGP gene; 5) an alteration in the level of a messenger RNA transcript of an SLGP gene, 6) aberrant modification of an SLGP gene, such as ofthe methylation pattern ofthe genomic DNA, 7) the presence of a non- wild type splicing pattern of a messenger RNA transcript of an SLGP gene, 8) a non- wild type level of an SLGP-protein, 9) allelic loss of an SLGP gene, and 10) inappropriate post-translational modification of an SLGP-protein.
- a preferred biological sample is a tissue or serum sample isolated by conventional means from a subject.
- detection ofthe alteration involves the use of a probe/primer in a polymerase chain reaction (PCR) (see, e.g., U.S. Patent Nos. 4,683,195 and 4,683,202), such as anchor PCR or RACE PCR, or, alternatively, in a ligation chain reaction (LCR) (see, e.g., Landegran et al. (1988) Science 241:1077-1080; and Nakazawa et al.
- PCR polymerase chain reaction
- LCR ligation chain reaction
- This method can include the steps of collecting a sample of cells from a patient, isolating nucleic acid (e.g., genomic, mRNA or both) from the cells ofthe sample, contacting the nucleic acid sample with one or more primers which specifically hybridize to an SLGP gene under conditions such that hybridization and amplification ofthe SLGP-gene (if present) occurs, and detecting the presence or absence of an amplification product, or detecting the size ofthe amplification product and comparing the length to a control sample.
- nucleic acid e.g., genomic, mRNA or both
- primers which specifically hybridize to an SLGP gene under conditions such that hybridization and amplification ofthe SLGP-gene (if present) occurs
- detecting the presence or absence of an amplification product or detecting the size ofthe amplification product and comparing the length to a control sample.
- PCR and/or LCR may be desirable to use as a preliminary amplification step in conjunction with any ofthe techniques used for
- mutations in an SLGP gene from a sample cell can be identified by alterations in restriction enzyme cleavage patterns.
- sample and control DNA is isolated, amplified (optionally), digested with one or more restriction endonucleases, and fragment length sizes are determined by gel electrophoresis and compared. Differences in fragment length sizes between sample and control DNA indicates mutations in the sample DNA.
- sequence specific ribozymes see, for example, U.S. Patent No. 5,498,531 can be used to score for the presence of specific mutations by development or loss of a ribozyme cleavage site.
- genetic mutations in SLGP can be identified by hybridizing a sample and control nucleic acids, e.g., DNA or RNA, to high density arrays containing hundreds or thousands of oligonucleotides probes (Cronin, M.T. et al. (1996) Human Mutation 1: 244-255; Kozal, M.J. et al. (1996) Nature Medicine 2: 753- 759).
- genetic mutations in SLGP can be identified in two dimensional arrays containing light-generated DNA probes as described in Cronin, M.T. et al. supra.
- a first hybridization array of probes can be used to scan through long stretches of DNA in a sample and control to identify base changes between the sequences by making linear arrays of sequential overlapping probes. This step allows the identification of point mutations. This step is followed by a second hybridization array that allows the characterization of specific mutations by using smaller, specialized probe arrays complementary to all variants or mutations detected.
- Each mutation array is composed of parallel probe sets, one complementary to the wild-type gene and the other complementary to the mutant gene.
- any of a variety of sequencing reactions known in the art can be used to directly sequence the SLGP gene and detect mutations by comparing the sequence ofthe sample SLGP with the corresponding wild-type (control) sequence.
- Examples of sequencing reactions include those based on techniques developed by Maxim and Gilbert ((1977) PNAS 74:560) or Sanger ((1977) PNAS 74:5463). It is also contemplated that any of a variety of automated sequencing procedures can be utilized when performing the diagnostic assays ((1995) Biotechniques 19:448), including sequencing by mass spectrometry (see, e.g., PCT International Publication No. WO 94/16101; Cohen et al. (1996) Adv. Chromatogr.
- RNA/RNA or RNA/DNA heteroduplexes methods in which protection from cleavage agents is used to detect mismatched bases in RNA/RNA or RNA/DNA heteroduplexes.
- Myers et al. (1985) Science 230:1242 methods in which protection from cleavage agents is used to detect mismatched bases in RNA/RNA or RNA/DNA heteroduplexes.
- the art technique of "mismatch cleavage" starts by providing heteroduplexes of formed by hybridizing (labeled) RNA or DNA containing the wild-type SLGP sequence with potentially mutant RNA or DNA obtained from a tissue sample.
- RNA/DNA duplexes can be treated with RNase and DNA/DNA hybrids treated with SI nuclease to enzymatically digesting the mismatched regions.
- either DNA/DNA or RNA/DNA duplexes can be treated with hydroxylamine or osmium tetroxide and with piperidine in order to digest mismatched regions. After digestion ofthe mismatched regions, the resulting material is then separated by size on denaturing polyacrylamide gels to determine the site of mutation. See, for example, Cotton et al. (1988) Proc. Natl Acad Sci USA 85:4397; Saleeba et al. (1992) Methods Enzymol. 217:286-295.
- the control DNA or RNA can be labeled for detection.
- the mismatch cleavage reaction employs one or more proteins that recognize mismatched base pairs in double-stranded DNA (so called "DNA mismatch repair" enzymes) in defined systems for detecting and mapping point mutations in SLGP cDNAs obtained from samples of cells.
- DNA mismatch repair enzymes
- the mutY enzyme of E. coli cleaves A at G/A mismatches and the thymidine DNA glycosylase from HeLa cells cleaves T at G/T mismatches (Hsu et al. (1994) Carcinogenesis 15:1657-1662).
- a probe based on an SLGP sequence e.g., a wild-type SLGP sequence
- a cDNA or other DNA product from a test cell(s).
- the duplex is treated with a DNA mismatch repair enzyme, and the cleavage products, if any, can be detected from electrophoresis protocols or the like. See, for example, U.S. Patent No. 5,459,039.
- alterations in electrophoretic mobility will be used to identify mutations in SLGP genes.
- single strand conformation polymo ⁇ hism may be used to detect differences in electrophoretic mobility between mutant and wild type nucleic acids (Orita et al.
- the subject method utilizes heteroduplex analysis to separate double stranded heteroduplex molecules on the basis of changes in electrophoretic mobility (Keen et al. (1991) Trends Genet 7:5).
- the movement of mutant or wild-type fragments in polyacrylamide gels containing a gradient of denaturant is assayed using denaturing gradient gel electrophoresis (DGGE) (Myers et al. (1985) Nature 313:495).
- DGGE denaturing gradient gel electrophoresis
- DNA will be modified to insure that it does not completely denature, for example by adding a GC clamp of approximately 40 bp of high-melting GC-rich DNA by PCR.
- a temperature gradient is used in place of a denaturing gradient to identify differences in the mobility of control and sample DNA (Rosenbaum and Reissner (1987) Biophys Chem 265:12753).
- oligonucleotide primers may be prepared in which the known mutation is placed centrally and then hybridized to target DNA under conditions which permit hybridization only if a perfect match is found (Saiki et al. (1986) Nature 324:163); Saiki et al. (1989) Proc. Natl Acad. Sci USA 86:6230).
- Such allele specific oligonucleotides are hybridized to PCR amplified target DNA or a number of different mutations when the oligonucleotides are attached to the hybridizing membrane and hybridized with labeled target DNA.
- Oligonucleotides used as primers for specific amplification may carry the mutation of interest in the center ofthe molecule (so that amplification depends on differential hybridization) (Gibbs et al. (1989) Nucleic Acids Res. 17:2437-2448) or at the extreme 3' end of one primer where, under appropriate conditions, mismatch can prevent, or reduce polymerase extension (Prossner (1993) Tibtech 11 :238).
- amplification may also be performed using Taq ligase for amplification (Barany (1991) Proc. Natl. Acad. Sci USA 88:189). In such cases, ligation will occur only if there is a perfect match at the 3' end ofthe 5' sequence making it possible to detect the presence of a known mutation at a specific site by looking for the presence or absence of amplification.
- the methods described herein may be performed, for example, by utilizing prepackaged diagnostic kits comprising at least one probe nucleic acid or antibody reagent described herein, which may be conveniently used, e.g., in clinical settings to diagnose patients exhibiting symptoms or family history of a disease or illness involving an SLGP gene.
- any cell type or tissue in which SLGP is expressed may be utilized in the prognostic assays described herein.
- SLGP protein e.g., a cellular proliferation, growth, differentiation, or migration process, e.g., angiogenesis
- agents e.g., drugs, compounds
- angiogenesis a cellular proliferation, growth, differentiation, or migration process, e.g., angiogenesis
- an agent determined by a screening assay as described herein to increase SLGP gene expression, protein levels, or upregulate SLGP activity can be monitored in clinical trials of subjects exhibiting decreased SLGP gene expression, protein levels, or downregulated SLGP activity.
- the effectiveness of an agent determined by a screening assay to decrease SLGP gene expression, protein levels, or downregulate SLGP activity can be monitored in clinical trails of subjects exhibiting increased SLGP gene expression, protein levels, or upregulated SLGP activity.
- the expression or activity of an SLGP gene, and preferably, other genes that have been implicated in, for example, a cellular proliferation, growth, differentiation, or migration disorder e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia
- a cellular proliferation, growth, differentiation, or migration disorder e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia
- tissue ischemia such as myocardial ischemia
- genes including SLGP, that are modulated in cells by treatment with an agent (e.g., compound, drug or small molecule) which modulates SLGP activity (e.g., identified in a- screening assay as described herein) can be identified.
- an agent e.g., compound, drug or small molecule
- SLGP activity e.g., identified in a- screening assay as described herein
- cells can be isolated and RNA prepared and analyzed for the levels of expression of SLGP and other genes implicated in the cellular proliferation, growth, differentiation, or migration disorder (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia), respectively.
- the levels of gene expression can be quantified by Northern blot analysis or RT-PCR, as described herein, or alternatively by measuring the amount of protein produced, by one ofthe methods as described herein, or by measuring the levels of activity of SLGP or other genes.
- the gene expression pattern can serve as a marker, indicative ofthe physiological response ofthe cells to the agent. Accordingly, this response state may be determined before, and at various points during treatment ofthe individual with the agent.
- the present invention provides a method for monitoring the effectiveness of treatment of a subject with an agent (e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate identified by the screening assays described herein) comprising the steps of (i) obtaining a pre-administration sample (e.g., a tumor sample) from a subject prior to administration ofthe agent; (ii) detecting the level of expression of an SLGP protein, mRNA, or genomic DNA in the preadministration sample; (iii) obtaining one or more post-administration samples (e.g., a tumor samples) from the subject; (iv) detecting the level of expression or activity ofthe SLGP protein, mRNA, or genomic DNA in the post-administration samples (e.g., a tumor samples); (v) comparing the level of expression or activity ofthe SLGP protein, mRNA, or genomic DNA in the preadministration sample (e.g., a tumor sample
- an agent
- increased administration ofthe agent may be desirable to increase the expression or activity of SLGP to higher levels than detected, i.e., to increase the effectiveness ofthe agent.
- decreased administration ofthe agent may be desirable to decrease expression or activity of SLGP to lower levels than detected, i.e. to decrease the effectiveness ofthe agent.
- SLGP expression or activity may be used as an indicator ofthe effectiveness of an agent, even in the absence of an observable phenotypic response (e.g., angiogenesis).
- the present invention provides for both prophylactic and therapeutic methods of treating a subject at risk of (or susceptible to) a disorder or having a disorder associated with aberrant SLGP expression or activity, e.g., a cellular proliferation, growth, differentiation, or migration disorder, (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia).
- a disorder associated with aberrant SLGP expression or activity e.g., a cellular proliferation, growth, differentiation, or migration disorder, (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia).
- Treatment is defined as the application or administration of a therapeutic agent to a patient, or application or administration of a therapeutic agent to an isolated tissue or cell line from a patient, who has a disease or disorder, a symptom of disease or disorder or a predisposition toward a disease or disorder, with the pu ⁇ ose of curing, healing, alleviating, relieving, altering, remedying, ameliorating, improving or affecting the disease or disorder, the symptoms of disease or disorder or the predisposition toward a disease or disorder.
- prophylactic and therapeutic methods of treatment such treatments may be specifically tailored or modified, based on knowledge obtained from the field of pharmacogenomics.
- “Pharmacogenomics” refers to the application of genomics technologies such as gene sequencing, statistical genetics, and gene expression analysis to drugs in clinical development and on the market. More specifically, the term refers the study of how a patient's genes determine his or her response to a drug (e.g., a patient's "drug response phenotype", or “drug response genotype”.)
- a patient's drug response phenotype e.g., a patient's "drug response phenotype", or “drug response genotype”.
- another aspect ofthe invention provides methods for tailoring an individual's prophylactic or therapeutic treatment with either the SLGP molecules ofthe present invention or SLGP modulators according to that individual's drug response genotype.
- Pharmacogenomics allows a clinician or physician to target prophylactic or therapeutic treatments to patients who will most benefit from the treatment and to avoid treatment of patients who will experience toxic drug-related side effects.
- the invention provides a method for preventing in a subject, a disease or condition associated with an aberrant SLGP expression or activity, by administering to the subject an SLGP or an agent which modulates SLGP expression or at least one SLGP activity (e.g., modulation of a cellular proliferation, growth, differentiation, or migration process (e.g., angiogenesis).
- an SLGP or an agent which modulates SLGP expression or at least one SLGP activity e.g., modulation of a cellular proliferation, growth, differentiation, or migration process (e.g., angiogenesis).
- Subjects at risk for a disease which is caused or contributed to by aberrant SLGP expression or activity can be identified by, for example, any or a combination of diagnostic or prognostic assays as described herein.
- a prophylactic agent can occur prior to the manifestation of symptoms characteristic ofthe SLGP aberrancy, such that a disease or disorder (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia) is prevented or, alternatively, delayed in its progression.
- a disease or disorder e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia
- tissue ischemia such as myocardial ischemia
- an SLGP, SLGP agonist or SLGP antagonist agent can be used for treating the subject.
- the appropriate agent can be determined based on screening assays described herein.
- the modulatory method ofthe invention involves contacting a cell with an SLGP molecule ofthe present invention such that the activity of an SLGP is modulated.
- the modulatory method ofthe invention involves contacting a cell with an agent that modulates one or more ofthe activities of SLGP protein activity associated with the cell.
- An agent that modulates SLGP protein activity can be an agent as described herein, such as a nucleic acid or a protein, a naturally-occurring target molecule of an SLGP protein (e.g., CD55), an SLGP antibody, an SLGP agonist or antagonist, a peptidomimetic of an SLGP agonist or antagonist, or other small molecule.
- the agent stimulates one or more SLGP activities. Examples of such stimulatory agents include active SLGP protein and a nucleic acid molecule encoding SLGP that has been introduced into the cell.
- the agent inhibits one or more SLGP activities. Examples of such inhibitory agents include antisense SLGP nucleic acid molecules and anti-SLGP antibodies.
- modulatory methods can be performed in vitro (e.g., by culturing the cells, e.g., tumor endothelial cells, with the agent) or, alternatively, in vivo (e.g., by administering the agent to a subject).
- the present invention provides methods of treating an individual afflicted with a disease or disorder characterized by aberrant expression or activity of an SLGP protein or nucleic acid molecule (a cellular proliferation, growth, differentiation, or migration disorder (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia)).
- the method involves administering an agent (e.g., an agent identified by a screening assay described herein), or combination of agents that modulates (e.g., upregulates or downregulates) SLGP expression or activity.
- an agent e.g., an agent identified by a screening assay described herein
- the method involves administering an SLGP protein or nucleic acid molecule as therapy to compensate for reduced or aberrant SLGP expression or activity. Stimulation of SLGP activity is desirable in situations in which SLGP is abnormally downregulated and/or in which increased SLGP activity is likely to have a beneficial effect.
- SLGP inhibition is desirable in situations in which SLGP is abnormally upregulated and/or in which decreased SLGP activity is likely to have a beneficial effect (e.g., cellular proliferation, growth, differentiation, or migration disorders (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia)).
- a beneficial effect e.g., cellular proliferation, growth, differentiation, or migration disorders (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia)).
- SLGP molecules ofthe present invention as well as agents, or modulators which have a stimulatory or inhibitory effect on SLGP activity (e.g., SLGP gene expression) as identified by a screening assay described herein can be administered to individuals to treat (prophylactically or therapeutically) disorders (e.g., cellular proliferation, growth, differentiation, or migration disorders (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia)) associated with aberrant SLGP activity.
- disorders e.g., cellular proliferation, growth, differentiation, or migration disorders (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia)
- pharmacogenomics i.e., the study ofthe relationship between an individual's genotype and that individual's response to a foreign compound or drug
- pharmacogenomics i.e., the study ofthe relationship between an individual'
- a physician or clinician may consider applying knowledge obtained in relevant pharmacogenomics studies in determining whether to administer an SLGP molecule or SLGP modulator as well as tailoring the dosage and/or therapeutic regimen of treatment with an SLGP molecule or SLGP modulator.
- Pharmacogenomics deals with clinically significant hereditary variations in the response to drugs due to altered drug disposition and abnormal action in affected persons. See e.g., Eichelbaum, M., Clin Exp Pharmacol Physiol, 1996, 23(10-11) :983- 985 and Linder, M.W., Clin Chem, 1997, 43(2):254-266.
- G6PD glucose-6-phosphate dehydrogenase deficiency
- a genome-wide association relies primarily on a high-resolution map ofthe human genome consisting of already known gene-related markers (e.g., a "bi- allelic” gene marker map which consists of 60,000-100,000 polymo ⁇ hic or variable sites on the human genome, each of which has two variants.)
- gene-related markers e.g., a "bi- allelic” gene marker map which consists of 60,000-100,000 polymo ⁇ hic or variable sites on the human genome, each of which has two variants.
- Such a high-resolution genetic map can be compared to a map ofthe genome of each of a statistically significant number of patients taking part in a Phase II/III drag trial to identify markers associated with a particular observed drug response or side effect.
- such a high resolution map can be generated from a combination of some ten-million known single nucleotide polymo ⁇ hisms (SNPs) in the human genome.
- SNP single nucleotide polymo ⁇ hisms
- a "SNP" is a common alteration that occurs in a single nucleotide base in a stretch of DNA. For example, a SNP may occur once per every 1000 bases of DNA.
- a SNP may be involved in a disease process, however, the vast majority may not be disease- associated.
- individuals Given a genetic map based on the occurrence of such SNPs, individuals can be grouped into genetic categories depending on a particular pattern of SNPs in their individual genome.
- treatment regimens can be tailored to groups of genetically similar individuals, taking into account traits that may be common among such genetically similar individuals.
- a method termed the "candidate gene approach” can be utilized to identify genes that predict drug response. According to this method, if a gene that encodes a drugs target is known (e.g., an SLGP protein or SLGP protein ofthe present invention), all common variants of that gene can be fairly easily identified in the population and it can be determined if having one version ofthe gene versus another is associated with a particular drug response.
- the activity of drug metabolizing enzymes is a major determinant of both the intensity and duration of drug action.
- the discovery of genetic polymo ⁇ hisms of drag metabolizing enzymes e.g., N-acetyltransferase 2 (NAT 2) and cytochrome P450 enzymes CYP2D6 and CYP2C19
- NAT 2 N-acetyltransferase 2
- CYP2D6 and CYP2C19 cytochrome P450 enzymes
- These polymo ⁇ hisms are expressed in two phenotypes in the population, the extensive metabolizer (EM) and poor metabolizer (PM). The prevalence of PM is different among different populations.
- the gene coding for C YP2D6 is highly polymo ⁇ hic and several mutations have been identified in PM, which all lead to the absence of functional CYP2D6. Poor metabolizers of CYP2D6 and CYP2C19 quite frequently experience exaggerated drag response and side effects when they receive standard doses. If a metabolite is the active therapeutic moiety, PM show no therapeutic response, as demonstrated for the analgesic effect of codeine mediated by its CYP2D6-formed metabolite mo ⁇ hine. The other extreme are the so called ultra-rapid metabolizers who do not respond to standard doses. Recently, the molecular basis of ultra-rapid metabolism has been identified to be due to CYP2D6 gene amplification.
- a method termed the "gene expression profiling” can be utilized to identify genes that predict drug response.
- the gene expression of an animal dosed with a drug e.g., an SLGP molecule or SLGP modulator ofthe present invention
- a drug e.g., an SLGP molecule or SLGP modulator ofthe present invention
- Information generated from more than one ofthe above pharmacogenomics approaches can be used to determine appropriate dosage and treatment regimens for prophylactic or therapeutic treatment an individual. This knowledge, when applied to dosing or drug selection, can avoid adverse reactions or therapeutic failure and thus enhance therapeutic or prophylactic efficiency when treating a subject with an SLGP molecule or SLGP modulator, such as a modulator identified by one ofthe exemplary screening assays described herein.
- SLGP sequence information refers to any nucleotide and/or amino acid sequence information particular to the SLGP molecules ofthe present invention, including but not limited to full-length nucleotide and/or amino acid sequences, partial nucleotide and/or amino acid sequences, polymorphic sequences including single nucleotide polymo ⁇ hisms (SNPs), epitope sequences, and the like.
- information "related to" said SLGP sequence information includes detection ofthe presence or absence of a sequence (e.g., detection of expression of a sequence, fragment, polymo ⁇ hism, etc.), determination ofthe level of a sequence (e.g., detection of a level of expression, for example, a quantative detection), detection of a reactivity to a sequence (e.g., detection of protein expression and/or levels, for example, using a sequence-specific antibody), and the like.
- electronic apparatus readable media refers to any suitable medium for storing, holding or containing data or information that can be read and accessed directly by an electronic apparatus.
- Such media can include, but are not limited to: magnetic storage media, such as floppy discs, hard disc storage medium, and magnetic tape; optical storage media such as compact disc; electronic storage media such as RAM, ROM, EPROM, EEPROM and the like; general hard disks and hybrids of these categories such as magnetic/optical storage media.
- the medium is adapted or configured for having recorded thereon SLGP sequence information ofthe present invention.
- the term "electronic apparatus" is intended to include any suitable computing or processing apparatus or other device configured or adapted for storing data or information.
- Examples of electronic apparatus suitable for use with the present invention include stand-alone computing apparatus; networks, including a local area network (LAN), a wide area network (WAN) Internet, Intranet, and Extranet; electronic appliances such as a personal digital assistants (PDAs), cellular phone, pager and the like; and local and distributed processing systems.
- networks including a local area network (LAN), a wide area network (WAN) Internet, Intranet, and Extranet
- electronic appliances such as a personal digital assistants (PDAs), cellular phone, pager and the like
- PDAs personal digital assistants
- recorded refers to a process for storing or encoding information on the electronic apparatus readable medium.
- Those skilled in the art can readily adopt any ofthe presently known methods for recording information on known media to generate manufactures comprising the SLGP sequence information.
- sequence information can be represented in a word processing text file, formatted in commercially-available software such as WordPerfect and MicroSoft Word, or represented in the form of an ASCII file, stored in a database application, such as DB2, Sybase, Oracle, or the like, as well as in other forms.
- a database application such as DB2, Sybase, Oracle, or the like
- Any number of data processor structuring formats e.g., text file or database
- SLGP sequence information By providing SLGP sequence information in readable form, one can routinely access the sequence information for a variety of pu ⁇ oses.
- sequence information in readable form to compare a target sequence or target structural motif with the sequence information stored within the data storage means.
- Search means are used to identify fragments or regions ofthe sequences ofthe invention which match a particular target sequence or target motif.
- the present invention therefore provides a medium for holding instructions for performing a method for determining whether a subject has a SLGP- associated disease or disorder or a pre-disposition to a SLGP-associated disease or disorder, wherein the method comprises the steps of determining SLGP sequence information associated with the subject and based on the SLGP sequence information, determining whether the subject has a SLGP -associated disease or disorder or a pre-disposition to a SLGP- associated disease or disorder and/or recommending a particular treatment for the disease, disorder or pre-disease condition.
- the present invention further provides in an electronic system and/or in a network, a method for determining whether a subject has a SLGP-associated disease or disorder or a pre-disposition to a disease associated with a SLGP wherein the method comprises the steps of determining SLGP sequence information associated with the subject, and based on the SLGP sequence information, determining whether the subject has a SLGP -associated disease or disorder or a pre-disposition to a SLGP-associated disease or disorder, and/or recommending a particular treatment for the disease, disorder or pre-disease condition.
- the method may further comprise the step of receiving phenotypic information associated with the subject and/or acquiring from a network phenotypic information associated with the subject.
- the present invention also provides in a network, a method for determining whether a subject has a SLGP-associated disease or disorder or a pre-disposition to a SLGP associated disease or disorder associated with SLGP, said method comprising the steps of receiving SLGP sequence information from the subject and/or information related thereto, receiving phenotypic information associated with the subject, acquiring information from the network corresponding to SLGP and/or a SLGP-associated disease or disorder, and based on one or more ofthe phenotypic information, the SLGP information (e.g., sequence information and/or information related thereto), and the acquired information, determining whether the subject has a SLGP-associated disease or disorder or a pre-disposition to a SLGP-associated disease or disorder (e.g., a cellular proliferation, growth, differentiation, or migration disorder).
- the method may further comprise the step of recommending a particular treatment for the disease, disorder or pre-disease condition.
- the present invention also provides a business method for determining whether a subject has a SLGP-associated disease or disorder or a pre-disposition to a SLGP- associated disease or disorder, said method comprising the steps of receiving information related to SLGP (e.g. , sequence information and/or information related thereto), receiving phenotypic information associated with the subject, acquiring information from the network related to SLGP and/or related to a SLGP-associated disease or disorder, and based on one or more ofthe phenotypic information, the SLGP information, and the acquired information, determining whether the subject has a SLGP- associated disease or disorder or a pre-disposition to a SLGP-associated disease or disorder.
- the method may further comprise the step of recommending a particular treatment for the disease, disorder or pre-disease condition.
- the invention also includes an array comprising a SLGP sequence ofthe present invention.
- the array can be used to assay expression of one or more genes in the array.
- the array can be used to assay gene expression in a tissue to ascertain tissue specificity of genes in the array.
- tissue specificity of genes in the array.
- up to about 7600 genes can be simultaneously assayed for expression, one of which can be SLGP.
- the invention allows the quantitation of gene expression.
- tissue specificity but also the level of expression of a battery of genes in the tissue is ascertainable.
- genes can be grouped on the basis of their tissue expression per se and level of expression in that tissue.
- tissue can be perturbed and the effect on gene expression in a second tissue can be determined.
- the effect of one cell type on another cell type in response to a biological stimulus can be determined.
- Such a determination is useful, for example, to know the effect of cell-cell interaction at the level of gene expression. If an agent is administered therapeutically to treat one cell • type but has an undesirable effect on another cell type, the invention provides an assay to determine the molecular basis ofthe undesirable effect and thus provides the opportunity to co-administer a counteracting agent or otherwise treat the undesired effect. Similarly, even within a single cell type, undesirable biological effects can be determined at the molecular level.
- the array can be used to monitor the time course of expression of one or more genes in the array. This can occur in various biological contexts, as disclosed herein, for example development of a SLGP-associated disease or disorder, progression of SLGP-associated disease or disorder, and processes, such a cellular transformation associated with the SLGP-associated disease or disorder.
- the array is also useful for ascertaining the effect ofthe expression of a gene on the expression of other genes in the same cell or in different cells (e.g., ascertaining the effect of SLGP expression on the expression of other genes). This provides, for example, for a selection of alternate molecular targets for therapeutic intervention if the ultimate or downstream target cannot be regulated.
- the array is also useful for ascertaining differential expression patterns of one or more genes in normal and abnormal cells.
- This provides a battery of genes (e.g., including SLGP) that could serve as a molecular target for diagnosis or therapeutic intervention.
- CDNAS In this example, the identification and characterization ofthe gene encoding human SLGP (also referred to as "Fcl ⁇ rb021h09”) is described.
- a program termed 'signal sequence trapping' was utilized to analyze the sequences of several cDNAs of a cDNA library derived from bronchial epithelial cells which had been stimulated with the cytokine, TNF ⁇ .
- This analysis identified a human clone having an insert of approximately 3 kb containing a protein-encoding sequence of approximately 2987 nucleotides capable of encoding approximately 690 amino acids of SLGP (e.g., the starting methionine through residue 690 of, for example, SEQ ID NO:2).
- the nucleotide sequence encoding the human SLGP protein is shown in Figure 1 and is set forth as SEQ ID NO .
- the full length protein encoded by this nucleic acid is comprised of about 690 amino acids and has the amino acid sequence shown in Figure 1 and set forth as SEQ ID NO:2.
- the coding portion (open reading frame) of SEQ ID NOT is set forth as SEQ ID NO:3.
- BLAST search Altschul et al. (1990) J. Mol. Biol. 215:403 ofthe nucleotide sequence of human SLGP has revealed that SLGP is significantly similar to a protein identified as human CD 97 (Accession No. U76764) and to a protein identified as rat latrophilin (Accession Nos. U78105, U72487).
- the SLGP proteins ofthe present invention contain a significant number of structural characteristics ofthe GPCR family. For instance, the SLGPs ofthe present invention contain conserved cysteines found in the first 2 loops (prior to the third and fifth transmembrane domains) of most GPCRs (cys490 and cys562 of SEQ ID NO:2). A highly conserved asparagine residue is present (asnl25 in SEQ ID NO:2). SLGP proteins contains a highly conserved leucine (leul 54 of SEQ ID NO:2). The two cysteine residues are believed to form a disulfide bond that stabilizes the functional protein structure.
- a highly conserved asparagine and arginine in the fourth transmembrane domain ofthe SLGP proteins is present (aspl 58 and arg218 of SEQ ID NO:2).
- a highly conserved proline is present (pro307 of SEQ ID NO:2).
- Proline residues in the fourth, fifth, sixth, and seventh transmembrane domains are thought to introduce kinks in the alpha-helices and may be important in the formation of the ligand binding pocket.
- a conserved tyrosine is present in the seventh ' transmembrane domain of SLGP-2 (tyr647 of SEQ ID NO:2).
- the SLGP family of proteins like the Secretin family of proteins, are referred to herein as G protein-coupled receptor-like proteins.
- SLGP is predicted to contain the following sites: N-glycosylation site at residues 15-18, residues 21-24, residues 64-67, residues 74-77, residues 127-130, residues 177- 180, residues 188-191, residues 249-252, residues 381-384, and at residues 395-398 of SEQ ID NO:2; Glycosaminoglycan attachment site at residues 49-52 of SEQ ID NO:2; cAMP- and cGMP-dependent protein kinase phosphorylation sites at residues 360-363 of SEQ ID NO:2; Protein kinase C phosphorylation sites at residues 135-137, residues 181-183, residues 233-235, residues 358-360, residues 363-365, residues 400-402, residues 457-459, residues 485-487, residues 558-560, and residues 667-669 of SEQ ID NO:2; Casein kinase II phosphorylation sites
- This Example describes the tissue distribution of SLGP mRNA, as determined by Northern blot hybridization. Northern blot hybridizations with the various RNA samples were performed
- SLGP cDNA This example describes the tissue distribution of human and mouse SLGP cDNA, as determined using the TaqManTM procedure.
- the TaqmanTM procedure is a quantitative, real-time PCR-based approach to detecting mRNA.
- the RT-PCR reaction exploits the 5' nuclease activity of AmpliTaq GoldTM DNA Polymerase to cleave a TaqManTM probe during PCR.
- cDNA is generated from the samples of interest and serves as the starting materials for PCR amplification.
- a gene-specific oligonucleotide probe (complementary to the region being amplified) is included in the reaction (i.e., the TaqmanTM probe).
- the TaqManTM probe includes the oligonucleotide with a fluorescent reporter dye covalently linked to the 5' end ofthe probe (such as FAM (6-carboxyfluorescein), TET (6-carboxy- 4,7,2',7'-tetrachlorofluorescein), JOE (6-carboxy-4,5-dichloro-2,7- dimethoxyfluorescein), or VIC) and a quencher dye (TAMRA (6-carboxy-N,N,N',N'- tetramethylrhodamine) at the 3' end ofthe probe.
- a fluorescent reporter dye covalently linked to the 5' end ofthe probe
- TET 6-carboxy- 4,7,2',7'-tetrachlorofluorescein
- JOE 6-carboxy-4,5-dichloro-2,7- dimethoxyfluorescein
- VIC a quencher dye
- cleavage ofthe probe separates the reporter dye and the quencher dye, resulting in increased fluorescence ofthe reporter. Accumulation of PCR products is detected directly by monitoring the increase in fluorescence of the reporter dye. When the probe is intact, the proximity of the reporter dye to the quencher dye results in suppression of the reporter fluorescence.
- the probe specifically anneals between the forward and reverse primer sites. The 5 '-3' nucleolytic activity of the AmpliTaqTM Gold DNA Polymerase cleaves the probe between the reporter and the quencher only if the probe hybridizes to the target. The probe fragments are then displaced from the target, and polymerization ofthe strand continues.
- Results indicate that Human SLGP is highest in endothelial cells, heart tissue and skeletal muscle.
- Human SLGP is upregulated in tube forming Human Microvascular Endothelial Cells (HMVEC) and in proliferating HMVEC as compared to arresting HMVEC. Human SLGP is also upregulated in glioblastomas as compared to normal brain. As shown in Figure 13, Mouse SLGP (ml 983) is upregulated in VEGF-induced angiogenic xenograft plugs as compared to parental plugs.
- HMVEC Human Microvascular Endothelial Cells
- Taqman analysis was also performed on a mouse ischemic hindlimb panel (day 6), indicating increased expression in ischemic versus sham limbs for 3 or 6 pairs with increased VE-cadherin (endothelial marker) expression, which indicates a role for SLGP in the regulation of angiogenesis.
- tissue distribution of human SLGP as determined using in situ hybridization analysis.
- tissues e.g. brain and glioblastoma tissues
- in situ analysis tissues, e.g. brain and glioblastoma tissues, were first frozen on dry ice.
- Ten-micrometer-thick sections ofthe tissues were postfixed with 4%o formaldehyde in DEPC-treated IX phosphate-buffered saline at room temperature for 10 minutes before being rinsed twice in DEPC IX phosphate-buffered saline and once in 0.1 M triethanolamine-HCl (pH 8.0).
- Hybridizations were performed with 35s-radiolabeled (5 X 10 cpm/ml) cRNA probes. Probes were incubated in the presence of a solution containing 600 mM NaCl, 10 mM Tris (pH 7.5), 1 mM EDTA, 0.01% sheared salmon sperm DNA, 0.01% yeast tRNA, 0.05% yeast total RNA type XI, IX Denhardt's solution, 50% formamide, 10% dextran sulfate, 100 mM dithiothreitol, 0.1% sodium dodecyl sulfate (SDS), and 0.1%> sodium thiosulfate for 18 hours at 55°C.
- SDS sodium dodecyl sulfate
- slides were washed with 2X SSC. Sections were then sequentially incubated at 37°C in TNE (a solution containing 10 mM Tris-HCl (pH 7.6), 500 mM NaCl, and 1 mM EDTA), for 10 minutes, in TNE with lO ⁇ g of RNase A per ml for 30 minutes, and finally in TNE for 10 minutes. Slides were then rinsed with 2X SSC at room temperature, washed with 2X SSC at 50°C for 1 hour, washed with 0.2X SSC at 55°C for 1 hour, and 0.2X SSC at 60°C for 1 hour.
- TNE a solution containing 10 mM Tris-HCl (pH 7.6), 500 mM NaCl, and 1 mM EDTA
- results of in situ hybridization also show focal expression of Human SLGP in non-necrotic/inflammatory infiltrate areas in mouse ischemic hindlimb, with a pattern resembling that of platelet endothelial cell adhesion molecule (PEC AM). Furthermore, results indicate that Human SLGP is also expressed at high levels in the aortic root of ApoE mice in endothelial cells on the valvular leaflet.
- the ApoE model is a well-characterized animal model of atherosclerosis, indicating a role for SLGP in cardiovascular disease, e.g., atherosclerosis.
- EXPRESSION This example describes the expression of human and mouse SLGP as determined by transcriptional profiling experiments. Expression of human SLGP in proliferating HMVEC and arresting HMVEC was analyzed by transcriptional profiling. As shown in Figure 10, expression of human SLGP is up-regulated in proliferating HMVEC as compared to arresting HMVEC.
- mouse SLGP expression is up-regulated in VEGF-induced angiogenic xenograft plugs as compared to parental xenografts.
- SLGP is expressed as a recombinant glutathione-S-transferase
- GST GST fusion polypeptide in E. coli and the fusion polypeptide is isolated and characterized.
- SLGP is fused to GST and this fusion polypeptide is expressed in E. coli, e.g., strain PEB199.
- Expression ofthe GST-SLGP fusion protein in PEB199 is induced with IPTG.
- the recombinant fusion polypeptide is purified from crude bacterial lysates ofthe induced PEB199 strain by affinity chromatography on glutathione beads. Using polyacrylamide gel electrophoretic analysis ofthe polypeptide purified from the bacterial lysates, the molecular weight ofthe resultant fusion polypeptide is determined.
- EXAMPLE 6 EXPRESSION OF RECOMBINANT SLGP PROTEIN
- the pcDNA/Amp vector by Invitrogen Co ⁇ oration (San Diego, CA) is used.
- This vector contains an SV40 origin of replication, an ampicillin resistance gene, an E. coli replication origin, a CMV promoter followed by a polylinker region, and an SV40 intron and polyadenylation site.
- a DNA fragment encoding the entire SLGP protein and an HA tag (Wilson et al. (1984) Cell 31:161) or a FLAG tag fused in-frame to its 3' end ofthe fragment is cloned into the polylinker region ofthe vector, thereby placing the expression ofthe recombinant protein under the control of the CMV promoter.
- the SLGP DNA sequence is amplified by PCR using two primers.
- the 5' primer contains the restriction site of interest followed by approximately twenty nucleotides ofthe SLGP coding sequence starting from the initiation codon; the 3' end sequence contains complementary sequences to the other restriction site of interest, a translation stop codon, the HA tag or FLAG tag and the last 20 nucleotides ofthe SLGP coding sequence.
- the PCR amplified fragment and the pCDNA/Amp vector are digested with the appropriate restriction enzymes and the vector is dephosphorylated using the CIAP enzyme (New England Biolabs, Beverly, MA).
- the two restriction sites chosen are different so that the SLGP gene is inserted in the correct orientation.
- the ligation mixture is transformed into E. coli cells (strains HB101, DH5 ⁇ , SURE, available from Stratagene Cloning Systems, La Jolla, CA, can be used), the transformed culture is plated on ampicillin media plates, and resistant colonies are selected. Plasmid DNA is isolated from transformants and examined by restriction analysis for the presence ofthe correct fragment. COS cells are subsequently transfected with the SLGP-pcDNA/Amp plasmid
- DNA using the calcium phosphate or calcium chloride co-precipitation methods, DEAE- dextran-mediated transfection, lipofection, or electroporation.
- Other suitable methods for transfecting host cells can be found in Sambrook, J., Fritsh, E. F., and Maniatis, T. Molecular Cloning: A Laboratory Manual. 2nd, ed, Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989.
- the expression ofthe SLGP polypeptide is detected by radiolabelling (35 S -methionine or ⁇ S-cysteine available from NEN, Boston, MA, can be used) and immunoprecipitation (Harlow, E. and Lane, D.
- HA specific monoclonal antibody A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1988
- the cells are labeled for 8 hours with 35s-methionine (or 35s-cysteine).
- the culture media are then collected and the cells are lysed using detergents (RIP A buffer, 150 mM NaCl, 1% NP-40, 0.1% SDS, 0.5% DOC, 50 mM Tris, pH 7.5). Both the cell lysate and the culture media are precipitated with an HA-specific monoclonal antibody. Precipitated polypeptides are then analyzed by SDS-PAGE.
- DNA containing the SLGP coding sequence is cloned directly into the polylinker ofthe pCDN A/Amp vector using the appropriate restriction sites.
- the resulting plasmid is transfected into COS cells in the manner described above, and the expression ofthe SLGP polypeptide is detected by radiolabelling and immunoprecipitation using an SLGP-specific monoclonal antibody.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Immunology (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Zoology (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
The invention provides isolated nucleic acids molecules, designated SLGP nucleic acid molecules, which encode novel GPCR family members. The invention also provides antisense nucleic acid molecules, recombinant expression vectors containing SLGP nucleic acid molecules, host cells into which the expression vectors have been introduced, and nonhuman transgenic animals in which an SLGP gene has been introduced or disrupted. The invention still further provides isolated SLGP proteins, fusion proteins, antigenic peptides and anti-SLGP antibodies. Diagnostic methods utilizing compositions of the invention are also provided.
Description
t NOVEL SLGP PROTEIN AND NUCLEIC ACID MOLECULES
AND USES THEREFOR
Related Applications This application claims priority to U.S. Patent Application No.09/608,921, filed
June 30, 2000, the entire contents of which is incorporated herein by reference.
Background of the Invention
G-protein coupled receptors (GPCRs) are one ofthe major classes of proteins that are responsible for transducing a signal within a cell. GPCRs are proteins that have seven transmembrane domains. Upon binding of a ligand to an extracellular portion of a GPCR, a signal is transduced within the cell that results in a change in a biological or physiological property ofthe cell.
G protein-coupled receptors (GPCRs), along with G-proteins and effectors (intracellular enzymes and channels which are modulated by G-proteins), are the components of a modular signaling system that connects the state of intracellular second messengers to extracellular inputs. These genes and gene-products are potential causative agents of disease (Spiegel et al, J Clin. Invest. (1993) 92:1119-1125); McKusick and Amberger, (1993) J. Med. Genet. 30:1-26). Specific defects in the rhodopsin gene and the V2 vasopressin receptor gene have been shown to cause various forms of autosomal dominant and autosomal recessive retinitis pigmentosa (see Nathans et al, (1992) Annual Rev. Genet. 26:403-424), and nephrogenic diabetes insipidus (Holtzman et al. (1993) Hum. Mol. Genet. 2:1201-1204). These receptors are of critical importance to both the central nervous system and peripheral physiological processes. Evolutionary analyses suggest that the ancestor of these proteins originally developed in concert with complex body plans and nervous systems.
The GPCR protein superfamily now contains over 250 types of paralogues, receptors that represent variants generated by gene duplications or other processes (as opposed to orthologues, the same receptor from different species and homologues, different forms of a receptor isolated from a single organism). The superfamily can be broken down into five families: Family I, receptors typified by rhodopsin and the beta2- adrenergic receptor and currently represented by over 200 unique members (reviewed by
Dohlman et al, (1991) Annu. Rev. Biochem. 60:653-688); Family II, the recently characterized parathyroid hormone/calcitonin/secretin receptor family (Juppner et al. (1991) Science 254:1024-1026; Lin et al. (1991) Science 254:1022-1024); Family III, the metabotropic glutamate receptor family in mammals, including GAB A receptors (Nakanishi et al. (1992) Science 258: 597-603); Family IV, the cAMP receptor family, important in the chemotaxis and development of D. discoideum (Klein et al(1988) Science 241 :1467-1472); and Family V, the fungal mating pheromone receptors such as STE2 (reviewed by Kurjan l et al. (1992) Annu. Rev. Biochem. 61:1097-1129).
In addition to these groups of GPCRs, there are a small number of other proteins which present seven putative hydrophobic segments and appear to be unrelated to GPCRs; however, they have not been shown to couple to G-proteins. Drosophila express a photoreceptor-specific protein bride of sevenless (boss), a seven- transmembrane-segment protein which has been extensively studied and does not show evidence of being a GPCR (Hart et al. (1993) Proc. Natl. Acad. Sci. USA 90:5047- 5051 ). The gene frizzled (fz) in Drosophila is also thought to be a protein with seven transmembrane segments. Like boss, fz has not been shown to couple to G-proteins (Vinson et al, Nature 338:263-264 (1989)).
G proteins represent a family of heterotrimeric proteins composed of α, β and γ subunits, which bind guanine nucleotides. These proteins are usually linked to cell surface receptors, e.g., receptors containing seven transmembrane domains. Following ligand binding to the GPCR, a conformational change is transmitted to the G protein, which causes the α-subunit to exchange a bound GDP molecule for a GTP molecule and to dissociate from the βγ-subunits. The GTP-bound form ofthe α-subunit typically functions as an effector-modulating moiety, leading to the production of second messengers, such as cyclic AMP (e.g., by activation of adenylate cyclase), diacylglycerol or inositol phosphates. Greater than 20 different types of α-subunits are known in man, which associate with a smaller pool of β and γ subunits. Examples of mammalian G proteins include Gi, Go, Gq, Gs and Gt. G proteins are described extensively in Lodish H. et al. Molecular Cell Biology, (Scientific American Books Inc., New York, N.Y., 1995).
GPCRs are a major target for drug action and development. Accordingly, it is valuable to the field of pharmaceutical development to identify and characterize previously unknown GPCRs.
Summary of the Invention
The present invention is based, at least in part, on the discovery of novel G- protein coupled receptor (GPCR) family members, referred to herein as "SLGP" nucleic acid and protein molecules. The human SLGP molecules ofthe invention are also referred to herein as "1983" nucleic acid and protein molecules. The mouse SLGP molecules ofthe invention are also referred to herein as "12231" or "ml983" nucleic acid and protein molecules. Accordingly, in one aspect, this invention provides isolated nucleic acid molecules encoding SLGP proteins or biologically active portions thereof, as well as nucleic acid fragments suitable as primers or hybridization probes for the detection of SLGP-encoding nucleic acids. The present invention is also based at least in part, on the discovery that the
SLGP molecules ofthe present invention are involved in the modulation of angiogenesis in endothelial cells (e.g., tumor endothelial cells) and that, therefore, they are useful as targets and therapeutic agents for the modulation of endothelial cell (e.g., tumor endothelial cell) proliferation, growth, differentiation, or migration. The SLGP molecules ofthe present invention are also useful as targets and therapeutic agents for cellular proliferation, growth, differentiation, or migration disorders (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia).
In one embodiment, an SLGP nucleic acid molecule ofthe invention is at least 40%, 42%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or more identical to the nucleotide sequence (e.g., to the entire length ofthe nucleotide sequence) shown in SEQ ID NOT, SEQ ID NO:3, SEQ ID NO:17, SEQ ID NO:19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or a complement thereof.
In a preferred embodiment, the isolated nucleic acid molecule includes the nucleotide sequence shown SEQ ID NOT, SEQ ID NO:3, SEQ ID NO:17, SEQ ID NO: 19, or a complement thereof. In another embodiment, the nucleic acid molecule includes SEQ ID NO:3 and nucleotides 1-19 of SEQ ID NOT. In another embodiment, the nucleic acid molecule includes SEQ ID NO:3 and nucleotides 2090-2987 of SEQ ID NOT. In another embodiment, the nucleic acid molecule includes SEQ ID NO: 19 and nucleotides 1-69 of SEQ ID NO:17. In another embodiment, the nucleic acid molecule includes SEQ ID NO: 19 and nucleotides 2139-3952 of SEQ ID NO: 17. In another preferred embodiment, the nucleic acid molecule consists ofthe nucleotide sequence shown in SEQ ID NO: 1,3, 17, or 19. In another preferred embodiment, the nucleic acid molecule includes a fragment of at least 749 nucleotides ofthe nucleotide sequence of SEQ ID NOT, SEQ ID NO:3, or a complement thereof.
In another embodiment, an SLGP nucleic acid molecule includes a nucleotide sequence encoding a protein having an amino acid sequence sufficiently homologous to the amino acid sequence of SEQ ID NO:2, SEQ ID NOT 8, or an amino acid sequence encoded by the DNA insert ofthe plasmid deposited with ATCC as Accession Number . In a preferred embodiment, an SLGP nucleic acid molecule includes a nucleotide sequence encoding a protein having an amino acid sequence at least 28%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or more identical to the amino acid sequence of SEQ ID NO:2, SEQ ID NOT 8, or the amino acid sequence encoded by the DNA insert ofthe plasmid deposited with ATCC as
Accession Number .
In another preferred embodiment, an isolated nucleic acid molecule encodes the amino acid sequence of human SLGP. In another preferred embodiment, an isolated nucleic acid molecule encodes the amino acid sequence of mouse SLGP. In yet another preferred embodiment, the nucleic acid molecule includes a nucleotide sequence encoding a protein having the amino acid sequence of SEQ ID NO:2, SEQ DI NOT 8, or the amino acid sequence encoded by the DNA insert ofthe plasmid deposited with ATCC as Accession Number . In yet another preferred embodiment, the nucleic acid molecule is at least 3952 nucleotides in length. In a further preferred
embodiment, the nucleic acid molecule is at least 3952 nucleotides in length and encodes a protein having an SLGP activity (as described herein).
Another embodiment ofthe invention features nucleic acid molecules, preferably SLGP nucleic acid molecules, which specifically detect SLGP nucleic acid molecules relative to nucleic acid molecules encoding non-SLGP proteins. For example, in one embodiment, such a nucleic acid molecule is at least 1930, 1900-2000, 1700-2200, 1500-2400, 1300-2600, 1100-2800 or more nucleotides in length and hybridizes under stringent conditions to a nucleic acid molecule comprising the nucleotide sequence shown in SEQ ID NOT or SEQ ID NO: 17, the nucleotide sequence ofthe DNA insert of the plasmid deposited with ATCC as Accession Number , or a complement thereof. In preferred embodiments, the nucleic acid molecules are at least 15 (e.g., contiguous) nucleotides in length and hybridize under stringent conditions to nucleotides 1-569, 1058-1295, or 2044-2225 of SEQ ID NOT. In other preferred embodiments, the nucleic acid molecules comprise nucleotides 1-569, 1058-1295, or 2044-2225 of SEQ ID NOT.
In other preferred embodiments, the nucleic acid molecule encodes a naturally occurring allelic variant of a polypeptide comprising the amino acid sequence of SEQ ID NO:2, SEQ ID NOT8, or an amino acid sequence encoded by the DNA insert ofthe plasmid deposited with ATCC as Accession Number , wherein the nucleic acid molecule hybridizes to a nucleic acid molecule comprising SEQ ID NO:l, SEQ ID NO:3, SEQ ID, SEQ ID NOT7, or SEQ ID NOT9 under stringent conditions.
Another embodiment ofthe invention provides an isolated nucleic acid molecule which is antisense to an SLGP nucleic acid molecule, e.g., the coding strand of an SLGP nucleic acid molecule. Another aspect ofthe invention provides a vector comprising an SLGP nucleic acid molecule. In certain embodiments, the vector is a recombinant expression vector. In another embodiment, the invention provides a host cell containing a vector ofthe invention. The invention also provides a method for producing a protein, preferably an SLGP protein, by culturing in a suitable medium, a host cell, e.g., a mammalian host cell
such as a non-human mammalian cell, ofthe invention containing a recombinant expression vector, such that the protein is produced.
Another aspect of this invention features isolated or recombinant SLGP proteins and polypeptides. In one embodiment, an SLGP protein, includes at least one transmembrane domain. In a preferred embodiment, the isolated protein, preferably an SLGP protein includes seven transmembrane domains. In a preferred embodiment, an SLGP protein includes at least one transmembrane domain and has an amino acid sequence at least about 28%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%), 85%, 90%), 95%, 98% or more identical to the amino acid sequence of SEQ ID NO:2, SEQ ID NO: 18, or the amino acid sequence encoded by the DNA insert ofthe plasmid deposited with ATCC as Accession Number . In another preferred embodiment, the SLGP protein includes at least one transmembrane domain and plays a role in the mobilization of intracellular molecules that participate in a signal transduction pathway, e.g., phosphatidylinositol 4,5-bisphosphate (P1P2 inositol 1,4,5-triphosphate (IP3), or adenylate cyclase; the production or secretion of molecules; alteration in the structure of a cellular component; cell proliferation, e.g., synthesis of DNA; cell migration; cell differentiation; cell survival; or angiogenesis, e.g. proliferation, elongation, and migration of cells (e.g., endothelial cells) and formation of new vessels (e.g., endothelial tubes). In another preferred embodiment, an SLGP protein includes at least one transmembrane domain and plays a role in the modulation of angiogenesis (e.g., angiogenesis in tumors). In yet another preferred embodiment, the protein, preferably an SLGP protein, includes at least one transmembrane domain and is encoded by a nucleic acid molecule having a nucleotide sequence which hybridizes under stringent hybridization conditions to a nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 1 , SEQ ID NO:3, SEQ ID NO: 17, or SEQ ID NO: 19.
In another embodiment, the invention features fragments ofthe protein having the amino acid sequence of SEQ ID NO:2 or SEQ ID NO: 18, wherein the fragment comprises at least 15 amino acids (e.g., contiguous amino acids) ofthe amino acid sequence of SEQ ID NO:2, SEQ ID NO: 18, or an amino acid sequence encoded by the DNA insert ofthe plasmid deposited with the ATCC as Accession Number . In
another embodiment, the protein, preferably an SLGP protein, has the amino acid sequence of SEQ ID NO:2 or SEQ ID NO: 18.
In another embodiment, the invention features an isolated protein, preferably an SLGP protein, which is encoded by a nucleic acid molecule consisting of a nucleotide sequence at least about 40%, 42%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or more identical to a nucleotide sequence of SEQ ID NOT, SEQ ID NO:3, SEQ ID NOT 7, SEQ ID NOT9, or a complement thereof. This invention further features an isolated protein which is encoded by a nucleic acid molecule consisting of a nucleotide sequence which hybridizes under stringent hybridization conditions to a nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 1 , SEQ ID NO:3, SEQ ID NOT7, SEQ ID NO:19, or a complement thereof.
The proteins ofthe present invention or portions thereof, e.g., biologically active portions thereof, can be operatively linked to a non-SLGP polypeptide (e.g., heterologous amino acid sequences) to form fusion proteins. The invention further features antibodies, such as monoclonal or polyclonal antibodies, that specifically bind the SLGP proteins ofthe invention. In addition, the SLGP proteins or biologically active portions thereof can be incorporated into pharmaceutical compositions, which optionally include pharmaceutically acceptable carriers.
In another aspect, the present invention provides a method for detecting the presence of an SLGP nucleic acid molecule, protein or polypeptide in a biological sample by contacting the biological sample with an agent capable of detecting an SLGP nucleic acid molecule, protein or polypeptide such that the presence of an SLGP nucleic acid molecule, protein or polypeptide is detected in the biological sample.
In another aspect, the present invention provides a method for detecting the presence of SLGP activity in a biological sample by contacting the biological sample with an agent capable of detecting an indicator of SLGP activity such that the presence of SLGP activity is detected in the biological sample.
In another aspect, the invention provides a method for modulating SLGP activity comprising contacting a cell capable of expressing SLGP with an agent that modulates SLGP activity such that SLGP activity in the cell is modulated. In one embodiment, the
agent inhibits SLGP activity. In another embodiment, the agent stimulates SLGP activity. In one embodiment, the agent is an antibody that specifically binds to an SLGP protein. In another embodiment, the agent modulates expression of SLGP by modulating transcription of an SLGP gene or translation of an SLGP mRNA. In yet another embodiment, the agent is a nucleic acid molecule having a nucleotide sequence that is antisense to the coding strand of an SLGP mRNA or an SLGP gene.
In one embodiment, the methods ofthe present invention are used to treat a subject having a disorder characterized by aberrant SLGP protein or nucleic acid expression or activity by administering an agent which is an SLGP modulator to the subject. In one embodiment, the SLGP modulator is an SLGP protein. In another embodiment the SLGP modulator is an SLGP nucleic acid molecule. In yet another embodiment, the SLGP modulator is a peptide, peptidomimetic, or other small molecule. In a preferred embodiment, the disorder characterized by aberrant SLGP protein or nucleic acid expression is a proliferative disorder, e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia.
The present invention also provides a diagnostic assay for identifying the presence or absence of a genetic alteration characterized by at least one of (i) aberrant modification or mutation of a gene encoding an SLGP protein; (ii) mis-regulation ofthe gene; and (iii) aberrant post-translational modification of an SLGP protein, wherein a wild-type form ofthe gene encodes an protein with an SLGP activity.
In another aspect the invention provides a method for identifying a compound that binds to or modulates the activity of an SLGP protein, by providing an indicator composition comprising an SLGP protein having SLGP activity, contacting the indicator composition with a test compound, and determining the effect ofthe test compound on SLGP activity in the indicator composition to identify a compound that modulates the activity of an SLGP protein.
Other features and advantages ofthe invention will be apparent from the following detailed description and claims.
Brief Description of the Drawings
Figure 1 depicts the cDNA sequence of human SLGP (also referred to herein as 1983). The nucleotide sequence corresponds to nucleic acids 1 to 2987 of SEQ ID NOT. Figure 2 depicts the predicted amino acid sequence of human SLGP. The amino acid sequence corresponds to amino acids 1 to 690 of SEQ ID NO:2.
Figures 3 A and 3B depict the coding region ofthe cDNA sequence of human SLGP. The nucleotide sequence corresponds to amino acids 1 to 2070 of SEQ ID NO:3. Figures 4A and 4B depict an alignment ofthe amino acid sequences of human SLGP (SEQ ID NO:2) and human CD 97 (Accession No. U76764, SEQ ID NO: 15). This alignment were generated utilizing the ALIGN program with the following parameter setting: PAM120, gap penalties: -12/-4 (Myers, E. and Miller, W. (1988) "Optimal Alignments in Linear Space" CABIOS 4:11-17).
Figures 5A-5F depict an alignment ofthe nucleotide sequences of human SLGP (SEQ ID NO:2) and human CD 97 (Accession No. U76764, SEQ ID NO: 16). This alignment were generated utilizing the ALIGN program with the following parameter setting: PAM120, gap penalties: -12/-4 (Myers, E. and Miller, W. (1988) "Optimal Alignments in Linear Space" CABIOS 4:11-17).
Figures 6 A and 6B depict the cDNA sequence of mouse SLGP (also referred to herein as ml983 and 12231). The nucleotide sequence corresponds to nucleic acids 1 to 3,592 of SEQ ID NO.T 7.
Figure 7 depicts the predicted amino acid sequence of mouse SLGP. The amino acid sequence corresponds to amino acids 1 to 689 of SEQ ID NO: 18.
■Figures 8 A and 8B depict the coding region ofthe cDNA sequence of mouse SLGP. The nucleotide sequence corresponds to amino acids 1 to 2067 of SEQ ID NO:19.
Figure 9 is a graph depicting the results of a TaqMan™ analysis of expression of human SLGP (1983) cDNA in HMVEC. Human SLGP (1983) is up-regulated in tube forming HMVEC and proliferating HMVEC as compared to arresting HMVEC.
Figure 10 is a graph depicting human SLGP (1983) expression in HMVEC by transcripional profiling analysis. Human SLGP (1983) is up-regulated in proliferating HMVEC as compared to arresting HMVEC.
Figure 11 is a graph depicting TaqMan™ analysis of human SLGP (1983) expression in HMVEC. Human SLGP (1983) is up-regulated in proliferating HMVEC.
Figure 12 is a graph depicting mouse SLGP (12231 or ml983) expression in VEGF -induced angiogenic xenograft plugs and parental xenografts by transcriptional profiling. Mouse SLGP (12231 or ml983) expression is up-regulated in VEGF-induced angiogenic xenograft plugs. Figure 13 is a graph depicting TaqMan™ analysis of mouse SLGP (12231 or ml 983) expression in VEGF-induced angiogenic xenograft plugs and parental plugs. Mouse SLGP (12231 or ml983) expression is up-regulated in VEGF-induced angiogenic xenograft plugs.
Figure 14 is a graph depicting TaqMan™ analysis of human SLGP (1983) expression in glioblastomas and normal brains. Human SLGP (1983) expression is up- regulated in glioblastomas as compared to normal brains.
Detailed Description of the Invention
The present invention is based, at least in part, on the discovery of novel G- protein coupled receptor (GPCR) family members, referred to herein as SLGP protein and nucleic acid molecules. The human SLGP molecules are also referred to as "1983" molecules and the mouse SLGP molecules are also referred to as "12231 or "ml983" molecules. The present invention also provides methods and compositions for the diagnosis and treatment of cellular proliferation, growth, differentiation, or migration disorders (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia).
The present invention is also based, at least in part, on the discovery that the novel SLGP molecules ofthe present invention are upregulated in in vitro proliferating and tube forming Human Dermal Microvascular Endothelial Cells (HMVEC) (see Figures 9, 10, and 11), are expressed in endothelial cells of glioblastomas as compared
to normal brains (see Figure 14), and are upregulated in VEGF-induced angiogenic xenograft plugs as compared to parental xenografts (see Figures 12 and 13). Therefore, the SLGP molecules ofthe present invention modulate angiogenesis by endothelial cells ' (e.g., tumor endothelial cells). Accordingly, the SLGP molecules ofthe present invention are useful as targets for developing modulating agents to regulate a variety of cellular processes including angiogenesis (e.g., the proliferation, elongation, and migration of endothelial cells, such as endothelial cells in tumors). Angiogenesis is responsible for the formation of new vessels in tumor sites. The new vessels provide the oxygen and nutritional supply to tumors. Therefore, the SLGP modulators ofthe invention can modulate tumor formation and growth by modulating angiogenesis. For example, inhibition ofthe activity of an SLGP molecule can cause decreased angiogenesis, i.e., a decrease in cellular proliferation, elongation, and migration of endothelial cells and, thus, a decrease in the formation of new vessels, and a decrease in the supply of oxygen and nutrition to a tumor. Therefore, the SLGP modulators ofthe invention can be used to treat formation and growth of tumors, e.g., cancer, and other diseases characterized by excessive vessel formation such as arthritis and retinopathy. Additionally, increasing the activity of an SLGP molecule can cause increased angiogenesis and, therefore, increased vessel formation and can, thus, be used in treating diseases characterized by decreased vessel formation, e.g., tissue ischemia. Therefore, the SLGP molecules ofthe present invention are useful as targets and therapeutic agents for the modulation of diseases characterized by decreased angiogenesis, e.g., tissue ischemia, such as myocardial ischemia.
The SLGP protein is a GPCR that participates in signaling pathways within cells, e.g., signaling pathways involved in proliferation or differentiation. As used herein, a signaling pathway refers to the modulation (e.g., the stimulation or inhibition) of a cellular function/activity upon the binding of a ligand to the GPCR (SLGP protein). Examples of such functions include mobilization of intracellular molecules that participate in a signal transduction pathway, e.g., phosphatidylinositol 4,5-bisphosphate (PIP2), inositol 1,4,5-triphosphate (IP3) or adenylate cyclase; polarization ofthe plasma membrane; production or secretion of molecules; alteration in the structure of a cellular
component; cell proliferation, e.g., synthesis of DNA and angiogenesis, e.g., proliferation, elongation, and migration of endothelial cells (e.g., tumor endothelial cells) to form new vessels (e.g., endothelial tubes); cell differentiation; and cell survival. Regardless ofthe cellular activity modulated by SLGP, it is universal that as a GPCR, the SLGP protein interacts with a "G protein" to produce one or more secondary signals in a variety of intracellular signal transduction pathways, e.g., through phosphatidylinositol or cyclic AMP metabolism and turnover, in a cell. G proteins represent a family of heterotrimeric proteins composed of α, β and γ subunits, which bind guanine nucleotides. These proteins are usually linked to cell surface receptors, e.g., receptors containing seven transmembrane domains, such as the ligand receptors. Following ligand binding to the receptor, a conformational change is transmitted to the G protein, which causes the α-subunit to exchange a bound GDP molecule for a GTP molecule and to dissociate from the βγ-subunits. The GTP-bound form ofthe α-subunit typically functions as an effector-modulating moiety, leading to the production of second messengers, such as cyclic AMP (e.g., by activation of adenylate cyclase), diacylglycerol or inositol phosphates. Greater than 20 different types of α-subunits are known in man/which associate with a smaller pool of β and γ subunits. Examples of mammalian G proteins include Gi, Go, Gq, Gs and Gt. G proteins are described extensively in Lodish H. et al. Molecular Cell Biology, (Scientific American Books Inc., New York, N.Y., 1995), the contents of which are incorporated herein by reference. As used herein, the phrase "phosphatidylinositol turnover and metabolism" includes the molecules involved in the turnover and metabolism of phosphatidylinositol 4,5-bisphosphate (PIP2) as well as to the activities of these molecules. PIP2 is a phospholipid found in the cytosolic leaflet ofthe plasma membrane. Binding of a ligand to the SLGP activates, in some cells, the plasma-membrane enzyme phospholipase C that in turn can hydrolyze PIP2 to produce 1,2-diacylglycerol (DAG) and inositol 1,4,5- triphosphate (IP3). Once formed IP3 can diffuse to the endoplasmic reticulum surface where it can bind an IP3 receptor, e.g., a calcium channel protein containing an IP3 binding site. IP3 binding can induce opening ofthe channel, allowing calcium ions to be released into the cytoplasm. IP3 can also be phosphorylated by a specific kinase to
form inositol 1,3,4,5-tetraphosphate (IP4), a molecule which can cause calcium entry into the cytoplasm from the extracellular medium. IP3 and IP4 can subsequently be hydrolyzed very rapidly to the inactive products inositol 1,4-biphosphate (IP2) and inositol 1,3,4-triphosphate, respectively. These inactive products can be recycled by the cell to synthesize PIP2- The other second messenger produced by the hydrolysis of PIP2, namely 1 ,2-diacylglycerol (DAG), remains in the cell membrane where it can serve to activate the enzyme protein kinase C. Protein kinase C is usually found soluble in the cytoplasm ofthe cell, but upon an increase in the intracellular calcium concentration, this enzyme can move to the plasma membrane where it can be activated by DAG. The activation of protein kinase C in different cells results in various cellular responses such as the phosphorylation of glycogen synthase, or the phosphorylation of various transcription factors, e.g., NF-kB. The language "phosphatidylinositol activity", as used herein, includes an activity of PIP2 or one of its metabolites.
Another signaling pathway in which the SLGP protein may participate is the cAMP turnover pathway. As used herein, "cyclic AMP turnover and metabolism" includes molecules involved in the turnover and metabolism of cyclic AMP (cAMP) as well as to the activities of these molecules. Cyclic AMP is a second messenger produced in response to ligand induced stimulation of certain G protein coupled receptors. In the ligand signaling pathway, binding of ligand to a ligand receptor can lead to the activation ofthe enzyme adenylate cyclase, which catalyzes the synthesis of cAMP. The newly synthesized cAMP can in turn activate a cAMP-dependent protein kinase.
The SLGP molecules ofthe present invention are involved in modulation of cellular proliferation, growth, differentiation, or migration processes. As used herein, a "cellular proliferation, growth, differentiation, or migration process" includes a process by which a cell e.g., an endothelial cell, increases in number, size, or content; by which a cell develops a specialized set of characteristics which differ from that of other cells; or by which a cell moves closer to or further from a particular location or stimulus (e.g., angiogenesis). As used herein, "cellular proliferation, growth, differentiation, or migration disorders" include cancer, e.g., carcinoma, sarcoma, or leukemia; tumor angiogenesis and metastasis; and other diseases which are characterized by increased or
deceased angiogenesis, including, but not limited to arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia.
The activity ofthe SLGP proteins ofthe invention may also be implicated in cardiovascular disorders, congestive heart failure, or other cardiac cellular processes. As used herein, the term "cardiovascular disorder" includes a disease, disorder, or state involving the cardiovascular system, e.g., the heart, the blood vessels, and/or the blood. A cardiovascular disorder can be caused by an imbalance in arterial pressure, a malfunction ofthe heart, or an occlusion of a blood vessel, e.g., by a thrombus. Examples of such disorders include hypertension, atherosclerosis, coronary artery spasm, coronary artery disease, valvular disease, arrhythmias, cardiomyopathies (e.g., dilated cardiomyopathy, idiopathic cardiomyopathy), arteriosclerosis, ischemia reperfusion injury, restenosis, arterial inflammation, vascular wall remodeling, ventricular remodeling, rapid ventricular pacing, coronary microembolism, tachycardia, bradycardia, pressure overload, aortic bending, coronary artery ligation, vascular heart disease, atrial fibrilation, long-QT syndrome, congestive heart failure, sinus node disfunction, angina, heart failure, hypertension, atrial fibrillation, atrial flutter, myocardial infarction, cardiac hypertrophy, and coronary artery spasm.
As used herein, the term "congestive heart failure" includes a condition characterized by a diminished capacity ofthe heart to supply the oxygen demands ofthe body. Symptoms and signs of congestive heart failure include diminished blood flow to the various tissues ofthe body, accumulation of excess blood in the various organs, e.g., when the heart is unable to pump out the blood returned to it by the great veins, exertional dyspnea, fatigue, and/or peripheral edema, e.g., peripheral edema resulting from left ventricular dysfunction. Congestive heart failure may be- acute or chronic. The manifestation of congestive heart failure usually occurs secondary to a variety of cardiac or systemic disorders that share a temporal or permanent loss of cardiac function. Examples of such disorders include hypertension, coronary artery disease, valvular disease, and cardiomyopathies, e.g., hypertrophic, dilative, or restrictive cardiomyopathies. Congestive heart failure is described in, for example, Cohn J.N. et al
(1998) American Family Physician 57:1901-04, the contents of which are incorporated herein by reference.
As used herein, the term "cardiac cellular processes" includes intra-cellular or inter-cellular processes involved in the functioning ofthe heart. Cellular processes involved in the nutrition and maintenance ofthe heart, the development ofthe heart, or the ability ofthe heart to pump blood to the rest ofthe body are intended to be covered by this term. Such processes include, for example, cardiac muscle contraction, distribution and transmission of electrical impulses, and cellular processes involved in the opening and closing ofthe cardiac valves. The term "cardiac cellular processes" further includes processes such as the transcription, translation and post- translational modification of proteins involved in the functioning ofthe heart, e.g., myofilament specific proteins, such as troponin I, troponin T, myosin light chain 1 (MLC1), and α- actinin.
The novel SLGP molecules ofthe present invention comprise a family of molecules having certain conserved structural and functional features. The term "family" when referring to the protein and nucleic acid molecules ofthe invention is intended to mean two or more proteins or nucleic acid molecules having a common structural domain or motif and having sufficient amino acid or nucleotide sequence homology as defined herein. Such family members can be naturally or non-naturally occurring and can be from either the same or different species. For example, a family can contain a first protein of human origin, as well as other, distinct proteins of human origin or alternatively, can contain homologues of non-human origin. Members of a family may also have common functional characteristics.
For example, the family of G protein-coupled receptors (GPCRs), to which the SLGP proteins ofthe present invention bear significant homology, comprise an N- terminal domain, seven transmembrane domains (also referred to as membrane-spanning domains), six loop domains, and a C-terminal cytoplasmic domain (also referred to as a cytoplasmic tail). Members ofthe SLGP family also share certain conserved amino acid residues, some of which have been determined to be critical to receptor function and/or G protein signaling. For example, GPCRs usually contain the following features: a
conserved asparagine residue in the first transmembrane domain; a cysteine residue in the second loop which is believed to form a disulfide bond with a conserved cysteine residue in the fourth loop; a conserved leucine and aspartate residue in the second transmembrane domain; an aspartate-arginine-tyrosine motif (DRY motif) at the interface ofthe third transmembrane domain and the third loop of which the arginine residue is almost invariant (members ofthe rhodopsin subfamily of GPCRs comprise a histidine-arginine-methionine motif (HRM motif) as compared to a DRY motif); a conserved tryptophan and proline residue in the fourth transmembrane domain; and conserved phenylalanine and leucine residues in the seventh transmembrane domain. Table I depicts an alignment ofthe transmembrane domain of 5 GPCRs. The conserved residues described herein are indicated by asterices. An alignment ofthe transmembrane domains of 44 representative GPCRs can be found at http://mgdkkl.nidll.nih.gov:8000/extended.html.
TABLE I ALIGNMENT OF:
thrombin (6. ) human P25116 rhodopsin (19.) human P08100 mlAC (21.) rat P08482 IL-8A (30.) human P25024 octopamine (40.) Drosophila melanogaster P22270
TM1 6 . 102 TLFVPSVYTGVFWSLPLNIMAIWFILKMK 132
19 . 37 FSMLAAYMFLLIVLGFPINFLTLYVTVQHKK 67
21 . 25 VAFIGITTGLLSLATVTGNLLVLISFKVNTE 55
30 . 39 KYWIIAYALVFLLSLLGNSLVMLVILYSRV 69
40 . 109 ALLTALVLSVIIVLTIIGNILVILSVFTYKP 139
1111111111111111111111111111111 3333333344444444445555555555666 2345678901234567890123456789012 TM2
6. 138 WY LHLATADVLFVSVLPFKISYYFSG 165
19. 73 NYILLNLAVADLFMVLGGFTSTLYTSLH 100
21. 61 NYFLLSLACADLIIGTFSMNLYTTYLLM 88 30. 75 DVYLLNLALADLLFALTLPI AASKVNG 102
40. 145 NFFIVSLAVADLTVALLVLPFNVAYSIL 172
2222222222222222222222222222 4444444444555555555566666666 0123456789012345678901234567
TM3
6. 176 RFVTAAFYCNMYASILLMTVISIDR 200
19. Ill NLEGFFATLGGEIAL SLWLAIER 135 21. 99 DL LALDYVASNASVMNLLLISFDR 123
30. Ill KVVSLLKΞVNFYSGILLLACISVDR 135
40. 183 KLWLTCDVLCCTSSILNLCAIALDR 207
3333333333333333333333333 2222333333333344444444445
6789012345678901234567890
T 4
* * 6. 215 TLGRASFTCLAI ALAIAGWPLVLKE 241
19. 149 GΞNHAIMGVAFTWVMALACAAPPLAGW 175
21. 138 TPRRAALMIGLA LVSFVL APAILF 164
30. 149 KRHLVKFVCLGC GLSMNLSLPFFLFR 175
40. 222 TVGRVLLLISGVWLLSLLISSPPLIGW 248
444444444444444444444444444 334444444444555555555566666 890123456789012345678901234 TM5
6. 268 AYYFSAFSAVFFFVPLIISTVCYVSIIRC 296
19. 201 ESFVIYMFWHFTIPMIIIFFCYGQLVFT 229
21. 186 PIITFGTAMAAFYLPVTVMCTLY RIYRE 214 30. 200 MVLRILPHTFGFIVPLFVMLFCYGFTLRT 228
40. 267 RGYVIYSSLGSFFIPLAIMTIVYIΞIFVA 295
I
55555555555555555555555555555
33334444444444555555555566666 67890123456789012345678901234
TM6
* * *
6. 313 FLSAAVFCIFIICFGPTNVLLIAHYSFL 340 19. 252 RMVIIMVIAFLIC VPYASVAFYIFTHQ 279
21. 365 RTLSAILLAFILTWTPYNIMVLVSTFCK 397
30. 242 RVIFAWLIFLLC LPY LVLLADTLMR 269
40. 529 RTLGIIMGVFVIC LPFFLMYVILPFCQ 556 6666666666666666666666666666
3333344444444445555555556666 5678901234567890123456789012
TM7
** *
6. 347 EAAYFAYLLCVCVSSISSCIDPLIYYYASSECQ 379
19. 282 NFGPIFMTIPAFFAKSAAIYNPVIYIMMNKQFR 314 21. 394 CVPΞTL ELGY LCYVNSTVNPMCYALCNKAFR 426
30. 281 NNIGRALDATEILGFLHSCLNPIIYAFIGQNFR 313
40. 559 CPTNKFKNFITWLGYINSGLNPVIYTIFNLDYR 591
I 777777777777777777777777777777777 233333333334444444444555555555566
901234567890123456789012345678901
The amino acid sequences of thrombin (Accession No. P25116), rhodopsin (Accession No. P08100), mlACh (Accession No. P08482), IL-8A (Accession No. P25024), octopamine (Accession No. P22270), can be found as SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, respectively. Accordingly, GPCR-like proteins such as the SLGP proteins ofthe present invention contain a significant number of structural characteristics ofthe GPCR family. For instance, the SLGPs ofthe present invention contain conserved cysteines found in the first two loops (prior to the third and fifth transmembrane domains) of most GPCRs (cys490 and cys562 of SEQ ID NO:2). A highly conserved asparagine residue is present (asnl25 in SEQ ID NO:2). SLGP proteins contains a highly conserved leucine (leu 154 of SEQ ID NO:2). The two cysteine residues are believed to form a disulfide bond that stabilizes the functional protein structure. A highly conserved asparagine and arginine in the fourth transmembrane domain ofthe SLGP proteins is present (aspl 58 and arg218 of SEQ ID NO:2). Moreover, a highly conserved proline is present (pro307 of SEQ ID NO:2). Proline residues in the fourth, fifth, sixth, and seventh transmembrane domains are thought to introduce kinks in the alpha-helices and may be important in the formation of the ligand binding pocket. Moreover, a conserved tyrosine is present in the seventh transmembrane domain of SLGP-2 (tyr647 of SEQ ID NO :2) .
In one embodiment, the SLGP proteins ofthe present invention contain at least one, two, three, four, five, six, or preferably, seven transmembrane domains. As used herein, the term "transmembrane domain" includes an amino acid sequence of about 15- 40 amino acid residues in length, more preferably, about 15-30 amino acid residues in length, and most preferably about 18-25 amino acid residues in length, which spans the
plasma membrane. Transmembrane domains are rich in hydrophobic residues, and typically have an α-helical structure. In a preferred embodiment, at least 50%, 60%, 10%, 80%), 90%>, 95%) or more ofthe amino acids of a transmembrane domain are hydrophobic, e.g., leucines, isoleucines, tyrosines, or tryptophans. Transmembrane domains are described in, for example, Zagotta W.N. et al, (1996) Annual Rev.
Neuronsci. 19: 235-63, the contents of which are incorporated herein by reference. In a preferred embodiment, an SLGP protein ofthe present invention has more than one transmembrane domain, preferably 2, 3, 4, 5, 6, or 7 transmembrane domains. For example, transmembrane domains can be found at about amino acids 433-452, 465-481, 500-524, 533-553, 570-594, 619-635, and 642-666 of SEQ ID NO:2. In a particularly preferred embodiment, an SLGP protein ofthe present invention has 7 transmembrane domains.
In another embodiment, an SLGP is identified based on the presence of at least one Loop domain, also referred to herein as a 'loop'. As defined herein, the term "loop" includes an amino acid sequence having a length of at least about 4, preferably about 5- 10, preferably about 10-20, and more preferably about 20-30, 30-40, 40-50, 50-60, 60- 70, 70-80, 80-90, 90-100, or 100-150 amino acid residues, and has an amino acid sequence that connects two transmembrane domains within a protein or polypeptide. Such loop regions may be located either extracellularly or in the cytoplasm. Accordingly, the N-terminal amino acid of a loop is adjacent to a C-terminal amino acid of a transmembrane domain in a naturally-occurring SLGP or SLGP-like molecule, and the C-terminal amino acid of a loop is adjacent to an N-terminal amino acid of a transmembrane domain in a naturally-occurring SLGP or SLGP-like molecule.
As used herein, a "cytoplasmic loop" includes an amino acid sequence located within a cell or. within the cytoplasm of a cell. Also as used herein, an "extracellular loop" includes an amino acid sequence located outside of a cell, or extracellularly. For example, loop domains can be found at about amino acid residues 453-464, 482- 499,525-532, 554-569, 595-618, and 636-641 of SEQ ID NO:2.
In another embodiment ofthe invention, an SLGP is identified based on the presence of a "C-terminal domain", also referred to herein as a C-terminal tail, in the sequence ofthe protein. As used herein, a "C-terminal domain" includes an amino acid sequence having a length of at least about 10, preferably about 10-25, more preferably about 25-50, more preferably about 50-75, even more preferably about 75-100, 100-150, 150-200, 200-250, 250-300, 300-400, 400-500, or 500-600 amino acid residues and is located within a cell or extracellularly. Accordingly, the N-terminal amino acid residue of a "C-terminal domain" is adjacent to a C-terminal amino acid residue of a transmembrane domain in a naturally-occurring SLGP or SLGP-like protein. For example, a C-terminal domain is found at about amino acid residues 667-690 of SEQ ID NO:2.
In another embodiment, an SLGP is identified based on the presence of an "N- terminal domain", also referred to herein as an N-terminal loop in the amino acid sequence ofthe protein. As used herein, an "N-terminal domain" includes an amino acid sequence having about 1-500, preferably about 1-400, more preferably about 1-300, more preferably about 1-200, even more preferably about 1-100, and even more preferably about 1-50, "1-25, or 1-10 amino acid residues in length and is located outside of a cell orintracellularly. The C-terminal amino acid residue of a "N-terminal domain" is adjacent to an N-teπninal amino acid residue of a transmembrane domain in a naturally-occurring SLGP or SLGP-like protein. For example, an N-terminal domain is found at about amino acid residues 1-432 of SEQ ID NO:2.
Accordingly in one embodiment ofthe invention, an SLGP includes at least one, preferably 6 or 7, transmembrane domains and and/or at least one loop. In another embodiment, the SLGP further includes an N-terminal domain and/or a C-terminal domain. In another embodiment, the SLGP can include six transmembrane domains, three cytoplasmic loops, and two extracellular loops, or can include six transmembrane domains, three extracellular loops, and 2 cytoplasmic loops. The former embodiment can further include an N-terminal domain. The latter embodiment can further include a C-terminal domain. In another embodiment, the SLGP can include seven
transmembrane domains, three cytoplasmic loops, and three extracellular loops and can further include an N-terminal domain or a C-terminal domain.
In another embodiment, an SLGP is identified based on the presence of at least one "7 transmembrane receptor profile", also referred to as a "Secretin family sequence profile", in the protein or corresponding nucleic acid molecule. As used herein, the term "7 transmembrane receptor profile" includes an amino acid sequence having at least about 50-350, preferably about 100-300, more preferably about 150-275 amino acid residues, or at least about 200-258 amino acids in length and having a bit score for the alignment ofthe sequence to the 7tm_l family Hidden Markov Model (HMM) of at least 20, preferably 20-30, more preferably 30-40, more preferably 40-50, or 50-75 or greater. The 7tm_l family HMM has been assigned the PFAM Accession PF00001 (http://pfam/wustl.edu/).
To identify the presence of a 7 transmembrane receptor profile in an SLGP, the amino acid sequence ofthe protein is searched against a database of HMMs (e.g., the Pfam database, release 2.1) using the default parameters
(http://www.sanger.ac.uk/Software/Pfam/HMM_search). For example, the hmmsf program, which is available as part ofthe HMMER package of search programs, is a family specific default program for PF00001 and a score of 15 is the default threshold score for determining a hit. For example, a search using the amino acid sequence of SEQ ID NO:2 was performed against the HMM database resulting in the identification of a 7 TM receptor profile in the amino acid sequence of SEQ ID NO:2. The results of the search are set forth below.
Score: 56.37 . Seq: 421 678 Model: 75 348 *ksYYyvvYiIYTVGYSMSiaaLlvAMfIFcfFRrLHCtRNYIHMNMFms
+++Y+++ I +G +S++ L + +F F FF + TR +IH+N+ S SLGP 421 IKDYNILTRITQLGIIISLICLAICIFTFWFFSEIQSTRTTIHKNLCCS 469 FILRa sWFIkDWvlyWmYsndeltwHCwMsivwCRivMfFMQYMMMtNY
L A +F++ +N +C I +Y+ ++ +
SLGP 470 LFL-AELVFLVGINT NTNKL FCSIIAGLLHYFFLAAF
505 FWMLvEGvYLHTLIv tFFsERqYF YyllGWGfPlVFiti vItRcyY
WM +EG+ L+ +V + + +Y++G +P+V ++ + + Y
SLGP 506 AWMCIEGIHLYLIVVGVIYNKGFLHKNFYIFGYLSPAVVVGFSAALGYRY 555
ENt ..nCWDmNDnMwyWWIIrgPIMlsIvVNFFFFINIIRILMtKLRepq + T C ++++N ++ +GP L 1+ N++ F 11+ + +
SLGP 556 YGTTKVC LSTEN-NFI SFIGPACLIILGNLLAFGVIIYKVFRHTAGLK 604
MgEndMqqY RlvKSTLlLIPLFGIHYMVFaWrPdNhwlwqlYMYFElsl + + + L L+ + +F + +++ Y+ +
SLGP 605 PEVSCF—ENIRSCARGALALLLLGTT IFGGLHVV-HASVVTAYLFTVS 651 iSFQGFFVAiIYCFcNhEVQmEIRRrW* + FQG+F + C + + Q+E R
SLGP 652 NAFQGMFIFLFLCVLSRKIQEEYYRLF 678
Accordingly, in one embodiment ofthe invention, an SLGP protein is a human SLGP protein having a 7 transmembrane receptor profile at about amino acids 421-678 of SEQ ID O:2. Such a 7 transmembrane receptor profile has the amino acid sequence:
IKDYNILTRITQLGIIISLICLAICIFTF FFSEIQSTRTTIHKNLCCSLFLAE LVFLVGINTNTNKLFCSIIAGLLHYFFLAAFAMCIEGIHLYLIVVGVIYNKGF LHKNFYIFGYLSPAVVVGFSAALGYRYYGTTKVCWLSTENNFI SFIGPACLII LGNLLAFGVIIYKVFRHTAGLKPEVSCFENIRSCARGALALLLLGTT IFGGLH WHASVVTAYLFTVSNAFQGMFIFLFLCVLSRKIQEEYYRLF(SEQ ID NO: 9)
Accordingly, SLGP proteins having at least 20-30%, 30-49%, 40-50%, 50-60% homology, preferably about 60-70%>, more preferably about 70-80%, or about 80-90% homology with the 7 transmembrane receptor profile of human SLGP (e.g., SEQ ID NO:2) are within the scope ofthe invention.
In another embodiment, an SLGP is identified based on the presence of a "EGF- like domain" in the protein or corresponding nucleic acid molecule. As used herein, the term "EGF-like domain" includes a protein domain having an amino acid sequence of about 55-90, preferably about 60-85, more preferably about 65-80 amino acid residues, or about 70-79 amino acids and having a bit score for the alignment ofthe sequence to the EGF-like domain (HMM) of at least 6, preferably 7-10, more preferably 10-30, more preferably 30-50, even more preferably 50-75, 75-100, 100-200 or greater. The EGF- like domain HMM has been assigned the PFAM Accession PF00008
(http://pfam.wustl.edu ). Preferably, one or more cysteine residues in the EGF-like
domain are conserved among SLGP family members or other proteins containing EGF- like domains (i.e., located in the same or similar position as the cysteine residues in other SLGP family members or other proteins containing EGF-like domains). In a preferred embodiment, an "EGF-like domain" has the consensus sequence X(4)-C- X(0,48)-C-X(3,12)-C-X(l,70)-C-X(l,6)-C-X(2)-G-a-X(0,21)-G-X(2)-C-X, (where C = conserved cysteine involved in a disulfide bond, G = often conserved glycine, a = often conserved aromatic acid, X = any residue); corresponding to SEQ ID NO TO. In another preferred embodiment, an "EGF-like domain" has the consensus sequence C-X-C-X(5)- G-X(2)-C, the 3 C's are involved in disulfide bonds; corresponding to SEQ ID NOT 1. In another preferred embodiment, an "EGF-like domain" has the consensus sequence C- X-C-X(2)-[GP]-[FYW]-X(4,8)-C, the three C's are involved in disulfide bonds; corresponding to SEQ ID NO: 12.
To identify the presence of an EGF-like domain in an SLGP protein, make the determination that a protein of interest has a particular profile, the amino acid sequence ofthe protein is searched against a database of HMMs (e.g., the Pfam database, release 2.1) using the default parameters
(http://www.sanger.ac.uk/Software/Pfam/HMM_search). For example, the hmmsf program, which is available as part ofthe HMMER package of search programs, is a family specific default program for PF00008 and a score of 15 is the default threshold score for determining a hit. Alternatively, the threshold score for detemiining a hit can be lowered (e.g., to 8 bits). A description ofthe Pfam database can be found in Sonhammer et al. (1997) Proteins 28(3)405-420 and a detailed description of HMMs can be found, for example, in Gribskov et α/.(1990) Meth. Enzymol 183:146-159; ■ Gribskov et α/.(1987) Proc. Natl. Acad. Sci. USA 84:4355-4358; Krogh et /.(1994) J Mol. Biol. 235:1501-1531; and Stultz et al(1993) Protein Sci. 2:305-314, the contents of which are incorporated herein by reference. A search was performed against the HMM database resulting in the identification of an EGF-like domain in the amino acid sequence of SEQ ID NO:2. The results ofthe search, indicating that such a domain is found at residues 22 through 100 of SEQ ID NO: 2, are set forth below.
Score: 6.16 Seq: 22 53 Model: 1 34
*CnpNPCmNgGtCvNtp.mYtCiCpeGYmyYtGrrC* C+ +PC+ +++C+ C C +G ++G SLGP 22 CTKTPCLPNAKCEIRNGIEACYCNMG FSGNGV 53
Score: 18.87 Seq: 62 100 Model: 1 34
*CnpN .. PCmNgGtCvNtp .mYtCiCpeGYm. y. YtGrrC* C ++ C +++ C+NT+ +Y+C C +G++ + + R+ SLGP 62 CGNLTQSCGENANCTNTEGSYYCMCVPGFRSSSNQDRFI 100
All amino acids are described using universal single letter abbreviations according to these motifs. Such an EGF-like domain has the following amino acid sequence:
CTKTPCLPNAKCEIRNGIEACYCNMGFSGNGV
CGNLTQSCGENANCTNTEGSYYCMCVPGFRSSSNQDRFI (SEQ ID NO: 13).
Accordingly, SLGP proteins having at least 50-60%> homology, preferably about 60- 70%), more preferably about 70-80%, or about 80-90%) homology with an EGF-like domain of human SLGP (e.g., SEQ ID NO.T3) are within the scope ofthe invention. In another embodiment, an SLGP is identified based on the presence of a "NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain" in the protein or corresponding nucleic acid molecule. As used herein, the term "NADH- ubiquinone/plastoquinone oxidoreductase chain 4L domain" includes a protein domain having an amino acid sequence of about 25-55, preferably about 30-50, more preferably about 35-45 amino acid residues, or about 40-43 amino acids and having a bit score for the alignment ofthe sequence to the NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain (HMM) of at least 6, preferably 7-10, more preferably 10-30, more preferably 30-50, even more preferably 50-75, 75-100, 100-200 or greater. The NADH- ubiquinone/plastoquinone oxidoreductase chain 4L domain HMM has been assigned the PFAM Accession PF00420 (http://pfam.wustl.edu/).
To identify the presence of a NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain in an SLGP protein, make the determination that a protein of interest has a particular profile, the amino acid sequence ofthe protein is searched against a database of HMMs (e.g., the Pfam database, release 2.1) using the default parameters (http://www.sanger.ac.uk/Software/Pfam HMM_search). For example, the hmmsf
program, which is available as part ofthe HMMER package of search programs, is a family specific default program for PF00420 and a score of 15 is the default threshold score for determining a hit. Alternatively, the threshold score for determining a hit can be lowered (e.g., to 8 bits). A description ofthe Pfam database can be found in Sonhammer et al (1997) Proteins 28(3)405-420 and a detailed description of HMMs can be found, for example, in Gribskov et α/.(1990) Meth. Enzymol 183:146-159; Gribskov et αZ. (1987) Proc. Natl. Acad. Sci. USA 84:4355-4358; Krogh et α/.(1994) J. Mol. Biol. 235:1501-1531; and Stultz et /.(1993) Protein Sci. 2:305-314, the contents of which are incorporated herein by reference. A search was performed against the HMM database resulting in the identification of a NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain in the amino acid sequence of SEQ ID NO:2. The results ofthe search, indicating that such a domain is found at residues 475 through 517 of SEQ ID NO:2, are set forth below.
Score: 6.77 Seq: 475 517 Model: 1 43
*MMMMthYHFiIMIaFmmGIMGIlMNRsHmMSMLMCLEmMMLSl* ++ + ++ +F+ I G+L + ++ MC+E++ L L SLGP 475 LVFLVGINTNTNKLFCSIIAGLLHYFFLAAFAWMCIEGIHLYL 517
All amino acids are described using universal single letter abbreviations according to these motifs.
Such a NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain has the amino acid sequence:
LVFLVGINTNTNKLFCSIIAGLLHYFFLAAFA MCIEGIHLYL ( SEQ ID NO : 14 ) .
Accordingly, SLGP proteins having at least 50-60% homology, preferably about 60- 70%, more preferably about 70-80%, or about 80-90% homology with a NADH- ubiquinone/plastoquinone oxidoreductase chain 4L domain of human SLGP (e.g., SEQ ID NO:14) are within the scope of the invention.
In another embodiment, an SLGP protein includes at least an EGF-like domain. In another embodiment, an SLGP protein includes at least an NADH- ubiquinone/plastoquinone oxidoreductase chain 4L domain. In another embodiment, an SLGP protein includes at least a 7 transmembrane receptor profile. In another embodiment,
an SLGP protein includes an EGF-like domain, and an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain. In another embodiment, an SLGP protein includes an EGF-like domain and a 7 transmembrane receptor profile. In another embodiment, an SLGP protein includes an EGF-like domain, and an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain, and a 7 transmembrane receptor profile. In another embodiment, an SLGP protein includes an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain and a 7 transmembrane receptor profile. In another embodiment, an SLGP protein is human SLGP which includes an EGF-like domain having about amino acids 22-100 of SEQ ID NO:2. In another embodiment, an SLGP protein is human SLGP which includes an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain having about amino acids 475-517 of SEQ ID NO:2. In another embodiment, an SLGP protein is human SLGP which includes a 7 transmembrane receptor profile having about amino acids 421-678 of SEQ ID NO:2.
In yet another embodiment, an SLGP protein is human SLGP which includes a an EGF-like domain having about amino acids 22- 100 of SEQ ID NO:2, an NADH- ubiquinone/plastoquinone oxidoreductase chain 4L domain having about amino acids 475- 517 of SEQ ID NO:2, and a 7 transmembrane receptor profile having about amino acids 421-678 of SEQ ID NO:2.
Preferred SLGP molecules ofthe present invention have an amino acid sequence sufficiently homologous to the amino acid sequence of SEQ ID NO:2 or SEQ ID NO: 18. As used herein, the term "sufficiently homologous" refers to a first amino acid or nucleotide sequence which contains a sufficient or minimum number of identical or equivalent (e.g., an amino acid residue which has a similar side chain) amino acid residues or nucleotides to a second amino acid or nucleotide sequence such that the first and second • amino acid or nucleotide sequences share common structural domains and/or a common functional activity. For example, amino acid or nucleotide sequences which share common structural domains have at least about 50%> homology, preferably 60%) homology, more preferably 70%-80%, and even more preferably 90-95%> homology across the amino acid sequences ofthe domains and contain at least one and preferably two structural domains, are defined herein as sufficiently homologous. Furthermore, amino acid or nucleotide
sequences which share at least 50%, preferably 60%, more preferably 70-80, or 90-95% homology and share a common functional activity are defined herein as sufficiently homologous.
As used interchangeably herein, an "SLGP activity", "biological activity of SLGP" o. "functional activity of SLGP", refers to an activity exerted by an SLGP protein, polypeptide or nucleic acid molecule on an SLGP responsive cell as determined in vivo, or in vitro, according to standard techniques. In one embodiment, an SLGP activity is a direct activity, such as an association with a SLGP-target molecule. As used herein, a "target molecule" or "binding partner" is a molecule with which an SLGP protein binds or interacts in nature, sucl that SLGP-mediated function is achieved. An SLGP target molecule can be a non-SLGP molecule or an SLGP protein or polypeptide ofthe present invention. In an exemplary embodiment, an SLGP target molecule is an SLGP ligand. Alternatively, an SLGP activity i an indirect activity, such as a cellular signaling activity mediated by interaction ofthe SLGP protein with an SLGP ligand. In a preferred embodiment, an SLGP activity is at least one or more ofthe following activities: (i) interaction of an SLGP protein with soluble SLGP ligand (e.g., CD55); (ii) interaction of an SLGP protein with a membrane-bound non-SLGP protein; (iii) interaction of an SLGP protein with an intracellular protein (e.g., an intracellular enzyme or signal transduction molecule); (iv) indirect interaction of an SLGP protein with an intracellular protein (e.g., a downstream signal transduction molecule); and (v) modulation of cellular proliferation, growth, differentiation, or migration. In yet another preferred embodiment, an SLGP activity is at least one or more ofthe following activities: (1) modulation of cellular signal transduction, either in vitro or in vivo; (2) regulation of activation in a cell expressing an SLGP protein exposure to alpha- latrotoxin); (3) regulation of inflammation; or (4) modulation of angiogenesis (e.g., proliferation, elongation, and migration of endothelial cells (e.g. tumor endothelial cells), to form new vessels).
Accordingly, another embodiment ofthe invention features isolated SLGP proteins and polypeptides having an SLGP activity. Preferred SLGP proteins have at least one transmembrane domain and an SLGP activity. In a preferred embodiment, an
SLGP protein has a 7 transmembrane receptor profile and an SLGP activity. In another preferred embodiment, an SLGP protein has an EGF-like domain and an SLGP activity. In another preferred embodiment, an SLGP protein has an NADH- ubiquinone/plastoquinone oxidoreductase chain 4L domain and an SLGP activity. In still another preferred embodiment, an SLGP protein has a 7 transmembrane receptor profile, an EGF-like domain, and SLGP activity. In still another preferred embodiment, an SLGP protein has a 7 transmembrane receptor profile, an EGF-like domain, and an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain and an SLGP activity. In still another preferred embodiment, an SLGP protein has a 7 transmembrane receptor profile and an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain and an SLGP activity. In still another preferred embodiment, an SLGP protein has an EGF-like domain and an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain and an SLGP activity. In still another preferred embodiment, an SLGP protein has a 7 transmembrane receptor profile, an EGF-like domain, an SLGP activity, and an amino acid sequence sufficiently homologous to an amino acid sequence of SEQ ID NO:2 or SEQ ID NO: 18.
The nucleotide sequence ofthe isolated human SLGP cDNA and the predicted amino acid sequence ofthe human SLGP polypeptide are shown in Figure 1 and in SEQ ID NOs.T and 2, respectively. ' The human SLGP cDNA, which is approximately 2987 nucleotides in length, encodes a protein which is approximately 690 amino acid residues in length.
The nucleotide sequence ofthe isolated mouse SLGP cDNA and the predicted amino acid sequence ofthe mouse SLGP polypeptide are shown in Figures 6A-B and 7 and in SEQ ID NOs:17 and 18, respectively. The mouse SLGP cDNA, which is approximately 3952 nucleotides in length, encodes a protein which is approximately 689 amino acid residues in length.
Plasmids containing the nucleotide sequence encoding human and mouse SLGP were deposited with the American Type Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA 20110-2209, on __ and assigned Accession Numbers and . This deposit will be maintained under the terms ofthe Budapest
Treaty on the International Recognition ofthe Deposit of Microorganisms for the Purposes of Patent Procedure. These deposits were made merely as a convenience for those of skill in the art and is not an admission that a deposit is required under 35 U.S.C. §112. In accordance with 37 CFR 1.808(a), access to the deposits will be available during pendancy ofthe instant application to one determined by the Commission to be entitled thereto under §1.14 and 35 USC §122. The deposits will irrevocably and without restriction or condition be released to the public upon grant of a patent on this application.
Various aspects ofthe invention are described in further detail in the following subsections:
I. Isolated Nucleic Acid Molecules
One aspect ofthe invention pertains to isolated nucleic acid molecules that encode SLGP proteins or biologically active portions thereof, as well as nucleic acid fragments sufficient for use as hybridization probes to identify SLGP-encoding nucleic acids (e.g., SLGP mRNA) and fragments for use as PCR primers for the amplification or mutation of SLGP nucleic acid molecules. As used herein, the term "nucleic acid molecule" is intended to include DNA molecules (e.g., cDNA or genomic DNA) and RNA molecules (e.g., mRNA) and analogs ofthe DNA or RNA generated using nucleotide analogs. The nucleic acid molecule can be single-stranded or double- stranded, but preferably is double-stranded DNA.
An "isolated" nucleic acid molecule is one which is separated from chromosomal DNA, e.g., other nucleic acid molecules which are present in the natural source ofthe nucleic acid. Preferably, an "isolated" nucleic acid is free of sequences which naturally flank the nucleic acid (i.e., sequences located at the 5' and 3' ends ofthe nucleic acid) in the genomic DNA ofthe organism from which the nucleic acid is derived. For example, in various embodiments, the isolated SLGP nucleic acid molecule can contain less than about 5 kb, 4kb, 3kb, 2kb, 1 kb, 0.5 kb or 0.1 kb of nucleotide sequences which naturally flank the nucleic acid molecule in genomic DNA ofthe cell from which the nucleic acid
is derived. Moreover, an "isolated" nucleic acid molecule, such as a cDNA molecule, can be substantially free of other cellular material, or culture medium when produced by recombinant techniques, or substantially free of chemical precursors or other chemicals when chemically synthesized. A nucleic acid molecule ofthe present invention, e.g., a nucleic acid molecule having the nucleotide sequence of SEQ ID NOT or SEQ ID NO: 17, the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or a portion thereof, can be isolated using standard molecular biology techniques and the sequence information provided herein. Using all or portion ofthe nucleic acid sequence of SEQ ID NOT, SEQ ID NO: 17, the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with
ATCC as Accession Number as a hybridization probe, SLGP nucleic acid molecules can be isolated using standard hybridization and cloning techniques (e.g., as described in Sambrook, J., Fritsh, E. F., and Maniatis, T. Molecular Cloning: A Laboratory Manual. 2nd, ed, Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989).
Moreover, a nucleic acid molecule encompassing all or a portion of SEQ ID NO : 1 , SEQ ID NO : 17, the nucleotide sequence of the DNA insert of the plasmid deposited with ATCC as Accession Number , or the nucleotide sequence ofthe
DNA insert ofthe plasmid deposited with ATCC as Accession Number can be isolated by the polymerase chain reaction (PCR) using synthetic oligonucleotide primers designed based upon the sequence of SEQ ID NOT, SEQ ID NOT 7, the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with
ATCC as Accession Number .
A nucleic acid ofthe invention can be amplified using cDNA, mRNA or alternatively, genomic DNA, as a template and appropriate oligonucleotide primers according to standard PCR amplification techniques. The nucleic acid so amplified can
be cloned into an appropriate vector and characterized by DNA sequence analysis. Furthermore, oligonucleotides corresponding to SLGP nucleotide sequences can be prepared by standard synthetic techniques, e.g., using an automated DNA synthesizer. In a preferred embodiment, an isolated nucleic acid molecule ofthe invention comprises the nucleotide sequence shown in SEQ ID NO: 1 or SEQ ID NO: 17. The sequence of SEQ ID NO corresponds to the human SLGP cDNA. This cDNA comprises sequences encoding the human SLGP protein (i.e., "the coding region", from nucleotides 19-2090, as well as 5' untranslated sequences (nucleotides 1-19), and 3' untranslated sequences (nucleotides 2090-2987). Alternatively, the nucleic acid molecule can comprise only the coding region of SEQ ID NOT (e.g., nucleotides 19- 2090, corresponding to SEQ ID NO:3. The sequence of SEQ ID NO: 17 corresponds to the mouse SLGP cDNA. This cDNA comprises sequences encoding the mouse SLGP protein (i.e., "the coding region", from nucleotides 70-2139, as well as 5' untranslated sequences (nucleotides 1-69), and 3' untranslated sequences (nucleotides 2140-3952). Alternatively, the nucleic acid molecule can comprise only the coding region of SEQ ID NO.T7 (e.g., nucleotides 70-2139, corresponding to SEQ ID NO.T9).
In another preferred embodiment, an isolated nucleic acid molecule ofthe invention comprises a nucleic acid molecule which is a complement ofthe nucleotide sequence shown in SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as
Accession Number , or a portion of any of these nucleotide sequences. A nucleic acid molecule which is complementary to the nucleotide sequence shown in SEQ ID NOT, SEQ ID NO:3, SEQ ID NOT7, SEQ ID NOT9, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , is one which is sufficiently complementary to the nucleotide sequence shown in SEQ ID NO , SEQ ID NO:3, SEQ ID NOT7, SEQ ID NOT9, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , such that it can hybridize to the nucleotide sequence shown in SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , thereby forming a stable duplex.
In still another preferred embodiment, an isolated nucleic acid molecule ofthe present invention comprises a nucleotide sequence which is at least about 40%, 42%), 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or more homologous to the entire length ofthe nucleotide sequence shown in SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or the entire length ofthe nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or a portion of any of these nucleotide sequences.
Moreover, the nucleic acid molecule ofthe invention can comprise only a portion ofthe nucleic acid sequence of SEQ ID NOT, SEQ ID NO:3, SEQ ID NO:17, SEQ ID NO: 19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with
ATCC as Accession Number , for example, a fragment which can be used as a probe or primer or a fragment encoding a biologically active portion of an SLGP protein. The nucleotide sequence determined from the cloning ofthe SLGP gene allows for the generation of probes and primers designed for use in identifying and/or cloning other SLGP family members, as well as SLGP homologues from other species. The probe/primer typically comprises substantially purified oligonucleotide. The oligonucleotide typically comprises a region of nucleotide sequence that hybridizes under stringent conditions to at least about 12 or 15, preferably about 20 or 25, more preferably about 30, 35, 40, 45, 50, 55, 60, 65, or 75 consecutive nucleotides of a sense sequence of SEQ ID NOT, SEQ ID NO:3, SEQ ID NOT7, SEQ ID NOT9, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as
Accession Number , of an anti-sense sequence of SEQ ID NO: 1 , SEQ ID NO:3,
SEQ ID NO: 17, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or of a naturally occurring allelic variant or mutant of SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as
Accession Number . In an exemplary embodiment, a nucleic acid molecule ofthe present invention comprises a nucleotide sequence which is greater than 749, or more nucleotides in length and hybridizes under stringent hybridization conditions to a nucleic acid molecule of SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or the
nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as
Accession Number .
Probes based on the SLGP nucleotide sequences can be used to detect transcripts or genomic sequences encoding the same or homologous proteins. In preferred embodiments, the probe further comprises a label group attached thereto, e.g., the label group can be a radioisotope, a fluorescent compound, an enzyme, or an enzyme co- factor. Such probes can be used as a part of a diagnostic test kit for identifying cells or tissue which misexpress an SLGP protein, such as by measuring a level of an SLGP- encoding nucleic acid in a sample of cells from a subject e.g., detecting SLGP mRNA levels or determining whether a genomic SLGP gene has been mutated or deleted. A nucleic acid fragment encoding a "biologically active portion of an SLGP protein" can be prepared by isolating a portion ofthe nucleotide sequence of SEQ ID NOT, SEQ ID NO: 17, the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , which encodes a polypeptide having an SLGP biological activity (the biological activities of the SLGP proteins have previously been described), expressing the encoded portion of the SLGP protein (e.g., by recombinant expression in vitro) and assessing the activity of the encoded portion ofthe SLGP protein. The invention further encompasses nucleic acid molecules that differ from the nucleotide sequence shown in SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with
ATCC as Accession Number , due to degeneracy ofthe genetic code and thus encode the same- SLGP proteins as those encoded by the nucleotide sequence shown in SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number . In another embodiment, an isolated nucleic acid molecule ofthe invention has a nucleotide sequence encoding a protein having an amino acid sequence shown in SEQ ID NO:2 or SEQ ID NO: 18.
In addition to the SLGP nucleotide sequences shown in SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NOT9, or the nucleotide sequence ofthe DNA insert of the plasmid deposited with ATCC as Accession Number , it will be appreciated by those skilled in the art that DNA sequence polymorphisms that lead to changes in the amino acid sequences ofthe SLGP proteins may exist within a population (e.g., the human population). Such genetic polymorphism in the SLGP genes may exist among individuals within a population due to natural allelic variation. As used herein, the terms "gene" and "recombinant gene" refer to nucleic acid molecules isolated from chromosomal DNA, which include an open reading frame encoding an SLGP protein, preferably a mammalian SLGP protein. A gene includes coding DNA sequences, non- coding regulatory sequences, and introns. As used herein, a gene refers to an isolated nucleic acid molecule, as defined herein.
Allelic variants of human SLGP include both functional and non-functional SLGP proteins. Functional allelic variants are naturally occurring amino acid sequence variants ofthe human SLGP protein that maintain the ability to bind an SLGP ligand and/or modulate programmed cell death. Functional allelic variants will typically contain only conservative substitution of one or more amino acids of SEQ ID NO:2 or SEQ ID NO: 18 or substitution, deletion or insertion of non-critical residues in non- critical regions ofthe protein. Non-functional allelic variants are naturally occurring amino acid sequence variants ofthe human SLGP protein that do not have the ability to either bind an SLGP ligand and/or modulate programmed cell death. Non-functional allelic variants will typically contain a non-conservative substitution, a deletion, or insertion or premature truncation ofthe amino acid sequence of SEQ ID NO:2 or SEQ ID NO:18 or a substitution, insertion or deletion in critical residues or critical regions.
The present invention further provides non-human orthologues ofthe human SLGP protein. Orthologues ofthe human SLGP protein are proteins that are isolated from non-human organisms and possess the same SLGP ligand binding and/or modulation of programmed cell death capabilities ofthe human SLGP protein.
Orthologues ofthe human SLGP protein can readily be identified as comprising an amino acid sequence that is substantially homologous to SEQ ID NO:2.
Moreover, nucleic acid molecules encoding other GPCR family members (e.g., other SLGP family members) and thus which have a nucleotide sequence which differs from the SLGP sequences of SEQ ID NOT, SEQ ID NO:3, SEQ ID NO:17, SEQ ID NO: 19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with
ATCC as Accession Number are intended to be within the scope ofthe invention.
For example, another SLGP cDNA can be identified based on the nucleotide sequence of human SLGP. Moreover, nucleic acid molecules encoding SLGP proteins from different species, and which, thus, have a nucleotide sequence which differs from the SLGP sequences of SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as
Accession Number are intended to be within the scope ofthe invention.
Nucleic acid molecules corresponding to natural allelic variants and homologues ofthe SLGP cDNAs ofthe invention can be isolated based on their homology to the SLGP nucleic acids disclosed herein using the cDNAs disclosed herein, or a portion thereof, as a hybridization probe according to standard hybridization techniques under stringent hybridization conditions.
Accordingly, in another embodiment, an isolated nucleic acid molecule ofthe invention is at least 15 nucleotides in length and hybridizes under stringent conditions to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NOT, SEQ ID NO:3, SEQ ID NOT7, SEQ ID NO: 19, the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number . In another embodiment, the nucleic acid is at least 30, 50, 100, 150, 200, 250, 275, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, or 950 nucleotides in length. As used herein, the term "hybridizes under stringent conditions" is intended to describe conditions for hybridization and washing under which nucleotide sequences at least 60%> homologous to each other typically remain hybridized to each other. Preferably, the conditions are such that sequences at least about 70%>, more preferably at least about
80%, even more preferably at least about 85% or 90% homologous to each other typically remain hybridized to each other. Such stringent conditions are known to those skilled in the art and can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6. A preferred, non-limiting example of stringent hybridization conditions are hybridization in 6X sodium chloride/sodium citrate (SSC) at about 45°C, followed by one or more washes in 0.2 X SSC, 0.1% SDS at 50-65°C. Preferably, an isolated nucleic acid molecule ofthe invention that hybridizes under stringent conditions to the sequence of SEQ ID NO: 1 , SEQ ID NO: 17, the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with
ATCC as Accession Number , corresponds to a naturally-occurring nucleic acid molecule. As used herein, a "naturally-occurring" nucleic acid molecule refers to an RNA or DNA molecule having a nucleotide sequence that occurs in nature (e.g., encodes a natural protein). In addition to naturally-occurring allelic variants of the SLGP sequences that may exist in the population, the skilled artisan will further appreciate that changes can be introduced by mutation into the nucleotide sequences of SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , thereby leading to changes in the amino acid sequence ofthe encoded SLGP proteins, without altering the functional ability ofthe SLGP proteins. For example, nucleotide substitutions leading to amino acid substitutions at "non-essential" amino acid residues can be made in the sequence of SEQ ID NOT, SEQ ID NO:3, SEQ ID NOT7, SEQ ID NOT9, or the nucleotide sequence of • the DNA insert ofthe plasmid deposited with ATCC as Accession Number . A "non-essential" amino acid residue is a residue that can be altered from the wild-type sequence of SLGP (e.g., the sequence of SEQ ID NO:2 or SEQ ID NO: 18) without altering the biological activity, whereas an "essential" amino acid residue is required for biological activity. For example, amino acid residues that are conserved among the SLGP proteins ofthe present invention, are predicted to be particularly unamenable to alteration. Furthermore, additional amino acid residues that are conserved between the
SLGP proteins ofthe present invention and other members ofthe GPCR families are not likely to be amenable to alteration.
Accordingly, another aspect ofthe invention pertains to nucleic acid molecules encoding SLGP proteins that contain changes in amino acid residues that are not essential for activity. Such SLGP proteins differ in amino acid sequence from SEQ ID NO:2 or SEQ ID NO: 18, yet retain biological activity. In one embodiment, the isolated nucleic acid molecule comprises a nucleotide sequence encoding a protein, wherein the protein comprises an amino acid sequence at least about 25%), 28%), 30%>, 35%>, 40%>, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or more homologous to SEQ ID NO:2 or SEQ ID NO:18.
An isolated nucleic acid molecule encoding an SLGP protein homologous to the protein of SEQ ID NO:2 or SEQ ID NO: 18 can be created by introducing one or more nucleotide substitutions, additions or deletions into the nucleotide sequence of SEQ ID NOT, SEQ ID NO:3, SEQ ID NO:17, SEQ ID NOT9, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number , such that one or more amino acid substitutions, additions or deletions are introduced into the encoded protein. Mutations can be introduced into SEQ ID NOT, SEQ ID NO:3, SEQ ID NOT7, SEQ ID NO.T9, or the nucleotide sequence ofthe DNA insert ofthe plasmid deposited with ATCC as Accession Number by standard techniques, such as site- directed mutagenesis and PCR-mediated mutagenesis. Preferably, conservative amino acid substitutions are made at one or more predicted non-essential amino acid residues. A "conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta- branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, a predicted nonessential amino acid
residue in an SLGP protein is preferably replaced with another amino acid residue from the same side chain family. Alternatively, in another embodiment, mutations can be introduced randomly along all or part of an SLGP coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for SLGP biological activity to identify mutants that retain activity. Following mutagenesis of SEQ ID NO , SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NOT 9, or the nucleotide sequence ofthe DNA insert of the plasmid deposited with ATCC as Accession Number , the encoded protein can be expressed recombinantly and the activity ofthe protein can be determined.
In a preferred embodiment, a mutant SLGP protein can be assayed for the ability to affect the (1) modulation of cellular signal transduction, either in vitro or in vivo; (2) regulation of activation in a cell expressing an SLGP protein; or (3) modulation of angiogenesis in endothelial cells (e.g., tumor endothelial cells).
In addition to the nucleic acid molecules encoding SLGP proteins described above, another aspect ofthe invention pertains to isolated nucleic acid molecules which are antisense thereto. An "antisense" nucleic acid comprises a nucleotide sequence which is complementary to a "sense" nucleic acid encoding a protein, e.g., complementary to the coding strand of a double-stranded cDNA molecule or complementary to an mRNA sequence. Accordingly, an antisense nucleic acid can hydrogen bond to a sense nucleic acid. The antisense nucleic acid can be complementary to an entire SLGP coding strand, or to only a portion thereof. In one embodiment, an antisense nucleic acid molecule is antisense to a "coding region" ofthe coding strand of a nucleotide sequence encoding SLGP. The term "coding region" refers to the region ofthe nucleotide sequence comprising codons which are translated into amino acid residues- (e.g., the coding region of human SLGP corresponds to SEQ ID NO:3 and the coding region of mouse SLGP corresponds to SEQ ID NOT9). In another embodiment, the antisense nucleic acid molecule is antisense to a "noncoding region" of the coding strand of a nucleotide sequence encoding SLGP. The term "noncoding region" refers to 5' and 3' sequences which flank the coding region that are not translated into amino acids (i.e., also referred to as 5' and 3' untranslated regions).
Given the coding strand sequences encoding SLGP disclosed herein (e.g., SEQ ID NO: 3 and SEQ ID NO: 19), antisense nucleic acids ofthe invention can be designed according to the rules of Watson and Crick base pairing. The antisense nucleic acid molecule can be complementary to the entire coding region of SLGP mRNA, but more preferably is an oligonucleotide which is antisense to only a portion ofthe coding or noncoding region of SLGP mRNA. For example, the antisense oligonucleotide can be complementary to the region surrounding the translation start site of SLGP mRNA. An antisense oligonucleotide can be, for example, about 5, 10, 15, 20, 25, 30, 35, 40, 45 or 50 nucleotides in length. An antisense nucleic acid ofthe invention can be constructed using chemical synthesis and enzymatic ligation reactions using procedures known in the art. For example, an antisense nucleic acid (e.g., an antisense oligonucleotide) can be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides designed to increase the biological stability ofthe molecules or to increase the physical stability ofthe duplex formed between the antisense and sense nucleic acids, e.g., phosphorothioate derivatives and acridine substituted nucleotides can be used. Examples of modified nucleotides which can be used to generate the antisense nucleic acid include 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xantine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl) uracil, 5- carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1- methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2- methylguanine, 3-methylcytosine, 5-methyIcytosine, N6-adenine, 7-methylguanine, 5- methylaminomethyluracil, 5 -methoxyaminomethyl-2-thiouracil, beta-D- mannosylqueosine, 5'-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6- isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5- oxyacetic acid methylester, uracil-5-oxyacetic acid (v), 5-methyl-2-thiouracil, 3-(3- amino-3-N-2-carboxypropyl) uracil, (acp3)w, and 2,6-diaminopurine. Alternatively, the antisense nucleic acid can be produced biologically using an expression vector into which a nucleic acid has been subcloned in an antisense orientation (i.e., RNA
transcribed from the inserted nucleic acid will be of an antisense orientation to a target nucleic acid of interest, described further in the following subsection).
The antisense nucleic acid molecules ofthe invention are typically administered to a subject or generated in situ such that they hybridize with or bind to cellular mRNA and/or genomic DNA encoding an SLGP protein to thereby inhibit expression ofthe protein, e.g., by inhibiting transcription and/or translation. The hybridization can be by conventional nucleotide complementarity to form a stable duplex, or, for example, in the case of an antisense nucleic acid molecule which binds to DNA duplexes, through specific interactions in the major groove ofthe double helix. An example of a route of administration of antisense nucleic acid molecules ofthe invention include direct injection at a tissue site. Alternatively, antisense nucleic acid molecules can be modified to target selected cells and then administered systemically. For example, for systemic administration, antisense molecules can be modified such that they specifically bind to receptors or antigens expressed on a selected cell surface, e.g., by linking the antisense nucleic acid molecules to peptides or antibodies which bind to cell surface receptors or antigens. The antisense nucleic acid molecules can also be delivered to cells using the vectors described herein. To achieve sufficient intracellular concentrations ofthe antisense molecules, vector constructs in which the antisense nucleic acid molecule is placed under the control of a strong pol II or pol III promoter are preferred. In yet another embodiment, the antisense nucleic acid molecule ofthe invention is an α-anomeric nucleic acid molecule. An α-anomeric nucleic acid molecule forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual β-units, the strands run parallel to each other (Gaultier et al. (1987) Nucleic Acids. Res. 15:6625-6641). The antisense nucleic acid molecule can also comprise a 2'-o- methylribonucleotide (Inoue et al. (1987) Nucleic Acids Res. 15:6131-6148) or a chimeric RNA-DNA analogue (Inoue et al (1987) FEBS Lett. 215:327-330).
In still another embodiment, an antisense nucleic acid ofthe invention is a ribozyme. Ribozymes are catalytic RNA molecules with ribonuclease activity which are capable of cleaving a single-stranded nucleic acid, such as an mRNA, to which they have a complementary region. Thus, ribozymes (e.g., hammerhead ribozymes
(described in Haselhoff and Gerlach (1988) Nature 334:585-591)) can be used to catalytically cleave SLGP mRNA transcripts to thereby inhibit translation of SLGP mRNA. A ribozyme having specificity for an SLGP-encoding nucleic acid can be designed based upon the nucleotide sequence of an SLGP cDNA disclosed herein (i.e., SEQ ID NOT or SEQ ID NOT7). For example, a derivative of a Tetrahymena L-19 IVS RNA can be constructed in which the nucleotide sequence ofthe active site is complementary to the nucleotide sequence to be cleaved in an SLGP-encoding mRNA. See, e.g., Cech et al. U.S. Patent No. 4,987,071 ; and Cech et al. U.S. Patent No. 5,116,742. Alternatively, SLGP mRNA can be used to select a catalytic RNA having a specific ribonuclease activity from a pool of RNA molecules. See, e.g., Bartel, D. and Szostak, J.W. (1993) Science 261:1411-1418.
Alternatively, SLGP gene expression can be inhibited by targeting nucleotide sequences complementary to the regulatory region ofthe SLGP (e.g., the SLGP promoter and/or enhancers) to form triple helical structures that prevent transcription of the SLGP gene in target cells. See generally, Helene, C. (1991) Anticancer DrugDes. 6(6):569-84; Helene, C. et al. (1992) Ann. N Y. Acad. Sci. 660:27-36; and Maher, L.J. (1992) Bioassays 14(12):807-15.
In yet another embodiment, the SLGP nucleic acid molecules ofthe present invention can be modified at the base moiety, sugar moiety or phosphate backbone to improve, e.g., the stability, hybridization, or solubility ofthe molecule. For example, the deoxyribose phosphate backbone ofthe nucleic acid molecules can be modified to generate peptide nucleic acids (see Hyrup B. et al. (1996) Bioorganic & Medicinal Chemistry 4 (1): 5-23). As used herein, the terms "peptide nucleic acids" or "PNAs" refer to nucleic acid mimics, e.g., DNA mimics, in which the deoxyribose phosphate backbone is replaced by a pseudopeptide backbone and only the four natural nucleobases are retained. The neutral backbone of PNAs has been shown to allow for specific hybridization to DNA and RNA under conditions of low ionic strength. The synthesis of PNA oligomers can be performed using standard solid phase peptide synthesis protocols as described in Hyrup B. et al (1996) supra; Perry-O'Keefe et al. PNAS 93: 14670-675.
PNAs of SLGP nucleic acid molecules can be used in therapeutic and diagnostic applications. For example, PNAs can be used as antisense or antigene agents for sequence-specific modulation of gene expression by, for example, inducing transcription or translation arrest or inhibiting replication. PNAs of SLGP nucleic acid molecules can also be used in the analysis of single base pair mutations in a gene, (e.g., by PNA- directed PCR clamping); as 'artificial restriction enzymes' when used in combination with other enzymes, (e.g., SI nucleases (Hyrup B. (1996) supra)); or as probes or primers for DNA sequencing or hybridization (Hyrup B. et al. (1996) supra; Perry- O'Keefe supra). In another embodiment, PNAs of SLGP can be modified, (e.g., to enhance their stability or cellular uptake), by attaching lipophilic or other helper groups to PNA, by the formation of PNA-DNA chimeras, or by the use of liposomes or other techniques of drug delivery known in the art. For example, PNA-DNA chimeras of SLGP nucleic acid molecules can be generated which may combine the advantageous properties of PNA and DNA. Such chimeras allow DNA recognition enzymes, (e.g., RNAse H and DNA polymerases), to interact with the DNA portion while the PNA portion would provide high binding affinity and specificity. PNA-DNA chimeras can be linked using linkers of appropriate lengths selected in terms of base stacking, number of bonds between the nucleobases, and orientation (Hyrup B. (1996) supra). The synthesis of PNA-DNA chimeras can be performed as described in Hyrup B. (1.996) supra and Finn P.J. et αl. (1996) Nucleic Acids Res. 24 (17): 3357-63. For example, a DNA chain can be synthesized on a solid support using standard phosphoramidite coupling chemistry and modified nucleoside analogs, e.g., 5'-(4-methoxytrityl)amino-5'-deoxy-thymidine phosphoramidite, can be used as a between the PNA and the 5' end of DNA (Mag, M. et αl. (1989) Nucleic Acid Res. 17: 5973-88). PNA monomers are then coupled in a step wise manner to produce a chimeric molecule with a 5' PNA segment and a 3' DNA segment (Finn P.J. et αl. (1996) supra). Alternatively, chimeric molecules can be synthesized with a 5' DNA segment and a 3' PNA segment (Peterser, K.H. et al. (1975) Bioorganic Med. Chem. Lett. 5: 1119-11124).
In other embodiments, the oligonucleotide may include other appended groups such as peptides (e.g., for targeting host cell receptors in vivo), or agents facilitating transport across the cell membrane (see, e.g., Letsinger et al. (1989) Proc. Natl. Acad. Sci. US. 86:6553-6556; Lemaitre et al (1981) Proc. Natl. Acad. Sci. USA 84:648-652; PCT Publication No. W088/09810, published December 15, 1988) or the blood-brain barrier (see, e.g., PCT Publication No. W089/10134, published April 25, 1988). In addition, oligonucleotides can be modified with hybridization-triggered cleavage agents (See, e.g., Krol et al. (1988) BioTechniques 6:958-976) or intercalating agents. (See, e.g., Zon (1988) Pharm. Res. 5:539-549). To this end, the oligonucleotide may be conjugated to another molecule, (e.g., a peptide, hybridization triggered cross-linking agent, transport agent, or hybridization-triggered cleavage agent).
Furthermore, given the fact that an important use for the SLGP molecules ofthe present invention is in the screening for SLGP ligands (e.g., surrogate ligands) and/or SLGP modulators, it is intended that the following are also within the scope ofthe present invention: isolated nucleic acids which encode and SLGP ligands or SLGP modulators, probes and/or primers useful for identifying SLGP ligands or SLGP modulators based on the sequences of nucleic acids which encode and SLGP ligands or SLGP modulators, isolated nucleic acid molecules which are complementary or antisense to the sequences of nucleic acids which encode and SLGP ligands or SLGP modulators, isolated nucleic acid molecules which are at least about 60-65%>, preferably at least about 70-75%>, more preferable at least about 80-85%), and even more preferably at least about 90-95%> or more homologous to the sequences of nucleic acids which encode and SLGP ligands or SLGP modulators, portions of nucleic acids which encode and SLGP ligands or SLGP modulators (e.g., biologically-active portions), naturally- • occurring allelic variants of nucleic acids which encode and SLGP ligands or SLGP modulators, nucleic acid molecules which hybridize under stringent hybridization conditions to nucleic acids which encode and SLGP ligands or SLGP modulators, functionally-active mutants of nucleic acids which encode and SLGP ligands or SLGP modulators, PNAs of nucleic acids which encode and SLGP ligands or SLGP modulators, as well as vectors containing a nucleic acid encoding an SLGP ligand or
SLGP modulator, described herein, host cells into which an expression vector encoding an SLGP ligand or SLGP modulator has been introduced, and homologous recombinant animal which express SLGP ligands or SLGP modulators.
II. Isolated SLGP Proteins and Anti-SLGP Antibodies
One aspect ofthe invention pertains to isolated SLGP proteins, and biologically active portions thereof, as well as polypeptide fragments suitable for use as immunogens to raise anti-SLGP antibodies. In one embodiment, native SLGP proteins can be isolated from cells or tissue sources by an appropriate purification scheme using standard protein purification techniques. In another embodiment, SLGP proteins are produced by recombinant DNA techniques. Alternative to recombinant expression, an SLGP protein or polypeptide can be synthesized chemically using standard peptide synthesis techniques.
An "isolated" or "purified" protein or biologically active portion thereof is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the SLGP protein is derived, or substantially free from chemical precursors or other chemicals when chemically synthesized. The language "substantially free of cellular material" includes preparations of SLGP protein in which the protein is separated from cellular components ofthe cells from which it is isolated or recombinantly produced. In one embodiment, the language "substantially free of cellular material" includes preparations of SLGP protein having less than about 30%) (by dry weight) of non-SLGP protein (also referred to herein as a "contaminating protein"), more preferably less than about 20%) of non-SLGP protein, still more preferably less than about 10%> of non-SLGP protein, and most preferably less than about 5%> non- SLGP protein. When the SLGP protein or biologically active portion thereof is recombinantly produced, it is also preferably substantially free of culture medium, i.e., culture medium represents less than about 20%>, more preferably less than about 10%>, and most preferably less than about 5%> ofthe volume ofthe protein preparation.
The language "substantially free of chemical precursors or other chemicals" includes preparations of SLGP protein in which the protein is separated from chemical precursors or other chemicals which are involved in the synthesis ofthe protein. In one embodiment, the language "substantially free of chemical precursors or other chemicals" includes preparations of SLGP protein having less than about 30% (by dry weight) of chemical precursors or non-SLGP chemicals, more preferably less than about 20%> chemical precursors or non-SLGP chemicals, still more preferably less than about 10% chemical precursors or non-SLGP chemicals, and most preferably less than about 5% chemical precursors or non-SLGP chemicals. Biologically active portions of an SLGP protein include peptides comprising amino acid sequences sufficiently homologous to or derived from the amino acid sequence ofthe SLGP protein, e.g., the amino acid sequence shown in SEQ ID NO:2 or SEQ ID NO: 18, which include less amino acids than the full length SLGP proteins, and exhibit at least one activity of an SLGP protein. Typically, biologically active portions comprise a domain or motif with at least one activity ofthe SLGP protein. A biologically active portion of an SLGP protein can be a polypeptide which is, for example, 10, 25, 50, 100 or more amino acids in length.
In one embodiment, a biologically active portion of an SLGP protein comprises at least a transmembrane domain. In another embodiment, a biologically active portion of an SLGP protein comprises at least one 7 transmembrane receptor profile. In another embodiment, a biologically active portion of an SLGP protein comprises at least an EGF-like domain. In another embodiment, a biologically active portion of an SLGP protein comprises at least an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L ■ domain. In another embodiment a biologically active portion of an SLGP protein comprises at least a 7 transmembrane receptor profile and an EGF-like domain. In another embodiment a biologically active portion of an SLGP protein comprises at least a 7 transmembrane receptor profile and an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain. In another embodiment a biologically active portion of an SLGP protein comprises at least a an EGF-like domain and an NADH- ubiquinone/plastoquinone oxidoreductase chain 4L domain. In another embodiment a
biologically active portion of an SLGP protein comprises at least a 7 transmembrane receptor profile, an EGF-like domain and an NADH-ubiquinone/plastoquinone oxidoreductase chain 4L domain.
It is to be understood that a preferred biologically active portion of an SLGP protein ofthe present invention may contain at least one ofthe above-identified structural domains and/or profiles. A more preferred biologically active portion of an SLGP protein may contain at least two ofthe above-identified structural domains and/or profiles. Moreover, other biologically active portions, in which other regions ofthe protein are deleted, can be prepared by recombinant techniques and evaluated for one or more of the functional activities of a native SLGP protein.
In a preferred embodiment, the SLGP protein has an amino acid sequence shown in SEQ ID NO:2 or SEQ ID NO: 18. In other embodiments, the SLGP protein is substantially homologous to SEQ ID NO:2 or SEQ ID NO: 18, and retains the functional activity ofthe protein of SEQ ID NO:2 or SEQ ID NO: 18, yet differs in amino acid sequence due to natural allelic variation or mutagenesis, as described in detail in subsection I above. Accordingly, in another embodiment, the SLGP protein is a protein which comprises an amino acid sequence at least about 25%, 28%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or more homologous to SEQ ID NO:2 or SEQ ID NO: 18. To determine the percent identity of two amino acid sequences or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). In a preferred embodiment, the length of a reference sequence aligned for comparison purposes is at least 30%>, preferably at least 40%>, more preferably at least 50%>, even more preferably at least 60%>, and even more preferably at least 70%, 80%, or 90% ofthe length ofthe reference sequence (e.g., when aligning a second sequence to the SLGP amino acid sequence of SEQ ID NO:2 having 689 amino acid residues, at least 100, 200, preferably at least 300, more preferably at least 400, even more preferably at least 500, and even more preferably at least 600, 650 or 689
amino acid residues are aligned). The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein amino acid or nucleic acid "identity" is equivalent to amino acid or nucleic acid "homology"). The percent identity between the two sequences is a function ofthe number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment ofthe two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. In a preferred embodiment, the percent identity between two amino acid sequences is determined using the Needleman and Wunsch (J. Mol. Biol. (48):444-453 (1970)) algorithm which has been incorporated into the GAP program in the GCG software package (available at http://www.gcg.com), using either a Blossom 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6. In yet another preferred embodiment, the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6. In another embodiment, the percent identity between two amino acid or nucleotide sequences is determined using the algorithm of E. Meyers and W. Miller (CABIOS, 4:11-17 (1989)) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. The nucleic acid and protein sequences ofthe present invention can further be used as a "query sequence" to perform a search against public databases to, for example, identify other family members or related sequences. Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J Mol. Biol. 215:403-10. BLAST nucleotide searches can be performed with the NBLAST program, score = 100, wordlength = 12 to obtain nucleotide sequences
homologous to SLGP nucleic acid molecules ofthe invention. BLAST protein searches can be performed with the XBLAST program, score = 50, wordlength = 3 to obtain amino acid sequences homologous to SLGP protein molecules ofthe invention. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al, (1997) Nucleic Acids Res. 25(17):3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters ofthe respective programs (e.g., XBLAST and NBLAST) can be used. See http://www.ncbi.nlm.nih.gov.
The invention also provides SLGP chimeric or fusion proteins. As used herein, an SLGP "chimeric protein" or "fusion protein" comprises an SLGP polypeptide operatively linked to a non-SLGP polypeptide. A "SLGP polypeptide" refers to a polypeptide having an amino acid sequence corresponding to SLGP, whereas a "non- SLGP polypeptide" refers to a polypeptide having an amino acid sequence corresponding to a protein which is not substantially homologous to the SLGP protein, e.g., a protein which is different from the SLGP protein and which is derived from the same or a different organism. Within an SLGP fusion protein the SLGP polypeptide can correspond to all or a portion of an SLGP protein. In a preferred embodiment, an SLGP fusion protein comprises at least one biologically active portion of an SLGP protein. In another preferred embodiment, an SLGP fusion protein comprises at least two biologically active portions of an SLGP protein. Within the fusion protein, the term "operatively linked" is intended to indicate that the SLGP polypeptide and the non- SLGP polypeptide are fused in-frame to each other. The non-SLGP polypeptide can be fused to the N-terminus or C-terminus ofthe SLGP polypeptide.
For example, in one embodiment, the fusion protein is a GST-SLGP fusion protein in which the SLGP sequences are fused to the C-terminus ofthe GST sequences. Such fusion proteins can facilitate the purification of recombinant SLGP. In another embodiment, the fusion protein is an SLGP protein containing a heterologous signal sequence at its N-terminus. For example, a native SLGP signal sequence can be removed and replaced with a signal sequence from another protein. In certain host cells (e.g., mammalian host cells), expression and/or secretion of SLGP can be increased through use of a heterologous signal sequence.
The SLGP fusion proteins ofthe invention can be incorporated into pharmaceutical compositions and administered to a subject in vivo. The SLGP fusion proteins can be used to affect the bioavailability of an SLGP substrate. Use of SLGP fusion proteins may be useful therapeutically for the treatment of SLGP-related disorders (e.g., paroxysmal nocturnal hemoglobinuria). Moreover, the SLGP-fusion proteins ofthe invention can be used as immunogens to produce anti-SLGP antibodies in a subject, to purify SLGP ligands and in screening assays to identify molecules which inhibit the interaction of SLGP with an SLGP ligand.
Moreover, the SLGP-fusion proteins ofthe invention can be used as immunogens to produce anti-SLGP antibodies in a subject, to purify SLGP ligands and in screening assays to identify molecules which inhibit the interaction of SLGP with an SLGP substrate.
Preferably, an SLGP chimeric or fusion protein ofthe invention is produced by standard recombinant DNA techniques. For example, DNA fragments coding for the different polypeptide sequences are ligated together in-frame in accordance with conventional techniques, for example by employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation. In another embodiment, the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers. Alternatively, PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed and reamplified to generate a chimeric •gene sequence (see, for example, Current Protocols in Molecular Biology, eds. Ausubel et al John Wiley & Sons: 1992). Moreover, many expression vectors are commercially available that already encode a fusion moiety (e.g., a GST polypeptide). An SLGP- encoding nucleic acid can be cloned into such an expression vector such that the fusion moiety is linked in-frame to the SLGP protein.
The present invention also pertains to variants of the SLGP proteins which function as either SLGP agonists (mimetics) or as SLGP antagonists. Variants ofthe SLGP proteins can be generated by mutagenesis, e.g., discrete point mutation or truncation of an SLGP protein. An agonist ofthe SLGP proteins can retain substantially the same, or a subset, ofthe biological activities ofthe naturally occurring form of an SLGP protein. An antagonist of an SLGP protein can inhibit one or more ofthe activities ofthe naturally occurring form ofthe SLGP protein by, for example, competitively inhibiting the protease activity of an SLGP protein. Thus, specific biological effects can be elicited by treatment with a variant of limited function. In one embodiment, treatment of a subject with a variant having a subset of the biological activities ofthe naturally occurring form ofthe protein has fewer side effects in a subject relative to treatment with the naturally occurring form ofthe SLGP protein.
In one embodiment, variants of an SLGP protein which function as either SLGP agonists (mimetics) or as SLGP antagonists can be identified by screening combinatorial libraries of mutants, e.g., truncation mutants, of an SLGP protein for SLGP protein agonist or antagonist activity. In one embodiment, a variegated library of SLGP variants is generated by combinatorial mutagenesis at the nucleic acid level and is encoded by a variegated gene library. A variegated library of SLGP variants can be produced by, for example, enzymatically ligating a mixture of synthetic oligonucleotides into gene sequences such that a degenerate set of potential SLGP sequences is expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display) containing the set of SLGP sequences therein. There are a variety of methods which can be used to produce libraries of potential SLGP variants from a degenerate oligonucleotide sequence. Chemical synthesis of a degenerate gene sequence can be performed in an automatic DNA synthesizer, and the synthetic gene then ligated into an appropriate expression vector. Use of a degenerate set of genes allows for the provision, in one mixture, of all ofthe sequences encoding the desired set of potential SLGP sequences. Methods for synthesizing degenerate oligonucleotides are known in the art (see, e.g., Narang, S.A. (1983) Tetrahedron 39:3; Itakura et al. (1984) Annu. Rev.
Biochem. 53:323; Itakura et al. (1984) Science 198:1056; Ike et al (1983) Nucleic Acid Res. 11:477.
In addition, libraries of fragments of an SLGP protein coding sequence can be used to generate a variegated population of SLGP fragments for screening and subsequent selection of variants of an SLGP protein. In one embodiment, a library of coding sequence fragments can be generated by treating a double stranded PCR fragment of an SLGP coding sequence with a nuclease under conditions wherein nicking occurs only about once per molecule, denaturing the double stranded DNA, renaturing the DNA to form double stranded DNA which can include sense/antisense pairs from different nicked products, removing single stranded portions from reformed duplexes by treatment with SI nuclease, and ligating the resulting fragment library into an expression vector. By this method, an expression library can be derived which encodes N-terminal, C-terminal and internal fragments of various sizes ofthe SLGP protein.
Several techniques are known in the art for screening gene products of combinatorial libraries made by point mutations or truncation, and for screening cDNA libraries for gene products having a selected property. Such techniques are adaptable for rapid screening ofthe gene libraries generated by the combinatorial mutagenesis of SLGP proteins. The most widely used techniques, which are amenable to high throughput analysis, for screening large gene libraries typically include cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates isolation ofthe vector encoding the gene whose product was detected. Recursive ensemble mutagenesis (REM), a new technique which enhances the frequency of functional mutants in the libraries, can be used in combination with the screening assays to identify SLGP variants (Arkin and Yourvan (1992) PNAS 89:7811-7815; Delgrave et al. (1993) Protein Engineering 6(3):327-331).
In one embodiment, cell based assays can be exploited to analyze a variegated SLGP library. For example, a library of expression vectors can be transfected into a cell line which ordinarily synthesizes SLGP. The transfected cells are then cultured such that a particular mutant SLGP is expressed and the effect of expression ofthe mutant on
SLGP activity in the cell can be detected, e.g., by any of a number of activity assays for native SLGP protein. Plasmid DNA can then be recovered from the cells which score for modulated SLGP activity, and the individual clones further characterized.
An isolated SLGP protein, or a portion or fragment thereof, can be used as an immunogen to generate antibodies that bind SLGP using standard techniques for polyclonal and monoclonal antibody preparation. A full-length SLGP protein can be used or, alternatively, the invention provides antigenic peptide fragments of SLGP for use as immunogens. The antigenic peptide of SLGP comprises at least 8 amino acid residues ofthe amino acid sequence shown in SEQ ID NO: 2 or SEQ ID NO: 18 and encompasses an epitope of SLGP such that an antibody raised against the peptide forms a specific immune complex with SLGP. Preferably, the antigenic peptide comprises at least 10 amino acid residues, more preferably at least 15 amino acid residues, even more preferably at least 20 amino acid residues, and most preferably at least 30 amino acid residues. Preferred epitopes encompassed by the antigenic peptide are regions of SLGP that are located on the surface ofthe protein, e.g., hydrophilic regions, as well as regions with high antigenicity.
An SLGP immunogen typically is used to prepare antibodies by immunizing a suitable subject, (e.g., rabbit, goat, mouse or other mammal) with the immunogen. An appropriate immunogenic preparation can contain, for example, recombinantly expressed SLGP protein or a chemically synthesized SLGP polypeptide. The preparation can further include an adjuvant, such as Freund's complete or incomplete adjuvant, or similar immunostimulatory agent. Immunization of a suitable subject with an immunogenic SLGP preparation induces a polyclonal anti-SLGP antibody response. Accordingly, another aspect ofthe invention pertains to anti-SLGP antibodies.
The term "antibody" as used herein refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site which specifically binds (immunoreacts with) an antigen, such as SLGP. Examples of immunologically active portions of immunoglobulin molecules include F(ab) and F(ab')2 fragments which can be generated by treating the
antibody with an enzyme such as pepsin. The invention provides polyclonal and monoclonal antibodies that bind SLGP. The term "monoclonal antibody" or "monoclonal antibody composition", as used herein, refers to a population of antibody molecules that contain only one species of an antigen binding site capable of immunoreacting with a particular epitope of SLGP. A monoclonal antibody composition thus typically displays a single binding affinity for a particular SLGP protein with which it immunoreacts.
Polyclonal anti-SLGP antibodies can be prepared as described above by immunizing a suitable subject with an SLGP immunogen. The anti-SLGP antibody titer in the immunized subject can be monitored over time by standard techniques, such as with an enzyme linked immunosorbent assay (ELISA) using immobilized SLGP. If desired, the antibody molecules directed against SLGP can be isolated from the mammal (e.g., from the blood) and further purified by well known techniques, such as protein A chromatography to obtain the IgG fraction. At an appropriate time after immunization, e.g., when the anti-SLGP antibody titers are highest, antibody-producing cells can be obtained from the subject and used to prepare monoclonal antibodies by standard techniques, such as the hybridoma technique originally described by Kohler and Milstein (1975) Nature 256:495-497) (see also, Brown et al. (1981) J Immunol. 127:539-46; Brown et al. (1980) J. Biol Chem .255:4980-83; Yeh et al (1976) PNAS 76:2927-31; and Yeh et al. (1982) Int. J. Cancer 29:269-75), the more recent human B cell hybridoma technique (Kozbor et al. (1983) Immunol Today 4:72), the EBV- hybridoma technique (Cole et al (1985), Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96) or trioma techniques. The technology for producing monoclonal antibody hybridomas is well known (see generally R. H. Kenneth, in Monoclonal Antibodies: A New Dimension In Biological Analyses, Plenum Publishing Corp., New York, New York (1980); E. A. Lerner (1981) Yale J. Biol. Med, 54:387-402; M. L. Gefter et al. (1977) Somatic Cell Genet. 3:231-36). Briefly, an immortal cell line (typically a myeloma) is fused to lymphocytes (typically splenocytes) from a mammal immunized with an SLGP immunogen as described above, and the
culture supernatants ofthe resulting hybridoma cells are screened to identify a hybridoma producing a monoclonal antibody that binds SLGP.
Any ofthe many well known protocols used for fusing lymphocytes and immortalized cell lines can be applied for the purpose of generating an anti-SLGP monoclonal antibody (see, e.g., G. Galfre et al. (1977) Nature 266:55052; Gefter et al. Somatic Cell Genet, cited supra; Lerner, Yale J. Biol. Med, cited supra; Kenneth, Monoclonal Antibodies, cited supra). Moreover, the ordinarily skilled worker will appreciate that there are many variations of such methods which also would be useful. Typically, the immortal cell line (e.g., a myeloma cell line) is derived from the same mammalian species as the lymphocytes. For example, murine hybridomas can be made by fusing lymphocytes from a mouse immunized with an immunogenic preparation of the present invention with an immortalized mouse cell line. Preferred immortal cell lines are mouse myeloma cell lines that are sensitive to culture medium containing hypoxanthine, aminopterin and thymidine ("HAT medium"). Any of a number of myeloma cell lines can be used as a fusion partner according to standard techniques, e.g., the P3-NSl/l-Ag4-l, P3-x63-Ag8.653 or Sp2/O-Agl4 myeloma lines. These myeloma lines are available from ATCC. Typically, HAT-sensitive mouse myeloma cells are fused to mouse splenocytes using polyethylene glycol ("PEG"). Hybridoma cells resulting from the fusion are then selected using HAT medium, which kills unfused and unproductively fused myeloma cells (unfused splenocytes die after several days because they are not transformed). Hybridoma cells producing a monoclonal antibody ofthe invention are detected by screening the hybridoma culture supernatants for antibodies that bind STGP, e.g., using a standard ELISA assay.
• Alternative to preparing monoclonal antibody-secreting hybridomas, a monoclonal anti-SLGP antibody can be identified and isolated by screening a recombinant combinatorial immunoglobulin library (e.g., an antibody phage display library) with SLGP to thereby isolate immunoglobulin library members that bind SLGP. Kits for generating and screening phage display libraries are commercially available (e.g., the Pharmacia Recombinant Phage Antibody System, Catalog No. 27-9400-01; and the Stratagene SurfZAP™ Phage Display Kit, Catalog No. 240612). Additionally,
examples of methods and reagents particularly amenable for use in generating and screening antibody display library can be found in, for example, Ladner et al U.S. Patent No. 5,223,409; Kang et al. PCT International Publication No. WO 92/18619; Dower et al PCT International Publication No. WO 91/17271 ; Winter et al. PCT International Publication WO 92/20791; Markland et al. PCT International Publication No. WO 92/15679; Breitling et al. PCT International Publication WO 93/01288; McCafferty et al. PCT International Publication No. WO 92/01047; Garrard et al PCT International Publication No. WO 92/09690; Ladner et al PCT International Publication No. WO 90/02809; Fuchs et al. (1991) Bio/Technology 9:1370-1372; Hay et al (1992) Hum. Antibod. Hybridomas 3:81-85; Huse et al. (1989) Science 246:1275-1281;
Griffiths et al. (1993) EMBO J 12:725-734; Hawkins et al. (1992) J. Mol Biol. 226:889- 896; Clarkson et al. (1991) Nature 352:624-628; Gram et al (1992) PNAS 89:3576- 3580; Garrad et al. (1991) Bio/Technology 9:1373-1377; Hoogenboom etal. (1991) Nuc. Acid Res. 19:4133-4137; Barbas et al (1991) PNAS 88:7978-7982; and McCafferty et al. Nature (1990) 348:552-554.
Additionally, recombinant anti-SLGP antibodies, such as chimeric and humanized monoclonal antibodies, comprising both human and non-human portions, which can be made using standard recombinant DNA techniques, are within the scope of the invention. Such chimeric and humanized monoclonal antibodies can be produced by recombinant DNA techniques known in the art, for example using methods described in Robinson et al. International Application No. PCT/US86/02269; Akira, et al. European Patent Application 184,187; Taniguchi, M., European Patent Application 171,496; Morrison et al. European Patent Application 173,494; Neuberger et al PCT International Publication No. WO 86/01533; Cabilly et al. U.S. Patent No. 4,816,567; Cabilly et al. European Patent Application 125,023; Better et al. (1988) Science
240:1041-1043; Liu et al (1987) PNAS 84:3439-3443; Liu et al. (1987) J. Immunol. 139:3521-3526; Sun et al. (1987) PNAS 84:214-218; Nishimura et α/. (1987) Cane. Res. 47:999-1005; Wood et al. (1985) Nature 314:446-449; and Shaw et al. (1988) J. Natl. Cancer Inst. 80:1553-1559); Morrison, S. L. (1985) Science 229:1202-1207; Oi et al (1986) BioTechniques 4:214; Winter U.S. Patent 5,225,539; Jones et al. (1986) Nature
321 :552-525; Verhoeyan et al. (1988) Science 239:1534; and Beidler et al. (1988) J. Immunol 141:4053-4060.
An anti-SLGP antibody (e.g., monoclonal antibody) can be used to isolate SLGP by standard techniques, such as affinity chromatography or immunoprecipitation. An anti-SLGP antibody can facilitate the purification of natural SLGP from cells and of recombinantly produced SLGP expressed in host cells. Moreover, an anti-SLGP antibody can be used to detect SLGP protein (e.g., in a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression ofthe SLGP protein. Anti-SLGP antibodies can be used diagnostically to monitor protein levels in tissue as part of a clinical testing procedure, e.g., to, for example, determine the efficacy of a given treatment regimen. Detection can be facilitated by coupling (i.e., physically linking) the antibody to a detectable substance. Examples of detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, -galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin, and examples of suitable radioactive material include 125I, 131I, 35S or H.
Furthermore, given the fact that an important use for the SLGP molecules ofthe present invention is in the screening for SLGP ligands (e.g., surrogate ligands) and/or SLGP modulators, it is intended that the following are also within the scope ofthe present invention: "isolated" or "purified" SLGP ligands or SLGP modulators, biologically-active portions of SLGP ligands or SLGP modulators, chimeric or fusion proteins comprising all or a portion of an SLGP ligand or SLGP modulator, and antibodies comprising all or a portion of an SLGP ligand or SLGP modulator.
III. Recombinant Expression Vectors and Host Cells
Another aspect ofthe invention pertains to vectors, preferably expression vectors, containing a nucleic acid encoding an SLGP protein (or a portion thereof). As used herein, the term "vector" refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a "plasmid", which refers to a circular double stranded DNA loop into which additional DNA segments can be ligated. Another type of vector is a viral vector, wherein additional DNA segments can be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as "expression vectors". In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, "plasmid" and "vector" can be used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno- associated viruses), which serve equivalent functions.
The recombinant expression vectors ofthe invention comprise a nucleic acid of the invention in a form suitable for expression ofthe nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory sequences, selected on the basis ofthe host cells to be used for expression, which is operatively linked to the nucleic acid sequence to be expressed. Within a recombinant expression vector, "operably linked" is intended to mean that the nucleotide sequence of interest is linked to the regulatory sequence(s) in a manner which allows for expression ofthe nucleotide sequence (e.g., in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell). The term "regulatory sequence" is intended to includes promoters, enhancers and other expression control
elements (e.g., polyadenylation signals). Such regulatory sequences are described, for example, in Goeddel; Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1990). Regulatory sequences include those which direct constitutive expression of a nucleotide sequence in many types of host cell and those which direct expression ofthe nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). It will be appreciated by those skilled in the art that the design ofthe expression vector can depend on such factors as the choice ofthe host cell to be transformed, the level of expression of protein desired, etc. The expression vectors ofthe invention can be introduced into host cells to thereby produce proteins or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., SLGP proteins, mutant forms of SLGP proteins, fusion proteins, etc.).
The recombinant expression vectors ofthe invention can be designed for expression of SLGP proteins in prokaryotic or eukaryotic cells. For example, SLGP proteins can be expressed in bacterial cells such as E. coli, insect cells (using baculovirus expression vectors) yeast cells or mammalian cells. Suitable host cells are discussed further in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1990). Alternatively, the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.
Expression of proteins in prokaryotes is most often carried out in E. coli with vectors containing constitutive or inducible promoters directing the expression of either fusion or non-fusion proteins. Fusion vectors add a number of amino acids to a protein encoded therein, usually to the amino terminus ofthe recombinant protein. Such fusion vectors typically serve three purposes: 1) to increase expression of recombinant protein; 2) to increase the solubility ofthe recombinant protein; and 3) to aid in the purification ofthe recombinant protein by acting as a ligand in affinity purification. Often, in fusion expression vectors, a proteolytic cleavage site is introduced at the junction ofthe fusion moiety and the recombinant protein to enable separation ofthe recombinant protein from the fusion moiety subsequent to purification ofthe fusion protein. Such enzymes, and
their cognate recognition sequences, include Factor Xa, thrombin and enterokinase. Typical fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith, D.B. and Johnson, K.S. (1988) Gene 67:31-40), pMAL (New England Biolabs, Beverly, MA) and pRIT5 (Pharmacia, Piscataway, NJ) which fuse glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the target recombinant protein. Purified fusion proteins can be utilized in SLGP activity assays, (e.g., direct assays or competitive assays described in detail below), or to generate antibodies specific for SLGP proteins, for example. In a preferred embodiment, an SLGP fusion protein expressed in a retro viral expression vector ofthe present invention can be utilized to infect bone marrow cells which are subsequently transplanted into irradiated recipients. The pathology ofthe subject recipient is then examined after sufficient time has passed (e.g., six (6) weeks).
Examples of suitable inducible non-fusion E. coli expression vectors include pTrc (Amann et al, (1988) Gene 69:301-315) and pET l id (Studier et al, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, California (1990) 60-89). Target gene expression from the pTrc vector relies on host RNA polymerase transcription from a hybrid trp-lac fusion promoter. Target gene expression from the pET l id vector relies on transcription from a T7 gnlO-lac fusion promoter mediated by a coexpressed viral RNA polymerase (T7 gnl). This viral polymerase is supplied by host strains BL21(DE3) or HMS174(DE3) from a resident prophage harboring a T7 gnl gene under the transcriptional control ofthe lacUV 5 promoter.
One strategy to maximize recombinant protein expression in E. coli is to express the protein in a host bacteria with an impaired capacity to proteolytically cleave the recombinant protein (Gottesman, S., Gene Expression Technology: Methods in
Enzymology 185, Academic Press, San Diego, California (1990) 119-128). Another strategy is to alter the nucleic acid sequence ofthe nucleic acid to be inserted into an expression vector so that the individual codons for each amino acid are those preferentially utilized in E. coli (Wada et al, (1992) Nucleic Acids Res. 20:2111-2118).
Such alteration of nucleic acid sequences ofthe invention can be carried out by standard DNA synthesis techniques.
In another embodiment, the SLGP expression vector is a yeast expression vector. Examples of vectors for expression in yeast S. cerivisae include pYepSecl (Baldari, et al. , (1987) Embo J. 6:229-234), pMFa (Kurjan and Herskowitz, (1982) Cell 30:933- 943), pJRY88 (Schultz et al, (1987) Gene 54:113-123), pYES2 (Invitrogen Corporation, San Diego, CA), and picZ (InVitrogen Corp, San Diego, CA).
Alternatively, SLGP proteins can be expressed in insect cells using baculovirus expression vectors. Baculovirus vectors available for expression of proteins in cultured insect cells (e.g., Sf 9 cells) include the pAc series (Smith et al (1983) Mol Cell Biol. 3:2156-2165) and the pVL series (Lucklow and Summers (1989) Virology 170:31-39).
In yet another embodiment, a nucleic acid ofthe invention is expressed in mammalian cells using a mammalian expression vector. Examples of mammalian expression vectors include pCDM8 (Seed, B. (1987) Nature 329:840) and pMT2PC (Kaufman et al (1987) EMBO J. 6: 187- 195). When used in mammalian cells, the expression vector's control functions are often provided by viral regulatory elements. For example, commonly used promoters are derived from polyoma, Adenovirus 2, cytomegalovirus and Simian Virus 40. For other suitable expression systems for both prokaryotic and eukaryotic cells see chapters 16 and 17 of Sambrook, J., Fritsh, E. F., and Maniatis, T. Molecular Cloning: A Laboratory Manual. 2nd, ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989.
In another embodiment, the recombinant mammalian expression vector is capable of directing expression ofthe nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid). Tissue- specific regulatory elements are known in the art. Non-limiting examples of suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert et al. (1987) Genes Dev. 1 :268-277), lymphoid-specific promoters (Calame and Eaton (1988) Adv. Immunol. 43:235-275), in particular promoters of T cell receptors (Winoto and Baltimore (1989) EMBO J. 8:729-733) and immunoglobulins (Banerji et al. (1983) Cell
33:729-740; Queen and Baltimore (1983) Cell 33:741-748), neuron-specific promoters (e.g., the neurofilament promoter; Byrne and Ruddle (1989) PNAS 86:5473-5477), pancreas-specific promoters (Edlund et al. (1985) Science 230:912-916), and mammary gland-specific promoters (e.g., milk whey promoter; U.S. Patent No. 4,873,316 and European Application Publication No. 264, 166). Developmentally-regulated promoters are also encompassed, for example the murine hox promoters (Kessel and Grass (1990) Science 249:374-379) and the α-fetoprotein promoter (Campes and Tilghman (1989) Genes Dev. 3:537-546).
The invention further provides a recombinant expression vector comprising a DNA molecule of the invention cloned into the expression vector in an antisense orientation. That is, the DNA molecule is operatively linked to a regulatory sequence in a manner which allows for expression (by transcription ofthe DNA molecule) of an RNA molecule which is antisense to SLGP mRNA. Regulatory sequences operatively linked to a nucleic acid cloned in the antisense orientation can be chosen which direct the continuous expression ofthe antisense RNA molecule in a variety of cell types, for instance viral promoters and/or enhancers, or regulatory sequences can be chosen which direct constitutive, tissue specific or cell type specific expression of antisense RNA. The antisense expression vector can be in the form of a recombinant plasmid, phagemid or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced. For a discussion ofthe regulation of gene expression using antisense genes see Weintraub, H. et al, Antisense RNA as a molecular tool for genetic analysis, Reviews - Trends in Genetics, Vol. 1(1) 1986.
Another aspect ofthe invention pertains to host cells into which an SLGP nucleic acid molecule ofthe invention is introduced, e.g., an SLGP nucleic acid molecule within a recombinant expression vector or an SLGP nucleic acid molecule containing sequences which allow it to homologously recombine into a specific site ofthe host cell's genome. The terms "host cell" and "recombinant host cell" are used interchangeably herein. It is understood that such terms refer not only to the particular subject cell but to the progeny or potential progeny of such a cell. Because certain
modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope ofthe term as used herein.
A host cell can be any prokaryotic or eukaryotic cell. For example, an SLGP protein can be expressed in bacterial cells such as E. coli, insect cells, yeast or mammalian cells (such as Chinese hamster ovary cells (CHO) or COS cells). Other suitable host cells are known to those skilled in the art.
Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. As used herein, the terms "transformation" and "transfection" are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g., DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, DΕAΕ-dextran-mediated transfection, lipofection, or electroporation. Suitable methods for transforming or transfecting host cells can be found in Sambrook, et al. (Molecular Cloning: A Laboratory Manual. 2nd, ed, Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989), and other laboratory manuals.
For stable transfection of mammalian cells, it is known that, depending upon the expression vector and transfection technique used, only a small fraction of cells may integrate the foreign DNA into their genome. In order to identify and select these integrants, a gene that encodes a selectable marker (e.g., resistance to antibiotics) is generally introduced into the host cells along with the gene of interest. Preferred selectable markers include those which confer resistance to drugs, such as G418, hygromycin and methotrexate. Nucleic acid encoding a selectable marker can be introduced into a host cell on the same vector as that encoding an SLGP protein or can be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die).
A host cell ofthe invention, such as a prokaryotic or eukaryotic host cell in culture, can be used to produce (i.e., express) an SLGP protein. Accordingly, the invention further provides methods for producing an SLGP protein using the host cells
ofthe invention. In one embodiment, the method comprises culturing the host cell of invention (into which a recombinant expression vector encoding an SLGP protein has been introduced) in a suitable medium such that an SLGP protein is produced. In another embodiment, the method further comprises isolating an SLGP protein from the medium or the host cell.
The host cells ofthe invention can also be used to produce nonhuman transgenic animals. For example, in one embodiment, a host cell ofthe invention is a fertilized oocyte or an embryonic stem cell into which SLGP-coding sequences have been introduced. Such host cells can then be used to create non-human transgenic animals in which exogenous SLGP sequences have been introduced into their genome or homologous recombinant animals in which endogenous SLGP sequences have been altered. Such animals are useful for studying the function and/or activity of an SLGP - and for identifying and/or evaluating modulators of SLGP activity. As used herein, a "transgenic animal" is a non-human animal, preferably a mammal, more preferably a rodent such as a rat or mouse, in which one or more ofthe cells ofthe animal includes a transgene. Other examples of transgenic animals include non-human primates, sheep, dogs, cows, goats, chickens, amphibians, etc. A transgene is exogenous DNA which is integrated into the genome of a cell from which a transgenic animal develops and which remains in the genome ofthe mature animal, thereby directing the expression of an encoded gene product in one or more cell types or tissues of the.transgenic animal. As used herein, a "homologous recombinant animal" is a non-human animal, preferably a mammal, more preferably a mouse, in which an endogenous SLGP gene has been altered by homologous recombination between the endogenous gene and an exogenous DNA molecule introduced into a cell ofthe animal, e.g., an embryonic cell of the animal, prior to development ofthe animal.
A transgenic animal ofthe invention can be created by introducing an SLGP- encoding nucleic acid into the male pronuclei of a fertilized oocyte, e.g., by microinjection, retroviral infection, and allowing the oocyte to develop in a pseudopregnant female foster animal. The SLGP cDNA sequence of SEQ ID NOT can be introduced as a transgene into the genome of a non-human animal. Alternatively, a
nonhuman homologue of a human SLGP gene, such as a mouse or rat SLGP gene, can be used as a transgene. Alternatively, an SLGP gene homologue, such as another GPCR family member, can be isolated based on hybridization to the SLGP cDNA sequences of SEQ ID NOT, SEQ ID NO:3, SEQ ID NOT7, SEQ ID NOT9, or the DNA insert ofthe plasmid deposited with ATCC as Accession Number (described further in subsection I above) and used as a transgene. Intronic sequences and polyadenylation signals can also be included in the transgene to increase the efficiency of expression of the transgene. A tissue-specific regulatory sequence(s) can be operably linked to an SLGP transgene to direct expression of an SLGP protein to particular cells. Methods for generating transgenic animals via embryo 'manipulation and microinjection, particularly animals such as mice, have become conventional in the art and are described, for example, in U.S. Patent Nos. 4,736,866 and 4,870,009, both by Leder et al, U.S. Patent No. 4,873,191 by Wagner et al. and in Hogan, B., Manipulating the Mouse Embryo, (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1986). Similar methods are used for production of other transgenic animals. A transgenic founder animal can be identified based upon the presence of an SLGP transgene in its genome and/or expression of SLGP mRNA in tissues or cells ofthe animals. A transgenic founder animal can then be used to breed additional animals carrying the transgene. Moreover, transgenic animals carrying a transgene encoding an SLGP protein can further be bred to other transgenic animals carrying other transgenes.
To create a homologous recombinant animal, a vector is prepared which contains at least a portion of an SLGP gene into which a deletion, addition or substitution has been introduced to thereby alter, e.g., functionally disrupt, the SLGP gene. The SLGP gene can be a human gene (e.g., the cDNA of SEQ ID NO:3), but more preferably, is a non-human homologue of a human SLGP gene (e.g., the cDNA of SEQ ID NOT9). For example, the mouse SLGP gene can be used to construct a homologous recombination nucleic acid molecule, e.g., a vector, suitable for altering an endogenous SLGP gene in the mouse genome. In a preferred embodiment, the homologous recombination nucleic acid molecule is designed such that, upon homologous recombination, the endogenous SLGP gene is functionally disrupted (i.e., no longer encodes a functional protein; also
referred to as a "knock out" vector). Alternatively, the homologous recombination nucleic acid molecule can be designed such that, upon homologous recombination, the endogenous SLGP gene is mutated or otherwise altered but still encodes functional protein (e.g., the upstream regulatory region can be altered to thereby alter the expression ofthe, endogenous SLGP protein). In the homologous recombination nucleic acid molecule, the altered portion ofthe SLGP gene is flanked at its 5' and 3' ends by additional nucleic acid sequence ofthe SLGP gene to allow for homologous recombination to occur between the exogenous SLGP gene carried by the homologous recombination nucleic acid molecule and an endogenous SLGP gene in a cell, e.g., an embryonic stem cell. The additional flanking STGP nucleic acid sequence is of sufficient length for successful homologous recombination with the endogenous gene. Typically, several kilobases of flanking DNA (both at the 5' and 3' ends) are included in the homologous recombination nucleic acid molecule (see, e.g., Thomas, K.R. and Capecchi, M. R. (1987) Cell 51 :503 for a description of homologous recombination vectors). The homologous recombination nucleic acid molecule is introduced into a cell, e.g., an embryonic stem cell line (e.g., by electroporation) and cells in which the introduced SLGP gene has homologously recombined with the endogenous SLGP gene are selected (see e.g., Li, E. et al. (1992) Cell 69:915). The selected cells can then injected into a blastocyst of an animal (e.g., a mouse) to form aggregation chimeras (see e.g., Bradley, A. in Teratocarcinomas and Embryonic Stem Cells: A Practical
Approach, E.J. Robertson, ed. (IRL, Oxford, 1987) pp. 113-152). A chimeric embryo can then be implanted into a suitable pseudopregnant female foster animal and the embryo brought to term. Progeny harboring the homologously recombined DNA in their germ cells can be used to breed animals in which all cells ofthe animal contain the homologously recombined DNA by germline transmission ofthe transgene. Methods for constructing homologous recombination nucleic acid molecules, e.g., vectors, or homologous recombinant animals are described further in Bradley, A. (1991) Current Opinion in Biotechnology 2:823-829 and in PCT International Publication Nos.: WO 90/11354 by Le Mouellec et al. ; WO 91/01140 by Smithies et al. ; WO 92/0968 by Zij lstra et al. ; and WO 93/04169 by Berns et al.
In another embodiment, transgenic non-humans animals can be produced which contain selected systems which allow for regulated expression ofthe transgene. One example of such a system is the cre/loxP recombinase system of bacteriophage PI . For a description ofthe cre/loxP recombinase system, see, e.g., Lakso et al. (1992) PNAS 89:6232-6236. Another example of a recombinase system is the FLP recombinase system of Saccharomyces cerevisiae (O'Gorman et al. (1991) Science 251:1351-1355. If a cre/loxP recombinase system is used to regulate expression ofthe transgene, animals containing transgenes encoding both the Cre recombinase and a selected protein are required. Such animals can be provided through the construction of "double" transgenic animals, e.g., by mating two transgenic animals, one containing a transgene encoding a selected protein and the other containing a transgene encoding a recombinase.
Clones ofthe non-human transgenic animals described herein can also be produced according to the methods described in Wilmut, I. et al. (1997) Nature 385:810- 813. In brief, a cell, e.g., a somatic cell, from the transgenic animal can be isolated and induced to exit the growth cycle and enter G0 phase. The quiescent cell can then be fused, e.g., through the use of electrical pulses, to an enucleated oocyte from an animal of the same species from which the quiescent cell is isolated. The reconstructed oocyte is then cultured such that it develops to morula or blastocyte and then transferred to pseudopregnant female foster animal. The offspring borne of this female foster animal will be a clone ofthe animal from which the cell, e.g., the somatic cell, is isolated. Alternatively, a cell, e.g., an embryonic stem cell, from the inner cell mass of a developing embryo can be transformed with a preferred transgene. Alternatively, a cell, e.g., a somatic cell, from cell culture line can be transformed with a preferred transgene and induced to exit the growth cycle and enter G0 phase. The cell can then be fused, e.g., through the use of electrical pulses, to an enucleated mammalian oocyte. The reconstructed oocyte is then cultured such that it develops to morula or blastocyst and then transferred to pseudopregnant female foster animal. The offspring borne of this female foster animal will be a clone ofthe animal from which the nuclear donor cell, e.g., the somatic cell, is isolated.
IV. Pharmaceutical Compositions
The SLGP nucleic acid molecules, SLGP proteins, anti-SLGP antibodies, SLGP ligands, and SLGP modulators (also referred to herein as "active compounds") ofthe invention can be incorporated into pharmaceutical compositions suitable for administration. Such compositions typically comprise the nucleic acid molecule, protein, antibody, or modulatory compound and a pharmaceutically acceptable carrier. As used herein the language "pharmaceutically acceptable carrier" is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incoφorated into the compositions. A pharmaceutical composition ofthe invention is formulated to be compatible with its intended route of administration. Examples of routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (topical), transmucosal, and rectal administration. Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
Pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor EL™ (BASF, Parsippany, NJ) or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance ofthe required particle size in the case of dispersion and by the use of surfactants. Prevention ofthe action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as manitol, sorbitol, sodium chloride in the composition. Prolonged absorption ofthe injectable compositions can be brought about by including in the composition an agent which delays absoφtion, for example, aluminum monostearate and gelatin.
Sterile injectable solutions can be prepared by incoφorating the active compound (e.g., an SLGP protein or anti-SLGP antibody) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incoφorating the active compound into a sterile vehicle which contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying which yields a powder ofthe active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the puφose of oral therapeutic administration, the active compound can be incoφorated with excipients and used in the form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part ofthe composition. The tablets, pills, capsules, troches and the like can contain any ofthe following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring. For administration by inhalation, the compounds are delivered in the form of an aerosol spray from pressured container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
Systemic administration can also be by transmucosal or transdermal means. For transmucosal or transdermal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives. Transmucosal administration can be accomplished through the use of nasal sprays or suppositories. For transdermal administration, the active compounds are formulated into ointments, salves, gels, or creams as generally known in • the art.
The compounds can also be prepared in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
In one embodiment, the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid.
Methods for preparation of such formulations will be apparent to those skilled in the art. The materials can also be obtained commercially from Alza Coφoration and Nova Pharmaceuticals, Inc. Liposomal suspensions (including liposomes targeted to infected cells with monoclonal antibodies to viral antigens) can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Patent No. 4,522,811.
It is especially advantageous to formulate oral or parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms ofthe invention are dictated by and directly dependent on the unique characteristics ofthe active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.
Toxicity and therapeutic efficacy of such compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% ofthe population) and the ED50 (the dose therapeutically effective in 50%> ofthe population). The dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio
LD50/ED50. Compounds which exhibit large therapeutic indices are preferred. While compounds that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such compounds to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects.
The data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage for use in humans. The dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration utilized. For any compound used in the method ofthe invention, the therapeutically effective dose can be estimated initially from cell culture assays. A dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the test compound which achieves a half-maximal inhibition of symptoms) as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. Levels in plasma may be measured, for example, by high performance liquid chromatography.
The nucleic acid molecules ofthe invention can be inserted into vectors and used as gene therapy vectors. Gene therapy vectors can be delivered to a subject by, for example, intravenous injection, local administration (see U.S. Patent 5,328,470) or by stereotactic injection (see e.g., Chen et al (1994) PNAS 91 :3054-3057). The pharmaceutical preparation ofthe gene therapy vector can include the gene therapy vector in an acceptable diluent, or can comprise a slow release matrix in which the gene delivery vehicle is imbedded. Alternatively, where the complete gene delivery vector can be produced intact from recombinant cells, e.g., retro viral vectors, the pharmaceutical preparation can include one or more cells which produce the gene delivery system.
The pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration.
V. Uses and Methods ofthe Invention
The nucleic acid molecules, proteins, protein homologues, and antibodies described herein can be used in one or more ofthe following methods: a) screening assays; b) predictive medicine (e.g., diagnostic assays, prognostic assays, monitoring clinical trials, and pharmacogenetics); and c) methods of treatment (e.g., therapeutic and
prophylactic). As described herein, an SLGP protein ofthe invention has one or more of the following activities: (i) interaction of an SLGP protein with soluble SLGP ligand (e.g., CD55); (ii) interaction of an SLGP protein with a membrane-bound non-SLGP protein; (iii) interaction of an SLGP protein with an intracellular protein (e.g., an intracellular enzyme or signal transduction molecule); (iv) indirect interaction of an SLGP protein with an intracellular protein (e.g., a downstream signal transduction molecule); and (v) modulation of cellular proliferation, migration, and growth and thus can be used in, for example, (1) modulation of cellular signal transduction, either in vitro or in vivo; (2) regulation of activation in a cell expressing an SLGP protein exposure to alpha-latrotoxin); (3) regulation of inflammation; or (4) modulation of angiogenesis (e.g., proliferation, elongation, and migration of endothelial cells (e.g. tumor endothelial cells), to form new vessels).
The isolated nucleic acid molecules ofthe invention can be used, for example, to express SLGP protein (e.g., via a recombinant expression vector in a host cell in gene therapy applications), to detect SLGP mRNA (e.g., in a biological sample) or a genetic alteration in an SLGP gene, and to modulate SLGP activity, as described further below. • The SLGP proteins can be used to treat disorders characterized by insufficient or excessive production of an SLGP protein and/or SLGP ligand (e.g., cancer and diseases characterized by increased or decreased angiogenesis such as, for example arthritis, retinal and optic disk neovascularization, and tissue ischemia , such as myocardial ischemia). In addition, the SLGP proteins can be used to screen drugs or compounds which modulate the SLGP activity as well as to treat disorders characterized by insufficient or excessive production of SLGP protein or production of SLGP protein forms which have decreased or aberrant activity compared to SLGP wild type protein (e.g., cellular proliferation, growth, differentiation, or migration disorder (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia). Moreover, the anti-SLGP antibodies ofthe invention can be used to detect and isolate SLGP proteins, regulate the bioavailability of SLGP proteins, and modulate SLGP activity.
A. Screening Assays:
The invention provides a method (also referred to herein as a "screening assay") for identifying modulators, i.e., candidate or test compounds or agents (e.g., peptides, peptidomimetics, small molecules or other drugs) which bind to SLGP proteins, or have a stimulatory or inhibitory effect on, for example, SLGP expression or SLGP activity (e.g., angiogenesis). Compounds identified using the assays described herein may be useful for treating diseases associated with aberrant angiogenesis (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia). In one embodiment, the invention provides assays for screening candidate or test compounds which bind to or modulate the activity of an SLGP protein or polypeptide or biologically active portion thereof. The test compounds ofthe present invention can be obtained using any ofthe numerous approaches in combinatorial library methods known in the art, including: biological libraries; spatially addressable parallel solid phase or solution phase libraries; synthetic library methods requiring deconvolution; the 'one- bead one-compound' library method; and synthetic library methods using affinity chromatography selection. The biological library approach is limited to peptide libraries, while the other four approaches are applicable to peptide, non-peptide oligomer or small molecule libraries of compounds (Lam, K.S. (1991) Anticancer Drug Des. 12:145).
Examples of methods for the synthesis of molecular libraries can be found in the art, for example in: DeWitt et al. (1993) Proc. Natl Acad. Sci. U.S.A. 90:6909; Erb et al. (1994) Proc. Natl. Acad. Sci. USA 91 :11422; Zuckermann et al. (1994). J Med. Chem. 37:2678; Cho et α/. (1993) Science 261:1303; Carrell et al. (1994) Angew. Chem. Int. Ed. Engl. 33:2059; Carell et al (1994) Angew. Chem. Int. Ed. Engl 33:2061; and in Gallop et al. (1994) J. Med. Chem. 37:1233.
Libraries of compounds may be presented in solution (e.g., Houghten (1992) Biotechniques 13:412-421), or on beads (Lam (1991) Nature 354:82-84), chips (Fodor (1993) Nature 364:555-556), bacteria (Ladner USP 5,223,409), spores (Ladner USP '409), plasmids (Cull et al. (1992) Proc Natl Acad Sci USA 89:1865-1869) or on phage
(Scott and Smith (1990) Science 249:386-390); (Devlin (1990) Science 249:404-406); (Cwirla et al. (1990) Proc. Natl. Acad. Sci. 87:6378-6382); (Felici (1991) J Mol. Biol. 222:301-310); (Ladner supra.).
In one embodiment, an assay is a cell-based assay in which a cell which expresses an SLGP protein on the cell surface is contacted with a test compound and the ability ofthe test compound to bind to the SLGP protein determined. The cell, for example, can be of mammalian origin or a yeast cell. Determining the ability ofthe test compound to bind to an SLGP protein can be accomplished, for example, by coupling the test compound with a radioisotope or enzymatic label such that binding ofthe test compound to the SLGP protein can be determined by detecting the labeled compound in a complex. For example, test compounds can be labeled with 125I, 35S, 14C, or 3H, either directly or indirectly, and the radioisotope detected by direct counting of radioemmission or by scintillation counting. Alternatively, test compounds can be enzymatically labeled with, for example, horseradish peroxidase, alkaline phosphatase, or luciferase, and the enzymatic label detected by determination of conversion of an appropriate substrate to product.
It is also within the scope of this invention to determine the ability of a test compound to interact with an SLGP protein without the labeling of any ofthe interactants. For example, a microphysiometer can be used to detect the interaction of a test compound with an SLGP protein without the labeling of either the test compound or the receptor. McConnell, H. M. et al. (1992) Science 257:1906-1912. As used herein, a "microphysiometer" (e.g., Cytosensor™) is an analytical instrument that measures the rate at which a cell acidifies its environment using a light-addressable potentiometric sensor (LAPS). Changes in this acidification rate can be used as an indicator ofthe interaction between ligand and receptor.
In another embodiment, an assay is a cell-based assay comprising contacting a cell expressing an SLGP target molecule (e.g., an SLGP substrate) with a test compound and determining the ability ofthe test compound to modulate (e.g., stimulate or inhibit) the activity ofthe SLGP target molecule. Determining the ability ofthe test compound to modulate the activity of an SLGP target molecule can be accomplished, for example,
by determining the ability ofthe SLGP protein to bind to or interact with the SLGP target molecule.
In another embodiment, an assay is a cell-based assay comprising contacting cells expressing an SLGP molecule with a test compound and determining the ability of the test compound to modulate (e.g., stimulate or inhibit) an SLGP activity, e.g., cellular proliferation, migration, growth or differentiation, and formation of vessels in endothelial tissues (e.g., angiogenesis). The cells can be of mammalian origin, e.g., an endothelial cell.
Cellular models may also be used to identify modulators of SLGP activity (e.g., modulators of angiogenesis) and to determine the ability of test compounds to modulate the activity of an SLGP target molecule. Cellular models for the study of angiogenesis include models of endothelial cell differentiation on Matrigel (Baatout, S. et al. (1996) Rom. J. Intern. Med. 34:263-269; Benelli, R et al. (1999) Int. J. Biol. Markers 14:243- 246), the culture of microvessel fragments in physiological gels (Hoying, JB et al. (1996) In Vitro Cell Dev. Biol. Anim. 32: 409-419; US Patent No. 5,976,782), and the treatment of endothelial cells and smooth muscle cells with atherogenic and angiogenic factors including growth factors and cytokines (e.g., IL-lβ, PDGF, TNFα, VEGF), homocysteine, and LDL. In vitro angiogenesis models are described in, for example, Black, AF et al (1999) Cell Biol. Toxicol 15:81-90. In a preferred embodiment, the assay comprises contacting a cell which expresses an SLGP protein or biologically active portion thereof, on the cell surface with an SLGP ligand, to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability ofthe test compound to interact with the SLGP protein or biologically active portion thereof, wherein determining the ability ofthe test compound to interact with the SLGP protein or biologically active portion thereof, comprises determining the ability ofthe test compound to preferentially bind to the SLGP protein or biologically active portion thereof, as compared to the ability ofthe SLGP ligand to bind to the SLGP protein or biologically active portion thereof.
Determining the ability ofthe SLGP ligand or SLGP modulator to bind to or interact with an SLGP protein or biologically active portion thereof, can be accomplished by one ofthe methods described above for determining direct binding. In a preferred embodiment, determining the ability ofthe SLGP ligand or modulator to bind to or interact with an SLGP protein or biologically active portion thereof, can be accomplished by determining the activity of an SLGP protein or of a downstream SLGP target molecule. For example, the target molecule can be a cellular second messenger, and the activity ofthe target molecule can be determined by detecting induction ofthe target (i.e. intracellular Ca2 +, diacylglycerol, IP 3, etc.), detecting catalytic/enzymatic activity ofthe target on an appropriate substrate, detecting the induction of a reporter gene (comprising an SLGP-responsive regulatory element operatively linked to a nucleic acid encoding a detectable marker, e.g., luciferase), or detecting a cellular response, for example, a cellular proliferation, growth, differentiation, or migration response. Accordingly, in one embodiment the present invention involves a method of identifying a compound which modulates the activity of an SLGP protein, comprising contacting a cell which expresses an SLGP protein with a test compound, determining the ability of the test compound to modulate the activity the SLGP protein (e.g., angiogenesis), and identifying the compound as a modulator of SLGP activity. In another embodiment, the present invention involves a method of identifying a compound which modulates the activity of an SLGP protein, comprising contacting a cell which expresses an SLGP protein with a test compound, determining the ability ofthe test compound to modulate the activity of a downstream SLGP target molecule, and identifying the compound as a modulator of SLGP activity.
In yet another embodiment, an assay ofthe present invention is a cell-free assay in which an SLGP protein or biologically active portion thereof is contacted with a test compound and the ability ofthe test compound to bind to the SLGP protein or biologically active portion thereof is determined. Binding ofthe test compound to the SLGP protein can be determined either directly or indirectly as described above.
Binding ofthe test compound to the SLGP protein can also be accomplished using a technology such as real-time Biomolecular Interaction Analysis (BIA). Sjolander, S. and Urbaniczky, C. (1991) Anal. Chem. 63:2338-2345 and Szabo et al. (1995) Curr. Opin. Struct. Biol. 5:699-705. As used herein, "BIA" is a technology for studying biospecific interactions in real time, without labeling any ofthe interactants (e.g., BIAcore™). Changes in the optical phenomenon of surface plasmon resonance (SPR) can be used as an indication of real-time reactions between biological molecules.
In a preferred embodiment, the assay includes contacting the SLGP protein or biologically active portion thereof with a known ligand which binds SLGP to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability ofthe test compound to interact with an SLGP protein, wherein determining the ability ofthe test compound to interact with an SLGP protein comprises determining the ability ofthe test compound to preferentially bind to SLGP or biologically active portion thereof as compared to the known ligand. In another embodiment, the assay is a cell-free assay in which an SLGP protein or biologically active portion thereof is contacted with a test compound and the ability of the test compound to modulate (e.g., stimulate or inhibit) the activity ofthe SLGP protein or biologically active portion thereof is determined. Preferred biologically active portions ofthe SLGP proteins to be used in assays ofthe present invention include fragments which participate in interactions with non-SLGP molecules, e.g., fragments with high surface probability scores. Determining the ability ofthe test compound to modulate the activity of an SLGP protein can be accomplished, for example, by determining the ability ofthe SLGP protein to modulate the activity of a downstream SLGP target molecule by one ofthe methods described above for cell-based assays. For example, the catalytic/enzymatic activity ofthe target molecule on an appropriate substrate can be determined as previously described.
In yet another embodiment, the cell-free assay involves contacting an SLGP protein or biologically active portion thereof with a known ligand which binds the SLGP protein to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability ofthe test compound to interact with the SLGP protein,
wherein determining the ability ofthe test compound to interact with the SLGP protein comprises determining the ability ofthe test compound to preferentially bind to or modulate the activity of an SLGP target molecule, as compared to the known ligand.
The cell-free assays ofthe present invention are amenable to use of both soluble and/or membrane-bound forms of isolated proteins (e.g. SLGP proteins or biologically active portions thereof or SLGP proteins). In the case of cell-free assays in which a membrane-bound form an isolated protein is used (e.g., an SLGP protein) it may be desirable to utilize a solubilizing agent such that the membrane-bound form ofthe isolated protein is maintained in solution. Examples of such solubilizing agents include non-ionic detergents such as n-octylglucoside, n-dodecylglucoside, n-dodecylmaltoside, octanoyl-N-methylglucamide, decanoyl-N-methylglucamide, Triton® X-100, Triton® X-l 14, Thesit®, Isotridecypoly(ethylene glycol ether)n, 3-[(3- cholamidopropyl)dimethylamminio]-l -propane sulfonate (CHAPS), 3-[(3- cholamidopropyl)dimethylamminio]-2-hydroxy-l -propane sulfonate (CHAPSO), or N- dodecyl=N,N-dimethyl-3-ammonio- 1 -propane sulfonate.
In more than one embodiment ofthe above assay methods ofthe present invention, it may be desirable to immobilize either SLGP or its target molecule to facilitate separation of complexed from uncomplexed forms of one or both ofthe proteins, as well as to accommodate automation ofthe assay. Binding of a test compound to an SLGP protein, or interaction of an SLGP protein with a target molecule in the presence and absence of a candidate compound, can be accomplished in any vessel suitable for containing the reactants. Examples of such vessels include microtitre plates, test tubes, and micro-centrifuge tubes. In one embodiment, a fusion protein can be provided which adds a domain that allows one or both ofthe proteins to be bound to a matrix. For example, glutathione-S -transferase/ SLGP fusion proteins or glutathione-S- transferase/target fusion proteins can be adsorbed onto glutathione sepharose beads (Sigma Chemical, St. Louis, MO) or glutathione derivatized microtitre plates, which are then combined with the test compound or the test compound and either the non-adsorbed target protein or SLGP protein, and the mixture incubated under conditions conducive to complex formation (e.g., at physiological conditions for salt and pH). Following
incubation, the beads or microtitre plate wells are washed to remove any unbound components, the matrix immobilized in the case of beads, complex determined either directly or indirectly, for example, as described above. Alternatively, the complexes can be dissociated from the matrix, and the level of SLGP binding or activity determined using standard techniques.
Other techniques for immobilizing proteins on matrices can also be used in the screening assays ofthe invention. For example, either an SLGP protein or an SLGP target molecule can be immobilized utilizing conjugation of biotin and streptavidin. Biotinylated SLGP protein or target molecules can be prepared from biotin-NHS (N-
» hydroxy-succinimide) using techniques well known in the art (e.g., biotinylation kit, Pierce Chemicals, Rockford, IL), and immobilized in the wells of streptavidin-coated 96 well plates (Pierce Chemical). Alternatively, antibodies reactive with SLGP protein or target molecules but which do not interfere with binding ofthe SLGP protein to its target molecule can be derivatized to the wells ofthe plate, and unbound target or SLGP protein trapped in the wells by antibody conjugation. Methods for detecting such complexes, in addition to those described above for the GST-immobilized complexes, include immunodetection of complexes using antibodies reactive with the SLGP protein or target molecule, as well as enzyme-linked assays which rely on detecting an enzymatic activity associated with the SLGP protein or target molecule. In another embodiment, modulators of SLGP expression are identified in a method wherein a cell is contacted with a candidate compound and the expression of SLGP mRNA or protein in the cell is determined. The level of expression of SLGP mRNA or protein in the presence ofthe candidate compound is compared to the level of expression of SLGP mRNA or protein in the absence ofthe candidate compound. The candidate compound can then be identified as a modulator of SLGP expression based on this comparison. For example, when expression of SLGP mRNA or protein is greater (statistically significantly greater) in the presence ofthe candidate compound than in its absence, the candidate compound is identified as a stimulator of SLGP mRNA or protein expression. Alternatively, when expression of SLGP mRNA or protein is less (statistically significantly less) in the presence ofthe candidate compound than in its
absence, the candidate compound is identified as an inhibitor of SLGP mRNA or protein expression. The level of SLGP mRNA or protein expression in the cells can be determined by methods described herein for detecting SLGP mRNA or protein.
In yet another aspect ofthe invention, the SLGP proteins can be used as "bait proteins" in a two-hybrid assay or three-hybrid assay (see, e.g., U.S. Patent No.
5,283,317; Zervos et al. (1993) Cell 72:223-232; Madura et al. (1993) J. Biol. Chem. 268:12046-12054; Bartel et al. (1993) Biotechniques 14:920-924; Iwabuchi et al. (1993) Oncogene 8:1693-1696; and Brent WO94/10300), to identify other proteins, which bind to or interact with SLGP ("SLGP-binding proteins" or "SLGP-bp") and are involved in SLGP activity. Such SLGP-binding proteins are also likely to be involved in the propagation of signals by the SLGP proteins as, for example, downstream elements of an SLGP-mediated signaling pathway. Alternatively, such SLGP-binding proteins are likely to be cell-surface molecules associated with non-SLGP expressing cells, wherein such SLGP-binding proteins are involved in chemoattraction. The two-hybrid system is based on the modular nature of most transcription factors, which consist of separable DNA-binding and activation domains. Briefly, the assay utilizes two different DNA constructs. In one construct, the gene that codes for an SLGP protein is fused to a gene encoding the DNA binding domain of a known transcription factor (e.g., GAL-4). In the other construct, a DNA sequence, from a library of DNA sequences, that encodes an unidentified protein ("prey" or "sample") is fused to a gene that codes for the activation domain ofthe known transcription factor. If the "bait" and the "prey" proteins are able to interact, in vivo, forming an SLGP- dependent complex, the DNA-binding and activation domains ofthe transcription factor are brought into close proximity. This proximity allows transcription of a reporter gene (e.g., LacZ) which is operably linked to a transcriptional regulatory site responsive to the transcription factor. Expression ofthe reporter gene can be detected and cell colonies • containing the functional transcription factor can be isolated and used to obtain the cloned gene which encodes the protein which interacts with the SLGP protein.
This invention further pertains to novel agents identified by the above-described screening assays. Accordingly, it is within the scope of this invention to further use an agent identified as described herein in an appropriate animal model. For example, an agent identified as described herein (e.g., an SLGP modulating agent, an antisense SLGP nucleic acid molecule, an SLGP-specific antibody, or an SLGP-binding partner) can be used in an animal model to determine the efficacy, toxicity, or side effects of treatment with such an agent. Alternatively, an agent identified as described herein can be used in an animal model to determine the mechanism of action of such an agent. Furthermore, this invention pertains to uses of novel agents identified by the above-described screening assays for treatments as described herein.
In vivo methods for identifying modulators of SLGP activity (e.g., modulators of angiogenesis in, for example, tumors), or expression are also within the scope ofthe invention. Models for studying angiogenesis in vivo include, for example, tumor cell- induced angiogenesis and tumor metastasis (Hoffman, RM (1998-99) Cancer Metastasis Rev. 17:271-277; Holash, J et al. (1999) Oncogene 18:5356-5362; Li, CY et al. (2000) J. Natl Cancer Inst. 92:143-147), matrix induced angiogenesis (US Patent No. 5,382,514), the disc angiogenesis system (Kowalski, j. et al. (1992) Exp. Mol. Pathol 56:1-19), the rodent mesenteric-window angiogenesis assay (Norrby, K (1992) EXS 61 :282-286), experimental choroidal neovascularization in the rat (Shen, WY et al. (1998) Br. J. Ophthalmol 82:1063-1071), and the chick embryo development (Brooks, PC et al. Methods Mol. Biol. (1999) 129:257-269) and chick embryo chorioallantoic membrane (CAM) models (McNatt LG et al. (1999) J. Ocul Pharmacol. Ther. 15:413-423; Ribatti, D et al (1996) Int. J. Dev. Biol. 40:1189-1197), and are reviewed in Ribatti, D and Vacca, A (1999) Int. J. Biol Markers 14:207-213.
B. Detection Assays
Portions or fragments ofthe cDNA sequences identified herein (and the corresponding complete gene sequences) can be used in numerous ways as polynucleotide reagents. For example, these sequences can be used to: (i) map their respective genes on a chromosome; and, thus, locate gene regions associated with
genetic disease; (ii) identify an individual from a minute biological sample (tissue typing); and (iii) aid in forensic identification of a biological sample. These applications are described in the subsections below.
1. Chromosome Mapping
Once the sequence (or a portion ofthe sequence) of a gene has been isolated, this sequence can be used to map the location ofthe gene on a chromosome. This process is called chromosome mapping. Accordingly, portions or fragments ofthe SLGP nucleotide sequences, described herein, can be used to map the location ofthe SLGP genes on a chromosome. The mapping ofthe SLGP sequences to chromosomes is an important first step in correlating these sequences with genes associated with disease.
Briefly, SLGP genes can be mapped to chromosomes by preparing PCR primers (preferably 15-25 bp in length) from the SLGP nucleotide sequences. Computer analysis ofthe SLGP sequences can be used to predict primers that do not span more than one exon in the genomic DNA, thus complicating the amplification process. These primers can then be used for PCR screening of somatic cell hybrids containing individual human chromosomes. Only those hybrids containing the human gene corresponding to the SLGP sequences will yield an amplified fragment.
Somatic cell hybrids are prepared by fusing somatic cells from different mammals (e.g., human and mouse cells). As hybrids of human and mouse cells grow and divide, they gradually lose human chromosomes in random order, but retain the mouse chromosomes. By using media in which mouse cells cannot grow, because they lack a particular enzyme, but human cells can, the one human chromosome that contains the gene encoding the needed enzyme, will be retained. By using various media, panels of hybrid cell lines can be established. Each cell line in a panel contains either a single human chromosome or a small number of human chromosomes, and a full set of mouse chromosomes, allowing easy mapping of individual genes to specific human chromosomes. (D'Eustachio P. et al. (1983) Science 220:919-924). Somatic cell hybrids containing only fragments of human chromosomes can also be produced by using human chromosomes with translocations and deletions.
PCR mapping of somatic cell hybrids is a rapid procedure for assigning a particular sequence to a particular chromosome. Three or more sequences can be assigned per day using a single thermal cycler. Using the SLGP nucleotide sequences to design oligonucleotide primers, sublocalization can be achieved with panels of fragments from specific chromosomes. Other mapping strategies which can similarly be used to map a 9o, lp, or lv sequence to its chromosome include in situ hybridization (described in Fan, Y. et al (1990) PNAS, 87:6223-27), pre-screening with labeled flow- sorted chromosomes, and pre-selection by hybridization to chromosome specific cDNA libraries. Fluorescence in situ hybridization (FISH) of a DNA sequence to a metaphase chromosomal spread can further be used to provide a precise chromosomal location in one step. Chromosome spreads can be made using cells whose division has been blocked in metaphase by a chemical such as colcemid that disrupts the mitotic spindle. The chromosomes can be treated briefly with trypsin, and then stained with Giemsa. A pattern of light and dark bands develops on each chromosome, so that the chromosomes can be identified individually. The FISH technique can be used with a DNA sequence as short as 500 or 600 bases. However, clones larger than 1,000 bases have a higher likelihood of binding to a unique chromosomal location with sufficient signal intensity for simple detection. Preferably 1,000 bases, and more preferably 2,000 bases will suffice to get good results at a reasonable amount of time. For a review of this technique, see Verma et al, Human Chromosomes: A Manual of Basic Techniques (Pergamon Press, New York 1988).
Reagents for chromosome mapping can be used individually to mark a single chromosome or a single site on that chromosome, or panels of reagents can be used for marking multiple sites and/or multiple chromosomes. Reagents corresponding to noncoding regions ofthe genes actually are preferred for mapping puφoses. Coding sequences are more likely to be conserved within gene families, thus increasing the chance of cross hybridizations during chromosomal mapping.
Once a sequence has been mapped to a precise chromosomal location, the physical position ofthe sequence on the chromosome can be correlated with genetic map data. (Such data are found, for example, in V. McKusick, Mendelian Inheritance in Man, available on-line through Johns Hopkins University Welch Medical Library). The relationship between a gene and a disease, mapped to the same chromosomal region, can then be identified through linkage analysis (co-inheritance of physically adjacent genes), described in, for example, Egeland, J. et al. (1987) Nature, 325:783-787.
Moreover, differences in the DNA sequences between individuals affected and unaffected with a disease associated with the SLGP gene, can be determined. If a mutation is observed in some or all ofthe affected individuals but not in any unaffected individuals, then the mutation is likely to be the causative agent ofthe particular disease. Comparison of affected and unaffected individuals generally involves first looking for structural alterations in the chromosomes, such as deletions or translocations that are visible from chromosome spreads or detectable using PCR based on that DNA sequence. Ultimately, complete sequencing of genes from several individuals can be performed to confirm the presence of a mutation and to distinguish mutations from polymoφhisms.
2. Tissue Typing
The SLGP sequences ofthe present invention can also be used to identify individuals from minute biological samples. The United States military, for example, is considering the use of restriction fragment length polymoφhism (RFLP) for identification of its personnel. In this technique, an individual's genomic DNA is digested with one or more restriction enzymes, and probed on a Southern blot to yield unique bands for identification. This method does not suffer from the current limitations of "Dog Tags" which can be lost, switched, or stolen, making positive identification difficult. The sequences ofthe present invention are useful as additional DNA markers for RFLP (described in U.S. Patent 5,272,057).
Furthermore, the sequences ofthe present invention can be used to provide an alternative technique which determines the actual base-by-base DNA sequence of selected portions of an individual's genome. Thus, the SLGP nucleotide sequences
described herein can be used to prepare two PCR primers from the 5' and 3' ends ofthe sequences. These primers can then be used to amplify an individual's DNA and subsequently sequence it.
Panels of corresponding DNA sequences from individuals, prepared in this manner, can provide unique individual identifications, as each individual will have a unique set of such DNA sequences due to allelic differences. The sequences ofthe present invention can be used to obtain such identification sequences from individuals and from tissue. The SLGP nucleotide sequences ofthe invention uniquely represent portions ofthe human genome. Allelic variation occurs to some degree in the coding regions of these sequences, and to a greater degree in the noncoding regions. It is estimated that allelic variation between individual humans occurs with a frequency of about once per each 500 bases. Each ofthe sequences described herein can, to some degree, be used as a standard against which DNA from an individual can be compared for identification puφoses. Because greater numbers of polymoφhisms occur in the noncoding regions, fewer sequences are necessary to differentiate individuals. The noncoding sequences of SEQ ID NOT, can comfortably provide positive individual identification with a panel of perhaps 10 to 1,000 primers which each yield a noncoding amplified sequence of 100 bases. If predicted coding sequences, such as those in SEQ ID NO: 3 are used, a more appropriate number of primers for positive individual identification would be 500-2,000.
If a panel of reagents from SLGP nucleotide sequences described herein is used to generate a unique identification database for an individual, those same reagents can later be used to identify tissue from that individual. Using the unique identification database, positive identification ofthe individual, living or dead, can be made from extremely small tissue samples.
3. Use of Partial SLGP Sequences in Forensic Biology DNA-based identification techniques can also be used in forensic biology. Forensic biology is a scientific field employing genetic typing of biological evidence found at a crime scene as a means for positively identifying, for example, a peφetrator
of a crime. To make such an identification, PCR technology can be used to amplify DNA sequences taken from very small biological samples such as tissues, e.g., hair or skin, or body fluids, e.g., blood, saliva, or semen found at a crime scene. The amplified sequence can then be compared to a standard, thereby allowing identification ofthe origin ofthe biological sample.
The sequences ofthe present invention can be used to provide polynucleotide reagents, e.g., PCR primers, targeted to specific loci in the human genome, which can enhance the reliability of DNA-based forensic identifications by, for example, providing another "identification marker" (i.e. another DNA sequence that is unique to a particular individual). As mentioned above, actual base sequence information can be used for identification as an accurate alternative to patterns formed by restriction enzyme generated fragments. Sequences targeted to noncoding regions of SEQ ID NOT are particularly appropriate for this use as greater numbers of polymoφhisms occur in the noncoding regions, making it easier to differentiate individuals using this technique. Examples of polynucleotide reagents include the SLGP nucleotide sequences or portions thereof, e.g., fragments derived from the noncoding regions of SEQ ID NOT, having a length of at least 20 bases, preferably at least 30 bases.
The SLGP nucleotide sequences described herein can further be used to provide polynucleotide reagents, e.g., labeled or labelable probes which can be used in, for example, an in situ hybridization technique, to identify a specific tissue, e.g., HMVEC tissue. This can be very useful in cases where a forensic pathologist is presented with a tissue of unknown origin. Panels of such SLGP probes can be used to identify tissue by species and/or by organ type.
In a similar fashion, these reagents, e.g., SLGP primers or probes can be used to screen tissue culture for contamination (i. e. screen for the presence of a mixture of different types of cells in a culture).
C. Predictive Medicine:
The present invention also pertains to the field of predictive medicine in which diagnostic assays, prognostic assays, and monitoring clinical trails are used for
prognostic (predictive) puφoses to thereby treat an individual prophylactically. Accordingly, one aspect ofthe present invention relates to diagnostic assays for determining SLGP protein and/or nucleic acid expression as well as SLGP activity, in the context of a biological sample (e.g., blood, serum, cells, (e.g., endothelial cells, including endothelial cells in tumors), and tissue) to thereby determine whether an individual is afflicted with a disease or disorder, or is at risk of developing a disorder, associated with aberrant SLGP expression or activity (e.g., a cellular proliferation, growth, differentiation, or migration disorder, (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia)). The invention also provides for prognostic (or predictive) assays for determining whether an individual is at risk of developing a disorder associated with SLGP protein, nucleic acid expression or activity. For example, mutations in an SLGP gene can be assayed in a biological sample. Such assays can be used for prognostic or predictive puφose to thereby phophylactically treat an individual prior to the onset of a disorder characterized by or associated with SLGP protein, nucleic acid expression or activity.
Another aspect ofthe invention pertains to monitoring the influence of agents (e.g., drugs, compounds) on the expression or activity of SLGP in clinical trials.
These and other agents are described in further detail in the following sections.
1. Diagnostic Assays
An exemplary method for detecting the presence or absence of SLGP protein or nucleic acid in a biological sample involves obtaining a biological sample from a test subject and contacting the biological sample with a compound or an agent capable of detecting SLGP protein or nucleic acid (e.g., mRNA, genomic DNA) that encodes SLGP protein such that the presence of SLGP protein or nucleic acid is detected in the biological sample. A preferred agent for detecting SLGP mRNA or genomic DNA is a labeled nucleic acid probe capable of hybridizing to SLGP mRNA or genomic DNA. The nucleic acid probe can be, for example, a full-length SLGP nucleic acid, such as the nucleic acid of SEQ ID NO: 1, SEQ ID NO: 17, or a fragment or portion of an SLGP nucleic acid such as an oligonucleotide of at least 15, 30, 50, 100, 250 or 500
nucleotides in length and sufficient to specifically hybridize under stringent conditions to SLGP mRNA or genomic DNA. Other suitable probes for use in the diagnostic assays ofthe invention are described herein.
A preferred agent for detecting SLGP protein is an antibody capable of binding to SLGP protein, preferably an antibody with a detectable label. Antibodies can be polyclonal, or more preferably, monoclonal. An intact antibody, or a fragment thereof (e.g., Fab or F(ab')2) can be used. The term "labeled", with regard to the probe or antibody, is intended to encompass direct labeling ofthe probe or antibody by coupling (i.e., physically linking) a detectable substance to the probe or antibody, as well as indirect labeling ofthe probe or antibody by reactivity with another reagent that is directly labeled. Examples of indirect labeling include detection of a primary antibody using a fluorescently labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently labeled streptavidin. The term "biological sample" is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject. That is, the detection method ofthe invention can be used to detect SLGP mRNA, protein, or genomic DNA in a biological sample in vitro as well as in vivo. For example, in vitro techniques for detection of SLGP mRNA include Northern hybridizations and in situ hybridizations. In vitro techniques for detection of SLGP protein include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations and immunofluorescence. In vitro techniques for detection of SLGP genomic DNA include Southern hybridizations. Furthermore, in vivo techniques for detection of SLGP protein include introducing into a subject a labeled anti-SLGP antibody. For example, the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
In one embodiment, the biological sample contains protein molecules from the test subject. Alternatively, the biological sample can contain mRNA molecules from the test subject or genomic DNA molecules from the test subject. A preferred biological sample is a serum sample isolated by conventional means from a subject.
In another embodiment, the methods further involve obtaining a control biological sample from a control subject, contacting the control sample with a compound or agent capable of detecting SLGP protein, mRNA, or genomic DNA, such that the presence of SLGP protein, mRNA or genomic DNA is detected in the biological sample, and comparing the presence of SLGP protein, mRNA or genomic DNA in the control sample with the presence of SLGP protein, mRNA or genomic DNA in the test sample.
The invention also encompasses kits for detecting the presence of SLGP in a biological sample. For example, the kit can comprise a labeled compound or agent capable of detecting SLGP protein or mRNA in a biological sample; means for determining the amount of SLGP in the sample; and means for comparing the amount of SLGP in the sample with a standard. The compound or agent can be packaged in a suitable container. The kit can further comprise instructions for using the kit to detect SLGP protein or nucleic acid.
2. Prognostic Assays
The diagnostic methods described herein can furthermore be utilized to identify subjects having or at risk of developing a disease or disorder associated with aberrant SLGP expression or activity. As used herein, the term "aberrant" includes an SLGP expression or activity which deviates from the wild type SLGP expression or activity. Aberrant expression or activity includes increased or decreased expression or activity, as well as expression or activity which does not follow the wild type developmental pattern of expression or the subcellular pattern of expression. For example, aberrant SLGP expression or activity is intended to include the cases in which a mutation in the SLGP gene causes the SLGP gene to be under-expressed or over-expressed and situations in which such mutations result in a non-functional SLGP protein or a protein which does not function in a wild-type fashion, e.g., a protein which does not interact with an SLGP ligand or one which interacts with a non-SLGP ligand.
The assays described herein, such as the preceding diagnostic assays or the following assays, can be utilized to identify subjects having or at risk of developing a disease or disorder associated with aberrant SLGP expression or activity, e.g., a cellular proliferation, growth, differentiation, or migration disorder such as cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia. For example, the assays described herein, such as the preceding diagnostic assays or the following assays, can be utilized to identify a subject having or at risk of developing a disorder associated with SLGP protein, nucleic acid expression or activity such as a cellular proliferation, growth, differentiation, or migration disorder (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia). Alternatively, the prognostic assays can be utilized to identify a subject having or at risk for developing a cellular proliferation, growth, differentiation, or migration disorder (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia). Thus, the present invention provides a method for identifying a disease or disorder associated with aberrant SLGP expression or activity in which a test sample is obtained from a subject and SLGP protein or nucleic acid (e.g., mRNA, genomic DNA) is detected, wherein the presence of SLGP protein or nucleic acid is diagnostic for a subject having or at risk of developing a disease or disorder associated with aberrant SLGP expression or activity (e.g., a cellular proliferation, growth, differentiation, or migration disorder, (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia)).
As used herein, a "test sample" refers to a biological sample obtained from a subject of interest. For example, a test sample can be a biological fluid (e.g., serum), cell sample (e.g., endothelial cells or tumor endothelial cells), or tissue. Furthermore, the prognostic assays described herein can be used to determine whether a subject can be administered an agent (e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate) to treat a disease or disorder associated with aberrant SLGP expression or activity. For example, such methods can be used to determine whether a subject can be effectively treated with an agent for a disorder, such as a cellular proliferation, growth,
differentiation, or migration disorder, (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia). Alternatively, such methods can be used to determine whether a subject can be effectively treated with an agent for a cellular proliferation, growth, differentiation, or migration disorder, (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia myocardial ischemia). Thus, the present invention provides methods for determining whether a subject can be effectively treated with an agent for a disorder associated with aberrant SLGP expression or activity in which a test sample is obtained and SLGP protein or nucleic acid expression or activity is detected (e.g., wherein the abundance of SLGP protein or nucleic acid expression or activity is diagnostic for a subject that can be administered the agent to treat a disorder associated with aberrant SLGP expression or activity (e.g., a cellular proliferation, growth, differentiation, or migration disorder, (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia)). The methods ofthe invention can also be used to detect genetic alterations in an
SLGP gene, thereby determining if a subject with the altered gene is at risk for a disorder characterized by an aberrant cellular proliferation, growth, differentiation, or migration response (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia). In preferred embodiments, the methods include detecting, in a sample of cells from the subject, the presence or absence of a genetic alteration characterized by at least one of an alteration affecting the integrity of a gene encoding an SLGP -protein, or the mis-expression ofthe SLGP gene. For example, such genetic alterations can be detected by ascertaining the existence of at least one of 1) a deletion of one or more nucleotides from an SLGP gene; 2) an addition of one or more nucleotides to an SLGP gene; 3) a substitution of one or more nucleotides of an SLGP gene, 4) a chromosomal rearrangement of an SLGP gene; 5) an alteration in the level of a messenger RNA transcript of an SLGP gene, 6) aberrant modification of an SLGP gene, such as ofthe methylation pattern ofthe genomic DNA, 7) the presence of a non- wild type splicing pattern of a messenger RNA transcript of an SLGP gene, 8) a non- wild type level of an SLGP-protein, 9) allelic loss of an SLGP gene, and 10)
inappropriate post-translational modification of an SLGP-protein. As described herein, there are a large number of assay techniques known in the art which can be used for detecting alterations in an SLGP gene. A preferred biological sample is a tissue or serum sample isolated by conventional means from a subject. In certain embodiments, detection ofthe alteration involves the use of a probe/primer in a polymerase chain reaction (PCR) (see, e.g., U.S. Patent Nos. 4,683,195 and 4,683,202), such as anchor PCR or RACE PCR, or, alternatively, in a ligation chain reaction (LCR) (see, e.g., Landegran et al. (1988) Science 241:1077-1080; and Nakazawa et al. (1994) PNAS 91 :360-364), the latter of which can be particularly useful for detecting point mutations in the SLGP-gene (see Abravaya et al. (1995) Nucleic Acids Res .23:675-682). This method can include the steps of collecting a sample of cells from a patient, isolating nucleic acid (e.g., genomic, mRNA or both) from the cells ofthe sample, contacting the nucleic acid sample with one or more primers which specifically hybridize to an SLGP gene under conditions such that hybridization and amplification ofthe SLGP-gene (if present) occurs, and detecting the presence or absence of an amplification product, or detecting the size ofthe amplification product and comparing the length to a control sample. It is anticipated that PCR and/or LCR may be desirable to use as a preliminary amplification step in conjunction with any ofthe techniques used for detecting mutations described herein. Alternative amplification methods include: self sustained sequence replication
(Guatelli, J.C. et al, 1990, Proc. Natl. Acad. Sci. USA 87:1874-1878), transcriptional amplification system (Kwoh, D.Y. et al, 1989, Proc. Natl. Acad. Sci. USA 86:1173- 1177), Q-Beta Replicase (Lizardi, P.M. et all, 1988, Bio/Technology 6:1197), or any other nucleic acid amplification method, followed by the detection ofthe amplified molecules using techniques well known to those of skill in the art. These detection schemes are especially useful for the detection of nucleic acid molecules if such molecules are present in very low numbers.
In an alternative embodiment, mutations in an SLGP gene from a sample cell can be identified by alterations in restriction enzyme cleavage patterns. For example, sample and control DNA is isolated, amplified (optionally), digested with one or more
restriction endonucleases, and fragment length sizes are determined by gel electrophoresis and compared. Differences in fragment length sizes between sample and control DNA indicates mutations in the sample DNA. Moreover, the use of sequence specific ribozymes (see, for example, U.S. Patent No. 5,498,531) can be used to score for the presence of specific mutations by development or loss of a ribozyme cleavage site.
In other embodiments, genetic mutations in SLGP can be identified by hybridizing a sample and control nucleic acids, e.g., DNA or RNA, to high density arrays containing hundreds or thousands of oligonucleotides probes (Cronin, M.T. et al. (1996) Human Mutation 1: 244-255; Kozal, M.J. et al. (1996) Nature Medicine 2: 753- 759). For example, genetic mutations in SLGP can be identified in two dimensional arrays containing light-generated DNA probes as described in Cronin, M.T. et al. supra. Briefly, a first hybridization array of probes can be used to scan through long stretches of DNA in a sample and control to identify base changes between the sequences by making linear arrays of sequential overlapping probes. This step allows the identification of point mutations. This step is followed by a second hybridization array that allows the characterization of specific mutations by using smaller, specialized probe arrays complementary to all variants or mutations detected. Each mutation array is composed of parallel probe sets, one complementary to the wild-type gene and the other complementary to the mutant gene.
In yet another embodiment, any of a variety of sequencing reactions known in the art can be used to directly sequence the SLGP gene and detect mutations by comparing the sequence ofthe sample SLGP with the corresponding wild-type (control) sequence. Examples of sequencing reactions include those based on techniques developed by Maxim and Gilbert ((1977) PNAS 74:560) or Sanger ((1977) PNAS 74:5463). It is also contemplated that any of a variety of automated sequencing procedures can be utilized when performing the diagnostic assays ((1995) Biotechniques 19:448), including sequencing by mass spectrometry (see, e.g., PCT International Publication No. WO 94/16101; Cohen et al. (1996) Adv. Chromatogr. 36:121-162; and Griffin et al. (1993) Appl. Biochem. Biotechnol 38:147-159).
Other methods for detecting mutations in the SLGP gene include methods in which protection from cleavage agents is used to detect mismatched bases in RNA/RNA or RNA/DNA heteroduplexes (Myers et al. (1985) Science 230:1242). In general, the art technique of "mismatch cleavage" starts by providing heteroduplexes of formed by hybridizing (labeled) RNA or DNA containing the wild-type SLGP sequence with potentially mutant RNA or DNA obtained from a tissue sample. The double-stranded duplexes are treated with an agent which cleaves single-stranded regions ofthe duplex such as which will exist due to basepair mismatches between the control and sample strands. For instance, RNA/DNA duplexes can be treated with RNase and DNA/DNA hybrids treated with SI nuclease to enzymatically digesting the mismatched regions. In other embodiments, either DNA/DNA or RNA/DNA duplexes can be treated with hydroxylamine or osmium tetroxide and with piperidine in order to digest mismatched regions. After digestion ofthe mismatched regions, the resulting material is then separated by size on denaturing polyacrylamide gels to determine the site of mutation. See, for example, Cotton et al. (1988) Proc. Natl Acad Sci USA 85:4397; Saleeba et al. (1992) Methods Enzymol. 217:286-295. In a preferred embodiment, the control DNA or RNA can be labeled for detection.
In still another embodiment, the mismatch cleavage reaction employs one or more proteins that recognize mismatched base pairs in double-stranded DNA (so called "DNA mismatch repair" enzymes) in defined systems for detecting and mapping point mutations in SLGP cDNAs obtained from samples of cells. For example, the mutY enzyme of E. coli cleaves A at G/A mismatches and the thymidine DNA glycosylase from HeLa cells cleaves T at G/T mismatches (Hsu et al. (1994) Carcinogenesis 15:1657-1662). According to an exemplary embodiment, a probe based on an SLGP sequence, e.g., a wild-type SLGP sequence, is hybridized to a cDNA or other DNA product from a test cell(s). The duplex is treated with a DNA mismatch repair enzyme, and the cleavage products, if any, can be detected from electrophoresis protocols or the like. See, for example, U.S. Patent No. 5,459,039.
In other embodiments, alterations in electrophoretic mobility will be used to identify mutations in SLGP genes. For example, single strand conformation polymoφhism (SSCP) may be used to detect differences in electrophoretic mobility between mutant and wild type nucleic acids (Orita et al. (1989) Proc Natl. Acad. Sci USA: 86:2166, see also Cotton (1993) Mutat Res 285:125-144; and Hayashi (1992) Genet Anal Tech Appl 9:73-79). Single-stranded DNA fragments of sample and control SLGP nucleic acids will be denatured and allowed to renature. The secondary structure of single-stranded nucleic acids varies according to sequence, the resulting alteration in electrophoretic mobility enables the detection of even a single base change. The DNA fragments may be labeled or detected with labeled probes. The sensitivity ofthe assay may be enhanced by using RNA (rather than DNA), in which the secondary structure is more sensitive to a change in sequence. In a preferred embodiment, the subject method utilizes heteroduplex analysis to separate double stranded heteroduplex molecules on the basis of changes in electrophoretic mobility (Keen et al. (1991) Trends Genet 7:5). In yet another embodiment the movement of mutant or wild-type fragments in polyacrylamide gels containing a gradient of denaturant is assayed using denaturing gradient gel electrophoresis (DGGE) (Myers et al. (1985) Nature 313:495). When DGGE is used as the method of analysis, DNA will be modified to insure that it does not completely denature, for example by adding a GC clamp of approximately 40 bp of high-melting GC-rich DNA by PCR. In a further embodiment, a temperature gradient is used in place of a denaturing gradient to identify differences in the mobility of control and sample DNA (Rosenbaum and Reissner (1987) Biophys Chem 265:12753).
Examples of other techniques for detecting point mutations include, but are not limited to, selective oligonucleotide hybridization, selective amplification, or selective primer extension. For example, oligonucleotide primers may be prepared in which the known mutation is placed centrally and then hybridized to target DNA under conditions which permit hybridization only if a perfect match is found (Saiki et al. (1986) Nature 324:163); Saiki et al. (1989) Proc. Natl Acad. Sci USA 86:6230). Such allele specific oligonucleotides are hybridized to PCR amplified target DNA or a number of different
mutations when the oligonucleotides are attached to the hybridizing membrane and hybridized with labeled target DNA.
Alternatively, allele specific amplification technology which depends on selective PCR amplification may be used in conjunction with the instant invention. Oligonucleotides used as primers for specific amplification may carry the mutation of interest in the center ofthe molecule (so that amplification depends on differential hybridization) (Gibbs et al. (1989) Nucleic Acids Res. 17:2437-2448) or at the extreme 3' end of one primer where, under appropriate conditions, mismatch can prevent, or reduce polymerase extension (Prossner (1993) Tibtech 11 :238). In addition it may be desirable to introduce a novel restriction site in the region ofthe mutation to create cleavage-based detection (Gasparini et al. (1992) Mol. Cell Probes 6:1). It is anticipated that in certain embodiments amplification may also be performed using Taq ligase for amplification (Barany (1991) Proc. Natl. Acad. Sci USA 88:189). In such cases, ligation will occur only if there is a perfect match at the 3' end ofthe 5' sequence making it possible to detect the presence of a known mutation at a specific site by looking for the presence or absence of amplification.
The methods described herein may be performed, for example, by utilizing prepackaged diagnostic kits comprising at least one probe nucleic acid or antibody reagent described herein, which may be conveniently used, e.g., in clinical settings to diagnose patients exhibiting symptoms or family history of a disease or illness involving an SLGP gene.
Furthermore, any cell type or tissue in which SLGP is expressed may be utilized in the prognostic assays described herein.
3. Monitoring of Effects During Clinical Trials
Monitoring the influence of agents (e.g., drugs, compounds) on the expression or activity of an SLGP protein (e.g., a cellular proliferation, growth, differentiation, or migration process, e.g., angiogenesis) can be applied not only in basic drug screening, but also in clinical trials. For example, the effectiveness of an agent determined by a screening assay as described herein to increase SLGP gene expression, protein levels, or
upregulate SLGP activity (e.g., angiogenesis), can be monitored in clinical trials of subjects exhibiting decreased SLGP gene expression, protein levels, or downregulated SLGP activity. Alternatively, the effectiveness of an agent determined by a screening assay to decrease SLGP gene expression, protein levels, or downregulate SLGP activity, can be monitored in clinical trails of subjects exhibiting increased SLGP gene expression, protein levels, or upregulated SLGP activity. In such clinical trials, the expression or activity of an SLGP gene, and preferably, other genes that have been implicated in, for example, a cellular proliferation, growth, differentiation, or migration disorder (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia) can be used as a "read out" or markers ofthe phenotype of a particular cell.
For example, and not by way of limitation, genes, including SLGP, that are modulated in cells by treatment with an agent (e.g., compound, drug or small molecule) which modulates SLGP activity (e.g., identified in a- screening assay as described herein) can be identified. Thus, to study the effect of agents on cellular proliferation, growth, differentiation, or migration disorders (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia), for example, in a clinical trial, cells can be isolated and RNA prepared and analyzed for the levels of expression of SLGP and other genes implicated in the cellular proliferation, growth, differentiation, or migration disorder (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia), respectively. The levels of gene expression (i.e., a gene expression pattern) can be quantified by Northern blot analysis or RT-PCR, as described herein, or alternatively by measuring the amount of protein produced, by one ofthe methods as described herein, or by measuring the levels of activity of SLGP or other genes. In this way, the gene expression pattern can serve as a marker, indicative ofthe physiological response ofthe cells to the agent. Accordingly, this response state may be determined before, and at various points during treatment ofthe individual with the agent.
In a preferred embodiment, the present invention provides a method for monitoring the effectiveness of treatment of a subject with an agent (e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate identified by the screening assays described herein) comprising the steps of (i) obtaining a pre-administration sample (e.g., a tumor sample) from a subject prior to administration ofthe agent; (ii) detecting the level of expression of an SLGP protein, mRNA, or genomic DNA in the preadministration sample; (iii) obtaining one or more post-administration samples (e.g., a tumor samples) from the subject; (iv) detecting the level of expression or activity ofthe SLGP protein, mRNA, or genomic DNA in the post-administration samples (e.g., a tumor samples); (v) comparing the level of expression or activity ofthe SLGP protein, mRNA, or genomic DNA in the preadministration sample (e.g., a tumor sample) with the SLGP protein, mRNA, or genomic DNA in the post administration sample or samples; and (vi) altering the administration ofthe agent to the subject accordingly. For example, increased administration ofthe agent may be desirable to increase the expression or activity of SLGP to higher levels than detected, i.e., to increase the effectiveness ofthe agent. Alternatively, decreased administration ofthe agent may be desirable to decrease expression or activity of SLGP to lower levels than detected, i.e. to decrease the effectiveness ofthe agent. According to such an embodiment, SLGP expression or activity may be used as an indicator ofthe effectiveness of an agent, even in the absence of an observable phenotypic response (e.g., angiogenesis).
C. Methods of Treatment:
The present invention provides for both prophylactic and therapeutic methods of treating a subject at risk of (or susceptible to) a disorder or having a disorder associated with aberrant SLGP expression or activity, e.g., a cellular proliferation, growth, differentiation, or migration disorder, (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia). "Treatment", as used herein, is defined as the application or administration of a therapeutic agent to a patient, or application or administration of a therapeutic agent to an isolated tissue or
cell line from a patient, who has a disease or disorder, a symptom of disease or disorder or a predisposition toward a disease or disorder, with the puφose of curing, healing, alleviating, relieving, altering, remedying, ameliorating, improving or affecting the disease or disorder, the symptoms of disease or disorder or the predisposition toward a disease or disorder. With regards to both prophylactic and therapeutic methods of treatment, such treatments may be specifically tailored or modified, based on knowledge obtained from the field of pharmacogenomics. "Pharmacogenomics", as used herein, refers to the application of genomics technologies such as gene sequencing, statistical genetics, and gene expression analysis to drugs in clinical development and on the market. More specifically, the term refers the study of how a patient's genes determine his or her response to a drug (e.g., a patient's "drug response phenotype", or "drug response genotype".) Thus, another aspect ofthe invention provides methods for tailoring an individual's prophylactic or therapeutic treatment with either the SLGP molecules ofthe present invention or SLGP modulators according to that individual's drug response genotype. Pharmacogenomics allows a clinician or physician to target prophylactic or therapeutic treatments to patients who will most benefit from the treatment and to avoid treatment of patients who will experience toxic drug-related side effects.
1. Prophylactic Methods
In one aspect, the invention provides a method for preventing in a subject, a disease or condition associated with an aberrant SLGP expression or activity, by administering to the subject an SLGP or an agent which modulates SLGP expression or at least one SLGP activity (e.g., modulation of a cellular proliferation, growth, differentiation, or migration process (e.g., angiogenesis). Subjects at risk for a disease which is caused or contributed to by aberrant SLGP expression or activity can be identified by, for example, any or a combination of diagnostic or prognostic assays as described herein. Administration of a prophylactic agent can occur prior to the manifestation of symptoms characteristic ofthe SLGP aberrancy, such that a disease or disorder (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue
ischemia, such as myocardial ischemia) is prevented or, alternatively, delayed in its progression. Depending on the type of SLGP aberrancy, for example, an SLGP, SLGP agonist or SLGP antagonist agent can be used for treating the subject. The appropriate agent can be determined based on screening assays described herein. The prophylactic methods ofthe present invention are further discussed in the following subsections.
2. Therapeutic Methods
Another aspect ofthe invention pertains to methods of modulating SLGP expression or activity for therapeutic puφoses. Accordingly, in an exemplary embodiment, the modulatory method ofthe invention involves contacting a cell with an SLGP molecule ofthe present invention such that the activity of an SLGP is modulated. Alternatively, the modulatory method ofthe invention involves contacting a cell with an agent that modulates one or more ofthe activities of SLGP protein activity associated with the cell. An agent that modulates SLGP protein activity can be an agent as described herein, such as a nucleic acid or a protein, a naturally-occurring target molecule of an SLGP protein (e.g., CD55), an SLGP antibody, an SLGP agonist or antagonist, a peptidomimetic of an SLGP agonist or antagonist, or other small molecule. In one embodiment, the agent stimulates one or more SLGP activities. Examples of such stimulatory agents include active SLGP protein and a nucleic acid molecule encoding SLGP that has been introduced into the cell. In another embodiment, the agent inhibits one or more SLGP activities. Examples of such inhibitory agents include antisense SLGP nucleic acid molecules and anti-SLGP antibodies. These modulatory methods can be performed in vitro (e.g., by culturing the cells, e.g., tumor endothelial cells, with the agent) or, alternatively, in vivo (e.g., by administering the agent to a subject). As such, the present invention provides methods of treating an individual afflicted with a disease or disorder characterized by aberrant expression or activity of an SLGP protein or nucleic acid molecule (a cellular proliferation, growth, differentiation, or migration disorder (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia)). In one embodiment, the method involves administering an agent (e.g., an agent identified by a screening assay described
herein), or combination of agents that modulates (e.g., upregulates or downregulates) SLGP expression or activity. In another embodiment, the method involves administering an SLGP protein or nucleic acid molecule as therapy to compensate for reduced or aberrant SLGP expression or activity. Stimulation of SLGP activity is desirable in situations in which SLGP is abnormally downregulated and/or in which increased SLGP activity is likely to have a beneficial effect. Likewise, inhibition of SLGP activity is desirable in situations in which SLGP is abnormally upregulated and/or in which decreased SLGP activity is likely to have a beneficial effect (e.g., cellular proliferation, growth, differentiation, or migration disorders (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia)).
3. Pharmacogenomics
The SLGP molecules ofthe present invention, as well as agents, or modulators which have a stimulatory or inhibitory effect on SLGP activity (e.g., SLGP gene expression) as identified by a screening assay described herein can be administered to individuals to treat (prophylactically or therapeutically) disorders (e.g., cellular proliferation, growth, differentiation, or migration disorders (e.g., cancer, arthritis, retinal and optic disk neovascularization, and tissue ischemia, such as myocardial ischemia)) associated with aberrant SLGP activity. In conjunction with such treatment, pharmacogenomics (i.e., the study ofthe relationship between an individual's genotype and that individual's response to a foreign compound or drug) may be considered. Differences in metabolism of therapeutics can lead to severe toxicity or therapeutic failure by altering the relation between dose and blood concentration ofthe pharmacologically active drug. Thus, a physician or clinician may consider applying knowledge obtained in relevant pharmacogenomics studies in determining whether to administer an SLGP molecule or SLGP modulator as well as tailoring the dosage and/or therapeutic regimen of treatment with an SLGP molecule or SLGP modulator.
Pharmacogenomics deals with clinically significant hereditary variations in the response to drugs due to altered drug disposition and abnormal action in affected persons. See e.g., Eichelbaum, M., Clin Exp Pharmacol Physiol, 1996, 23(10-11) :983- 985 and Linder, M.W., Clin Chem, 1997, 43(2):254-266. In general, two types of pharmacogenetic conditions can be differentiated. Genetic conditions transmitted as a single factor altering the way drugs act on the body (altered drug action) or genetic conditions transmitted as single factors altering the way the body acts on drugs (altered drug metabolism). These pharmacogenetic conditions can occur either as rare genetic defects or as naturally-occurring polymoφhisms. For example, glucose-6-phosphate dehydrogenase deficiency (G6PD) is a common inherited enzymopathy in which the main clinical complication is haemolysis after ingestion of oxidant drags (anti-malarials, sulfonamides, analgesics, nitrofurans) and consumption of fava beans.
One pharmacogenomics approach to identifying genes that predict drag response, known as "a genome-wide association", relies primarily on a high-resolution map ofthe human genome consisting of already known gene-related markers (e.g., a "bi- allelic" gene marker map which consists of 60,000-100,000 polymoφhic or variable sites on the human genome, each of which has two variants.) Such a high-resolution genetic map can be compared to a map ofthe genome of each of a statistically significant number of patients taking part in a Phase II/III drag trial to identify markers associated with a particular observed drug response or side effect. Alternatively, such a high resolution map can be generated from a combination of some ten-million known single nucleotide polymoφhisms (SNPs) in the human genome. As used herein, a "SNP" is a common alteration that occurs in a single nucleotide base in a stretch of DNA. For example, a SNP may occur once per every 1000 bases of DNA. A SNP may be involved in a disease process, however, the vast majority may not be disease- associated. Given a genetic map based on the occurrence of such SNPs, individuals can be grouped into genetic categories depending on a particular pattern of SNPs in their individual genome. In such a manner, treatment regimens can be tailored to groups of genetically similar individuals, taking into account traits that may be common among such genetically similar individuals.
Alternatively, a method termed the "candidate gene approach", can be utilized to identify genes that predict drug response. According to this method, if a gene that encodes a drugs target is known (e.g., an SLGP protein or SLGP protein ofthe present invention), all common variants of that gene can be fairly easily identified in the population and it can be determined if having one version ofthe gene versus another is associated with a particular drug response.
As an illustrative embodiment, the activity of drug metabolizing enzymes is a major determinant of both the intensity and duration of drug action. The discovery of genetic polymoφhisms of drag metabolizing enzymes (e.g., N-acetyltransferase 2 (NAT 2) and cytochrome P450 enzymes CYP2D6 and CYP2C19) has provided an explanation as to why some patients do not obtain the expected drug effects or show exaggerated drug response and serious toxicity after taking the standard and safe dose of a drug. These polymoφhisms are expressed in two phenotypes in the population, the extensive metabolizer (EM) and poor metabolizer (PM). The prevalence of PM is different among different populations. For example, the gene coding for C YP2D6 is highly polymoφhic and several mutations have been identified in PM, which all lead to the absence of functional CYP2D6. Poor metabolizers of CYP2D6 and CYP2C19 quite frequently experience exaggerated drag response and side effects when they receive standard doses. If a metabolite is the active therapeutic moiety, PM show no therapeutic response, as demonstrated for the analgesic effect of codeine mediated by its CYP2D6-formed metabolite moφhine. The other extreme are the so called ultra-rapid metabolizers who do not respond to standard doses. Recently, the molecular basis of ultra-rapid metabolism has been identified to be due to CYP2D6 gene amplification.
Alternatively, a method termed the "gene expression profiling", can be utilized to identify genes that predict drug response. For example, the gene expression of an animal dosed with a drug (e.g., an SLGP molecule or SLGP modulator ofthe present invention) can give an indication whether gene pathways related to toxicity have been turned on.
Information generated from more than one ofthe above pharmacogenomics approaches can be used to determine appropriate dosage and treatment regimens for prophylactic or therapeutic treatment an individual. This knowledge, when applied to dosing or drug selection, can avoid adverse reactions or therapeutic failure and thus enhance therapeutic or prophylactic efficiency when treating a subject with an SLGP molecule or SLGP modulator, such as a modulator identified by one ofthe exemplary screening assays described herein.
VI. Electronic Apparatus Readable Media and Arrays Electronic apparatus readable media comprising SLGP sequence information is also provided. As used herein, "SLGP sequence information" refers to any nucleotide and/or amino acid sequence information particular to the SLGP molecules ofthe present invention, including but not limited to full-length nucleotide and/or amino acid sequences, partial nucleotide and/or amino acid sequences, polymorphic sequences including single nucleotide polymoφhisms (SNPs), epitope sequences, and the like. Moreover, information "related to" said SLGP sequence information includes detection ofthe presence or absence of a sequence (e.g., detection of expression of a sequence, fragment, polymoφhism, etc.), determination ofthe level of a sequence (e.g., detection of a level of expression, for example, a quantative detection), detection of a reactivity to a sequence (e.g., detection of protein expression and/or levels, for example, using a sequence-specific antibody), and the like. As used herein, "electronic apparatus readable media" refers to any suitable medium for storing, holding or containing data or information that can be read and accessed directly by an electronic apparatus. Such media can include, but are not limited to: magnetic storage media, such as floppy discs, hard disc storage medium, and magnetic tape; optical storage media such as compact disc; electronic storage media such as RAM, ROM, EPROM, EEPROM and the like; general hard disks and hybrids of these categories such as magnetic/optical storage media. The medium is adapted or configured for having recorded thereon SLGP sequence information ofthe present invention.
As used herein, the term "electronic apparatus" is intended to include any suitable computing or processing apparatus or other device configured or adapted for storing data or information. Examples of electronic apparatus suitable for use with the present invention include stand-alone computing apparatus; networks, including a local area network (LAN), a wide area network (WAN) Internet, Intranet, and Extranet; electronic appliances such as a personal digital assistants (PDAs), cellular phone, pager and the like; and local and distributed processing systems.
As used herein, "recorded" refers to a process for storing or encoding information on the electronic apparatus readable medium. Those skilled in the art can readily adopt any ofthe presently known methods for recording information on known media to generate manufactures comprising the SLGP sequence information.
• A variety of software programs and formats can be used to store the sequence information on the electronic apparatus readable medium. For example, the sequence information can be represented in a word processing text file, formatted in commercially-available software such as WordPerfect and MicroSoft Word, or represented in the form of an ASCII file, stored in a database application, such as DB2, Sybase, Oracle, or the like, as well as in other forms. Any number of data processor structuring formats (e.g., text file or database) may be employed in order to obtain or create a medium having recorded thereon the SLGP sequence information. By providing SLGP sequence information in readable form, one can routinely access the sequence information for a variety of puφoses. For example, one skilled in the art can use the sequence information in readable form to compare a target sequence or target structural motif with the sequence information stored within the data storage means. Search means are used to identify fragments or regions ofthe sequences ofthe invention which match a particular target sequence or target motif.
The present invention therefore provides a medium for holding instructions for performing a method for determining whether a subject has a SLGP- associated disease or disorder or a pre-disposition to a SLGP-associated disease or disorder, wherein the method comprises the steps of determining SLGP sequence information associated with the subject and based on the SLGP sequence information, determining whether the
subject has a SLGP -associated disease or disorder or a pre-disposition to a SLGP- associated disease or disorder and/or recommending a particular treatment for the disease, disorder or pre-disease condition.
The present invention further provides in an electronic system and/or in a network, a method for determining whether a subject has a SLGP-associated disease or disorder or a pre-disposition to a disease associated with a SLGP wherein the method comprises the steps of determining SLGP sequence information associated with the subject, and based on the SLGP sequence information, determining whether the subject has a SLGP -associated disease or disorder or a pre-disposition to a SLGP-associated disease or disorder, and/or recommending a particular treatment for the disease, disorder or pre-disease condition. The method may further comprise the step of receiving phenotypic information associated with the subject and/or acquiring from a network phenotypic information associated with the subject.
The present invention also provides in a network, a method for determining whether a subject has a SLGP-associated disease or disorder or a pre-disposition to a SLGP associated disease or disorder associated with SLGP, said method comprising the steps of receiving SLGP sequence information from the subject and/or information related thereto, receiving phenotypic information associated with the subject, acquiring information from the network corresponding to SLGP and/or a SLGP-associated disease or disorder, and based on one or more ofthe phenotypic information, the SLGP information (e.g., sequence information and/or information related thereto), and the acquired information, determining whether the subject has a SLGP-associated disease or disorder or a pre-disposition to a SLGP-associated disease or disorder (e.g., a cellular proliferation, growth, differentiation, or migration disorder). The method may further comprise the step of recommending a particular treatment for the disease, disorder or pre-disease condition.
The present invention also provides a business method for determining whether a subject has a SLGP-associated disease or disorder or a pre-disposition to a SLGP- associated disease or disorder, said method comprising the steps of receiving information related to SLGP (e.g. , sequence information and/or information related
thereto), receiving phenotypic information associated with the subject, acquiring information from the network related to SLGP and/or related to a SLGP-associated disease or disorder, and based on one or more ofthe phenotypic information, the SLGP information, and the acquired information, determining whether the subject has a SLGP- associated disease or disorder or a pre-disposition to a SLGP-associated disease or disorder. The method may further comprise the step of recommending a particular treatment for the disease, disorder or pre-disease condition.
The invention also includes an array comprising a SLGP sequence ofthe present invention. The array can be used to assay expression of one or more genes in the array. In one embodiment, the array can be used to assay gene expression in a tissue to ascertain tissue specificity of genes in the array. In this manner, up to about 7600 genes can be simultaneously assayed for expression, one of which can be SLGP. This allows a profile to be developed showing a battery of genes specifically expressed in one or more tissues. In addition to such qualitative determination, the invention allows the quantitation of gene expression. Thus, not only tissue specificity, but also the level of expression of a battery of genes in the tissue is ascertainable. Thus, genes can be grouped on the basis of their tissue expression per se and level of expression in that tissue. This is useful, for example, in ascertaining the relationship of gene expression between or among tissues. Thus, one tissue can be perturbed and the effect on gene expression in a second tissue can be determined. In this context, the effect of one cell type on another cell type in response to a biological stimulus can be determined. Such a determination is useful, for example, to know the effect of cell-cell interaction at the level of gene expression. If an agent is administered therapeutically to treat one cell • type but has an undesirable effect on another cell type, the invention provides an assay to determine the molecular basis ofthe undesirable effect and thus provides the opportunity to co-administer a counteracting agent or otherwise treat the undesired effect. Similarly, even within a single cell type, undesirable biological effects can be determined at the molecular level. Thus, the effects of an agent on expression of other than the target gene can be ascertained and counteracted.
In another embodiment, the array can be used to monitor the time course of expression of one or more genes in the array. This can occur in various biological contexts, as disclosed herein, for example development of a SLGP-associated disease or disorder, progression of SLGP-associated disease or disorder, and processes, such a cellular transformation associated with the SLGP-associated disease or disorder.
The array is also useful for ascertaining the effect ofthe expression of a gene on the expression of other genes in the same cell or in different cells (e.g., ascertaining the effect of SLGP expression on the expression of other genes). This provides, for example, for a selection of alternate molecular targets for therapeutic intervention if the ultimate or downstream target cannot be regulated.
The array is also useful for ascertaining differential expression patterns of one or more genes in normal and abnormal cells. This provides a battery of genes (e.g., including SLGP) that could serve as a molecular target for diagnosis or therapeutic intervention.
This invention is further illustrated by the following examples which should not be construed as limiting. The contents of all references, patents and published patent applications cited throughout this application are hereby incoφorated by reference. References throughout the instant specification to websites maintained as part ofthe World Wide Web are referred to herein by the prefix http://. The information contained in such websites is publicly available and can be accessed elctronically by contacting the cited address.
EXAMPLES
EXAMPLE 1: IDENTIFICATION AND CHARACTERIZATION OF SLGP
CDNAS In this example, the identification and characterization ofthe gene encoding human SLGP (also referred to as "Fclιrb021h09") is described.
Isolation ofthe human SLGP cDNA
In order to identify novel secreted and/or membrane-bound proteins, a program termed 'signal sequence trapping' was utilized to analyze the sequences of several cDNAs of a cDNA library derived from bronchial epithelial cells which had been stimulated with the cytokine, TNFα. This analysis identified a human clone having an insert of approximately 3 kb containing a protein-encoding sequence of approximately 2987 nucleotides capable of encoding approximately 690 amino acids of SLGP (e.g., the starting methionine through residue 690 of, for example, SEQ ID NO:2).
The nucleotide sequence encoding the human SLGP protein is shown in Figure 1 and is set forth as SEQ ID NO . The full length protein encoded by this nucleic acid is comprised of about 690 amino acids and has the amino acid sequence shown in Figure 1 and set forth as SEQ ID NO:2. The coding portion (open reading frame) of SEQ ID NOT is set forth as SEQ ID NO:3.
Analysis of Human SLGP
A BLAST search (Altschul et al. (1990) J. Mol. Biol. 215:403) ofthe nucleotide sequence of human SLGP has revealed that SLGP is significantly similar to a protein identified as human CD 97 (Accession No. U76764) and to a protein identified as rat latrophilin (Accession Nos. U78105, U72487).
The SLGP proteins ofthe present invention contain a significant number of structural characteristics ofthe GPCR family. For instance, the SLGPs ofthe present invention contain conserved cysteines found in the first 2 loops (prior to the third and fifth transmembrane domains) of most GPCRs (cys490 and cys562 of SEQ ID NO:2).
A highly conserved asparagine residue is present (asnl25 in SEQ ID NO:2). SLGP proteins contains a highly conserved leucine (leul 54 of SEQ ID NO:2). The two cysteine residues are believed to form a disulfide bond that stabilizes the functional protein structure. A highly conserved asparagine and arginine in the fourth transmembrane domain ofthe SLGP proteins is present (aspl 58 and arg218 of SEQ ID NO:2). Moreover, a highly conserved proline is present (pro307 of SEQ ID NO:2). Proline residues in the fourth, fifth, sixth, and seventh transmembrane domains are thought to introduce kinks in the alpha-helices and may be important in the formation of the ligand binding pocket. Moreover, a conserved tyrosine is present in the seventh' transmembrane domain of SLGP-2 (tyr647 of SEQ ID NO:2).
As such, the SLGP family of proteins, like the Secretin family of proteins, are referred to herein as G protein-coupled receptor-like proteins.
SLGP is predicted to contain the following sites: N-glycosylation site at residues 15-18, residues 21-24, residues 64-67, residues 74-77, residues 127-130, residues 177- 180, residues 188-191, residues 249-252, residues 381-384, and at residues 395-398 of SEQ ID NO:2; Glycosaminoglycan attachment site at residues 49-52 of SEQ ID NO:2; cAMP- and cGMP-dependent protein kinase phosphorylation sites at residues 360-363 of SEQ ID NO:2; Protein kinase C phosphorylation sites at residues 135-137, residues 181-183, residues 233-235, residues 358-360, residues 363-365, residues 400-402, residues 457-459, residues 485-487, residues 558-560, and residues 667-669 of SEQ ID NO:2; Casein kinase II phosphorylation sites at residues 54-57, residues 68-71, residues 76-79, residues 94-97, residues 135-138, residues 150-153, residues 155-158, residues 161-164, residues 181-184, residues 190-193, residues 244-247, residues 310-313, residues 325-328, residues 346-349, and at residues 608-611 of SEQ ID NO:2; Tyrosine kinase phosphorylation site at residues 36-43, and residues 668-675 of SEQ ID NO:2; N-myristoylation sites at residues 38-43, residues 50-55, residues 80-85, residues 382- 387, residues388-393, residues 434-439, residues 480-485, residues 521-526, residues 584-589, and at residues 619-624 of SEQ ID NO:2; Aspartic acid and asparagine hydroxylation at residues 75-86 of SEQ ID NO:2, EF-hand calcium-binding domain at residues 153-165 of SEQ ID NO:2.
ill
Tissue Distribution of SLGP mRNA by Northern Blot Hybridization
This Example describes the tissue distribution of SLGP mRNA, as determined by Northern blot hybridization. Northern blot hybridizations with the various RNA samples were performed
(Clontech Human Multi-tissue Northern I and a human normal and diseased heart tissue northern) under standard conditions and washed under stringent conditions. A 3.2 Kb and a 4.2 Kb mRNA transcript was detected in all tissues tested (heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas), with the highest expression in heart. Specifically, the expression was found to be localized to endothelial cells in the heart. Additionally, these transcripts were found in both normal and diseased hearts.
EXAMPLE 2: TISSUE DISTRIBUTION ANALYSIS OF HUMAN AND MOUSE
SLGP cDNA This example describes the tissue distribution of human and mouse SLGP cDNA, as determined using the TaqMan™ procedure. The Taqman™ procedure is a quantitative, real-time PCR-based approach to detecting mRNA. The RT-PCR reaction exploits the 5' nuclease activity of AmpliTaq Gold™ DNA Polymerase to cleave a TaqMan™ probe during PCR. Briefly, cDNA is generated from the samples of interest and serves as the starting materials for PCR amplification. In addition to the 5' and 3' gene-specific primers, a gene-specific oligonucleotide probe (complementary to the region being amplified) is included in the reaction (i.e., the Taqman™ probe). The TaqMan™ probe includes the oligonucleotide with a fluorescent reporter dye covalently linked to the 5' end ofthe probe (such as FAM (6-carboxyfluorescein), TET (6-carboxy- 4,7,2',7'-tetrachlorofluorescein), JOE (6-carboxy-4,5-dichloro-2,7- dimethoxyfluorescein), or VIC) and a quencher dye (TAMRA (6-carboxy-N,N,N',N'- tetramethylrhodamine) at the 3' end ofthe probe.
During the PCR reaction, cleavage ofthe probe separates the reporter dye and the quencher dye, resulting in increased fluorescence ofthe reporter. Accumulation of PCR products is detected directly by monitoring the increase in fluorescence of the reporter
dye. When the probe is intact, the proximity of the reporter dye to the quencher dye results in suppression of the reporter fluorescence. During PCR, if the target of interest is present, the probe specifically anneals between the forward and reverse primer sites. The 5 '-3' nucleolytic activity of the AmpliTaq™ Gold DNA Polymerase cleaves the probe between the reporter and the quencher only if the probe hybridizes to the target. The probe fragments are then displaced from the target, and polymerization ofthe strand continues. The 3' end of the probe is blocked to prevent extension of the probe during PCR. This process occurs in every cycle and does not interfere with the exponential accumulation of product. RNA was prepared using the trizol method and treated with DNAse to remove contaminating genomic DNA. cDNA was synthesized using standard techniques. Mock cDNA synthesis in the absence of reverse transcriptase resulted in samples with no detectable PCR amplification of the control GAPDH gene confirming efficient removal of genomic DNA contamination.
Results indicate that Human SLGP is highest in endothelial cells, heart tissue and skeletal muscle.
As shown in Figures 9 and 11 , Human SLGP is upregulated in tube forming Human Microvascular Endothelial Cells (HMVEC) and in proliferating HMVEC as compared to arresting HMVEC. Human SLGP is also upregulated in glioblastomas as compared to normal brain. As shown in Figure 13, Mouse SLGP (ml 983) is upregulated in VEGF-induced angiogenic xenograft plugs as compared to parental plugs.
Taqman analysis was also performed on a mouse ischemic hindlimb panel (day 6), indicating increased expression in ischemic versus sham limbs for 3 or 6 pairs with increased VE-cadherin (endothelial marker) expression, which indicates a role for SLGP in the regulation of angiogenesis.
EXAMPLE 3: IN SITU HYBRIDIZATION ANALYSIS OF HUMAN SLGP
This example describes the tissue distribution of human SLGP as determined using in situ hybridization analysis. For in situ analysis, tissues, e.g. brain and glioblastoma tissues, were first frozen on dry ice. Ten-micrometer-thick sections ofthe
tissues were postfixed with 4%o formaldehyde in DEPC-treated IX phosphate-buffered saline at room temperature for 10 minutes before being rinsed twice in DEPC IX phosphate-buffered saline and once in 0.1 M triethanolamine-HCl (pH 8.0). Following incubation in 0.25% acetic anhydride-0.1 M triethanolamine-HCl for 10 minutes, sections were rinsed in DEPC 2X SSC (IX SSC is 0.15 M NaCl plus 0.015 M sodium citrate). Tissues were then dehydrated through a series of ethanol washes, incubated in 100% chloroform for 5 minutes, and then rinsed in 100%) ethanol for 1 minute and 95%> ethanol for 1 minute and allowed to air dry.
Hybridizations were performed with 35s-radiolabeled (5 X 10 cpm/ml) cRNA probes. Probes were incubated in the presence of a solution containing 600 mM NaCl, 10 mM Tris (pH 7.5), 1 mM EDTA, 0.01% sheared salmon sperm DNA, 0.01% yeast tRNA, 0.05% yeast total RNA type XI, IX Denhardt's solution, 50% formamide, 10% dextran sulfate, 100 mM dithiothreitol, 0.1% sodium dodecyl sulfate (SDS), and 0.1%> sodium thiosulfate for 18 hours at 55°C. After hybridization, slides were washed with 2X SSC. Sections were then sequentially incubated at 37°C in TNE (a solution containing 10 mM Tris-HCl (pH 7.6), 500 mM NaCl, and 1 mM EDTA), for 10 minutes, in TNE with lOμg of RNase A per ml for 30 minutes, and finally in TNE for 10 minutes. Slides were then rinsed with 2X SSC at room temperature, washed with 2X SSC at 50°C for 1 hour, washed with 0.2X SSC at 55°C for 1 hour, and 0.2X SSC at 60°C for 1 hour. Sections were then dehydrated rapidly through serial ethanol-0.3 M sodium acetate concentrations before being air dried and exposed to Kodak Biomax MR scientific imaging film for 24 hours and subsequently dipped in NB-2 photoemulsion and exposed at 4°C for 7 days before being developed and counter stained. In situ hybridization results show that human SLGP (1983) expression is upregulated in endothelial cells of glioblastomas as compared to endothelial cells of normal brain tissue.
Results of in situ hybridization also show focal expression of Human SLGP in non-necrotic/inflammatory infiltrate areas in mouse ischemic hindlimb, with a pattern resembling that of platelet endothelial cell adhesion molecule (PEC AM).
Furthermore, results indicate that Human SLGP is also expressed at high levels in the aortic root of ApoE mice in endothelial cells on the valvular leaflet. The ApoE model is a well-characterized animal model of atherosclerosis, indicating a role for SLGP in cardiovascular disease, e.g., atherosclerosis.
EXAMPLE 4: ANALYSIS OF HUMAN AND MOUSE SLGP
EXPRESSION This example describes the expression of human and mouse SLGP as determined by transcriptional profiling experiments. Expression of human SLGP in proliferating HMVEC and arresting HMVEC was analyzed by transcriptional profiling. As shown in Figure 10, expression of human SLGP is up-regulated in proliferating HMVEC as compared to arresting HMVEC.
Expression of mouse SLGP in VEGF-induced angiogenic plugs and parental xenografts was also analyzed by transcriptional profiling. As shown in Figure 12, mouse SLGP expression is up-regulated in VEGF-induced angiogenic xenograft plugs as compared to parental xenografts.
EXAMPLE 5: EXPRESSION OF RECOMBINANT SLGP PROTEIN IN
BACTERIAL CELLS In this example, SLGP is expressed as a recombinant glutathione-S-transferase
(GST) fusion polypeptide in E. coli and the fusion polypeptide is isolated and characterized. Specifically, SLGP is fused to GST and this fusion polypeptide is expressed in E. coli, e.g., strain PEB199. Expression ofthe GST-SLGP fusion protein in PEB199 is induced with IPTG. The recombinant fusion polypeptide is purified from crude bacterial lysates ofthe induced PEB199 strain by affinity chromatography on glutathione beads. Using polyacrylamide gel electrophoretic analysis ofthe polypeptide purified from the bacterial lysates, the molecular weight ofthe resultant fusion polypeptide is determined.
EXAMPLE 6: EXPRESSION OF RECOMBINANT SLGP PROTEIN
IN COS CELLS
To express the SLGP gene in COS cells, the pcDNA/Amp vector by Invitrogen Coφoration (San Diego, CA) is used. This vector contains an SV40 origin of replication, an ampicillin resistance gene, an E. coli replication origin, a CMV promoter followed by a polylinker region, and an SV40 intron and polyadenylation site. A DNA fragment encoding the entire SLGP protein and an HA tag (Wilson et al. (1984) Cell 31:161) or a FLAG tag fused in-frame to its 3' end ofthe fragment is cloned into the polylinker region ofthe vector, thereby placing the expression ofthe recombinant protein under the control of the CMV promoter.
To construct the plasmid, the SLGP DNA sequence is amplified by PCR using two primers. The 5' primer contains the restriction site of interest followed by approximately twenty nucleotides ofthe SLGP coding sequence starting from the initiation codon; the 3' end sequence contains complementary sequences to the other restriction site of interest, a translation stop codon, the HA tag or FLAG tag and the last 20 nucleotides ofthe SLGP coding sequence. The PCR amplified fragment and the pCDNA/Amp vector are digested with the appropriate restriction enzymes and the vector is dephosphorylated using the CIAP enzyme (New England Biolabs, Beverly, MA). Preferably the two restriction sites chosen are different so that the SLGP gene is inserted in the correct orientation. The ligation mixture is transformed into E. coli cells (strains HB101, DH5α, SURE, available from Stratagene Cloning Systems, La Jolla, CA, can be used), the transformed culture is plated on ampicillin media plates, and resistant colonies are selected. Plasmid DNA is isolated from transformants and examined by restriction analysis for the presence ofthe correct fragment. COS cells are subsequently transfected with the SLGP-pcDNA/Amp plasmid
DNA using the calcium phosphate or calcium chloride co-precipitation methods, DEAE- dextran-mediated transfection, lipofection, or electroporation. Other suitable methods for transfecting host cells can be found in Sambrook, J., Fritsh, E. F., and Maniatis, T. Molecular Cloning: A Laboratory Manual. 2nd, ed, Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989. The expression
ofthe SLGP polypeptide is detected by radiolabelling (35 S -methionine or ^^S-cysteine available from NEN, Boston, MA, can be used) and immunoprecipitation (Harlow, E. and Lane, D. Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1988) using an HA specific monoclonal antibody. Briefly, the cells are labeled for 8 hours with 35s-methionine (or 35s-cysteine). The culture media are then collected and the cells are lysed using detergents (RIP A buffer, 150 mM NaCl, 1% NP-40, 0.1% SDS, 0.5% DOC, 50 mM Tris, pH 7.5). Both the cell lysate and the culture media are precipitated with an HA-specific monoclonal antibody. Precipitated polypeptides are then analyzed by SDS-PAGE. Alternatively, DNA containing the SLGP coding sequence is cloned directly into the polylinker ofthe pCDN A/Amp vector using the appropriate restriction sites. The resulting plasmid is transfected into COS cells in the manner described above, and the expression ofthe SLGP polypeptide is detected by radiolabelling and immunoprecipitation using an SLGP-specific monoclonal antibody.
Equivalents
Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments ofthe invention described herein. Such equivalents are intended to be encompassed by the following claims.
Claims
1. An isolated nucleic acid molecule comprising the nucleotide sequence set forth in SEQ ID NOT, SEQ ID NO: 17, or a complement thereof.
2. An isolated nucleic acid molecule comprising the nucleotide sequence set forth in SEQ ID NO:3, SEQ ID NO: 19, or a complement thereof.
3. An isolated nucleic acid molecule consisting ofthe nucleotide sequence set forth in SEQ ID NOT, SEQ ID NOT7, or a complement thereof.
4. An isolated nucleic acid molecule consisting ofthe nucleotide sequence set forth in SEQ ID NO:3, SEQ ID NO: 19, or a complement thereof.
5. An isolated nucleic acid molecule which encodes a polypeptide comprising the amino acid sequence set forth in SEQ ID NO:2, SEQ ID NO: 18, or a complement thereof.
6. An isolated nucleic acid molecule which encodes a polypeptide consisting ofthe amino acid sequence set forth in SEQ ID NO:2, SEQ ID NOT 8, or a complement thereof.
7. An isolated nucleic acid molecule comprising a nucleotide sequence encoding a mammalian G protein-coupled receptor, wherein the nucleotide sequence hybridizes to a nucleic acid molecule consisting of SEQ ID NOT, SEQ ID NO:3, SEQ DI NO: 17, or SEQ ID NO: 19 at 6X SSC at 45° C, followed by one or more washes in 0.2X SSC, 0.1% SDS at 50-65° C.
8. An isolated nucleic acid molecule consisting of a nucleotide sequence encoding a mammalian G protein-coupled receptor, wherein the nucleotide sequence hybridizes to a nucleic acid molecule consisting of SEQ ID NO: 1 , SEQ ID NO:3, SEQ ID NO: 17, or SEQ ID NO: 19 at 6X SSC at 45° C, followed by one or more washes in 0.2X SSC, 0.1% SDS at 50-65° C.
9. An isolated nucleic acid molecule comprising a nucleotide sequence encoding a mammalian G protein-coupled receptor polypeptide, wherein the nucleotide sequence is at least 90% identical to the nucleotide sequence of SEQ ID NOT, SEQ ID NO:3, SEQ ID NO: 17, SEQ ID NO: 19, or a complement thereof.
10. An isolated nucleic acid molecule consisting of a nucleotide sequence encoding a mammalian G protein-coupled receptor polypeptide, wherein the nucleotide sequence is at least 90% identical to the nucleotide sequence of SEQ ID NOT, SEQ ID NO:3, SEQ ID NOT 7, SEQ ID NO.T9, or a complement thereof.
11. An isolated nucleic acid molecule comprising the nucleic acid molecule of any one of claims 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, and a nucleotide sequence encoding a heterologous polypeptide.
12. A vector comprising the nucleic acid molecule of any one of claims 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
13. The vector of claim 12, which is an expression vector.
14. An isolated host cell comprising the nucleic acid molecule of any one of claims 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, wherein the nucleic acid molecule is operatively linked to a recombinant regulatory sequence.
15. A method of expressing a polypeptide comprising the step of culturing the isolated host cell of claim 14 under conditions in which the nucleic acid molecule is expressed, thereby expressing the polypeptide.
16. A method of producing a polypeptide comprising the steps of culturing the isolated host cell ofclaim 14 under conditions in which the nucleic acid molecule is expressed and isolating said polypeptide from the culture medium, thereby producing a polypeptide.
17. A kit comprising the nucleic acid molecule of any one of claims 1 , 2, 3,
4, 5, 6, 7, 8, 9, or 10, and instructions for use.
18. A method for identifying a compound capable of treating a cellular proliferation, growth, differentiation, or migration disorder comprising assaying the ability ofthe compound to modulate SLGP nucleic acid expression or SLGP polypeptide activity, thereby identifying a compound capable of treating a cellular proliferation, growth, differentiation, or migration disorder.
19. The method ofclaim 18, wherein the cellular proliferation, growth, differentiation, or migration disorder is cancer.
20. The method ofclaim 18, wherein the ability ofthe compound modulate SLGP nucleic acid expression or SLGP polypeptide activity is determined by detecting increased or decreased angiogenesis.
21. The method of claim 18, wherein the ability of the compound modulate SLGP nucleic acid expression or SLGP polypeptide activity is determined by detecting decreased angiogenesis in tumor endothelial cells.
22. A method for identifying a compound capable of modulating an endothelial cell process comprising: a) contacting an endothelial cell with a test compound; and b) assaying the ability ofthe test compound to modulate the expression of an SLGP nucleic acid or the activity of an SLGP polypeptide, thereby identifying a compound capable of modulating an endothelial cell process.
23. The method of claim 22, wherein said endothelial cell process is endothelial cell proliferation.
24. The method of claim 22, wherein said endothelial cell process is endothelial cell migration.
25. The method of claim 22, wherein said endothelial cell process is endothelial cell differentiation.
26. The method of claim 22, wherein said endothelial cell is a tumor endothelial cell.
27. A method for modulating an endothelial cell process comprising contacting an endothelial cell with an SLGP modulator, thereby modulating said endothelial cell process.
28. The method ofclaim 27, wherein said endothelial cell process is endothelial cell proliferation.
29. The method ofclaim 27, wherein said endothelial cell process is endothelial cell migration.
30. The method of claim 27, wherein said endothelial cell process is endothelial cell differentiation.
31. The method of claim 27, wherein the SLGP modulator is a small molecule.
32. The method of claim 27, wherein the SLGP modulator is capable of modulating SLGP polypeptide activity.
33. The method ofclaim 32, wherein the SLGP modulator is an anti-SLGP antibody.
34. The method ofclaim 32, wherein the SLGP modulator is an SLGP polypeptide comprising the amino acid sequence of SEQ ID NO:2, or a fragment thereof.
35. The method of claim 32, wherein the SLGP modulator is an SLGP polypeptide comprising an amino acid sequence which is at least 90 percent identical to the amino acid sequence of SEQ ID NO:2.
36. The method ofclaim 32, wherein the SLGP modulator is an isolated naturally occurring allelic variant of a polypeptide consisting ofthe amino acid sequence of SEQ ID NO:2, wherein the polypeptide is encoded by a nucleic acid molecule which hybridizes to a complement of a nucleic acid molecule consisting of SEQ ID NO: 1 at 6X SSC at 45°C, followed by one or more washes in 0.2X SSC, 0.1% SDS at 50-65°C.
37. The method of claim 27, wherein the SLGP modulator is capable of modulating SLGP nucleic acid expression.
38. The method ofclaim 37, wherein the SLGP modulator is an antisense SLGP nucleic acid molecule.
39. The method of claim 37, wherein the SLGP modulator is a ribozyme.
40. The method ofclaim 37, wherein the SLGP modulator comprises the nucleotide sequence of SEQ ID NOT, or a fragment thereof.
41. A method for treating a subject having a cellular proliferation, growth, differentiation, or migration disorder characterized by aberrant SLGP polypeptide activity or aberrant SLGP nucleic acid expression comprising administering to the subject an SLGP modulator, thereby treating said subject having a cellular proliferation, growth, differentiation, or migration disorder.
42. The method of claim 41 , wherein said cellular proliferation, growth, differentiation, or migration disorder is cancer.
43. The method of claim 41 , wherein said SLGP modulator' is administered in a pharmaceutically acceptable formulation.
44. The method of claim 41 , wherein said SLGP modulator is administered using a gene therapy vector.
45. The method of claim 41 , wherein the SLGP modulator is a small molecule.
46. The method of claim 41 , wherein the SLGP modulator is capable of modulating SLGP polypeptide activity.
47. The method of claim 46, wherein the SLGP modulator is an anti-SLGP antibody.
48. The method of claim 46, wherein the SLGP modulator is an SLGP polypeptide comprising the amino acid sequence of SEQ ID NO:2, or a fragment thereof.
49. The method ofclaim 46, wherein the SLGP modulator is an SLGP polypeptide comprising an amino acid sequence which is at least 90 percent identical to the amino acid sequence of SEQ ID NO:2.
50. The method ofclaim 46, wherein the SLGP modulator is an isolated naturally occurring allelic variant of a polypeptide consisting ofthe amino acid sequence of SEQ ID NO:2, wherein the polypeptide is encoded by a nucleic acid molecule which hybridizes to a complement of a nucleic acid molecule consisting of SEQ ID NO: 1 at 6X SSC at 45°C, followed by one or more washes in 0.2X SSC, 0.1% SDS at 50-65°C.
51. The method of claim 41 , wherein the SLGP modulator is capable of modulating SLGP nucleic acid expression.
52. The method of claim 51, wherein the SLGP modulator is an antisense SLGP nucleic acid molecule.
• 53. The method of claim 51 , wherein the SLGP modulator is a ribozyme.
54. The method of claim 51 , wherein the SLGP modulator comprises the nucleotide sequence of SEQ ID NOT, or a fragment thereof.
55. A method for modulating angiogenesis in a subject comprising administering to the subject an SLGP modulator, thereby modulating angiogenesis in said subject.
56. A method for modulating angiogenesis in a tumor comprising contacting the tumor with an SLGP modulator, thereby modulating angiogenesis in said tumor.
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US608921 | 1996-02-29 | ||
| US60892100A | 2000-06-30 | 2000-06-30 | |
| PCT/US2001/020751 WO2002002602A2 (en) | 2000-06-30 | 2001-06-29 | Slgp protein and nucleic acid molecules and uses therefor |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP1309686A2 true EP1309686A2 (en) | 2003-05-14 |
Family
ID=24438633
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP01952313A Withdrawn EP1309686A2 (en) | 2000-06-30 | 2001-06-29 | Slgp protein and nucleic acid molecules and uses therefor |
Country Status (3)
| Country | Link |
|---|---|
| EP (1) | EP1309686A2 (en) |
| AU (1) | AU2001273077A1 (en) |
| WO (1) | WO2002002602A2 (en) |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000053753A2 (en) * | 1999-03-08 | 2000-09-14 | Genentech, Inc. | Promotion or inhibition of angiogenesis and cardiovascularization |
| NZ503343A (en) * | 1997-09-17 | 2002-09-27 | Genentech Inc | Secreted and transmembrane polypeptides and use to induce apoptosis of tumour cells |
| WO2000018923A2 (en) * | 1998-09-30 | 2000-04-06 | Millennium Pharmaceuticals, Inc. | Slgp protein and nucleic acid molecule and uses therefor |
| WO2001060999A1 (en) * | 2000-02-14 | 2001-08-23 | Imclone Systems Incorporated | Nucleic acid sequences characteristic of hematopoietic stem cells |
-
2001
- 2001-06-29 AU AU2001273077A patent/AU2001273077A1/en not_active Abandoned
- 2001-06-29 EP EP01952313A patent/EP1309686A2/en not_active Withdrawn
- 2001-06-29 WO PCT/US2001/020751 patent/WO2002002602A2/en not_active Ceased
Non-Patent Citations (1)
| Title |
|---|
| See references of WO0202602A3 * |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2001273077A1 (en) | 2002-01-14 |
| WO2002002602A3 (en) | 2002-08-22 |
| WO2002002602A2 (en) | 2002-01-10 |
| WO2002002602A9 (en) | 2003-03-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP1131433A1 (en) | Members of the capsaicin/vanilloid receptor family of proteins and uses thereof | |
| US8133689B2 (en) | Members of the capsaicin/vanilloid receptor family of proteins and uses thereof | |
| EP1100877A1 (en) | Novel potassium channel molecules and uses therefor | |
| WO2000052164A2 (en) | Potassium channel molecules and uses therefor | |
| WO2000042170A1 (en) | Novel lrsg protein and nucleic acid molecules and uses therefor | |
| US20020173636A1 (en) | 66784, a novel human potassium channel and uses therefor | |
| AU4101599A (en) | Novel secreted and membrane-associated proteins and uses therefor | |
| WO2002038767A2 (en) | G protein-coupled receptor protein and nucleic acid molecules and uses therefor | |
| US20030087343A1 (en) | Novel SLGP nucleic acid molecules and uses therefor | |
| US20060275870A1 (en) | Novel G-protein coupled receptors and uses therefor | |
| US6204013B1 (en) | MSP-5 nucleic acid molecules and uses therefor | |
| WO2001085768A2 (en) | G-protein coupled receptors and uses therefor | |
| WO2001083523A2 (en) | Stmst protein and nucleic acid molecules and uses therefor | |
| US6756212B1 (en) | Isolated proteins and nucleic acid molecules having homology to the NIP2 protein and uses thereof | |
| US20020004193A1 (en) | Novel MP-7 protein and nucleic acid molecules and uses therefor | |
| US20030119147A1 (en) | Novel SLGP protein and nucleic acid molecules and uses therefor | |
| EP1309686A2 (en) | Slgp protein and nucleic acid molecules and uses therefor | |
| WO2001000878A2 (en) | A novel vascular endothelial growth factor family member and uses thereof | |
| EP1792913A1 (en) | Novel secreted and membrane-associated proteins and uses therefor | |
| WO2000043514A9 (en) | Human acid sensing ion channel and uses thereof | |
| WO2000017236A2 (en) | Apoptosis related protein and uses therefor |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20030129 |
|
| AK | Designated contracting states |
Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE TR |
|
| AX | Request for extension of the european patent |
Extension state: AL LT LV MK RO SI |
|
| 17Q | First examination report despatched |
Effective date: 20030710 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20040914 |