EP1283875A1 - Improved nucleic acid modifying enzymes - Google Patents

Improved nucleic acid modifying enzymes

Info

Publication number
EP1283875A1
EP1283875A1 EP01941707A EP01941707A EP1283875A1 EP 1283875 A1 EP1283875 A1 EP 1283875A1 EP 01941707 A EP01941707 A EP 01941707A EP 01941707 A EP01941707 A EP 01941707A EP 1283875 A1 EP1283875 A1 EP 1283875A1
Authority
EP
European Patent Office
Prior art keywords
acid
nucleic
domain
sequence
protein
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Granted
Application number
EP01941707A
Other languages
German (de)
French (fr)
Other versions
EP1283875A4 (en
EP1283875B1 (en
Inventor
Yan Wang
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Bio Rad Laboratories Inc
Original Assignee
MJ Bioworks Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by MJ Bioworks Inc filed Critical MJ Bioworks Inc
Priority to EP07009588.0A priority Critical patent/EP1832652B1/en
Publication of EP1283875A1 publication Critical patent/EP1283875A1/en
Publication of EP1283875A4 publication Critical patent/EP1283875A4/en
Application granted granted Critical
Publication of EP1283875B1 publication Critical patent/EP1283875B1/en
Anticipated expiration legal-status Critical
Expired - Lifetime legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/12Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
    • C12N9/1241Nucleotidyltransferases (2.7.7)
    • C12N9/1276RNA-directed DNA polymerase (2.7.7.49), i.e. reverse transcriptase or telomerase
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/001Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K19/00Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/12Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
    • C12N9/1241Nucleotidyltransferases (2.7.7)
    • C12N9/1252DNA-directed DNA polymerase (2.7.7.7), i.e. DNA replicase
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/96Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P19/00Preparation of compounds containing saccharide radicals
    • C12P19/26Preparation of nitrogen-containing carbohydrates
    • C12P19/28N-glycosides
    • C12P19/30Nucleotides
    • C12P19/34Polynucleotides, e.g. nucleic acids, oligoribonucleotides
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y207/00Transferases transferring phosphorus-containing groups (2.7)
    • C12Y207/07Nucleotidyltransferases (2.7.7)
    • C12Y207/07049RNA-directed DNA polymerase (2.7.7.49), i.e. telomerase or reverse-transcriptase
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/80Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y207/00Transferases transferring phosphorus-containing groups (2.7)
    • C12Y207/07Nucleotidyltransferases (2.7.7)
    • C12Y207/07007DNA-directed DNA polymerase (2.7.7.7), i.e. DNA replicase
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02PCLIMATE CHANGE MITIGATION TECHNOLOGIES IN THE PRODUCTION OR PROCESSING OF GOODS
    • Y02P20/00Technologies relating to chemical industry
    • Y02P20/50Improvements relating to the production of bulk chemicals
    • Y02P20/52Improvements relating to the production of bulk chemicals using catalysts, e.g. selective catalysts

Definitions

  • This invention provides for an improved generation of novel nucleic acid modifying enzymes.
  • the improvement is the joining of a sequence-non-specific nucleic- acid-binding domain to the enzyme in a manner that enhances the ability of the enzyme to bind and catalytically modify the nucleic acid.
  • nucleic acid modifying enzyme i. e. , the amount of modified product generated by the enzyme per binding event
  • the efficiency of a nucleic acid modifying enzyme can be enhanced by increasing the stability of the modifying enzyme/nucleic acid complex.
  • attachment of a high probability binding site, e.g., a positively charged binding tail, to a nucleic acid modifying enzyme can increase the frequency with which the modifying enzyme interacts with the nucleic acid (see, e.g., U.S. Patent No. 5, 474,911).
  • the pr ⁇ sent invention now provides novel modifying enzymes in which the double-stranded conformation of the nucleic acid is stabilized and the efficiency of the enzyme increased by joining a sequence- non-specific double-stranded nucleic acid binding domain to the enzyme, or its catalytic domain.
  • the modifying proteins that are processive in nature exhibit increased processivity when joined to a binding domain compared to the enzyme alone.
  • both processive and non-processive modifying enzymes exhibit increased efficiency at higher temperatures when joined to a typical binding domain described herein.
  • the invention provides fusion polymerases that provide an enhanced ability to perform long PCR, i.e., amplification of sequences of 5 kb or greater in length. Polymerase mixture to perform long PCR are known in the art.
  • modified polymerase enzymes that exhibit an enhanced ability to perform long PCR compared to those polymerases and/or polymerase mixtures currently available. These modified enzymes, e.g., Pfu-Sso7d, incorporate a polymerase with error-correcting activity and a sequence-nonspecific double-stranded DNA-binding domain, and therefore provide the capability of PCR amplifying DNA larger than 5 kb without need to resort to polymerase mixtures.
  • modified enzymes can efficiently amplify a given fragment using shorter extension times than are required by conventional polymerase mixtures.
  • use of the hybrid polymerases described herein instead of the conventional mixtures can greatly decrease the reaction time required to amplify large fragments, e.g. from about seven hours to about two hours.
  • the present invention provides a protein consisting of at least two heterologous domains wherein a first domain that is a sequence-non-specific double-stranded nucleic acid binding domain is joined to a second domain that is a catalytic nucleic acid modifying domain having a processive nature, where the presence of the sequence-nonspecific double-stranded nucleic acid binding domain enhances the processive nature of the nucleic acid modifying domain compared to an identical protein not having a sequence-non- specific nucleic acid binding domain joined thereto.
  • the nucleic acid modifying domain can have a polymerase activity, which can be thermally stable, e.g., a Thermus polymerase domain.
  • the catalytic domain is an RNA polymerase, a reverse transcriptase, a methylase, a 3' or 5' exonuclease, a gyrase, or a topoisomerase.
  • a sequence-non-specific nucleic acid binding domain of the protein can specifically bind to polyclonal antibodies generated against Sac7d or Sso7d.
  • the sequence-non-specific nucleic acid binding domain can contain a 50 amino acid subsequence that has 50% amino acid similarity to Sso7d.
  • the nucleic acid binding domain can also be Sso7d.
  • a protein of the invention contains a sequence-nonspecific double-stranded nucleic acid binding domain that specifically binds to polyclonal antibodies generated against a PCNA homolog of Pyrococcus furiosus, or can be a PCNA homolog of Pyrococcus furiosus.
  • the invention also provides a protein consisting of at least two heterologous domains, wherein a first domain that is a sequence-non-specific double-stranded nucleic acid binding domain is joined to a second domain that is a catalytic nucleic-acid-modifying domain, where the presence of the sequence-non-specific nucleic-acid binding domain stabilizes the double-stranded conformation of a nucleic acid by at least 1°C compared to an identical protein not having a sequence-non-specific nucleic acid binding domain joined thereto.
  • the nucleic acid modifying domain of such a protein can have polymerase activity, which can be thermally stable.
  • the nucleic-acid-modifying domain can also have RNA polymerase, reverse transcriptase, methylase, 3' or 5' exonuclease, gyrase, or topoisomerase activity.
  • the sequence-non-specific nucleic-acid-binding domain can specifically bind to polyclonal antibodies generated against either Sac7d or Sso7d, frequently Sso7d, or contains a 50 amino acid subsequence containing 50% or 15% amino acid similarity to Sso7d. Often, the sequence-non-specific nucleic-acid-binding domain is Sso7d.
  • Proteins of the invention include a protein wherein the sequence-non-specific nucleic-acid-binding domain specifically binds to polyclonal antibodies generated against the PCNA homolog of Pyrococcus furiosus; often the binding domain is the PCNA homolog of Pyrococcus furiosus.
  • the invention provides methods of modifying nucleic acids using the proteins.
  • One embodiment is a method of modifying a nucleic acid in an aqueous solution by: (i) contacting the nucleic acid with a protein comprising at least two heterologous domains, wherein a first domain that is a sequence-non-specific nucleic-acid- binding domain is joined to a second domain that is a catalytic nucleic-acid-modifying domain having a processive nature, where the sequence-non-specific nucleic-acid-binding domain: a. binds to double-stranded nucleic acid, and b.
  • the solution is at a temperature and of a composition that permits the binding domain to bind to the nucleic acid and the enzyme to function in a catalytic manner; and (ii) permitting the catalytic domain to modify the nucleic acid in the solution.
  • the invention provides a method of modifying a nucleic acid by: (i) contacting the nucleic acid with an aqueous solution containing a protein having at least two heterologous domains, wherein a first domain that is a sequence-non-specific double-stranded nucleic-acid-binding domain is joined to a second domain that is a catalytic nucleic-acid-modifying domain, where the presence of the sequence-non-specific nucleic- acid-binding domain stabilizes the formation of a double-stranded nucleic acid compared to an otherwise identical protein not having the sequence-non-specific nucleic-acid-binding domain joined to it; and wherein the solution is at a temperature and of a composition that permits the binding domain to bind to the nucleic acid and the enzyme to function in a catalytic manner; and (ii) permitting the catalytic domain to modify the nucleic acid in the solution.
  • the invention provides a method of amplifying a 5kb or longer subsequence of a target nucleic acid in an aqueous solution using a polymerase chain reaction, the method comprising: (i) contacting the target nucleic acid with a protein comprising at least two heterologous domains, wherein a first domain that is a sequence-nonspecific nucleic-acid-binding domain is joined to a second domain that is a polymerase domain with error-correcting activity, where the sequence non-specific nucleic-acid-binding domain: (a) binds to double-stranded nucleic acid, and (b) enhances the processivity of the polymerase compared to an identical polymerase not having the sequence non-specific nucleic-acid-binding domain fused to it, and, wherein the solution is of a composition that permits the binding domain to bind to the target nucleic acid
  • the nucleic- acid-modifying domain has thermally stable polymerase activity.
  • the nucleic-acid modifying domain comprises a Pyrococcus polymerase domain.
  • the sequence-non-specific nucleic-acid-binding domain specifically binds to polyclonal antibodies generated against either Sac7d or Sso7d, contains a 50 amino acid subsequence containing 50% amino acid similarity to Sso7D, or specifically binds to polyclonal antibodies generated against Sso7d.
  • the sequence-nonspecific nucleic-acid-binding domain is Sso7d.
  • the invention provides a method of amplifying a subsequence of a target nucleic acid in an aqueous solution using a polymerase chain reaction, the method comprising(i) contacting the target nucleic acid with a protein comprising at least two heterologous domains, wherein a first domain that is a sequence-non- specific nucleic-acid-binding domain is joined to a second domain that is a polymerase domain with error-correcting activity, where the sequence non-specific nucleic-acid-binding domain: (a) binds to double-stranded nucleic acid, and (b) enhances the processivity of the polymerase compared to an identical polymerase not having the sequence non-specific nucleic-acid-binding domain fused to it, and wherein the solution comprises 10 5 or fewer copies/ml of the target nucleic acid and is of a composition that permits the binding domain to bind to the target nucleic acid and the polymerase domain to extend a
  • the nucleic-acid-modifying domain has thermally stable polymerase activity. Often, the nucleic-acid modifying domain comprises a Pyrococcus polymerase domain. In other embodiments of the method, the sequence-non-specific nucleic-acid-binding domain specifically binds to polyclonal antibodies generated against either Sac7d or Sso7d, contains a 50 amino acid subsequence containing 50% amino acid similarity to Sso7D, or specifically binds to polyclonal antibodies generated against Sso7d. In another embodiment, the sequence-non-specific nucleic-acid-binding domain is Sso7d.
  • “Archaeal small basic DNA-binding protein” refers to protein of between 50- 75 amino acids having either 50%) homology to a natural Archaeal small basic DNA-binding protein such as Sso-7d from Sulfolobus sulfataricus or binds to antibodies generated against a native Archaeal small basic DNA-binding protein.
  • Catalytic nucleic-acid-modifying domains having a processive nature refers to a protein sequence or subsequence that performs as an enzyme having the ability to slide along the length of a nucleic acid molecule and chemically alter its structure repeatedly.
  • a catalytic domain can include an entire enzyme, a subsequence thereof, or can include additional amino acid sequences that are not attached to the enzyme or subsequence as found in nature.
  • Domain refers to a unit of a protein or protein complex, comprising a polypeptide subsequence, a complete polypeptide sequence, or a plurality of polypeptide sequences where that unit has a defined function.
  • the function is understood to be broadly defined and can be ligand binding, catalytic activity or can have a stabilizing effect on the structure of the protein.
  • Efficiency in the context of a nucleic acid modifying enzyme of this invention refers to the ability of the enizyme to perform its catalytic function under specific reaction conditions. Typically, “efficiency” as defined herein is indicated by the amount of modified bases generated by the modifying enzyme per binding to a nucleic acid.
  • Enhances in the context of an enzyme refers to improving the activity of the enzyme, i.e., increasing the amount of product per unit enzyme per unit time. “Fused” refers to linkage by covalent bonding.
  • Heterologous when used with reference to portions of a protein, indicates that the protein comprises two or more domains that are not found in the same relationship to each other in nature.
  • a protein e.g., a fusion protein
  • “Join” refers to any method known in the art for functionally connecting protein domains, including without limitation recombinant fusion with or without intervening domains, intein-mediated fusion, non-covalent association, and covalent bonding, including disulfide bonding; hydrogen bonding; electrostatic bonding; and conformational bonding, e.g., antibody-antigen, and biotin-avidin associations.
  • Method refers to an enzyme that can modify a nucleic acid by the addition of a methyl group to a nucleotide.
  • Nuclease refers to an enzyme capable of cleaving the phosphodiester bonds between nucleotide subunits of nucleic acids.
  • Nucleic-acid-modifying enzyme refers to an enzyme that covalently alters a nucleic acid.
  • Polymerase refers to an enzyme that performs template-directed synthesis of polynucleotides.
  • Error-correcting activity of a polymerase or polymerase domain refers to the 3' to 5' exonuclease proofreading activity of a template-specific nucleic acid polymerase whereby nucleotides that do not form Watson-Crick base pairs with the template are removed from the 3' end of an oligonucleotide, i.e., a strand being synthesized from a template, in a sequential manner.
  • Examples of polymerases that have error-correcting activity include polymerases from Pry ococcus furiosus, Thermococcus litoralis, and Thermotoga maritima.
  • Processivity refers to the ability of a nucleic acid modifying enzyme to remain attached to the template or substrate and perform multiple modification reactions. Typically "processivity” refers to the ability to modify relatively long tracts of nucleic acid.
  • Restriction Endonuclease refers to any of a group of enzymes, produced by bacteria, that cleave molecules of DNA internally at specific base sequences.
  • Sequence-non-specific nucleic-acid-binding domain refers to a protein domain which binds with significant affinity to a nucleic acid, for which there is no known nucleic acid which binds to the protein domain with more than 100-fold more affinity than another nucleic acid with the same nucleotide composition but a different nucleotide sequence.
  • Thermally stable polymerase refers to any enzyme that catalyzes polynucleotide synthesis by addition of nucleotide units to a nucleotide chain using DNA or RNA as a template and has an optimal activity at a temperature above 45°C.
  • Thermus polymerase refers to a family A DNA polymerase isolated from any Thermus species, including without limitation Thermus aquaticus, Thermus brockianus, and Thermus thermophilus; any recombinant enzymes deriving from Thermus species, and any functional derivatives thereof, whether derived by genetic modification or chemical modification or other methods known in the art.
  • PCR Polymerase chain reaction
  • Long PCR refers to the amplification of a DNA fragment of 5 kb or longer in length. Long PCR is typically performed using specially-adapted polymerases or polymerase mixtures (see, e.g., U.S. Patent Nos. 5, 436,149 and 5,512,462) that are distinct from the polymerases conventionally used to amplify shorter products.
  • a “primer” refers to a polynucleotide sequence that hybridizes to a sequence on a target nucleic acid and serves as a point of initiation of nucleic acid synthesis.
  • Primers can be of a variety of lengths and are often less than 50 nucleotides in length, for example 12- 25 nucleotides, in length.
  • the length and sequences of primers for use in PCR can be designed based on principles known to those of skill in the art, see, e.g., Innis et al., supra.
  • a “temperature profile” refers to the temperature and lengths of time of the denaturation, annealing and/or extension steps of a PCR reaction.
  • a temperature profile for a PCR reaction typically consists of 10 to 60 repetitions of similar or identical shorter temperature profiles; each of these shorter profiles typically define a two step or three-step PCR reaction. Selection of a "temperature profile” is based on various considerations known to those of skill in the art, see, e.g., Innis et al, supra. In a long PCR reaction as described herein, the extension time required to obtain an amplification product of 5 kb or greater in length is reduced compared to conventional polymerase mixtures.
  • PCR "sensitivity” refers to the ability to amplify a target nucleic acid that is present in low copy number.
  • Low copy number refers to 10 5 , often 10 4 , 10 3 , 10 2 , or fewer, copies of the target sequence in the nucleic acid sample to be amplified.
  • a “template” refers to a double stranded polynucleotide sequence that comprises the polynucleotide to be amplified, flanked by primer hybridization sites.
  • a “target template” comprises the target polynucleotide sequence flanked by hybridization sites for a 5' primer and a 3' primer.
  • Figure la-c shows the results of PCR amplification reactions performed using primers of different lengths to compare the efficiency of Sso7d-modified polymerase with the unmodifed full-length polymerase.
  • Figure 2 shows the results of a PCR amplification reaction using a 12 nt forward primer to evaluate the PCR products generated using Sac7d- ⁇ Taq compared to Taq.
  • Figure 3 shows the results of PCR amplification reactions that demonstrate that Pfu-Sso7d is more efficient than DyNAzyme EXT in long PCR.
  • the present invention is the discovery that sequence-non-specific double- stranded nucleic acid binding proteins can be joined to catalytic nucleic acid modifying proteins to enhance the processive nature of the catalytic protein. While the prior art taught that nucleic acid binding proteins can increase the binding affinity of enzymes to nucleic acid, the group of binding proteins having the ability to enhance the processive nature of the enzymes is of particular value. Not to be bound by theory, binding domains of the invention typically dissociate from double-stranded nucleic acid at a very slow rate. Thus, they increase the processivity and/or efficiency of a modifying enzyme to which they are joined by stablizing the enzyme-nucleic acid complex.
  • this invention includes the discovery that DNA-binding domains can stabilize the double-stranded conformation of a nucleic acid and increase the efficiency of a catalytic domain that requires a double-stranded substrate. Described herein are examples and simple assays to readily determine the improvement to the catalytic and or processive nature of catalytic nucleic acid modifying enzymes.
  • a catalytic nucleic-acid-modifying domain is the region of a modification enzyme that performs the enzymatic function.
  • the catalytic nucleic-acid modifying domains of the invention can be processive, e.g., polymerase, exonuclease, etc., or non-processive, e.g., ligases, restriction endonucleases, etc.
  • Processivity reflects the ability of a nucleic acid modifying enzyme to synthesize or perform multiple modifications, e.g., nucleotide additions or methylations, in a single binding event.
  • the processive proteins of the present invention exhibit enhanced processivity due to the presence of a sequence-non-specific double-stranded DNA binding domain that is joined to the processive modifying enzyme (or the enzymatic domain of the modifying enzyme), thereby providing a tethering domain to stabilize the nucleic acid/enzyme complex.
  • the binding domain is from a thermostable organism and provides enhanced activity at higher temperatures, e.g., temperatures above 45°C.
  • Examples of processive modifying enzymes include DNA polymerases, RNA polymerases, reverse transcriptases, methylases, 3' or 5' exonucleases, gyrases, and topoisomerase.
  • DNA polymerases are well-known to those skilled in the art. These include both DNA-dependent polymerases and RNA-dependent polymerases such as reverse transcriptase. At least five families of DNA-dependent DNA polymerases are known, although most fall into families A, B and C. There is little or no structural or sequence similarity among the various families. Most family A polymerases are single chain proteins that can contain multiple enzymatic functions including polymerase, 3' to 5' exonuclease activity and 5' to 3' exonuclease activity. Family B polymerases typically have a single catalytic domain with polymerase and 3' to 5' exonuclease activity, as well as accessory factors.
  • Family C polymerases are typically multi-subunit proteins with polymerizing and 3 ' to 5' exonuclease activity.
  • DNA polymerases I family A
  • II family B
  • III family C
  • family B family B polymerases
  • DNA polymerases ⁇ , ⁇ , and ⁇ are implicated in nuclear replication
  • a family A polymerase, polymerase ⁇ is used for mitochondrial DNA replication.
  • Other types of DNA polymerases include phage polymerases.
  • RNA polymerase typically include eukaryotic RNA polymerases I, II, and III, and bacterial RNA polymerases as well as phage and viral polymerases.
  • RNA polymerases can be DNA-dependent and RNA-dependent.
  • polymerase domains that have an error-correcting activity are used as the catalytic domain of the improved polymerases described herein.
  • These polymerases can be used to obtain long, i.e., 5 kb, often 10 kb, or greater in length, PCR products.
  • "Long PCR” using these improved polymerases can be performed using extension times that are reduced compared to prior art "long PCR” polymerase and/or polymerase mixtures. Extension times of less than 30 seconds per kb, often 15 seconds per kb, can be used to amplify long products in PCR reactions using the improved polymerases.
  • these modified polymerases also exhibit increased sensitivity.
  • Prior-art non-error-correcting polymerases such as Taq polymerase are capable of amplifying DNA from very small input copy concentrations, such as, in the extreme, 10 copies per ml. However, because of the low fidelity of such polymerases, products cloned from such amplifications are likely to contain introduced mutations.
  • Prior-art error-correcting polymerases such as Pfu copy DNA with higher fidelity than Taq, but are not capable of amplifying DNA from small input copy concentrations. The most likely explanation for such failure is the very low processivity of these enzymes.
  • the hybrid error-correcting polymerases of the invention exhibit much higher processivity while retaining error-correcting activity and thereby provide both sensitivity and fidelity in amplification reactions.
  • DNA gyrases and topoisomerases play a role in higher orders of DNA structures such as supercoiling.
  • DNA gyrases introduce negative supercoils.
  • the A subunit is responsible for DNA cutting and reunion and the B subunit contains the ATP-hydrolysis activity.
  • DNA gyrase introduces supercoiling processively and catalytically, typically introducing up to 100 supercoils per minute per molecule of DNA gyrase. In the absence of ATP, gyrase will slowly relax negative supercoils.
  • Topoisomerases are enzymes found in both prokaryotes and eukaryotes that catalyze the interconversion of different topological isomers of DNA, thereby causing a change in the link number. Topoisomerases can remove negative or positive supercoils from DNA or can introduce negative supercoils.
  • methylases and 3' or 5' exonucleases are also described in the art including bacterial, prokaryotic, eukaryotic and phage enzymes.
  • exonucleases such as lambda exonuclease
  • some methylases are also processive.
  • the activity of a catalytic subunit can be measured using assays well known to those of skill in the art.
  • a processive enzymatic activity such as a polymerase activity
  • the amount of product obtained with a modifying enzyme of the invention e.g. a polymerase containing a sequence-non-specific double-stranded DNA binding domain, can then be compared to the amount of product obtained with the normal modifying enzyme, which will be described in more detail below and in the Examples.
  • Modifying enzymes such as ligases or restriction endonucleases bind to double-stranded nucleic acids to perform the modifying function.
  • the catalytic activity is typically measured by determining the amount of modified product produced under particular assay conditions.
  • ligase activity can be assayed by determining the amount of circularized plasmid, which had previously been digested with a restriction endonuclease to generate compatible ends, in a ligation reaction following incubation by quantifying the number of transformants obtained with an aliquot of the ligation reaction.
  • Activity of a restriction endonuclease can be determined by assaying the extent of digestion of the target DNA, for example, by analyzing the extent of digestion of the DNA on a gel.
  • a catalytic modifying domain suitable for use in the invention can be the modifying enzyme itself or the catalytic modifying domain, e.g., Taq polymerase or a domain of Taq with polymerase activity.
  • the catalytic domain may include additional amino acids and/or may be a variant that contains amino acid substitutions, deletions or additions, but still retains enzymatic activity.
  • SEQUENCE-NON-SPECIFIC NUCLEIC-ACID-BINDING DOMAIN SEQUENCE-NON-SPECIFIC NUCLEIC-ACID-BINDING DOMAIN.
  • a double-stranded sequence-non-specific nucleic acid binding domain is a protein or defined region of a protein that binds to double-stranded nucleic acid in a sequence-independent manner, i.e., binding does not exhibit a gross preference for a particular sequence.
  • double-stranded nucleic acid binding proteins exhibit a 10- fold or higher affinity for double-stranded versus single-stranded nucleic acids.
  • the double- stranded nucleic acid binding proteins in particular embodiments of the invention are preferably thermostable.
  • Such proteins include, but are not limited to, the Archaeal small basic DNA binding proteins Sac7d and Sso7d (see, e.g., Choli et al, Biochimica et Biophysica Ada 950:193-203, 1988; Baumann et al, Structural Biol. 1:808- 819, 1994; and Gao et al, Nature Struc. Biol. 5:782-786, 1998), Archael HMf-like proteins (see, e.g., Starich et al., J. Molec.
  • Sso7d and Sac7d are small (about 7,000 kd MW), basic chromosomal proteins from the hyperthermophilic archaeabacteria Sulfolobus solfataricus and S. acidocaldarius, respectively. These proteins are lysine-rich and have high thermal, acid and chemical stability. They bind DNA in a sequence-independent manner and when bound, increase the T M of DNA by up to 40° C under some conditions (McAfee et al, Biochemistry 34:10063- 10077, 1995). These proteins and their homologs are typically believed to be involved in stabilizing genomic DNA at elevated temperatures.
  • HMf-like proteins are archaeal histones that share homology both in amino acid sequences and in structure with eukaryotic H4 histones, which are thought to interact directly with DNA.
  • the HMf family of proteins form stable dimers in solution, and several HMf homologs have been identified from thermostable species (e.g.,
  • HMf family of proteins once joined to Taq DNA polymerase or any DNA modifying enzyme with a low intrinsic processivity, can enhance the ability of the enzyme to slide along the DNA substrate and thus increase its processivity.
  • the dimeric HMf-like protein can be covalently linked to the N terminus of Taq DNA polymerase, e.g., via chemical modification, and thus improve the processivity of the polymerase.
  • PCNA homologs Many but not all family B DNA polymerases interact with accessory proteins to achieve highly processive DNA synthesis.
  • a particularly important class of accessory proteins is referred to as the sliding clamp.
  • Several characterized sliding clamps exist as trimers in solution, and can form a ring-like structure with a central passage capable of accommodating double-stranded DNA.
  • the sliding clamp forms specific interactions with the amino acids located at the C terminus of particular DNA polymerases, and tethers those polymerases to the DNA template during replication.
  • the sliding clamp in eukarya is referred to as the proliferating cell nuclear antigen (PCNA), while similar proteins in other domains are often referred to as PCNA homologs. These homologs have marked structural similarity but limited sequence similarity.
  • PCNA homologs have been identified from thermophilic Archaea
  • Some family B polymerases in Archaea have a C terminus containing a consensus PCNA-interacting amino acid sequence and are capable of using a PCNA homolog as a processivity factor (see, e.g., Cann et al, J. Bacteriol. 181:6591-6599, 1999 and De Felice et al, J. Mol Biol 291:47-57, 1999). These PCNA homologs are useful sequence-non-specific double-stranded DNA binding domains for the invention.
  • a consensus PCNA-interacting sequence can be joined to a polymerase that does not naturally interact with a PCNA homolog, thereby allowing a PCNA homolog to serve as a processivity factor for the polymerase.
  • the PCNA-interacting sequence from Pyrococcus furiosus PolII (a heterodimeric DNA polymerase containing two family B-like polypeptides) can be covalently joined to
  • Pyrococcus furiosus Poll (a monomeric family B polymerase that does not normally interact with a PCNA homolog).
  • the resulting fusion protein can then be allowed to associate non- covalently with the Pyrococcus furiosus PCNA homolog to generate a novel heterologous protein with increased processivity relative to the unmodified Pyrococcus furiosus Poll.
  • nucleic acid binding domains suitable for use in the invention can be identified by homology with known sequence non-specific double-stranded DNA binding proteins and/or by antibody crossreactivity, or may be found by means of a biochemical assay.
  • nucleic acid binding domains based on homology.
  • domains that have about 50% amino acid sequence identity, optionally about 60%, 75, 80, 85, 90, or 95-98% amino acid sequence identity to a known sequence non-specific double-stranded nucleic acid binding protein over a comparison window of about 25 amino acids, optionally about 50-100 amino acids, or the length of the entire protein, can be used in the invention.
  • the sequence can be compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. For purposes of this patent, percent amino acid identity is determined by the default parameters of BLAST.
  • sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
  • test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
  • sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
  • the comparison window includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
  • Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc.
  • PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pair- wise alignments to show relationship and percent sequence identity. It also plots a tree or dendogram showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng & Doolittle, J. Mol. Evol.
  • the method used is similar to the method described by Higgins & Sharp, CABIOS 5:151-153 (1989).
  • the program can align up to 300 sequences, each of a maximum length of 5,000 nucleotides or amino acids.
  • the multiple alignment procedure begins with the pair- wise alignment of the two most similar sequences, producing a cluster of two aligned sequences. This cluster is then aligned to the next most related sequence or cluster of aligned sequences. Two clusters of sequences are aligned by a simple extension of the pair- wise alignment of two individual sequences. The final alignment is achieved by a series of progressive, pair-wise alignments.
  • the program is run by designating specific sequences and their amino acid or nucleotide coordinates for regions of sequence comparison and by designating the program parameters.
  • PILEUP a reference sequence is compared to other test sequences to determine the percent sequence identity relationship using the following parameters: default gap weight (3.00), default gap length weight (0.10), and weighted end gaps.
  • PILEUP can be obtained from the GCG sequence analysis software package, e.g., version 7.0 (Devereaux et al., Nuc. Acids Res. 12:387-395 (1984)).
  • Another example of algorithm that is suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al, Nuc. Acids Res.
  • HSPs high scoring sequence pairs
  • the word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always ⁇ 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative- scoring residue alignments; or the end of either sequence is reached.
  • the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
  • W wordlength
  • E expectation
  • the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat 'I Acad. Sci. USA 90:5873- 5787 (1993)).
  • One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
  • P(N) the smallest sum probability
  • a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
  • Sequence non-specific doubled-stranded nucleic acid binding domains for use in the invention can also be identified by cross-reactivity using antibodies, preferably polyclonal antibodies, that bind to known nucleic acid binding domains.
  • Polyclonal antibodies are generated using methods well known to those of ordinary skill in the art (see, e.g., Coligan, Current Protocols in Immunology (1991); Harlow & Lane, Antibodies, A Laboratory Manual (1988)).
  • Those proteins that are immunologically cross-reactive binding proteins can then be detected by a variety of assay methods. For descriptions of various formats and conditions that can be used, see, e.g., Methods in Cell Biology: Antibodies in Cell Biology, volume 37 (Asai, ed. 1993), Coligan, supra, and Harlow & Lane, supra.
  • Useful immunoassay formats include assays where a sample protein is immobilized to a solid support.
  • a cross-reactive binding protein can be identified using an immunoblot analysis such as a western blot.
  • the western blot technique generally comprises separating sample proteins by gel electrophoresis on the basis of molecular weight, transferring the separated proteins to a suitable solid support, (such as a nitrocellulose filter, a nylon filter, or derivatized nylon filter), and incubating the sample with the antibodies that bind to the sequence non-specific double-stranded nucleic acid binding domain.
  • the antibodies specifically bind to cross-reactive polypeptides on the solid support.
  • the antibodies may be directly labeled or alternatively may be subsequently detected using labeled antibodies (e.g., labeled sheep anti-mouse antibodies) that specifically bind to the anti-binding domain antibodies.
  • labeled antibodies e.g., labeled sheep anti-mouse antibodies
  • Other immunoblot assays such as analysis of recombinant protein libraries, are also useful for identifying proteins suitable for use in the invention. Using this methodology under designated immunoassay conditions, immunologically cross-reactive proteins that bind to a particular antibody at least two times the background or more, typically more than 10 times background, and do not substantially bind in a significant amount to other proteins present in the sample can be identified. Immunoassays in the competitive binding format can also be used for crossreactivity determinations. For example, polyclonal antisera are generated to a known, sequence non-specific double-stranded nucleic acid binding domain protein, e.g., a
  • Pyrococcus furiosus (Pfu) PCNA Pyrococcus furiosus
  • the target antigen can then be immobilized to a solid support.
  • Non-target antigens having minor crossreactivity (if they exist) can be added to the assay to improve the selectivity of the sera.
  • the ability of the added proteins to compete for binding of the antisera to the immobilized protein is compared to the ability of the binding domain protein, in this example Pfu PCNA, to compete with itself.
  • the percent crossreactivity for the above proteins is calculated, using standard calculations. Those antisera with less than 10% crossreactivity with the added protein are selected and pooled. Cross-reacting antibodies to non-target antigens can also be removed from the pooled antisera by immunoabsorption with the non-target antigens. Antibodies that specifically bind to particular nucleic acid binding domains of the invention can also be made using this methodology.
  • the immunoabsorbed and pooled antisera are then used in a competitive binding immunoassay as described above to compare a second protein, thought to be perhaps an allele, polymorphic variant or a homolog of the known binding domain, for example, a PCNA homolog from another Pyrococcus sp., to the immunogen protein.
  • a second protein thought to be perhaps an allele, polymorphic variant or a homolog of the known binding domain, for example, a PCNA homolog from another Pyrococcus sp.
  • the two proteins are each assayed at a wide range of concentrations and the amount of each protein required to inhibit 50% of the binding of the antisera to the immobilized protein is determined.
  • the second protein required to inhibit 50% of binding is less than 10 times the amount of the nucleic acid binding domain protein that is required to inhibit 50% of binding, then the second protein is said to specifically bind to the polyclonal antibodies generated to the nucleic acid binding domain immunogen.
  • sequence non-specific double-stranded nucleic acid binding domains The activity of the sequence non-specific double-stranded nucleic acid binding domains can be assessed using a variety of assays. Suitable binding domains exhibit a marked preference for double-stranded vs. single-stranded nucleic acids.
  • Specificity for binding to double-stranded nucleic acids can be tested using a variety of assays known to those of ordinary skill in the art. These include such assays as filter binding assays or gel-shift assays.
  • assays as filter binding assays or gel-shift assays.
  • filter binding assays the polypeptide to be assessed for binding activity to double-stranded DNA is pre-mixed with radio-labeled DNA, either double-stranded or single-stranded, in the appropriate buffer.
  • the mixture is filtered through a membrane (e.g., nitrocellulose) which retains the protein and the protein-DNA complex.
  • the amount of DNA that is retained on the filter is indicative of the quantity that bound to the protein.
  • Binding can be quantified by a competition analysis in which binding of labeled DNA is competed by the addition of increasing amounts of unlabelled DNA.
  • a polypeptide that binds double-stranded DNA at a 10-fold or greater affinity than single-stranded DNA is defined herein as a double-stranded DNA binding protein.
  • binding activity can be assessed by a gel shift assay in which radiolabeled DNA is incubated with the test polypeptide. The protein-DNA complex will migrate slower through the gel than unbound DNA, resulting in a shifted band. The amount of binding is assessed by incubating samples with increasing amounts of double-stranded or single-stranded unlabeled DNA, and quantifying the amount of radioactivity in the shifted band.
  • a binding domain suitable for use in the invention binds to double-stranded nucleic acids in a sequence-independent fashion, i.e., a binding domain of the invention binds double-stranded nucleic acids with a significant affinity, but, there is no known nucleic acid that binds to the domain with more than 100-fold more affinity than another nucleic acid with the same nucleotide composition, but a different nucleic acid sequence.
  • Non-specific binding can be assayed using methodology similar to that described for determining double-stranded vs. single-stranded nucleic acid binding.
  • Filter binding assays or gel mobility shift assays can be performed as above using competitor DNAs of the same nucleotide composition, but different nucleic acid sequences to determine specificity of binding. Sequence non-specific double-stranded nucleic acid binding domains for use in the invention can also be assessed, for example, by assaying the ability of the double- stranded binding domain to increase processivity or efficiency of a modifying enzyme or to increase the stability of a nucleic acid duplex by at least 1°C can be determined. These techniques are discussed below in the section describing the analysis for enhanced efficiency of a nucleic acid modifying enzyme.
  • a binding domain of the invention can also be identified by direct assessment of the ability of such a domain to stabilize a double-stranded nucleic acid conformation.
  • a melting curve of a primer-template construct can be obtained in the presence or absence of protein by monitoring the UV absorbance of the DNA at 260 nm.
  • the TM of the double-stranded substrate can be determined from the midpoint of the melting curve.
  • the effect of the sequence-non-specific double-stranded nucleic-acid-binding protein on the T can then be determined by comparing the T M obtained in the presence of the modified enzyme with that in the presence of the unmodified enzyme. (The protein does not significantly contribute to the UV absorbance because it has a much lower extinction coefficient at 260 nm than DNA).
  • a domain that increases the T M by 1°, often by 5°, 10° or more, can then be selected for use in the invention.
  • Novel sequence non-specific double-stranded nucleic acid binding proteins of the invention can also be isolated by taking advantage of their DNA binding activity, for instance by purification on DNA-cellulose columns.
  • the isolated proteins can then be further purified by conventional means, sequenced, and the genes cloned by conventional means via PCR. Proteins overexpressed from these clones can then be tested by any of the means described above.
  • the catalytic domain and the double-stranded nucleic-acid-binding domain can be joined by methods well known to those of skill in the art. These methods include chemical and recombinant means. Chemical means of joining the heterologous domains are described, e.g., in
  • the means of linking the catalytic domain and the nucleic acid binding domain comprises a heterobifunctional coupling reagent which ultimately contributes to formation of an intermolecular disulfide bond between the two moieties.
  • a heterobifunctional coupling reagent which ultimately contributes to formation of an intermolecular disulfide bond between the two moieties.
  • Other types of coupling reagents that are useful in this capacity for the present invention are described, for example, in U.S. Patent 4,545,985.
  • an intermolecular disulfide may conveniently be formed between cysteines in each moiety, which occur naturally or are inserted by genetic engineering.
  • the means of linking moieties may also use thioether linkages between heterobifunctional crosslinking reagents or specific low pH cleavable crosslinkers or specific protease cleavable linkers or other cleavable or noncleavable chemical linkages.
  • the means of linking the heterologous domains of the protein may also comprise a peptidyl bond formed between moieties that are separately synthesized by standard peptide synthesis chemistry or recombinant means.
  • the protein itself can also be produced using chemical methods to synthesize an amino acid sequence in whole or in part.
  • peptides can be synthesized by solid phase techniques, such as, e.g., the Merrifield solid phase synthesis method, in which amino acids are sequentially added to a growing chain of amino acids (see, Merrifield (1963) J. Am. Chem. Soc, 85:2149-2146).
  • Equipment for automated synthesis of polypeptides is commercially available from suppliers such as PE Corp. (Foster City, CA), and may generally be operated according to the manufacturer's instructions.
  • the synthesized peptides can then be cleaved from the resin, and purified, e.g. , by preparative high performance liquid chromatography (see Creighton, Proteins Structures and Molecular Principles, 50-60 (1983)).
  • composition of the synthetic polypeptides or of subfragments of the polypeptide may be confirmed by amino acid analysis or sequencing (e.g., the Edman degradation procedure; see Creighton, Proteins, Structures and Molecular Principles, pp. 34-49 (1983)).
  • amino acid analysis or sequencing e.g., the Edman degradation procedure; see Creighton, Proteins, Structures and Molecular Principles, pp. 34-49 (1983)
  • nonclassical amino acids or chemical amino acid analogs can be introduced as a substitution or addition into the sequence.
  • Non-classical amino acids include, but are not limited to, the D-isomers of the common amino acids, ⁇ -amino isobutyric acid, 4- aminobutyric acid, Abu, 2-amino butyric acid, ⁇ -Abu, ⁇ -Ahx, 6-amino hexanoic acid, Aib, 2- amino isobutyric acid, 3 -amino propionic acid, ornithine, norleucine, norvaline, hydroxy- proline, sarcosine, citrulline, cysteic acid, t-butylglycine, t-butylalanine, phenylglycine, cyclohexylalanine, ⁇ -alanine, fiuoro-amino acids, designer amino acids such as ⁇ -methyl amino acids, C ⁇ -methyl amino acids, N ⁇ -methyl amino acids, and amino acid analogs in general.
  • the amino acid can be D (dextrorotary) or L (levorotary).
  • the domains of a protein of the invention e.g., Sso7d and Taq polymerase, are joined via a linking group.
  • the linking group can be a chemical crosslinking agent, including, for example, succimmidyl-(N-maleimidomethyl)-cyclohexane- 1-carboxylate (SMCC).
  • SMCC succimmidyl-(N-maleimidomethyl)-cyclohexane- 1-carboxylate
  • the linking group can also be an additional amino acid sequence(s), including, for example, a polyalanine, polyglycine or similarly, linking group.
  • the coding sequences of each polypeptide in the fusion protein are directly joined at their amino- or carboxy-terminus via a peptide bond in any order.
  • an amino acid linker sequence may be employed to separate the first and second polypeptide components by a distance sufficient to ensure that each polypeptide folds into its secondary and tertiary structures.
  • Such an amino acid linker sequence is incorporated into the fusion protein using standard techniques well known in the art.
  • Suitable peptide linker sequences may be chosen based on the following factors: (1) their ability to adopt a flexible extended conformation; (2) their inability to adopt a secondary structure that could interact with functional epitopes on the first and second polypeptides; and (3) the lack of hydrophobic or charged residues that might react with the polypeptide functional epitopes.
  • Typical peptide linker sequences contain Gly, Val and Tlir residues. Other near neutral amino acids, such as Ser and Ala can also be used in the linker sequence.
  • Amino acid sequences which may be usefully employed as linkers include those disclosed in Maratea et al. (1985) Gene 40:39-46; Murphy et al. (1986) Proc. Natl. Acad. Sci.
  • the linker sequence may generally be from 1 to about 50 amino acids in length, e.g., 3, 4, 6, or 10 amino acids in length, but can be 100 or 200 amino acids in length. Linker sequences may not be required when the first and second polypeptides have non-essential N-terminal amino acid regions that can be used to separate the functional domains and prevent steric interference.
  • Other chemical linkers include carbohydrate linkers, lipid linkers, fatty acid linkers, poly ether linkers, e.g., PEG, etc.
  • poly(ethylene glycol) linkers are available from Shearwater Polymers, Inc. Huntsville, Alabama. These linkers optionally have amide linkages, sulfhydryl linkages, or heterofunctional linkages.
  • domains may also be joined together through an intermediate interacting sequence.
  • a consensus PCNA- interacting sequence can be joined to a polymerase that does not naturally interact with a PCNA homolog.
  • the resulting fusion protein can then be allowed to associate non- covalently with the PCNA homolog to generate a novel heterologous protein with increased processivity.
  • a protein of the invention is produced by recombinant expression of a nucleic acid encoding the protein, which is well known to those of skill in the art.
  • a fusion product can be made by ligating the appropriate nucleic acid sequences encoding the desired amino acid sequences to each other by methods known in the art, in the proper coding frame, and expressing the product by methods known in the art.
  • Nucleic acids encoding the domains to be incorporated into the fusion proteins of the invention can be obtained using routine techniques in the field of recombinant genetics. Basic texts disclosing the general methods of use in this invention include Sambrook et al, Molecular Cloning, A Laboratory Manual (2nd ed. 1989); Kriegler, Gene Transfer and Expression: A Laboratory Manual (1990); and Current Protocols in Molecular Biology (Ausubel et al. , eds., 1994)).
  • nucleic acid sequences encoding catalytic or nucleic acid binding domains or related nucleic acid sequence homologs are cloned from cDNA and genomic DNA libraries by hybridization with probes, or isolated using amplification techniques with oligonucleotide primers. Amplification techniques can be used to amplify and isolate sequences from DNA or RNA (see, e.g., Dieffenfach & Dveksler, PCR Primers: A
  • nucleic acids encoding catalytic or double-stranded nucleic acid binding domains can also be isolated from expression libraries using antibodies as probes.
  • the nucleic acid sequence or subsequence is PCR amplified, using a sense primer containing one restriction site and an antisense primer containing another restriction site. This will produce a nucleic acid encoding the desired domain sequence or subsequence and having terminal restriction sites.
  • This nucleic acid can then be easily ligated into a vector containing a nucleic acid encoding the second domain and having the appropriate corresponding restriction sites.
  • the domains can be directly joined or may be separated by a linker, or other, protein sequence.
  • Suitable PCR primers can be determined by one of skill in the art using the sequence information provided in GenBank or other sources.
  • Appropriate restriction sites can also be added to the nucleic acid encoding the protein or protein subsequence by site-directed mutagenesis.
  • the plasmid containing the domain- encoding nucleotide sequence or subsequence is cleaved with the appropriate restriction endonuclease and then ligated into an appropriate vector for amplification and/or expression according to standard methods.
  • One of skill will recognize many ways of generating alterations in a given nucleic acid construct. Such well-known methods include site-directed mutagenesis, PCR amplification using degenerate oligonucleotides, exposure of cells containing the nucleic acid to mutagenic agents or radiation, chemical synthesis of a desired oligonucleotide (e.g., in conjunction with ligation and/or cloning to generate large nucleic acids) and other well-known techniques. See, e.g., Giliman and Smith (1979) Gene 8:81-97, Roberts et al. (1987) Nature 328: 731- 734.
  • the catalytic and/or nucleic acid binding domains can be modified to facilitate the linkage of the two domains to obtain the polynucleotides that encode the fusion polypeptides of the invention.
  • Catalytic domains and binding domains that are modified by such methods are also part of the invention.
  • a codon for a cysteine residue can be placed at either end of a domain so that the domain can be linked by, for example, a sulfide linkage.
  • the modification can be performed using either recombinant or chemical methods (see, e.g., Pierce Chemical Co. catalog, Rockford IL).
  • linker domains usually polypeptide sequences such as those described above, which can be about 200 amino acids or more in length, with 1 to 100 amino acids being typical.
  • proline residues are incorporated into the linker to prevent the formation of significant secondary structural elements by the linker.
  • Linkers can often be flexible amino acid subsequences that are synthesized as part of a recombinant fusion protein. Such flexible linkers are known to persons of skill in the art.
  • the recombinant nucleic acids the recombinant nucleic acids encoding the proteins of the invention are modified to provide preferred codons which enhance translation of the nucleic acid in a selected organism (e.g., yeast preferred codons are substituted into a coding nucleic acid for expression in yeast).
  • the polynucleotide that encodes the fusion polypeptide is placed under the control of a promoter that is functional in the desired host cell.
  • a promoter that is functional in the desired host cell.
  • An extremely wide variety of promoters are available, and can be used in the expression vectors of the invention, depending on the particular application. Ordinarily, the promoter selected depends upon the cell in which the promoter is to be active.
  • Other expression control sequences such as ribosome binding sites, transcription termination sites and the like are also optionally included. Constructs that include one or more of these control sequences are termed "expression cassettes." Accordingly, the nucleic acids that encode the joined polypeptides are incorporated for high level expression in a desired host cell.
  • prokaryotic control sequences that are suitable for use in a particular host cell are often obtained by cloning a gene that is expressed in that cell.
  • Commonly used prokaryotic control sequences which are defined herein to include promoters for transcription initiation, optionally with an operator, along with ribosome binding site sequences, include such commonly used promoters as the beta-lactamase (penicillinase) and lactose (lac) promoter systems (Change et al, Nature (1977) 198: 1056), the tryptophan (trp) promoter system (Goeddel et al, Nucleic Acids Res. (1980) 8: 4057), the tac promoter (DeBoer, et al, Proc. Natl. Acad.
  • Standard bacterial expression vectors include plasmids such as pBR322-based plasmids, e.g., pBLUESCRIPTTM, pSKF, pET23D, ⁇ -phage derived vectors, and fusion expression systems such as GST and LacZ.
  • Epitope tags can also be added to recombinant proteins to provide convenient methods of isolation, e.g., c-myc, HA- tag, 6-His tag, maltose binding protein, VSV-G tag, anti-DYKDDDDK tag, or any such tag, a large number of which are well known to those of skill in the art.
  • a promoter that functions in the particular prokaryotic species is required.
  • Such promoters can be obtained from genes that have been cloned from the species, or heterologous promoters can be used.
  • the hybrid trp-lac promoter functions in Bacillus in addition to E. coli.
  • suitable bacterial promoters are well known in the art and are described, e.g., in Sambrook et al. and Ausubel et al.
  • Bacterial expression systems for expressing the proteins of the invention are available in, e.g., E.
  • yeast Eukaryotic expression systems for mammalian cells, yeast, and insect cells are well known in the art and are also commercially available.
  • vectors include Yeast Integrating plasmids (e.g., YIp5) and Yeast Replicating plasmids (the YRp series plasmids) and pGPD-2.
  • Expression vectors containing regulatory elements from eukaryotic viruses are typically used in eukaryotic expression vectors, e.g., SV40 vectors, papilloma virus vectors, and vectors derived from Epstein-Barr virus.
  • eukaryotic vectors include pMSG, pAV009/A+, ⁇ MTO10/A+, pMAMneo-5, baculovirus pDSVE, and any other vector allowing expression of proteins under the direction of the CMV promoter, SV40 early promoter, S V40 later promoter, metallothionein promoter, murine mammary tumor virus promoter, Rous sarcoma virus promoter, polyhedrin promoter, or other promoters shown effective for expression in eukaryotic cells.
  • Either constitutive or regulated promoters can be used in the present invention.
  • Regulated promoters can be advantageous because the host cells can be grown to high densities before expression of the fusion polypeptides is induced. High level expression of heterologous proteins slows cell growth in some situations.
  • An inducible promoter is a promoter that directs expression of a gene where the level of expression is alterable by environmental or developmental factors such as, for example, temperature, pH, anaerobic or aerobic conditions, light, transcription factors and chemicals.
  • inducible promoters are known to those of skill in the art. These include, for example, the lac promoter, the bacteriophage lambda P promoter, the hybrid trp-lac promoter (Amann et al. (1983) Gene 25: 167; de Boer et al. (1983) Proc. Nat'l. Acad. Sci. USA 80: 21), and the bacteriophage T7 promoter (Studier et al. (1986) J. Mol. Biol; Tabor et al. (1985) Proc. Nat'l. Acad. Sci. USA 82: 1074- 8). These promoters and their use are discussed in Sambrook et al., supra.
  • Inducible promoters for other organisms are also well known to those of skill in the art. These include, for example, the metallothionein promoter, the heat shock promoter, as well as many others.
  • Translational coupling may be used to enhance expression.
  • the strategy uses a short upstream open reading frame derived from a highly expressed gene native to the translational system, which is placed downstream of the promoter, and a ribosome binding site followed after a few amino acid codons by a termination codon. Just prior to the termination codon is a second ribosome binding site, and following the termination codon is a start codon for the initiation of translation. The system dissolves secondary structure in the RNA, allowing for the efficient initiation of translation. See Squires, et. al (1988), J. Biol Chem. 263: 16297-16302.
  • polynucleotide constructs generally requires the use of vectors able to replicate in bacteria. Such vectors are commonly used in the art.
  • kits are commercially available for the purification of plasmids from bacteria (for example, EasyPrepJ, FlexiPrepJ, from Pharmacia Biotech; StrataCleanJ, from Stratagene; and, QIAexpress Expression System, Qiagen).
  • the isolated and purified plasmids can then be further manipulated to produce other plasmids, and used to transform cells.
  • the fusion polypeptides can be expressed intracellularly, or can be secreted from the cell. Intracellular expression often results in high yields. If necessary, the amount of soluble, active fusion polypeptide may be increased by performing refolding procedures (see, e.g., Sambrook et al., supra.; Marston et al., Bio/Technology (1984) 2: 800; Schoner et al, Bio/Technology (1985) 3: 151). Fusion polypeptides of the invention can be expressed in a variety of host cells, including E. coli, other bacterial hosts, yeast, and various higher eukaryotic cells such as the COS, CHO and HeLa cells lines and myeloma cell lines.
  • the host cells can be mammalian cells, insect cells, or microorganisms, such as, for example, yeast cells, bacterial cells, or fungal cells.
  • the recombinant fusion polypeptides can be purified according to standard procedures of the art, including ammonium sulfate precipitation, affinity columns, column chromatography, gel electrophoresis and the like (see, generally, R. Scopes, Protein Purification, Springer- Verlag, N.Y. (1982), Guider, Methods in Enzymology Vol. 182: Guide to Protein Purification., Academic Press, Inc. N.Y. (1990)). Substantially pure compositions of at least about 90 to 95% homogeneity are preferred, and 98 to 99% or more homogeneity are most preferred.
  • the polypeptides may then be used (e.g., as immunogens for antibody production).
  • the nucleic acids that encode the fusion polypeptides can also include a coding sequence for an epitope or "tag" for which an affinity binding reagent is available.
  • suitable epitopes include the myc and V-5 reporter genes; expression vectors useful for recombinant production of fusion polypeptides having these epitopes are commercially available (e.g., Invitrogen (Carlsbad CA) vectors pcDNA3.1/Myc-His and pcDNA3.1/V5-His are suitable for expression in mammalian cells). Additional expression vectors suitable for attaching a tag to the fusion proteins of the invention, and corresponding detection systems are known to those of skill in the art, and several are commercially available (e.g., FLAG" (Kodak, Rochester NY). Another example of a suitable tag is a polyhistidine sequence, which is capable of binding to metal chelate affinity ligands.
  • Suitable metal chelate affinity ligands that can serve as the binding moiety for a polyhistidine tag include nitrilo-tri-acetic acid (NTA) (Hochuli, E. (1990) "Purification of recombinant proteins with metal chelating adsorbents" In Genetic Engineering: Principles and Methods, J.K. Setlow, Ed., Plenum Press, NY; commercially available from Qiagen (Santa Clarita, CA)).
  • NTA nitrilo-tri-acetic acid
  • modifications could be made to the catalytic and sequence nonspecific double-stranded nucleic acid binding domains without diminishing their biological activity. Some modifications may be made to facilitate the cloning, expression, or incorporation of a domain into a fusion protein. Such modifications are well known to those of skill in the art and include, for example, the addition of codons at either terminus of the polynucleotide that encodes the binding domain to provide, for example, a methionine added at the amino terminus to provide an initiation site, or additional amino acids (e.g., poly His) placed on either terminus to create conveniently located restriction sites or termination codons or purification sequences. -
  • ASSAYS TO DETERMINE IMPROVED ACTIVITY FOR THE CATALYTIC DOMAINS Activity of the catalytic domain can be measured using a variety of assays that can be used to compare processivity or modification activity of a modifying protein domain joined to a binding domain compared to the protein by itself. Improvement in activity includes both increased processivity and increased efficiency.
  • Polymerase processivity can be measured in variety of methods known to those of ordinary skill in the art. Polymerase processivity is generally defined as the number of nucleotides incorporated during a single binding event of a modifying enzyme to a primed template. For example, a 5 ' FAM-labeled primer is annealed to circular or linearized ssM13mpl8 DNA to form a primed template. In measuring processivity, the primed template usually is present in significant molar excess to the enzyme or catalytic domain to be assayed so that the chance of any primed template being extended more than once by the polymerase is minimized.
  • the primed template is therefore mixed with the polymerase catalytic domain to be assayed at a ratio such as approximately 4000: 1 (primed DNA:DNA polymerase) in the presence of buffer and dNTPs.
  • MgCl 2 is added to initiate DNA synthesis.
  • Samples are quenched at various times after initiation, and analyzed on a sequencing gel. At a polymerase concentration where the median product length does not change with time or polymerase concentration, the length corresponds to the processivity of the enzyme.
  • a protein of the invention i.e., a protein that contains a sequence non-specific double-stranded nucleic acid binding domain fused to the catalytic domain of a processive nucleic acid modifying enzyme such as a polymerase, is then compared to the processivity of the enzyme without the binding domain.
  • Enhanced efficiency can also be demonstrated by measuring the increased ability of an enzyme to produce product.
  • Such an analysis measures the stability of the double-stranded nucleic acid duplex indirectly by determining the amount of product obtained in a reaction.
  • a PCR assay can be used to measure the amount of PCR product obtained with a short, e.g., 12 nucleotide in length, primer annealed at an elevated temperature, e.g., 50°C.
  • a polymerase such as a Taq polymerase to produce more product in a PCR reaction using the 12 nucleotide primer annealed at 50°C when it is joined to a sequence-non-specific double- stranded nucleic-acid-binding domain of the invention, e.g., Sso7d
  • a binding tract that is a series of charged residues, e.g. lysines, when joined to a polymerase does not enhance processivity.
  • Similar assay conditions can be employed to test for improved processivity when the catalytic domain is a reverse transcriptase, methylase, gyrase, topoisomerase, or an exonuclease.
  • processivity is measured as the ability of the enzyme to remain attached to the template or substrate and perform multiple modification reactions.
  • the molar ratio of nucleic acid to enzyme is typically sufficiently high so that one the average only one enzyme molecule is bound per substrate nucleic acid.
  • the activity of a processive exonuclease, lambda exonuclease can be assayed using published methods (see, e.g., Mitsis and Kwagh, Nucleic Acid Research, 27:3057-3063, 1999).
  • a long DNA substrates (0.5-20 kb) can be amplified from a DNA template using a 5'- biotinylated primer as the forward primer and a 5' phosphorylated primer as the reverse primer, or vice versa.
  • Radio-labeled dATP is used to internally label the PCR fragment, which serves as the substrate for the lambda exonuclease.
  • the purified internally-labeled substrate is mixed with the enzyme at a sufficient high molar ratio of DNA to enzyme to ensure that on average only one exonuclease molecule bound per substrate DNA. Aliquots of the sample are removed over time and can be assayed either by gel electrophoresis or by monitoring the formation of acid soluble radio-labels.
  • Catalytic domains of non-processive DNA modifying enzymes can also be used in the invention.
  • modifying enzymes include ligases and restriction endonucleases.
  • the catalytic domains are obtained from thermostable Thermus or Pyrococcus species.
  • the enzymatic function can be analyzed under a variety of conditions, often increased reaction temperatures, e.g., temperatures 45 °C or above, and compared to the unmodified enzyme activity.
  • Taq DNA ligase catalyzes the formation of a phosphodiester bond between juxtaposed 5' phosphate and 3' hydroxyl termini of two adjacent oligonucleotides that are hybridized to a complementary target DNA.
  • the enzyme is active at 45°C-65°C.
  • the yield of the ligated product is dependent on how efficiently the complementary strands of DNA are annealed to form the substrate for the enzyme.
  • a binding domain of the invention such as a Sso7d-like protein, when joined to the ligase can stabilize the DNA duplex by increasing its melting temperature, so that an elevated reaction temperature can be used to maximize the activity of the enzyme without compromising the basepairing interactions.
  • the effect of Sso7d fusion on the activity of a ligase can be analyzed by comparing the ligation efficiency of the modified versus that of the unmodified enzyme.
  • the ligation efficiency of two linear DNA fragments can be monitored by agarose gel electrophoresis, whereas the ligation efficiency of converting a linearized plasmid to a circular plasmid can be monitored by DNA transformation.
  • the catalytic domain of a nucleic acid modifying enzyme with improved activity can be from a restriction enzyme isolated from a thermophilic species that requires an elevated reaction temperature to achieve optimal activity.
  • a restriction enzyme with improved activity because of the presence of a binding domain of the invention, e.g., an Sso7d-like protein joined to the restriction endonuclease, can produce a greater amount of product, i.e., digested DNA, than the restriction enzyme by itself.
  • the product yield from a particular reaction can be assessed by visualization on a gel or by assessment of transformation efficiency.
  • nucleic acid modifying enzymes of the invention can be determined by those of ordinary skill in the art using standard assays of the enzymatic activity of a given modification enzyme.
  • processive modifying enzymes such as reverse transcriptases, methylases, gyrases, and topoisomerases, and other non-processive modifying enzymes can be similarly analyzed by comparing activities of the protein, or a catalytic domain, joined to a sequence non-specific double-stranded nucleic acid binding domain and the protein by itself. All publications, patents, and patent applications cited in this specification are herein incorporated by reference as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference.
  • Thermus aquaticus Poll DNA polymerase (a family A polymerase known as Taq DNA polymerase) that is deleted at the N terminus by 289 amino acids ( ⁇ Taq).
  • oligonucleotides were used in constructing a synthetic gene encoding Sso7d.
  • the oligonucleotides were annealed and ligated using T4 DNA ligase.
  • the final ligated product was used as the template in a PCR reaction using two terminal oligonucleotides as primers to amplify the full- length gene.
  • the resulting PCR fragment contains a unique EcoRI site at the 5' terminus, and a unique BstXI site at the 3' terminus.
  • the above PCR fragment also encodes a peptide linker with the amino acid sequence of Gly-Gly-Val-Thr positioned at the C terminus of the Sso7d protein.
  • the synthetic gene of Sso7d has the DNA sequence shown in SEQ ID NO: 1 , and it encodes a polypeptide with the amino acid sequence shown in SEQ ID NO:2.
  • the synthetic gene encoding Sso7d was then used to generate a fusion protein in which Sso7d replaces the first 289 amino acid of Taq.
  • the fragment encoding Sso7d was subcloned into a plasmid encoding Taq polymerase to generate the fusion protein, as follows. Briefly, the DNA fragment containing the synthetic Sso7d gene was digested with restriction endonucleases EcoRI and BstXI, and ligated into the corresponding sites of a plasmid encoding Taq. As the result, the region that encodes the first 289 amino acid of Taq is replaced by the synthetic gene of Sso7d.
  • This plasmid allows the expression of a single polypeptide containing Sso7d fused to the N terminus of ⁇ Taq via a synthetic linker composed of Gly-Gly-Val-Thr.
  • the DNA sequence encoding the fusion protein (Sso7d- ⁇ Taq) and the amino acid sequence of the protein are shown in SEQ ID NOs:3 and 4, respectively. Construction of Sso7d-Taq fusion.
  • An Sso7d/full-length Taq fusion protein was also constructed. Briefly, a 1 kb PCR fragment encoding the first 336 amino acids of Taq polymerase was generated using two primers. The 5' primer introduces a Spel site into the 5' terminus of the PCR fragment, and the 3' primer hybridizes to nucleotides 1008-1026 of the Taq gene. The fragment was digested with Spel and BstXI, releasing a 0.9 kb fragment encoding the first 289 amino acids of Taq polymerase. The 0.9 kb fragment was ligated into plasmid pYWl at the Spel (located in the region encoding the linker) and BstXI sites.
  • the resulting plasmid (pYW2) allows the expression of a single polypeptide containing the Sso7d protein fused to the N terminus of the full length Taq DNA polymerase via a linker composed of Gly-Gly-Val-Thr, the same as in Sso7d- ⁇ Taq.
  • the DNA sequence encoding the Sso7d-Taq fusion protein and the amino acid sequence of the protein are shown in SEQ ID. NO.5 and NO.6, respectively.
  • a third fusion protein was created, joining Sso7d to the C terminus of Pyrococcus furiosus DNA poll (a family B DNA polymerase known as Pfu).
  • Pfu Pyrococcus furiosus DNA poll
  • a pET-based plasmid carrying the Pfu DNA polymerase gene was modified so that a unique Kpnl site and a unique Spel site are introduced at the 3' end of the Pfu gene before the stop codon.
  • the resulting plasmid expresses a Pfu polymerase with three additional amino acids (Gly-Thr-His) at its C terminus.
  • Two primers were used to PCR amplify the synthetic Sso7d gene described above to introduce a Kpn I site and a Nhel site flanking the Sso7d gene.
  • the 5' primer also introduced six additional amino acids (Gly-Thr-Gly-Gly-Gly-Gly), which serve as a linker, at the N terminus of the Sso7d protein.
  • the PCR fragment was ligated into pPFKS at the corresponding sites.
  • the resulting plasmid allows the expression of a single polypeptide containing Sso7d protein fused to the C terminus of the Pfu polymerase via a peptide linker (Gly-Thr-Gly-Gly-Gly-Gly).
  • the DNA sequence encoding the fusion protein (Pfu-Sso7d) and the amino acid sequence of the fusion protein are shown in SEQ ID NOs: 7 and 8, respectively. Construction of Sac7d- ⁇ Taq fusion.
  • a fourth fusion protein was constructed, which joined a sequence-non-specific DNA binding protein from a different species to ⁇ Taq.
  • Two primers were used to PCR amplify the Sac7d gene from genomic DNA of Sulfolobus acidocaldarius. The primers introduced a unique EcoRI site and a unique Spel site to the PCR fragment at the 5' and 3' termini, respectively. Upon restriction digestion with EcoRI and Spel, the PCR fragment was ligated into pYWl (described above) at the corresponding sites. The resulting plasmid expresses a single polypeptide containing the Sac7d protein fused to the N terminus of ⁇ Taq via the same linker as used in Sso7d- ⁇ Taq.
  • the DNA sequence of the fusion protein (Sac7d- ⁇ Taq) and the amino acid sequence of the protein are shown in SEQ ID. NOs: 9 and 10, respectively.
  • a fifth fusion protein joins a peptide composed of 14 ly sines and 2 arginines to the N terminus of ⁇ Taq.
  • PL polylysine
  • two 67 nt oligonucleotides were annealed to form a duplexed DNA fragment with a 5' protruding end compatible with an EcoRI site, and a 3' protruding end compatible with an Spel site.
  • the DNA fragment encodes a lysine-rich peptide of the following composition: NSKKKKKKKRKKRKKKGGGVT.
  • the numbers of lysines and arginines in this peptide are identical to the that in Sso7d.
  • This DNA fragment was ligated into pYWl, predigested with EcoRI and Spel, to replace the region encoding Sso7d.
  • the resulting plasmid expresses a single polypeptide containing the lysine-rich peptide fused to the N terminus of ⁇ Taq.
  • the DNA sequence encoding the fusion protein (PL- ⁇ Taq) and the amino acid sequence of the protein are shown in SEQ ID NOs: 11 and NO. 12, respectively.
  • Example 2 Assessing the processivity of the fusion polymerases. This example illustrates enhancement of processivity of the fusion proteins of the invention generated in Example 1. Polymerase unit definition assay
  • the following assay was used to define a polymerase unit.
  • An oligonucleotide was pre-annealed to ssM13mpl8 DNA in the presence of Mg ⁇ -free reaction buffer and dNTPs.
  • the DNA polymerase of interest was added to the primed DNA mixture.
  • MgCl 2 was added to initiate DNA synthesis at 72°C.
  • Samples were taken at various time points and added to TE buffer containing PicoGreen (Molecular Probes, Eugene Oregon).
  • the amount of DNA synthesized was quantified using a fluorescence plate reader.
  • the unit activity of the DNA polymerase of interest was determined by comparing its initial rate with that of a control DNA polymerase (e.g., a commercial polymerase of known unit concentration).
  • Processivity was measured by determining the number of nucleotides incorporated during a single binding event of the polymerase to a primed template.
  • Primed template 40 nM of a 5' FAM-labeled primer (34 nt long) was annealed to 80 nM of circular or linearized ssM13mpl8 DNA to form the primed template.
  • the primed template was mixed with the DNA polymerase of interest at a molar ratio of approximately 4000: 1 (primed DNA:DNA polymerase) in the presence of standard PCR buffer (free of Mg ++ )and 200 ⁇ M of each dNTPs.
  • MgCl 2 was added to a final concentration of 2 mM to initiate DNA synthesis.
  • samples were quenched with sequencing loading dye containing 99% formamide, and analyzed on a sequencing gel.
  • the median product length which is defined as the product length above or below which there are equal amounts of products, was determined based on integration of all detectable product peaks. At a polymerase concentration for which the median product length change with time or polymerase concentration, the length corresponds to the processivity of the enzyme.
  • the ranges presented in Table 1 represent the range of values obtained in several repeats of the assay.
  • Pfu belongs to family B of polymerases. Unlike Taq polymerase, Pfu possesses a 3' to 5' exonuclease activity, allowing it to maintain high fidelity during DNA synthesis.
  • a modified Pfu polymerase, in which Sso7d is fused to the C terminus of the full length Pfu polymerase, and an unmodified Pfu polymerase were analyzed in the processivity assay described above. As shown in Table I, the Pfu polymerase exhibited a processivity of 2-3 nt, whereas the Pfu-Sso7d fusion protein had a processivity of 35-39 nt.
  • This experiment demonstrates the increased efficiency of the Sso7d- ⁇ Taq fusion protein, compared to Taq, to produce product at higher annealing temperatures by stabilizing dsDNA.
  • a gradient thermal cycler (MJ Research, Waltham MA) was used to vary the annealing temperature from 50°C to 72°C in a PCR cycling program.
  • the amounts of PCR products generated using identical number of units of Sso7d- ⁇ Taq and Taq were quantified and compared. The results are shown in Table II.
  • the Sso7d- ⁇ Taq fusion protein exhibited significantly higher efficiency than full length Taq at higher annealing temperatures. Thus, the presence of Sso7d in cis increases the melting temperature of the primer on the template.
  • the annealing temperature assay above was used to investigate whether PL- ⁇ Taq has any effect on the annealing temperature of primer during PCR amplification. As shown in Table II, little or no amplified product was observed when the annealing temperature was at or above 63 °C.
  • T M of the primers (as shown above) predicts that shorter primers could be used by Sso7d- ⁇ Taq, but not by Taq, to achieve efficient PCR amplification. This analysis shows that Sso7d- ⁇ Taq is more efficient in an assay using shorter primers compared to Taq.
  • PCR using primers 57F12 (12 nt) and 732R16 (16 nt) were used to compare the efficiency of Sac7d- ⁇ Taq to the unmodified full length Taq in PCR reaction. Results are shown in Figure 2. Similar to Sso7d- ⁇ Taq, Sac7d- ⁇ Taq is significantly more efficient than Taq in amplifying using short primers. A primer length assay was used to determine the ability of PL- ⁇ Taq to use short primers in PCR amplification. When long primers (57F and 732R) were used, the amplified product generated by PL- ⁇ Taq is -50% of that by Sso7d- ⁇ Taq. When short primers (57F12 and 732R16) were used, the amplified product generated by PL- ⁇ Taq is ⁇ 20% of that by Sso7d- ⁇ Taq .
  • Table III Comparison of the effect of primer length on PCR amplification by Sso7d- ⁇ Taq and Taq DNA polymerase.
  • fusion proteins of the invention provide increased efficiency in performing various modification reactions.
  • polymerase fusion proteins can provide more efficient amplification in PCR reactions.
  • Many factors influence the outcome of a PCR reaction including primer specificity, efficiency of the polymerase, quality, quantity and GC-content of the template, length of the amplicon, etc.
  • Examples 5-8 demonstrate that fusion proteins that include a double-stranded sequence-non-specific nucleic acid binding domain, e.g., Sso7d, joined to a thermostable polymerase or polymerase domain have several advantageous features over the unmodified enzyme in PCR applications.
  • the binding of polymerase to a primed DNA template is sensitive to the ionic strength of the reaction buffer due to electrostatic interactions, which is stronger in low salt concentration and weaker in high.
  • the presence of Sso7d in a fusion polymerase protein stabilizes the binding interaction of the polymerase to DNA template. This example demonstrates that Sso7d fusion proteins exhibit improved performance in PCR reactions containing elevated KCl concentrations.
  • Lambda DNA (2 pM) was used as a template in a PCR reactions with primers 57F and 732R.
  • concentration of KCl was varied from 10 mM to 150 mM, while all other components of the reaction buffer were unchanged.
  • the PCR reaction was carried out using a cycling program of 94°C for 3 min, 20 cycles of 94°C for 30 sec, 55°C for 30 sec, and 72°C for 30 sec, followed by 72°C for 10 min.
  • 5 ⁇ l of the PCR reaction was removed and mixed with 195 ⁇ l of 1:400 dilution of PicoGreen in TE to quantify the amounts of amplicon generated.
  • PCR reaction products were also analyzed in parallel on an agarose gel to verify that amplicons of expected length were generated (data not shown).
  • the effects of KCl concentration on the PCR efficiency of Sso7d- ⁇ Taq versus that of ⁇ Taq, and Pfu-Sso7d versus Pfu are shown in Table IV.
  • the unmodified enzymes, ⁇ Taq and Pfu showed a preference for KCl concentration below 25 mM and 40 mM, respectively, to maintain 80% of the maximum activity.
  • fusion proteins Sso7d- ⁇ Taq and Pfu-Sso7d maintain 80% of the maximum activity in 30-100 mM and 60-100 mM KCl, respectively.
  • the Sso7d fusion proteins were more tolerant of elevated KCl concentration in comparison to their unmodified counter parts.
  • This feature of the hybrid polymerase will potentially allow PCR amplification from low quality of DNA template, e.g., DNA samples prepared from, but not limited to, blood, food, and plant sources.
  • Pfu-Sso7d has a 4-fold higher specific activity than Pfu.
  • the specific activity is defined as unit/mol of enzyme.
  • the processivity of a polymerase directly effects the efficiency of the polymerization step. For example, a polymerase with low processivity dissociates more frequently and requires more time to rebind to the primed-template, whereas a polymerase with high processivity requires fewer binding events to complete replication of the entire template.
  • Sso7d fusion proteins have significantly higher processivity than their unmodified counterparts. Thus, the fusion proteins should be more efficient during the primer extension step of a PCR reaction.
  • an Sso7d fusion polymerase requires a shorter extension time to amplify a large fragment during PCR compared to unmodified polymerases.
  • Example 6-1 Sso7d fusion polymerases require shorter extension time in PCR
  • Lambda DNA (2.25 pM) was used as a PCR template.
  • Each reaction contained 40 unit/ml of polymerase, where the unit was defined as described in Example 2, and 0.36 mM of each of the four dNTPs.
  • the reaction buffer used for Pfu contained 20 mM Tris-HCl (pH 8.8), 2 mM MgSO 4 , 10 mM KCl, 10 mM (NH 4 ) 2 SO 4 , 0.1% Triton X- 100, and 0.1 mg/ml BSA.
  • the reaction buffer for Pfu-Sso7d, Taq, and Sso7d-Taq was the above buffer with an additional 40 mM of KCl. Two cycling programs with a 1 min or a 5 min extension time were used for PCR amplification.
  • Each cycling program was composed of 94°C for 20 sec, hot start at 80°C by the addition of the polymerase, 20 cycles of 94°C for 10 sec followed by 72°C for 1 or 5 min, and 72°C for 5 min.
  • the results showed that a Pfu-Sso7d fusion protein was able to amplify both the 1 kb and 5 kb fragments using a 1 min extension time, and was also able to amplify the 10 kb fragment using a 5 min extension time.
  • Pfu polymerase amplified only the 1 kb fragment using either a 1 min or a 5 min extension time.
  • the Sso7d-Taq fusion protein amplified the lkb fragment using a 1 min extension time, and both the 1 kb and 5 kb fragments with a 5 min extension time, whereas Taq polymerase amplified only the 1 kb fragment with a 5 min extension time.
  • Example 6-2 Pfu-Sso7d fusion polymerase outperforms existing long PCR enzyme mixture
  • PCR amplification of long DNA fragments requires the use of an enzyme mixture containing both a non-proofreading polymerase (e.g. Taq or DyNAzyme II) and a small amount of proofreading polymerase (e.g. Pfu or Deep Vent).
  • a non-proofreading polymerase e.g. Taq or DyNAzyme II
  • proofreading polymerase e.g. Pfu or Deep Vent
  • Lambda DNA (2.25 pM) was used as a PCR template.
  • the reaction buffer for Pfu-Sso7d was as described in Example 6-1.
  • the reaction buffer for DyNAzyme EXT contained 20 mM Tris (pH 9.0), 2 mM MgCl 2 , 15 mM (NH 4 ) 2 SO 4 , and 0.1 % Triton X- 100 (provided by Finnzymes).
  • the PCR cycling program consists of 95°C for 20 sec, 20 cycles of 94°C for 10 sec and 70°C for 1 or 1.5 min, and 1 cycle of 72°C for 10 min.
  • a 1 min extension time using Pfu-Sso7d generated significant amounts of the 0.9 kb product in the presence of 10, 20, 40 and 80 unit/ml of polymerase.
  • the 4.8 kb and 5.0 kb products were also produced, although at a lower level, in the presence of 40 and 80 unit/ml of polymerase.
  • the 4.8 kb and 5.0 kb products were generated with 10 unit/ml or higher Pfu-Sso7d, and the 10.2 kb fragment was produced in a significant amount with 40 and 80 unit/ml of Pfu-Sso7d.
  • DyNAzyme EXT was used, only the lkb and 4.8 kb products were generated using 1.5 min extension time in the presence of 40 unit/ml of polymerase, and no 10 kb product was detected.
  • the fusion polymerase Pfu-Sso7d is notably more efficient as a single enzyme than an enzyme mixture such as DyNAzyme EXT in long PCR.
  • This example demonstrates that an Sso7d fusion polymerase can amplify a target that is present at a lower copy number compared to the unmodified polymerases.
  • Plasmid DNA was used as a PCR template with T3 and T7 as the primers, which amplify a 500 bp fragment.
  • the amount of plasmid DNA was varied so that the number of copies of DNA template present in the PCR reaction ranged from 10 8 to 1.
  • the cycling program was 94°C for 3 min, 25 or 35 cycles of 96°C for 1 sec, 50°C for 15 sec, and 68°C for 30 sec, followed by 1 cycle at 68°C for 5 min.
  • template copy numbers from 10 4 to 10 s per 25 ⁇ l reaction
  • 25 cycles of amplification were performed; for template copy numbers from 1 to 10 4 (per 25 ⁇ l reaction), 35 cycles of amplification were performed.
  • the Sso7d fusion polymerase was compared to the unmodified polymerase in the requirements for minimum copies of template for efficient amplification. As shown in Table V, Pfu-Sso7d is significantly more sensitive than Pfu in its ability to amplify a low copy number of DNA template, showing that fusion polymerase of the invention can increase the sensitivity of PCR reactions by as much as five orders of magnitude.
  • Sso7d fusion protein can amplify usin a lower number of co ies of DNA tem late
  • Sso7d- ⁇ Taq fusion protein stabilizes primer-template interactions, as reflected by its ability to allow higher annealing temperature and/or shorter primers in PCR amplification.
  • a complex DNA template e.g. human genomic DNA
  • the following two examples demonstrate that the specificity of amplification achieved using Pfu-Sso7d is no less than that Taq, the most commonly used PCR enzyme.
  • Example 8-1 Amplification of a gender-specific marker from human DNA using Pfu-Sso7d Human female or male type DNA (concentration, 1 fM) from placenta or chorionic tissue (from Sigma) was used as the template.
  • Primers H-Amelo-Y (5'- CCACCTCATCCTGG GCACC-3') and H-Amelo-YR (5'-GCTTGAGGCCAACCATCA GAGC-3') were used to amplify a 212 bp amplicon from X chromosome and a 218 bp amplicon from Y chromosome.
  • a single 212 bp fragment should be amplified from female typed DNA, whereas three fragments (212 bp, 218 bp, and the 212 bp/218 bp heterozygote) were expected from male typed DNA.
  • Each reaction contained 20 unit/ml of polymerase and 0.36 mM of each of the four dNTPs.
  • the reaction buffer for Taq included 10 mM Tris (pH 8.8), 50 mM KCl, 1.5 mM MgC12 and 0.1% Triton X-100 (provided by Amersham).
  • the reaction buffer for Pfu-Sso7d contains was performed using DyNAzyme EXT buffer (see Example 6-2) with an additional 40 mM KCl.
  • Example 8-2 Amplification of ⁇ -globin gene from human DNA using Pfu-Sso7d
  • CTCCCAGG-3' and Bglbn536R (5'-GCTCACTCAGTGTGGCAAAG-3'), Bglbn536F and Bglbnl083R, and Bglbn536F and Bglbnl408R (5'-GATTAGCAAAAGGGCCTAGCTTGG- 3') were used to amplify DNA fragments of the size of 0.5, 1.1 and 1.4 kb, respectively.
  • Each reaction contained 20 unit/ml of polymerase and 0.36 mM of each of the four dNTPs.
  • the reaction buffers for Taq and Pfu-Sso7d were as described in Example 8-1.
  • SEQ ID NO-.2 The amino acid sequence of Sso7d.
  • SEQ ID NO:3 The DNA sequence encoding the Sso7d- ⁇ Taq fusion protein ATGATTACGAATTCGAGCGCAACCGTAAAGTTCAAGTACAAAGGCGAAGAAAAA GAGGTAGACATCTCCAAGATCAAGAAAGTATGGCGTGTGGGCAAGATGATCTCC TTCACCTACGACGAGGGCGGTGGCAAGACCGGCCGTGGTGCGGTAAGCGAAAAG GACGCGCCGAAGGAGCTGCTGCAGATGCTGGAGAAGCAGAAAAAGGGCGGCGG TGTCACTAGTCCCAAGGCcCTGGAGGAGGCCCCCTGGCCCCCGCCGGAAGGGGCC TTCGTGGGCTTTGTGCTTTCCCGCAAGGAGCCCATGTGGGCCGATCTTCTGGCCCT GGCCGCCGCCAGGGGGGGCCGGCCACCGGGCCCCCGAGCCTTATAAAGCCCT CAGGGACCTGAAGGAGGCGCGGGGGCTTCTCGCCAAAGACCTGAGCGTTCTGGC CCTGAGGGAAGGCCTTG
  • SEQ ID NO:4 The amino acid sequence of Sso7d- ⁇ Taq fusion protein
  • SEQ ID NO:5 The DNA sequence encoding the Sso7d-Taq fusion protein
  • SEQ H The amino acid sequence of Sso7d-Taq fusion protein.
  • SEQ ID NO:8 The amino acid sequence of the Pfu-Sso7d fusion protein MILDVDYITEEGKPVIRLFKKENGKFKIEHDRTFRPYIYALLRDDSKIEEVKKITGERH GKIVRIVDVEKVEKKFLGKPITVWKLYLEHPQDVPTIREKVREHPAWDIFEYDIPFA KRYLIDKGLIPMEGEEELKILAFDIETLYHEGEEFGKGPIIMISYADENEAKVITWKNID LPYVEWSSEREMIKRFLRIIREKDPDIIVTYNGDSFDFPYLAKRAEKLGIKLTIGRDGS EPKMQPJGDMTAVEVKGRIHFDLYHVITRT ⁇ NLPTYTLEAVYEAIFGKPKEKV ⁇ ADEI AKAWESGENLERVAKYSMEDAKATYELGKEFLPMEIQLSRLVGQPLWDVSRSSTGN LVEWFLLRKAY ⁇ RNEVAPNKPSEEEYQRRLRESYTGGFVKE
  • SEQ D3 NO:10 The amino acid sequence of the Sac7d- ⁇ Taq fusion protein
  • SEQ ID NO.ll The DNA sequence encoding the PL- ⁇ Taq fusion protein
  • GVPREAVDPLMRRAAKT ⁇ NFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSFPKVR AWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAAD LMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPL AVPLEVEVGIGEDWLSAKEGIDGRGGGGHHHHHH

Landscapes

  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Biochemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

This invention provides for an improved generation of novel nucleic acid modifying enzymes. The improvement is the fusion of a sequence-non-specific nucleic-acid-binding domain to the enzyme in a manner that enhances the ability of the enzyme to bind and catalytically modify the nucleic acid.

Description

IMPROVED NUCLEIC ACID MODIFYING ENZYMES
CROSS-REFERENCE TO RELATED APPLICATIONS
This application claims the benefit of priority of U.S. Provisional Application Serial No. 60/207,567 filed May 26, 2000, and claims priority to U.S. Application No. 09/640,958, filed August 16, 2000. Each application is herein incorporated by reference.
FIELD OF THE INVENTION
This invention provides for an improved generation of novel nucleic acid modifying enzymes. The improvement is the joining of a sequence-non-specific nucleic- acid-binding domain to the enzyme in a manner that enhances the ability of the enzyme to bind and catalytically modify the nucleic acid.
BACKGROUND OF THE INVENTION
The efficiency of a nucleic acid modifying enzyme, i. e. , the amount of modified product generated by the enzyme per binding event, can be enhanced by increasing the stability of the modifying enzyme/nucleic acid complex. The prior art has suggested that attachment of a high probability binding site, e.g., a positively charged binding tail, to a nucleic acid modifying enzyme can increase the frequency with which the modifying enzyme interacts with the nucleic acid (see, e.g., U.S. Patent No. 5, 474,911). The prέsent invention now provides novel modifying enzymes in which the double-stranded conformation of the nucleic acid is stabilized and the efficiency of the enzyme increased by joining a sequence- non-specific double-stranded nucleic acid binding domain to the enzyme, or its catalytic domain. The modifying proteins that are processive in nature exhibit increased processivity when joined to a binding domain compared to the enzyme alone. Moreover, both processive and non-processive modifying enzymes exhibit increased efficiency at higher temperatures when joined to a typical binding domain described herein. In one aspect, the invention provides fusion polymerases that provide an enhanced ability to perform long PCR, i.e., amplification of sequences of 5 kb or greater in length. Polymerase mixture to perform long PCR are known in the art. One difficulty with such mixtures is that long extension times are required for optimal yields of the expected products. Conventional recommendations are to allow extension times of 1 minute per kb. For a 10 kb product and using 40 cycles of amplification, the PCR requires approximately seven hours. Described herein are modified polymerase enzymes that exhibit an enhanced ability to perform long PCR compared to those polymerases and/or polymerase mixtures currently available. These modified enzymes, e.g., Pfu-Sso7d, incorporate a polymerase with error-correcting activity and a sequence-nonspecific double-stranded DNA-binding domain, and therefore provide the capability of PCR amplifying DNA larger than 5 kb without need to resort to polymerase mixtures. In addition, such modified enzymes can efficiently amplify a given fragment using shorter extension times than are required by conventional polymerase mixtures. Thus, use of the hybrid polymerases described herein instead of the conventional mixtures can greatly decrease the reaction time required to amplify large fragments, e.g. from about seven hours to about two hours.
SUMMARY OF THE INVENTION
The present invention provides a protein consisting of at least two heterologous domains wherein a first domain that is a sequence-non-specific double-stranded nucleic acid binding domain is joined to a second domain that is a catalytic nucleic acid modifying domain having a processive nature, where the presence of the sequence-nonspecific double-stranded nucleic acid binding domain enhances the processive nature of the nucleic acid modifying domain compared to an identical protein not having a sequence-non- specific nucleic acid binding domain joined thereto. In one aspect of the invention, the nucleic acid modifying domain can have a polymerase activity, which can be thermally stable, e.g., a Thermus polymerase domain. In alternative embodiments, the catalytic domain is an RNA polymerase, a reverse transcriptase, a methylase, a 3' or 5' exonuclease, a gyrase, or a topoisomerase. In a particular embodiment, a sequence-non-specific nucleic acid binding domain of the protein can specifically bind to polyclonal antibodies generated against Sac7d or Sso7d. Alternatively, the sequence-non-specific nucleic acid binding domain can contain a 50 amino acid subsequence that has 50% amino acid similarity to Sso7d. The nucleic acid binding domain can also be Sso7d. In another embodiment, a protein of the invention contains a sequence-nonspecific double-stranded nucleic acid binding domain that specifically binds to polyclonal antibodies generated against a PCNA homolog of Pyrococcus furiosus, or can be a PCNA homolog of Pyrococcus furiosus. The invention also provides a protein consisting of at least two heterologous domains, wherein a first domain that is a sequence-non-specific double-stranded nucleic acid binding domain is joined to a second domain that is a catalytic nucleic-acid-modifying domain, where the presence of the sequence-non-specific nucleic-acid binding domain stabilizes the double-stranded conformation of a nucleic acid by at least 1°C compared to an identical protein not having a sequence-non-specific nucleic acid binding domain joined thereto. The nucleic acid modifying domain of such a protein can have polymerase activity, which can be thermally stable. The nucleic-acid-modifying domain can also have RNA polymerase, reverse transcriptase, methylase, 3' or 5' exonuclease, gyrase, or topoisomerase activity. In further embodiments, the sequence-non-specific nucleic-acid-binding domain can specifically bind to polyclonal antibodies generated against either Sac7d or Sso7d, frequently Sso7d, or contains a 50 amino acid subsequence containing 50% or 15% amino acid similarity to Sso7d. Often, the sequence-non-specific nucleic-acid-binding domain is Sso7d. Proteins of the invention include a protein wherein the sequence-non-specific nucleic-acid-binding domain specifically binds to polyclonal antibodies generated against the PCNA homolog of Pyrococcus furiosus; often the binding domain is the PCNA homolog of Pyrococcus furiosus.
In another aspect, the invention provides methods of modifying nucleic acids using the proteins. One embodiment is a method of modifying a nucleic acid in an aqueous solution by: (i) contacting the nucleic acid with a protein comprising at least two heterologous domains, wherein a first domain that is a sequence-non-specific nucleic-acid- binding domain is joined to a second domain that is a catalytic nucleic-acid-modifying domain having a processive nature, where the sequence-non-specific nucleic-acid-binding domain: a. binds to double-stranded nucleic acid, and b. enhances the processivity of the enzyme compared to an identical enzyme not having the sequence non-specific nucleic-acid- binding domain fused to it, and wherein the solution is at a temperature and of a composition that permits the binding domain to bind to the nucleic acid and the enzyme to function in a catalytic manner; and (ii) permitting the catalytic domain to modify the nucleic acid in the solution.
In another aspect, the invention provides a method of modifying a nucleic acid by: (i) contacting the nucleic acid with an aqueous solution containing a protein having at least two heterologous domains, wherein a first domain that is a sequence-non-specific double-stranded nucleic-acid-binding domain is joined to a second domain that is a catalytic nucleic-acid-modifying domain, where the presence of the sequence-non-specific nucleic- acid-binding domain stabilizes the formation of a double-stranded nucleic acid compared to an otherwise identical protein not having the sequence-non-specific nucleic-acid-binding domain joined to it; and wherein the solution is at a temperature and of a composition that permits the binding domain to bind to the nucleic acid and the enzyme to function in a catalytic manner; and (ii) permitting the catalytic domain to modify the nucleic acid in the solution. The methods of modifying a nucleic acid can employ any of the protein embodiments described herein. In further aspects, the invention provides a method of amplifying a 5kb or longer subsequence of a target nucleic acid in an aqueous solution using a polymerase chain reaction, the method comprising: (i) contacting the target nucleic acid with a protein comprising at least two heterologous domains, wherein a first domain that is a sequence-nonspecific nucleic-acid-binding domain is joined to a second domain that is a polymerase domain with error-correcting activity, where the sequence non-specific nucleic-acid-binding domain: (a) binds to double-stranded nucleic acid, and (b) enhances the processivity of the polymerase compared to an identical polymerase not having the sequence non-specific nucleic-acid-binding domain fused to it, and, wherein the solution is of a composition that permits the binding domain to bind to the target nucleic acid and the polymerase domain to extend a primer that is hybridized to the target nucleic acid sequence to a length of 5 kb or longer; (ii) incubating the solution using a polymerase chain reaction temperature profile that amplifies the 5 kb or longer subsequence. In one embodiment of the method, the nucleic- acid-modifying domain has thermally stable polymerase activity. Often, the nucleic-acid modifying domain comprises a Pyrococcus polymerase domain. In other embodiments of the method, the sequence-non-specific nucleic-acid-binding domain specifically binds to polyclonal antibodies generated against either Sac7d or Sso7d, contains a 50 amino acid subsequence containing 50% amino acid similarity to Sso7D, or specifically binds to polyclonal antibodies generated against Sso7d. In another embodiment, the sequence-nonspecific nucleic-acid-binding domain is Sso7d. Iin another aspect, the invention provides a method of amplifying a subsequence of a target nucleic acid in an aqueous solution using a polymerase chain reaction, the method comprising(i) contacting the target nucleic acid with a protein comprising at least two heterologous domains, wherein a first domain that is a sequence-non- specific nucleic-acid-binding domain is joined to a second domain that is a polymerase domain with error-correcting activity, where the sequence non-specific nucleic-acid-binding domain: (a) binds to double-stranded nucleic acid, and (b) enhances the processivity of the polymerase compared to an identical polymerase not having the sequence non-specific nucleic-acid-binding domain fused to it, and wherein the solution comprises 105 or fewer copies/ml of the target nucleic acid and is of a composition that permits the binding domain to bind to the target nucleic acid and the polymerase domain to extend a primer that is hybridized to the target nucleic acid sequence; (ii) incubating the solution using a polymerase chain reaction temperature profile that amplifies the subsequence. In one embodiment of the method, the nucleic-acid-modifying domain has thermally stable polymerase activity. Often, the nucleic-acid modifying domain comprises a Pyrococcus polymerase domain. In other embodiments of the method, the sequence-non-specific nucleic-acid-binding domain specifically binds to polyclonal antibodies generated against either Sac7d or Sso7d, contains a 50 amino acid subsequence containing 50% amino acid similarity to Sso7D, or specifically binds to polyclonal antibodies generated against Sso7d. In another embodiment, the sequence-non-specific nucleic-acid-binding domain is Sso7d.
DEFINITIONS
"Archaeal small basic DNA-binding protein" refers to protein of between 50- 75 amino acids having either 50%) homology to a natural Archaeal small basic DNA-binding protein such as Sso-7d from Sulfolobus sulfataricus or binds to antibodies generated against a native Archaeal small basic DNA-binding protein.
"Catalytic nucleic-acid-modifying domains having a processive nature" refers to a protein sequence or subsequence that performs as an enzyme having the ability to slide along the length of a nucleic acid molecule and chemically alter its structure repeatedly. A catalytic domain can include an entire enzyme, a subsequence thereof, or can include additional amino acid sequences that are not attached to the enzyme or subsequence as found in nature.
"Domain" refers to a unit of a protein or protein complex, comprising a polypeptide subsequence, a complete polypeptide sequence, or a plurality of polypeptide sequences where that unit has a defined function. The function is understood to be broadly defined and can be ligand binding, catalytic activity or can have a stabilizing effect on the structure of the protein.
"Efficiency" in the context of a nucleic acid modifying enzyme of this invention refers to the ability of the enizyme to perform its catalytic function under specific reaction conditions. Typically, "efficiency" as defined herein is indicated by the amount of modified bases generated by the modifying enzyme per binding to a nucleic acid.
"Enhances" in the context of an enzyme refers to improving the activity of the enzyme, i.e., increasing the amount of product per unit enzyme per unit time. "Fused" refers to linkage by covalent bonding.
"Heterologous", when used with reference to portions of a protein, indicates that the protein comprises two or more domains that are not found in the same relationship to each other in nature. Such a protein, e.g., a fusion protein, contains two or more domains from unrelated proteins arranged to make a new functional protein. "Join" refers to any method known in the art for functionally connecting protein domains, including without limitation recombinant fusion with or without intervening domains, intein-mediated fusion, non-covalent association, and covalent bonding, including disulfide bonding; hydrogen bonding; electrostatic bonding; and conformational bonding, e.g., antibody-antigen, and biotin-avidin associations. "Methylase" refers to an enzyme that can modify a nucleic acid by the addition of a methyl group to a nucleotide.
"Nuclease" refers to an enzyme capable of cleaving the phosphodiester bonds between nucleotide subunits of nucleic acids.
"Nucleic-acid-modifying enzyme" refers to an enzyme that covalently alters a nucleic acid.
"Polymerase" refers to an enzyme that performs template-directed synthesis of polynucleotides.
"Error-correcting activity" of a polymerase or polymerase domain refers to the 3' to 5' exonuclease proofreading activity of a template-specific nucleic acid polymerase whereby nucleotides that do not form Watson-Crick base pairs with the template are removed from the 3' end of an oligonucleotide, i.e., a strand being synthesized from a template, in a sequential manner. Examples of polymerases that have error-correcting activity include polymerases from Pry ococcus furiosus, Thermococcus litoralis, and Thermotoga maritima. "Processivity" refers to the ability of a nucleic acid modifying enzyme to remain attached to the template or substrate and perform multiple modification reactions. Typically "processivity" refers to the ability to modify relatively long tracts of nucleic acid.
"Restriction Endonuclease" refers to any of a group of enzymes, produced by bacteria, that cleave molecules of DNA internally at specific base sequences.
"Sequence-non-specific nucleic-acid-binding domain" refers to a protein domain which binds with significant affinity to a nucleic acid, for which there is no known nucleic acid which binds to the protein domain with more than 100-fold more affinity than another nucleic acid with the same nucleotide composition but a different nucleotide sequence.
"Thermally stable polymerase" as used herein refers to any enzyme that catalyzes polynucleotide synthesis by addition of nucleotide units to a nucleotide chain using DNA or RNA as a template and has an optimal activity at a temperature above 45°C.
"Thermus polymerase" refers to a family A DNA polymerase isolated from any Thermus species, including without limitation Thermus aquaticus, Thermus brockianus, and Thermus thermophilus; any recombinant enzymes deriving from Thermus species, and any functional derivatives thereof, whether derived by genetic modification or chemical modification or other methods known in the art.
"Polymerase chain reaction" or "PCR" refers to a method whereby a specific segment or subsequence of a target double-stranded DNA, is amplified in a geometric progression. PCR is well known to those of skill in the art; see, e.g., U.S. Patents 4,683,195 and 4,683,202; and PCR Protocols: A Guide to Methods and Applications, Innis et al, eds, 1990.
"Long PCR" refers to the amplification of a DNA fragment of 5 kb or longer in length. Long PCR is typically performed using specially-adapted polymerases or polymerase mixtures (see, e.g., U.S. Patent Nos. 5, 436,149 and 5,512,462) that are distinct from the polymerases conventionally used to amplify shorter products.
A "primer" refers to a polynucleotide sequence that hybridizes to a sequence on a target nucleic acid and serves as a point of initiation of nucleic acid synthesis. Primers can be of a variety of lengths and are often less than 50 nucleotides in length, for example 12- 25 nucleotides, in length. The length and sequences of primers for use in PCR can be designed based on principles known to those of skill in the art, see, e.g., Innis et al., supra.
A "temperature profile" refers to the temperature and lengths of time of the denaturation, annealing and/or extension steps of a PCR reaction. A temperature profile for a PCR reaction typically consists of 10 to 60 repetitions of similar or identical shorter temperature profiles; each of these shorter profiles typically define a two step or three-step PCR reaction. Selection of a "temperature profile" is based on various considerations known to those of skill in the art, see, e.g., Innis et al, supra. In a long PCR reaction as described herein, the extension time required to obtain an amplification product of 5 kb or greater in length is reduced compared to conventional polymerase mixtures.
PCR "sensitivity" refers to the ability to amplify a target nucleic acid that is present in low copy number. "Low copy number" refers to 105, often 104, 103, 102, or fewer, copies of the target sequence in the nucleic acid sample to be amplified. A "template" refers to a double stranded polynucleotide sequence that comprises the polynucleotide to be amplified, flanked by primer hybridization sites. Thus, a "target template" comprises the target polynucleotide sequence flanked by hybridization sites for a 5' primer and a 3' primer.
BRIEF DESCRIPTION OF THE FIGURES
Figure la-c shows the results of PCR amplification reactions performed using primers of different lengths to compare the efficiency of Sso7d-modified polymerase with the unmodifed full-length polymerase. Figure 2 shows the results of a PCR amplification reaction using a 12 nt forward primer to evaluate the PCR products generated using Sac7d-ΔTaq compared to Taq.
Figure 3 shows the results of PCR amplification reactions that demonstrate that Pfu-Sso7d is more efficient than DyNAzyme EXT in long PCR.
DETAILED DESCRIPTION
INTRODUCTION
The present invention is the discovery that sequence-non-specific double- stranded nucleic acid binding proteins can be joined to catalytic nucleic acid modifying proteins to enhance the processive nature of the catalytic protein. While the prior art taught that nucleic acid binding proteins can increase the binding affinity of enzymes to nucleic acid, the group of binding proteins having the ability to enhance the processive nature of the enzymes is of particular value. Not to be bound by theory, binding domains of the invention typically dissociate from double-stranded nucleic acid at a very slow rate. Thus, they increase the processivity and/or efficiency of a modifying enzyme to which they are joined by stablizing the enzyme-nucleic acid complex. Accordingly, this invention includes the discovery that DNA-binding domains can stabilize the double-stranded conformation of a nucleic acid and increase the efficiency of a catalytic domain that requires a double-stranded substrate. Described herein are examples and simple assays to readily determine the improvement to the catalytic and or processive nature of catalytic nucleic acid modifying enzymes.
CATALYTIC NUCLEIC-ACID-MODIFYING DOMAINS. A catalytic nucleic-acid-modifying domain is the region of a modification enzyme that performs the enzymatic function. The catalytic nucleic-acid modifying domains of the invention can be processive, e.g., polymerase, exonuclease, etc., or non-processive, e.g., ligases, restriction endonucleases, etc.
Processivity reflects the ability of a nucleic acid modifying enzyme to synthesize or perform multiple modifications, e.g., nucleotide additions or methylations, in a single binding event. The processive proteins of the present invention exhibit enhanced processivity due to the presence of a sequence-non-specific double-stranded DNA binding domain that is joined to the processive modifying enzyme (or the enzymatic domain of the modifying enzyme), thereby providing a tethering domain to stabilize the nucleic acid/enzyme complex. Often the binding domain is from a thermostable organism and provides enhanced activity at higher temperatures, e.g., temperatures above 45°C. Examples of processive modifying enzymes include DNA polymerases, RNA polymerases, reverse transcriptases, methylases, 3' or 5' exonucleases, gyrases, and topoisomerase.
Polymerases
DNA polymerases are well-known to those skilled in the art. These include both DNA-dependent polymerases and RNA-dependent polymerases such as reverse transcriptase. At least five families of DNA-dependent DNA polymerases are known, although most fall into families A, B and C. There is little or no structural or sequence similarity among the various families. Most family A polymerases are single chain proteins that can contain multiple enzymatic functions including polymerase, 3' to 5' exonuclease activity and 5' to 3' exonuclease activity. Family B polymerases typically have a single catalytic domain with polymerase and 3' to 5' exonuclease activity, as well as accessory factors. Family C polymerases are typically multi-subunit proteins with polymerizing and 3 ' to 5' exonuclease activity. In E. coli, three types of DNA polymerases have been found, DNA polymerases I (family A), II (family B), and III (family C). In eukaryotic cells, three different family B polymerases, DNA polymerases α, δ, and ε, are implicated in nuclear replication, and a family A polymerase, polymerase γ, is used for mitochondrial DNA replication. Other types of DNA polymerases include phage polymerases.
Similarly, RNA polymerase typically include eukaryotic RNA polymerases I, II, and III, and bacterial RNA polymerases as well as phage and viral polymerases. RNA polymerases can be DNA-dependent and RNA-dependent.
In one embodiment, polymerase domains that have an error-correcting activity are used as the catalytic domain of the improved polymerases described herein. These polymerases can be used to obtain long, i.e., 5 kb, often 10 kb, or greater in length, PCR products. "Long PCR" using these improved polymerases can be performed using extension times that are reduced compared to prior art "long PCR" polymerase and/or polymerase mixtures. Extension times of less than 30 seconds per kb, often 15 seconds per kb, can be used to amplify long products in PCR reactions using the improved polymerases. Furthermore, these modified polymerases also exhibit increased sensitivity.
Prior-art non-error-correcting polymerases such as Taq polymerase are capable of amplifying DNA from very small input copy concentrations, such as, in the extreme, 10 copies per ml. However, because of the low fidelity of such polymerases, products cloned from such amplifications are likely to contain introduced mutations.
Prior-art error-correcting polymerases such as Pfu copy DNA with higher fidelity than Taq, but are not capable of amplifying DNA from small input copy concentrations. The most likely explanation for such failure is the very low processivity of these enzymes. The hybrid error-correcting polymerases of the invention exhibit much higher processivity while retaining error-correcting activity and thereby provide both sensitivity and fidelity in amplification reactions.
Other modifying enzymes
Typically, DNA gyrases and topoisomerases play a role in higher orders of DNA structures such as supercoiling. DNA gyrases introduce negative supercoils. In prokaryotes, the A subunit is responsible for DNA cutting and reunion and the B subunit contains the ATP-hydrolysis activity. DNA gyrase introduces supercoiling processively and catalytically, typically introducing up to 100 supercoils per minute per molecule of DNA gyrase. In the absence of ATP, gyrase will slowly relax negative supercoils.
Topoisomerases are enzymes found in both prokaryotes and eukaryotes that catalyze the interconversion of different topological isomers of DNA, thereby causing a change in the link number. Topoisomerases can remove negative or positive supercoils from DNA or can introduce negative supercoils.
A variety of methylases and 3' or 5' exonucleases are also described in the art including bacterial, prokaryotic, eukaryotic and phage enzymes. Typically, exonucleases, such as lambda exonuclease, and some methylases are also processive. The activity of a catalytic subunit can be measured using assays well known to those of skill in the art. For example, a processive enzymatic activity, such as a polymerase activity, can be measured by determining the amount of nucleic acid synthesized in a reaction, such as a polymerase chain reaction. In determining the relative efficiency of the enzyme, the amount of product obtained with a modifying enzyme of the invention, e.g. a polymerase containing a sequence-non-specific double-stranded DNA binding domain, can then be compared to the amount of product obtained with the normal modifying enzyme, which will be described in more detail below and in the Examples.
Modifying enzymes such as ligases or restriction endonucleases bind to double-stranded nucleic acids to perform the modifying function. The catalytic activity is typically measured by determining the amount of modified product produced under particular assay conditions. For example, ligase activity can be assayed by determining the amount of circularized plasmid, which had previously been digested with a restriction endonuclease to generate compatible ends, in a ligation reaction following incubation by quantifying the number of transformants obtained with an aliquot of the ligation reaction. Activity of a restriction endonuclease can be determined by assaying the extent of digestion of the target DNA, for example, by analyzing the extent of digestion of the DNA on a gel.
A catalytic modifying domain suitable for use in the invention can be the modifying enzyme itself or the catalytic modifying domain, e.g., Taq polymerase or a domain of Taq with polymerase activity. The catalytic domain may include additional amino acids and/or may be a variant that contains amino acid substitutions, deletions or additions, but still retains enzymatic activity. SEQUENCE-NON-SPECIFIC NUCLEIC-ACID-BINDING DOMAIN.
A double-stranded sequence-non-specific nucleic acid binding domain is a protein or defined region of a protein that binds to double-stranded nucleic acid in a sequence-independent manner, i.e., binding does not exhibit a gross preference for a particular sequence. Typically, double-stranded nucleic acid binding proteins exhibit a 10- fold or higher affinity for double-stranded versus single-stranded nucleic acids. The double- stranded nucleic acid binding proteins in particular embodiments of the invention are preferably thermostable. Examples of such proteins include, but are not limited to, the Archaeal small basic DNA binding proteins Sac7d and Sso7d (see, e.g., Choli et al, Biochimica et Biophysica Ada 950:193-203, 1988; Baumann et al, Structural Biol. 1:808- 819, 1994; and Gao et al, Nature Struc. Biol. 5:782-786, 1998), Archael HMf-like proteins (see, e.g., Starich et al., J. Molec. Biol 255:187-203, 1996; Sandman et al, Gene 150:207- 208, 1994), and PCNA homologs (see, e.g., Cann et al, J. Bacteriology 181:6591-6599, 1999; Shamoo and Steitz, Ce//:99, 155-166, 1999; De Felice et al, J. Molec. Biol. 291, 47- 57, 1999; and Zhang et al, Biochemistry 34:10703-10712, 1995).
Sso7d and Sac7d
Sso7d and Sac7d are small (about 7,000 kd MW), basic chromosomal proteins from the hyperthermophilic archaeabacteria Sulfolobus solfataricus and S. acidocaldarius, respectively. These proteins are lysine-rich and have high thermal, acid and chemical stability. They bind DNA in a sequence-independent manner and when bound, increase the TM of DNA by up to 40° C under some conditions (McAfee et al, Biochemistry 34:10063- 10077, 1995). These proteins and their homologs are typically believed to be involved in stabilizing genomic DNA at elevated temperatures.
HMF-like proteins
The HMf-like proteins are archaeal histones that share homology both in amino acid sequences and in structure with eukaryotic H4 histones, which are thought to interact directly with DNA. The HMf family of proteins form stable dimers in solution, and several HMf homologs have been identified from thermostable species (e.g.,
Methanothermus fervidus and Pyrococcus strain GB-3a). The HMf family of proteins, once joined to Taq DNA polymerase or any DNA modifying enzyme with a low intrinsic processivity, can enhance the ability of the enzyme to slide along the DNA substrate and thus increase its processivity. For example, the dimeric HMf-like protein can be covalently linked to the N terminus of Taq DNA polymerase, e.g., via chemical modification, and thus improve the processivity of the polymerase.
PCNA homologs Many but not all family B DNA polymerases interact with accessory proteins to achieve highly processive DNA synthesis. A particularly important class of accessory proteins is referred to as the sliding clamp. Several characterized sliding clamps exist as trimers in solution, and can form a ring-like structure with a central passage capable of accommodating double-stranded DNA. The sliding clamp forms specific interactions with the amino acids located at the C terminus of particular DNA polymerases, and tethers those polymerases to the DNA template during replication. The sliding clamp in eukarya is referred to as the proliferating cell nuclear antigen (PCNA), while similar proteins in other domains are often referred to as PCNA homologs. These homologs have marked structural similarity but limited sequence similarity. Recently, PCNA homologs have been identified from thermophilic Archaea
(e.g., Sulfolobus sofataricus, Pyroccocus furiosus, etc.). Some family B polymerases in Archaea have a C terminus containing a consensus PCNA-interacting amino acid sequence and are capable of using a PCNA homolog as a processivity factor (see, e.g., Cann et al, J. Bacteriol. 181:6591-6599, 1999 and De Felice et al, J. Mol Biol 291:47-57, 1999). These PCNA homologs are useful sequence-non-specific double-stranded DNA binding domains for the invention. For example, a consensus PCNA-interacting sequence can be joined to a polymerase that does not naturally interact with a PCNA homolog, thereby allowing a PCNA homolog to serve as a processivity factor for the polymerase. By way of illustration, the PCNA-interacting sequence from Pyrococcus furiosus PolII (a heterodimeric DNA polymerase containing two family B-like polypeptides) can be covalently joined to
Pyrococcus furiosus Poll (a monomeric family B polymerase that does not normally interact with a PCNA homolog). The resulting fusion protein can then be allowed to associate non- covalently with the Pyrococcus furiosus PCNA homolog to generate a novel heterologous protein with increased processivity relative to the unmodified Pyrococcus furiosus Poll.
Other sequence-nonspecific double-stranded nucleic acid binding domains
Additional nucleic acid binding domains suitable for use in the invention can be identified by homology with known sequence non-specific double-stranded DNA binding proteins and/or by antibody crossreactivity, or may be found by means of a biochemical assay.
Identification of nucleic acid binding domains based on homology. Typically, domains that have about 50% amino acid sequence identity, optionally about 60%, 75, 80, 85, 90, or 95-98% amino acid sequence identity to a known sequence non-specific double-stranded nucleic acid binding protein over a comparison window of about 25 amino acids, optionally about 50-100 amino acids, or the length of the entire protein, can be used in the invention. The sequence can be compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. For purposes of this patent, percent amino acid identity is determined by the default parameters of BLAST.
For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
The comparison window includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. NatT. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by manual alignment and visual inspection (see, e.g., Current Protocols in Molecular Biology (Ausubel et al., eds. 1995 supplement)). One example of a useful algorithm is PILEUP. PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pair- wise alignments to show relationship and percent sequence identity. It also plots a tree or dendogram showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng & Doolittle, J. Mol. Evol.
35:351-360 (1987). The method used is similar to the method described by Higgins & Sharp, CABIOS 5:151-153 (1989). The program can align up to 300 sequences, each of a maximum length of 5,000 nucleotides or amino acids. The multiple alignment procedure begins with the pair- wise alignment of the two most similar sequences, producing a cluster of two aligned sequences. This cluster is then aligned to the next most related sequence or cluster of aligned sequences. Two clusters of sequences are aligned by a simple extension of the pair- wise alignment of two individual sequences. The final alignment is achieved by a series of progressive, pair-wise alignments. The program is run by designating specific sequences and their amino acid or nucleotide coordinates for regions of sequence comparison and by designating the program parameters. Using PILEUP, a reference sequence is compared to other test sequences to determine the percent sequence identity relationship using the following parameters: default gap weight (3.00), default gap length weight (0.10), and weighted end gaps. PILEUP can be obtained from the GCG sequence analysis software package, e.g., version 7.0 (Devereaux et al., Nuc. Acids Res. 12:387-395 (1984)). Another example of algorithm that is suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al, Nuc. Acids Res. 25:3389-3402 (1977) and Altschul et al, J. Mol. Biol. 215:403-410 (1990), respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/). This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al, supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always < 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative- scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) or 10, M=5, N=-4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)) alignments (B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of both strands.
The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat 'I Acad. Sci. USA 90:5873- 5787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
Cross-reactive binding to antibodies
Sequence non-specific doubled-stranded nucleic acid binding domains for use in the invention can also be identified by cross-reactivity using antibodies, preferably polyclonal antibodies, that bind to known nucleic acid binding domains. Polyclonal antibodies are generated using methods well known to those of ordinary skill in the art (see, e.g., Coligan, Current Protocols in Immunology (1991); Harlow & Lane, Antibodies, A Laboratory Manual (1988)). Those proteins that are immunologically cross-reactive binding proteins can then be detected by a variety of assay methods. For descriptions of various formats and conditions that can be used, see, e.g., Methods in Cell Biology: Antibodies in Cell Biology, volume 37 (Asai, ed. 1993), Coligan, supra, and Harlow & Lane, supra.
Useful immunoassay formats include assays where a sample protein is immobilized to a solid support. For example, a cross-reactive binding protein can be identified using an immunoblot analysis such as a western blot. The western blot technique generally comprises separating sample proteins by gel electrophoresis on the basis of molecular weight, transferring the separated proteins to a suitable solid support, (such as a nitrocellulose filter, a nylon filter, or derivatized nylon filter), and incubating the sample with the antibodies that bind to the sequence non-specific double-stranded nucleic acid binding domain. The antibodies specifically bind to cross-reactive polypeptides on the solid support. The antibodies may be directly labeled or alternatively may be subsequently detected using labeled antibodies (e.g., labeled sheep anti-mouse antibodies) that specifically bind to the anti-binding domain antibodies. Other immunoblot assays, such as analysis of recombinant protein libraries, are also useful for identifying proteins suitable for use in the invention. Using this methodology under designated immunoassay conditions, immunologically cross-reactive proteins that bind to a particular antibody at least two times the background or more, typically more than 10 times background, and do not substantially bind in a significant amount to other proteins present in the sample can be identified. Immunoassays in the competitive binding format can also be used for crossreactivity determinations. For example, polyclonal antisera are generated to a known, sequence non-specific double-stranded nucleic acid binding domain protein, e.g., a
Pyrococcus furiosus (Pfu) PCNA. The target antigen can then be immobilized to a solid support. Non-target antigens having minor crossreactivity (if they exist) can be added to the assay to improve the selectivity of the sera. The ability of the added proteins to compete for binding of the antisera to the immobilized protein is compared to the ability of the binding domain protein, in this example Pfu PCNA, to compete with itself. The percent crossreactivity for the above proteins is calculated, using standard calculations. Those antisera with less than 10% crossreactivity with the added protein are selected and pooled. Cross-reacting antibodies to non-target antigens can also be removed from the pooled antisera by immunoabsorption with the non-target antigens. Antibodies that specifically bind to particular nucleic acid binding domains of the invention can also be made using this methodology.
The immunoabsorbed and pooled antisera are then used in a competitive binding immunoassay as described above to compare a second protein, thought to be perhaps an allele, polymorphic variant or a homolog of the known binding domain, for example, a PCNA homolog from another Pyrococcus sp., to the immunogen protein. In order to make this comparison, the two proteins are each assayed at a wide range of concentrations and the amount of each protein required to inhibit 50% of the binding of the antisera to the immobilized protein is determined. If the amount of the second protein required to inhibit 50% of binding is less than 10 times the amount of the nucleic acid binding domain protein that is required to inhibit 50% of binding, then the second protein is said to specifically bind to the polyclonal antibodies generated to the nucleic acid binding domain immunogen.
Assays for sequence non-specific double-stranded nucleic acid binding activity The activity of the sequence non-specific double-stranded nucleic acid binding domains can be assessed using a variety of assays. Suitable binding domains exhibit a marked preference for double-stranded vs. single-stranded nucleic acids.
Specificity for binding to double-stranded nucleic acids can be tested using a variety of assays known to those of ordinary skill in the art. These include such assays as filter binding assays or gel-shift assays. For example, in a filter-binding assay the polypeptide to be assessed for binding activity to double-stranded DNA is pre-mixed with radio-labeled DNA, either double-stranded or single-stranded, in the appropriate buffer. The mixture is filtered through a membrane (e.g., nitrocellulose) which retains the protein and the protein-DNA complex. The amount of DNA that is retained on the filter is indicative of the quantity that bound to the protein. Binding can be quantified by a competition analysis in which binding of labeled DNA is competed by the addition of increasing amounts of unlabelled DNA. A polypeptide that binds double-stranded DNA at a 10-fold or greater affinity than single-stranded DNA is defined herein as a double-stranded DNA binding protein. Alternatively, binding activity can be assessed by a gel shift assay in which radiolabeled DNA is incubated with the test polypeptide. The protein-DNA complex will migrate slower through the gel than unbound DNA, resulting in a shifted band. The amount of binding is assessed by incubating samples with increasing amounts of double-stranded or single-stranded unlabeled DNA, and quantifying the amount of radioactivity in the shifted band. A binding domain suitable for use in the invention binds to double-stranded nucleic acids in a sequence-independent fashion, i.e., a binding domain of the invention binds double-stranded nucleic acids with a significant affinity, but, there is no known nucleic acid that binds to the domain with more than 100-fold more affinity than another nucleic acid with the same nucleotide composition, but a different nucleic acid sequence. Non-specific binding can be assayed using methodology similar to that described for determining double-stranded vs. single-stranded nucleic acid binding. Filter binding assays or gel mobility shift assays can be performed as above using competitor DNAs of the same nucleotide composition, but different nucleic acid sequences to determine specificity of binding. Sequence non-specific double-stranded nucleic acid binding domains for use in the invention can also be assessed, for example, by assaying the ability of the double- stranded binding domain to increase processivity or efficiency of a modifying enzyme or to increase the stability of a nucleic acid duplex by at least 1°C can be determined. These techniques are discussed below in the section describing the analysis for enhanced efficiency of a nucleic acid modifying enzyme.
A binding domain of the invention can also be identified by direct assessment of the ability of such a domain to stabilize a double-stranded nucleic acid conformation. For example, a melting curve of a primer-template construct can be obtained in the presence or absence of protein by monitoring the UV absorbance of the DNA at 260 nm. The TM of the double-stranded substrate can be determined from the midpoint of the melting curve. The effect of the sequence-non-specific double-stranded nucleic-acid-binding protein on the T can then be determined by comparing the TM obtained in the presence of the modified enzyme with that in the presence of the unmodified enzyme. (The protein does not significantly contribute to the UV absorbance because it has a much lower extinction coefficient at 260 nm than DNA). A domain that increases the TM by 1°, often by 5°, 10° or more, can then be selected for use in the invention.
Novel sequence non-specific double-stranded nucleic acid binding proteins of the invention can also be isolated by taking advantage of their DNA binding activity, for instance by purification on DNA-cellulose columns. The isolated proteins can then be further purified by conventional means, sequenced, and the genes cloned by conventional means via PCR. Proteins overexpressed from these clones can then be tested by any of the means described above.
JOINING THE CATALYTIC DOMAIN WITH THE NUCLEIC- ACID-BINDING
DOMAIN.
The catalytic domain and the double-stranded nucleic-acid-binding domain can be joined by methods well known to those of skill in the art. These methods include chemical and recombinant means. Chemical means of joining the heterologous domains are described, e.g., in
Bioconjugate Techniques, Hermanson, Ed., Academic Press (1996). These include, for example, derivitization for the purpose of linking the moieties to each other, either directly or through a linking compound, by methods that are well known in the art of protein chemistry.
For example, in one chemical conjugation embodiment, the means of linking the catalytic domain and the nucleic acid binding domain comprises a heterobifunctional coupling reagent which ultimately contributes to formation of an intermolecular disulfide bond between the two moieties. Other types of coupling reagents that are useful in this capacity for the present invention are described, for example, in U.S. Patent 4,545,985. Alternatively, an intermolecular disulfide may conveniently be formed between cysteines in each moiety, which occur naturally or are inserted by genetic engineering. The means of linking moieties may also use thioether linkages between heterobifunctional crosslinking reagents or specific low pH cleavable crosslinkers or specific protease cleavable linkers or other cleavable or noncleavable chemical linkages. The means of linking the heterologous domains of the protein may also comprise a peptidyl bond formed between moieties that are separately synthesized by standard peptide synthesis chemistry or recombinant means. The protein itself can also be produced using chemical methods to synthesize an amino acid sequence in whole or in part. For example, peptides can be synthesized by solid phase techniques, such as, e.g., the Merrifield solid phase synthesis method, in which amino acids are sequentially added to a growing chain of amino acids (see, Merrifield (1963) J. Am. Chem. Soc, 85:2149-2146). Equipment for automated synthesis of polypeptides is commercially available from suppliers such as PE Corp. (Foster City, CA), and may generally be operated according to the manufacturer's instructions. The synthesized peptides can then be cleaved from the resin, and purified, e.g. , by preparative high performance liquid chromatography (see Creighton, Proteins Structures and Molecular Principles, 50-60 (1983)). The composition of the synthetic polypeptides or of subfragments of the polypeptide, may be confirmed by amino acid analysis or sequencing (e.g., the Edman degradation procedure; see Creighton, Proteins, Structures and Molecular Principles, pp. 34-49 (1983)). In addition, nonclassical amino acids or chemical amino acid analogs can be introduced as a substitution or addition into the sequence. Non-classical amino acids include, but are not limited to, the D-isomers of the common amino acids, α-amino isobutyric acid, 4- aminobutyric acid, Abu, 2-amino butyric acid, γ-Abu, ε-Ahx, 6-amino hexanoic acid, Aib, 2- amino isobutyric acid, 3 -amino propionic acid, ornithine, norleucine, norvaline, hydroxy- proline, sarcosine, citrulline, cysteic acid, t-butylglycine, t-butylalanine, phenylglycine, cyclohexylalanine, β-alanine, fiuoro-amino acids, designer amino acids such as β-methyl amino acids, Cα-methyl amino acids, Nα-methyl amino acids, and amino acid analogs in general. Furthermore, the amino acid can be D (dextrorotary) or L (levorotary). In another embodiment, the domains of a protein of the invention, e.g., Sso7d and Taq polymerase, are joined via a linking group. The linking group can be a chemical crosslinking agent, including, for example, succimmidyl-(N-maleimidomethyl)-cyclohexane- 1-carboxylate (SMCC). The linking group can also be an additional amino acid sequence(s), including, for example, a polyalanine, polyglycine or similarly, linking group.
In a specific embodiment, the coding sequences of each polypeptide in the fusion protein are directly joined at their amino- or carboxy-terminus via a peptide bond in any order. Alternatively, an amino acid linker sequence may be employed to separate the first and second polypeptide components by a distance sufficient to ensure that each polypeptide folds into its secondary and tertiary structures. Such an amino acid linker sequence is incorporated into the fusion protein using standard techniques well known in the art. Suitable peptide linker sequences may be chosen based on the following factors: (1) their ability to adopt a flexible extended conformation; (2) their inability to adopt a secondary structure that could interact with functional epitopes on the first and second polypeptides; and (3) the lack of hydrophobic or charged residues that might react with the polypeptide functional epitopes. Typical peptide linker sequences contain Gly, Val and Tlir residues. Other near neutral amino acids, such as Ser and Ala can also be used in the linker sequence. Amino acid sequences which may be usefully employed as linkers include those disclosed in Maratea et al. (1985) Gene 40:39-46; Murphy et al. (1986) Proc. Natl. Acad. Sci. USA 83:8258-8262; U.S. Patent Nos. 4,935,233 and 4,751,180. The linker sequence may generally be from 1 to about 50 amino acids in length, e.g., 3, 4, 6, or 10 amino acids in length, but can be 100 or 200 amino acids in length. Linker sequences may not be required when the first and second polypeptides have non-essential N-terminal amino acid regions that can be used to separate the functional domains and prevent steric interference. Other chemical linkers include carbohydrate linkers, lipid linkers, fatty acid linkers, poly ether linkers, e.g., PEG, etc. For example, poly(ethylene glycol) linkers are available from Shearwater Polymers, Inc. Huntsville, Alabama. These linkers optionally have amide linkages, sulfhydryl linkages, or heterofunctional linkages.
Other methods of joining the domains include ionic binding by expressing negative and positive tails and indirect binding through antibodies and streptavidin-biotin interactions. (See, e.g., Bioconjugate Techniques, supra). The domains may also be joined together through an intermediate interacting sequence. For example, a consensus PCNA- interacting sequence can be joined to a polymerase that does not naturally interact with a PCNA homolog. The resulting fusion protein can then be allowed to associate non- covalently with the PCNA homolog to generate a novel heterologous protein with increased processivity.
Production of fusion proteins using recombinant techniques In one embodiment, a protein of the invention is produced by recombinant expression of a nucleic acid encoding the protein, which is well known to those of skill in the art. Such a fusion product can be made by ligating the appropriate nucleic acid sequences encoding the desired amino acid sequences to each other by methods known in the art, in the proper coding frame, and expressing the product by methods known in the art. Nucleic acids encoding the domains to be incorporated into the fusion proteins of the invention can be obtained using routine techniques in the field of recombinant genetics. Basic texts disclosing the general methods of use in this invention include Sambrook et al, Molecular Cloning, A Laboratory Manual (2nd ed. 1989); Kriegler, Gene Transfer and Expression: A Laboratory Manual (1990); and Current Protocols in Molecular Biology (Ausubel et al. , eds., 1994)).
Often, the nucleic acid sequences encoding catalytic or nucleic acid binding domains or related nucleic acid sequence homologs are cloned from cDNA and genomic DNA libraries by hybridization with probes, or isolated using amplification techniques with oligonucleotide primers. Amplification techniques can be used to amplify and isolate sequences from DNA or RNA (see, e.g., Dieffenfach & Dveksler, PCR Primers: A
Laboratory Manual (1995)). Alternatively, overlapping oligonucleotides can be produced synthetically and joined to produce one or more of the domains. Nucleic acids encoding catalytic or double-stranded nucleic acid binding domains can also be isolated from expression libraries using antibodies as probes. In an example of obtaining a nucleic acid encoding a catalytic or nucleic acid binding domain using PCR, the nucleic acid sequence or subsequence is PCR amplified, using a sense primer containing one restriction site and an antisense primer containing another restriction site. This will produce a nucleic acid encoding the desired domain sequence or subsequence and having terminal restriction sites. This nucleic acid can then be easily ligated into a vector containing a nucleic acid encoding the second domain and having the appropriate corresponding restriction sites. The domains can be directly joined or may be separated by a linker, or other, protein sequence. Suitable PCR primers can be determined by one of skill in the art using the sequence information provided in GenBank or other sources. Appropriate restriction sites can also be added to the nucleic acid encoding the protein or protein subsequence by site-directed mutagenesis. The plasmid containing the domain- encoding nucleotide sequence or subsequence is cleaved with the appropriate restriction endonuclease and then ligated into an appropriate vector for amplification and/or expression according to standard methods.
Examples of techniques sufficient to direct persons of skill through in vitro amplification methods are found in Berger, Sambrook, and Ausubel, as well as Mullis et al, (1987) U.S. Patent No. 4,683,202; PCR Protocols A Guide to Methods and Applications (Innis et al, eds) Academic Press Inc. San Diego, CA (1990) (Innis); Arnheim & Levinson (October 1, 1990) C&EN 36-47; The Journal Of NIH Research (1991) 3: 81-94; (Kwoh et al. (1989) Proc. Natl. Acad. Sci. USA 86: 1173; Guatelli et al. (1990) Proc. Natl. Acad. Sci. USA 87, 1874; Lomell et al. (1989) J. Clin. Chem., 35: 1826; Landegren et al, (1988) Science 241: 1077-1080; Van Brunt (1990) Biotechnology 8: 291-294; Wu and Wallace (1989) Gene 4: 560; and Barringer et al (1990) Gene 89: 117. Other physical properties of a polypeptide expressed from a particular nucleic acid can be compared to properties of known sequence nonspecific double-stranded nucleic acid binding proteins or nucleic acid modifying enzyme catalytic domains to provide another method of identifying suitable nucleic acids.
In some embodiments, it may be desirable to modify the polypeptides encoding the catalytic and/or nucleic acid binding regions of the recombinant fusion protein. One of skill will recognize many ways of generating alterations in a given nucleic acid construct. Such well-known methods include site-directed mutagenesis, PCR amplification using degenerate oligonucleotides, exposure of cells containing the nucleic acid to mutagenic agents or radiation, chemical synthesis of a desired oligonucleotide (e.g., in conjunction with ligation and/or cloning to generate large nucleic acids) and other well-known techniques. See, e.g., Giliman and Smith (1979) Gene 8:81-97, Roberts et al. (1987) Nature 328: 731- 734.
For example, the catalytic and/or nucleic acid binding domains can be modified to facilitate the linkage of the two domains to obtain the polynucleotides that encode the fusion polypeptides of the invention. Catalytic domains and binding domains that are modified by such methods are also part of the invention. For example, a codon for a cysteine residue can be placed at either end of a domain so that the domain can be linked by, for example, a sulfide linkage. The modification can be performed using either recombinant or chemical methods (see, e.g., Pierce Chemical Co. catalog, Rockford IL).
The catalytic and binding domains of the recombinant fusion protein are often joined by linker domains, usually polypeptide sequences such as those described above, which can be about 200 amino acids or more in length, with 1 to 100 amino acids being typical. In some embodiments, proline residues are incorporated into the linker to prevent the formation of significant secondary structural elements by the linker. Linkers can often be flexible amino acid subsequences that are synthesized as part of a recombinant fusion protein. Such flexible linkers are known to persons of skill in the art. In some embodiments, the recombinant nucleic acids the recombinant nucleic acids encoding the proteins of the invention are modified to provide preferred codons which enhance translation of the nucleic acid in a selected organism (e.g., yeast preferred codons are substituted into a coding nucleic acid for expression in yeast).
Expression cassettes and host cells for expressing the fusion polypeptides
There are many expression systems for producing the fusion polypeptide that are well know to those of ordinary skill in the art. (See, e.g., Gene Expression Systems. Fernandex and Hoeffler, Eds. Academic Press, 1999.) Typically, the polynucleotide that encodes the fusion polypeptide is placed under the control of a promoter that is functional in the desired host cell. An extremely wide variety of promoters are available, and can be used in the expression vectors of the invention, depending on the particular application. Ordinarily, the promoter selected depends upon the cell in which the promoter is to be active. Other expression control sequences such as ribosome binding sites, transcription termination sites and the like are also optionally included. Constructs that include one or more of these control sequences are termed "expression cassettes." Accordingly, the nucleic acids that encode the joined polypeptides are incorporated for high level expression in a desired host cell.
Expression control sequences that are suitable for use in a particular host cell are often obtained by cloning a gene that is expressed in that cell. Commonly used prokaryotic control sequences, which are defined herein to include promoters for transcription initiation, optionally with an operator, along with ribosome binding site sequences, include such commonly used promoters as the beta-lactamase (penicillinase) and lactose (lac) promoter systems (Change et al, Nature (1977) 198: 1056), the tryptophan (trp) promoter system (Goeddel et al, Nucleic Acids Res. (1980) 8: 4057), the tac promoter (DeBoer, et al, Proc. Natl. Acad. Sci. U.S.A. (1983) 80:21-25); and the lambda-derived PL promoter andN-gene ribosome binding site (Shimatake et al, Nature (1981) 292: 128). The particular promoter system is not critical to the invention, any available promoter that functions in prokaryotes can be used. Standard bacterial expression vectors include plasmids such as pBR322-based plasmids, e.g., pBLUESCRIPT™, pSKF, pET23D, λ-phage derived vectors, and fusion expression systems such as GST and LacZ. Epitope tags can also be added to recombinant proteins to provide convenient methods of isolation, e.g., c-myc, HA- tag, 6-His tag, maltose binding protein, VSV-G tag, anti-DYKDDDDK tag, or any such tag, a large number of which are well known to those of skill in the art.
For expression of fusion polypeptides in prokaryotic cells other than E. coli, a promoter that functions in the particular prokaryotic species is required. Such promoters can be obtained from genes that have been cloned from the species, or heterologous promoters can be used. For example, the hybrid trp-lac promoter functions in Bacillus in addition to E. coli. These and other suitable bacterial promoters are well known in the art and are described, e.g., in Sambrook et al. and Ausubel et al. Bacterial expression systems for expressing the proteins of the invention are available in, e.g., E. coli, Bacillus sp., and Salmonella (Palva et al, Gene 22:229-235 (1983); Mosbach et al, Nature 302:543-545 (1983). Kits for such expression systems are commercially available. Eukaryotic expression systems for mammalian cells, yeast, and insect cells are well known in the art and are also commercially available. In yeast, vectors include Yeast Integrating plasmids (e.g., YIp5) and Yeast Replicating plasmids (the YRp series plasmids) and pGPD-2. Expression vectors containing regulatory elements from eukaryotic viruses are typically used in eukaryotic expression vectors, e.g., SV40 vectors, papilloma virus vectors, and vectors derived from Epstein-Barr virus. Other exemplary eukaryotic vectors include pMSG, pAV009/A+, ρMTO10/A+, pMAMneo-5, baculovirus pDSVE, and any other vector allowing expression of proteins under the direction of the CMV promoter, SV40 early promoter, S V40 later promoter, metallothionein promoter, murine mammary tumor virus promoter, Rous sarcoma virus promoter, polyhedrin promoter, or other promoters shown effective for expression in eukaryotic cells.
Either constitutive or regulated promoters can be used in the present invention. Regulated promoters can be advantageous because the host cells can be grown to high densities before expression of the fusion polypeptides is induced. High level expression of heterologous proteins slows cell growth in some situations. An inducible promoter is a promoter that directs expression of a gene where the level of expression is alterable by environmental or developmental factors such as, for example, temperature, pH, anaerobic or aerobic conditions, light, transcription factors and chemicals.
For E. coli and other bacterial host cells, inducible promoters are known to those of skill in the art. These include, for example, the lac promoter, the bacteriophage lambda P promoter, the hybrid trp-lac promoter (Amann et al. (1983) Gene 25: 167; de Boer et al. (1983) Proc. Nat'l. Acad. Sci. USA 80: 21), and the bacteriophage T7 promoter (Studier et al. (1986) J. Mol. Biol; Tabor et al. (1985) Proc. Nat'l. Acad. Sci. USA 82: 1074- 8). These promoters and their use are discussed in Sambrook et al., supra.
Inducible promoters for other organisms are also well known to those of skill in the art. These include, for example, the metallothionein promoter, the heat shock promoter, as well as many others. Translational coupling may be used to enhance expression. The strategy uses a short upstream open reading frame derived from a highly expressed gene native to the translational system, which is placed downstream of the promoter, and a ribosome binding site followed after a few amino acid codons by a termination codon. Just prior to the termination codon is a second ribosome binding site, and following the termination codon is a start codon for the initiation of translation. The system dissolves secondary structure in the RNA, allowing for the efficient initiation of translation. See Squires, et. al (1988), J. Biol Chem. 263: 16297-16302.
The construction of polynucleotide constructs generally requires the use of vectors able to replicate in bacteria. Such vectors are commonly used in the art. A plethora of kits are commercially available for the purification of plasmids from bacteria (for example, EasyPrepJ, FlexiPrepJ, from Pharmacia Biotech; StrataCleanJ, from Stratagene; and, QIAexpress Expression System, Qiagen). The isolated and purified plasmids can then be further manipulated to produce other plasmids, and used to transform cells.
The fusion polypeptides can be expressed intracellularly, or can be secreted from the cell. Intracellular expression often results in high yields. If necessary, the amount of soluble, active fusion polypeptide may be increased by performing refolding procedures (see, e.g., Sambrook et al., supra.; Marston et al., Bio/Technology (1984) 2: 800; Schoner et al, Bio/Technology (1985) 3: 151). Fusion polypeptides of the invention can be expressed in a variety of host cells, including E. coli, other bacterial hosts, yeast, and various higher eukaryotic cells such as the COS, CHO and HeLa cells lines and myeloma cell lines. The host cells can be mammalian cells, insect cells, or microorganisms, such as, for example, yeast cells, bacterial cells, or fungal cells.
Once expressed, the recombinant fusion polypeptides can be purified according to standard procedures of the art, including ammonium sulfate precipitation, affinity columns, column chromatography, gel electrophoresis and the like (see, generally, R. Scopes, Protein Purification, Springer- Verlag, N.Y. (1982), Deutscher, Methods in Enzymology Vol. 182: Guide to Protein Purification., Academic Press, Inc. N.Y. (1990)). Substantially pure compositions of at least about 90 to 95% homogeneity are preferred, and 98 to 99% or more homogeneity are most preferred. Once purified, partially or to homogeneity as desired, the polypeptides may then be used (e.g., as immunogens for antibody production). To facilitate purification of the fusion polypeptides of the invention, the nucleic acids that encode the fusion polypeptides can also include a coding sequence for an epitope or "tag" for which an affinity binding reagent is available. Examples of suitable epitopes include the myc and V-5 reporter genes; expression vectors useful for recombinant production of fusion polypeptides having these epitopes are commercially available (e.g., Invitrogen (Carlsbad CA) vectors pcDNA3.1/Myc-His and pcDNA3.1/V5-His are suitable for expression in mammalian cells). Additional expression vectors suitable for attaching a tag to the fusion proteins of the invention, and corresponding detection systems are known to those of skill in the art, and several are commercially available (e.g., FLAG" (Kodak, Rochester NY). Another example of a suitable tag is a polyhistidine sequence, which is capable of binding to metal chelate affinity ligands. Typically, six adjacent histidines are used, although one can use more or less than six. Suitable metal chelate affinity ligands that can serve as the binding moiety for a polyhistidine tag include nitrilo-tri-acetic acid (NTA) (Hochuli, E. (1990) "Purification of recombinant proteins with metal chelating adsorbents" In Genetic Engineering: Principles and Methods, J.K. Setlow, Ed., Plenum Press, NY; commercially available from Qiagen (Santa Clarita, CA)).
One of skill would recognize that modifications could be made to the catalytic and sequence nonspecific double-stranded nucleic acid binding domains without diminishing their biological activity. Some modifications may be made to facilitate the cloning, expression, or incorporation of a domain into a fusion protein. Such modifications are well known to those of skill in the art and include, for example, the addition of codons at either terminus of the polynucleotide that encodes the binding domain to provide, for example, a methionine added at the amino terminus to provide an initiation site, or additional amino acids (e.g., poly His) placed on either terminus to create conveniently located restriction sites or termination codons or purification sequences. -
ASSAYS TO DETERMINE IMPROVED ACTIVITY FOR THE CATALYTIC DOMAINS. Activity of the catalytic domain can be measured using a variety of assays that can be used to compare processivity or modification activity of a modifying protein domain joined to a binding domain compared to the protein by itself. Improvement in activity includes both increased processivity and increased efficiency.
Improved activity of processive modifying enzymes
Polymerase processivity can be measured in variety of methods known to those of ordinary skill in the art. Polymerase processivity is generally defined as the number of nucleotides incorporated during a single binding event of a modifying enzyme to a primed template. For example, a 5 ' FAM-labeled primer is annealed to circular or linearized ssM13mpl8 DNA to form a primed template. In measuring processivity, the primed template usually is present in significant molar excess to the enzyme or catalytic domain to be assayed so that the chance of any primed template being extended more than once by the polymerase is minimized. The primed template is therefore mixed with the polymerase catalytic domain to be assayed at a ratio such as approximately 4000: 1 (primed DNA:DNA polymerase) in the presence of buffer and dNTPs. MgCl2 is added to initiate DNA synthesis. Samples are quenched at various times after initiation, and analyzed on a sequencing gel. At a polymerase concentration where the median product length does not change with time or polymerase concentration, the length corresponds to the processivity of the enzyme. The processivity of a protein of the invention, i.e., a protein that contains a sequence non-specific double-stranded nucleic acid binding domain fused to the catalytic domain of a processive nucleic acid modifying enzyme such as a polymerase, is then compared to the processivity of the enzyme without the binding domain. Enhanced efficiency can also be demonstrated by measuring the increased ability of an enzyme to produce product. Such an analysis measures the stability of the double-stranded nucleic acid duplex indirectly by determining the amount of product obtained in a reaction. For example, a PCR assay can be used to measure the amount of PCR product obtained with a short, e.g., 12 nucleotide in length, primer annealed at an elevated temperature, e.g., 50°C. In this analysis, enhanced efficiency is shown by the ability of a polymerase such as a Taq polymerase to produce more product in a PCR reaction using the 12 nucleotide primer annealed at 50°C when it is joined to a sequence-non-specific double- stranded nucleic-acid-binding domain of the invention, e.g., Sso7d, than Taq polymerase does alone. In contrast, a binding tract that is a series of charged residues, e.g. lysines, when joined to a polymerase does not enhance processivity.
Similar assay conditions can be employed to test for improved processivity when the catalytic domain is a reverse transcriptase, methylase, gyrase, topoisomerase, or an exonuclease. In these analyses, processivity is measured as the ability of the enzyme to remain attached to the template or substrate and perform multiple modification reactions. The molar ratio of nucleic acid to enzyme is typically sufficiently high so that one the average only one enzyme molecule is bound per substrate nucleic acid. For example, the activity of a processive exonuclease, lambda exonuclease, can be assayed using published methods (see, e.g., Mitsis and Kwagh, Nucleic Acid Research, 27:3057-3063, 1999). In brief, a long DNA substrates (0.5-20 kb) can be amplified from a DNA template using a 5'- biotinylated primer as the forward primer and a 5' phosphorylated primer as the reverse primer, or vice versa. Radio-labeled dATP is used to internally label the PCR fragment, which serves as the substrate for the lambda exonuclease. The purified internally-labeled substrate is mixed with the enzyme at a sufficient high molar ratio of DNA to enzyme to ensure that on average only one exonuclease molecule bound per substrate DNA. Aliquots of the sample are removed over time and can be assayed either by gel electrophoresis or by monitoring the formation of acid soluble radio-labels.
Enhanced activity of non-processive modifying enzymes Catalytic domains of non-processive DNA modifying enzymes, or the enzymes themselves, can also be used in the invention. Examples of such modifying enzymes include ligases and restriction endonucleases. Often, the catalytic domains are obtained from thermostable Thermus or Pyrococcus species. To determine improved activity, the enzymatic function can be analyzed under a variety of conditions, often increased reaction temperatures, e.g., temperatures 45 °C or above, and compared to the unmodified enzyme activity.
For example, Taq DNA ligase catalyzes the formation of a phosphodiester bond between juxtaposed 5' phosphate and 3' hydroxyl termini of two adjacent oligonucleotides that are hybridized to a complementary target DNA. The enzyme is active at 45°C-65°C. The yield of the ligated product is dependent on how efficiently the complementary strands of DNA are annealed to form the substrate for the enzyme. A binding domain of the invention, such as a Sso7d-like protein, when joined to the ligase can stabilize the DNA duplex by increasing its melting temperature, so that an elevated reaction temperature can be used to maximize the activity of the enzyme without compromising the basepairing interactions.
The effect of Sso7d fusion on the activity of a ligase can be analyzed by comparing the ligation efficiency of the modified versus that of the unmodified enzyme. The ligation efficiency of two linear DNA fragments can be monitored by agarose gel electrophoresis, whereas the ligation efficiency of converting a linearized plasmid to a circular plasmid can be monitored by DNA transformation.
In another example, the catalytic domain of a nucleic acid modifying enzyme with improved activity can be from a restriction enzyme isolated from a thermophilic species that requires an elevated reaction temperature to achieve optimal activity. For example when the restriction enzyme recognition sites are located very close to the end of a DNA fragment or in duplexed oligonucleotides, higher temperatures may destabilize the duplex structure. At a higher reaction temperature, e.g., 45°C or above, a restriction enzyme with improved activity because of the presence of a binding domain of the invention, e.g., an Sso7d-like protein joined to the restriction endonuclease, can produce a greater amount of product, i.e., digested DNA, than the restriction enzyme by itself. The product yield from a particular reaction can be assessed by visualization on a gel or by assessment of transformation efficiency.
Other methods of assessing enhanced efficiency of the improved nucleic acid modifying enzymes of the invention can be determined by those of ordinary skill in the art using standard assays of the enzymatic activity of a given modification enzyme. Thus, processive modifying enzymes such as reverse transcriptases, methylases, gyrases, and topoisomerases, and other non-processive modifying enzymes can be similarly analyzed by comparing activities of the protein, or a catalytic domain, joined to a sequence non-specific double-stranded nucleic acid binding domain and the protein by itself. All publications, patents, and patent applications cited in this specification are herein incorporated by reference as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference.
Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be readily apparent to those of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims.
EXAMPLES
The following examples are provided by way of illustration only and not by way of limitation. Those of skill will readily recognize a variety of non-critical parameters that could be changed or modified to yield essentially similar results.
Example 1. Construction of fusion proteins.
Construction ofSso 7 d-ΔTaq fusion.
The following example illustrates the construction of a polymerase protein possessing enhanced processivity, in which the sequence-non-specific double-stranded nucleic acid binding protein Sso7d is fused to the Thermus aquaticus Poll DNA polymerase (a family A polymerase known as Taq DNA polymerase) that is deleted at the N terminus by 289 amino acids (ΔTaq).
Based on the published amino acid sequence of Sso7d, seven oligonucleotides were used in constructing a synthetic gene encoding Sso7d. The oligonucleotides were annealed and ligated using T4 DNA ligase. The final ligated product was used as the template in a PCR reaction using two terminal oligonucleotides as primers to amplify the full- length gene. By design, the resulting PCR fragment contains a unique EcoRI site at the 5' terminus, and a unique BstXI site at the 3' terminus. In addition to encoding the Sso7d protein, the above PCR fragment also encodes a peptide linker with the amino acid sequence of Gly-Gly-Val-Thr positioned at the C terminus of the Sso7d protein. The synthetic gene of Sso7d has the DNA sequence shown in SEQ ID NO: 1 , and it encodes a polypeptide with the amino acid sequence shown in SEQ ID NO:2.
The synthetic gene encoding Sso7d was then used to generate a fusion protein in which Sso7d replaces the first 289 amino acid of Taq. The fragment encoding Sso7d was subcloned into a plasmid encoding Taq polymerase to generate the fusion protein, as follows. Briefly, the DNA fragment containing the synthetic Sso7d gene was digested with restriction endonucleases EcoRI and BstXI, and ligated into the corresponding sites of a plasmid encoding Taq. As the result, the region that encodes the first 289 amino acid of Taq is replaced by the synthetic gene of Sso7d. This plasmid (pYWl) allows the expression of a single polypeptide containing Sso7d fused to the N terminus of ΔTaq via a synthetic linker composed of Gly-Gly-Val-Thr. The DNA sequence encoding the fusion protein (Sso7d- ΔTaq) and the amino acid sequence of the protein are shown in SEQ ID NOs:3 and 4, respectively. Construction of Sso7d-Taq fusion.
An Sso7d/full-length Taq fusion protein was also constructed. Briefly, a 1 kb PCR fragment encoding the first 336 amino acids of Taq polymerase was generated using two primers. The 5' primer introduces a Spel site into the 5' terminus of the PCR fragment, and the 3' primer hybridizes to nucleotides 1008-1026 of the Taq gene. The fragment was digested with Spel and BstXI, releasing a 0.9 kb fragment encoding the first 289 amino acids of Taq polymerase. The 0.9 kb fragment was ligated into plasmid pYWl at the Spel (located in the region encoding the linker) and BstXI sites. The resulting plasmid (pYW2) allows the expression of a single polypeptide containing the Sso7d protein fused to the N terminus of the full length Taq DNA polymerase via a linker composed of Gly-Gly-Val-Thr, the same as in Sso7d-ΔTaq. The DNA sequence encoding the Sso7d-Taq fusion protein and the amino acid sequence of the protein are shown in SEQ ID. NO.5 and NO.6, respectively.
Construction ofPfu-Sso 7d fusion.
A third fusion protein was created, joining Sso7d to the C terminus of Pyrococcus furiosus DNA poll (a family B DNA polymerase known as Pfu). A pET-based plasmid carrying the Pfu DNA polymerase gene was modified so that a unique Kpnl site and a unique Spel site are introduced at the 3' end of the Pfu gene before the stop codon. The resulting plasmid (pPFKS) expresses a Pfu polymerase with three additional amino acids (Gly-Thr-His) at its C terminus.
Two primers were used to PCR amplify the synthetic Sso7d gene described above to introduce a Kpn I site and a Nhel site flanking the Sso7d gene. The 5' primer also introduced six additional amino acids (Gly-Thr-Gly-Gly-Gly-Gly), which serve as a linker, at the N terminus of the Sso7d protein. Upon digestion with Kpnl and Nhel, the PCR fragment was ligated into pPFKS at the corresponding sites. The resulting plasmid (pPFS) allows the expression of a single polypeptide containing Sso7d protein fused to the C terminus of the Pfu polymerase via a peptide linker (Gly-Thr-Gly-Gly-Gly-Gly). The DNA sequence encoding the fusion protein (Pfu-Sso7d) and the amino acid sequence of the fusion protein are shown in SEQ ID NOs: 7 and 8, respectively. Construction of Sac7d-ΔTaq fusion.
A fourth fusion protein was constructed, which joined a sequence-non-specific DNA binding protein from a different species to ΔTaq. Two primers were used to PCR amplify the Sac7d gene from genomic DNA of Sulfolobus acidocaldarius. The primers introduced a unique EcoRI site and a unique Spel site to the PCR fragment at the 5' and 3' termini, respectively. Upon restriction digestion with EcoRI and Spel, the PCR fragment was ligated into pYWl (described above) at the corresponding sites. The resulting plasmid expresses a single polypeptide containing the Sac7d protein fused to the N terminus of ΔTaq via the same linker as used in Sso7d-ΔTaq. The DNA sequence of the fusion protein (Sac7d- ΔTaq) and the amino acid sequence of the protein are shown in SEQ ID. NOs: 9 and 10, respectively.
Construction of PL- ΔTaq fusion.
A fifth fusion protein joins a peptide composed of 14 ly sines and 2 arginines to the N terminus of ΔTaq. To generate the polylysine (PL)-ΔTaq fusion protein, two 67 nt oligonucleotides were annealed to form a duplexed DNA fragment with a 5' protruding end compatible with an EcoRI site, and a 3' protruding end compatible with an Spel site. The DNA fragment encodes a lysine-rich peptide of the following composition: NSKKKKKKKRKKRKKKGGGVT. The numbers of lysines and arginines in this peptide are identical to the that in Sso7d. This DNA fragment was ligated into pYWl, predigested with EcoRI and Spel, to replace the region encoding Sso7d. The resulting plasmid (pLST) expresses a single polypeptide containing the lysine-rich peptide fused to the N terminus of ΔTaq. The DNA sequence encoding the fusion protein (PL-ΔTaq) and the amino acid sequence of the protein are shown in SEQ ID NOs: 11 and NO. 12, respectively.
Example 2. Assessing the processivity of the fusion polymerases. This example illustrates enhancement of processivity of the fusion proteins of the invention generated in Example 1. Polymerase unit definition assay
The following assay was used to define a polymerase unit. An oligonucleotide was pre-annealed to ssM13mpl8 DNA in the presence of Mg^-free reaction buffer and dNTPs. The DNA polymerase of interest was added to the primed DNA mixture. MgCl2 was added to initiate DNA synthesis at 72°C. Samples were taken at various time points and added to TE buffer containing PicoGreen (Molecular Probes, Eugene Oregon). The amount of DNA synthesized was quantified using a fluorescence plate reader. The unit activity of the DNA polymerase of interest was determined by comparing its initial rate with that of a control DNA polymerase (e.g., a commercial polymerase of known unit concentration). Processivity assay
Processivity was measured by determining the number of nucleotides incorporated during a single binding event of the polymerase to a primed template.
Briefly, 40 nM of a 5' FAM-labeled primer (34 nt long) was annealed to 80 nM of circular or linearized ssM13mpl8 DNA to form the primed template. The primed template was mixed with the DNA polymerase of interest at a molar ratio of approximately 4000: 1 (primed DNA:DNA polymerase) in the presence of standard PCR buffer (free of Mg++)and 200 μM of each dNTPs. MgCl2 was added to a final concentration of 2 mM to initiate DNA synthesis. At various times after initiation, samples were quenched with sequencing loading dye containing 99% formamide, and analyzed on a sequencing gel. The median product length, which is defined as the product length above or below which there are equal amounts of products, was determined based on integration of all detectable product peaks. At a polymerase concentration for which the median product length change with time or polymerase concentration, the length corresponds to the processivity of the enzyme. The ranges presented in Table 1 represent the range of values obtained in several repeats of the assay.
Table I. Comparison of processivity
In comparing the processivity of modified enzyme to the unmodified enzyme, ΔTaq had a processivity of 2-6 nucleotides, whereas Sso7d-ΔTaq fusion exhibited a processivity of 39-58 nucleotides (Table I). Full length Taq had a processivity of 15-20 nucleotides, which was significantly lower than that of Sso7d-Taq fusion with a processivity of 130-160 nucleotides. These results demonstrate that Sso7d joined to Taq polymerase enhanced the processivity of the polymerase.
Pfu belongs to family B of polymerases. Unlike Taq polymerase, Pfu possesses a 3' to 5' exonuclease activity, allowing it to maintain high fidelity during DNA synthesis. A modified Pfu polymerase, in which Sso7d is fused to the C terminus of the full length Pfu polymerase, and an unmodified Pfu polymerase were analyzed in the processivity assay described above. As shown in Table I, the Pfu polymerase exhibited a processivity of 2-3 nt, whereas the Pfu-Sso7d fusion protein had a processivity of 35-39 nt. Thus, the fusion of Sso7d to the C terminus of Pfu resulted in a > 10-fold enhancement of the processivity over the unmodified enzyme. The ability of a lysine-rich peptide to enhance the processivity of Taq polymerase was also assessed. The processivity of PL-ΔTaq was measured using the method described above, and compared to that of the unmodified protein, ΔTaq. As shown in Table I, the presence of the polylysine tract did not enhance the processivity of ΔTaq. Thus, although the addition of a lysine-rich peptide to a nucleic acid binding protein may increase the association rate of an enzyme to its substrate as disclosed in the prior art, processivity is not increased.
Example 3. Effect of fusion proteins on oligonucleotide annealing temperature
This experiment demonstrates the increased efficiency of the Sso7d-ΔTaq fusion protein, compared to Taq, to produce product at higher annealing temperatures by stabilizing dsDNA.
Two primers, primer 1008 (19mer; TM =56.4°C) and 2180R (20mer; TM =56.9°C), were used to amplify a 1 kb fragment (1008-2180) of the Taq pol gene. A gradient thermal cycler (MJ Research, Waltham MA) was used to vary the annealing temperature from 50°C to 72°C in a PCR cycling program. The amounts of PCR products generated using identical number of units of Sso7d-ΔTaq and Taq were quantified and compared. The results are shown in Table II. The Sso7d-ΔTaq fusion protein exhibited significantly higher efficiency than full length Taq at higher annealing temperatures. Thus, the presence of Sso7d in cis increases the melting temperature of the primer on the template.
The annealing temperature assay above was used to investigate whether PL- ΔTaq has any effect on the annealing temperature of primer during PCR amplification. As shown in Table II, little or no amplified product was observed when the annealing temperature was at or above 63 °C.
Table II. Comparison of activities at different annealing temperatures.
nd: not detectable
Example 4. Effect of fusion proteins on required primer length
An enhancement of TM of the primers (as shown above) predicts that shorter primers could be used by Sso7d-ΔTaq, but not by Taq, to achieve efficient PCR amplification. This analysis shows that Sso7d-ΔTaq is more efficient in an assay using shorter primers compared to Taq.
Primers of different lengths were used to compare the efficiencies of PCR amplification by Sso7d-ΔTaq and by Taq. The results are shown in Table III and in Figure lA-lC. When two long primers, 57F (22mer, TM =58°C) and 732R (24mer, TM =57°C) were used, no significant difference was observed between Sso7d-ΔTaq and Taq at either low or high annealing temperatures. When medium length primers, 57F15 (15mer, TM =35°C) and 732R16 (16mer, Tm=35°C), were used, Sso7d-ΔTaq was more efficient than Taq, especially when the annealing temperature was high. The most striking difference between the two enzymes was observed with short primers, 57F12 (12mer) and 732R16 (16mer), where Sso7d-ΔTaq generated 10 times more products than Taq at both low and high annealing temperatures.
PCR using primers 57F12 (12 nt) and 732R16 (16 nt) were used to compare the efficiency of Sac7d-ΔTaq to the unmodified full length Taq in PCR reaction. Results are shown in Figure 2. Similar to Sso7d-ΔTaq, Sac7d-ΔTaq is significantly more efficient than Taq in amplifying using short primers. A primer length assay was used to determine the ability of PL-ΔTaq to use short primers in PCR amplification. When long primers (57F and 732R) were used, the amplified product generated by PL-ΔTaq is -50% of that by Sso7d-ΔTaq. When short primers (57F12 and 732R16) were used, the amplified product generated by PL-ΔTaq is <20% of that by Sso7d-ΔTaq .
Table III. Comparison of the effect of primer length on PCR amplification by Sso7d-ΔTaq and Taq DNA polymerase.
Increased performance of fusion polymerases in PCR reactions The increased stability and/or processivity of the fusion proteins of the invention provide increased efficiency in performing various modification reactions. For example, polymerase fusion proteins can provide more efficient amplification in PCR reactions. Many factors influence the outcome of a PCR reaction, including primer specificity, efficiency of the polymerase, quality, quantity and GC-content of the template, length of the amplicon, etc. Examples 5-8 demonstrate that fusion proteins that include a double-stranded sequence-non-specific nucleic acid binding domain, e.g., Sso7d, joined to a thermostable polymerase or polymerase domain have several advantageous features over the unmodified enzyme in PCR applications.
Example 5. Sso7d fusion proteins exhibit a higher and broader salt-tolerance in PCR
The binding of polymerase to a primed DNA template is sensitive to the ionic strength of the reaction buffer due to electrostatic interactions, which is stronger in low salt concentration and weaker in high. The presence of Sso7d in a fusion polymerase protein stabilizes the binding interaction of the polymerase to DNA template. This example demonstrates that Sso7d fusion proteins exhibit improved performance in PCR reactions containing elevated KCl concentrations.
Lambda DNA (2 pM) was used as a template in a PCR reactions with primers 57F and 732R. The concentration of KCl was varied from 10 mM to 150 mM, while all other components of the reaction buffer were unchanged. The PCR reaction was carried out using a cycling program of 94°C for 3 min, 20 cycles of 94°C for 30 sec, 55°C for 30 sec, and 72°C for 30 sec, followed by 72°C for 10 min. Upon completion of the reaction, 5 μl of the PCR reaction was removed and mixed with 195 μl of 1:400 dilution of PicoGreen in TE to quantify the amounts of amplicon generated. The PCR reaction products were also analyzed in parallel on an agarose gel to verify that amplicons of expected length were generated (data not shown). The effects of KCl concentration on the PCR efficiency of Sso7d-ΔTaq versus that of ΔTaq, and Pfu-Sso7d versus Pfu are shown in Table IV. The unmodified enzymes, ΔTaq and Pfu, showed a preference for KCl concentration below 25 mM and 40 mM, respectively, to maintain 80% of the maximum activity. In contrast, fusion proteins Sso7d- ΔTaq and Pfu-Sso7d maintain 80% of the maximum activity in 30-100 mM and 60-100 mM KCl, respectively. Thus, the Sso7d fusion proteins were more tolerant of elevated KCl concentration in comparison to their unmodified counter parts. This feature of the hybrid polymerase will potentially allow PCR amplification from low quality of DNA template, e.g., DNA samples prepared from, but not limited to, blood, food, and plant sources.
Table IV. Sso7d modification increases salt-tolerance of ol merase in PCR reaction
* Pfu-Sso7d has a 4-fold higher specific activity than Pfu. The specific activity is defined as unit/mol of enzyme.
Example 6. Sso7d fusion polymerases require shorter extension time in PCR
The processivity of a polymerase directly effects the efficiency of the polymerization step. For example, a polymerase with low processivity dissociates more frequently and requires more time to rebind to the primed-template, whereas a polymerase with high processivity requires fewer binding events to complete replication of the entire template. As demonstrated in Example 2, Sso7d fusion proteins have significantly higher processivity than their unmodified counterparts. Thus, the fusion proteins should be more efficient during the primer extension step of a PCR reaction. Here we provide examples demonstrating that an Sso7d fusion polymerase requires a shorter extension time to amplify a large fragment during PCR compared to unmodified polymerases. In addition, we show that a single enzyme fusion polymerase exhibits an enhanced ability to amplify large DNA fragments in a limited amount of time in comparison to an enzyme mixture (DyNAzyme EXT) currently used in the art for amplification of large fragments.
Example 6-1. Sso7d fusion polymerases require shorter extension time in PCR
Lambda DNA (2.25 pM) was used as a PCR template. Three pairs of primers L71F (5'-CCTGCTCTGCCGCTTCACGC-3') and L71R (5'-GCACAGCGGCTGGCTGAG GA-3'), L18015F (5'-TGACGGAGGATAACGCCAGCAG-3') and L23474R (5'- GAAAGACGA TGGGTCGCTAATACGC-3'), and L18015F (5'-TGACGGAGGATAAC GCCAGCAG-3 ') and L29930R (5 '-GGGGTTGGAGGTCAATGGGTTC-3 '), were used to amplify DNA fragments of the size of 0.9 kb, 5.5 kb and 11.9 kb, respectively. Each reaction contained 40 unit/ml of polymerase, where the unit was defined as described in Example 2, and 0.36 mM of each of the four dNTPs. The reaction buffer used for Pfu (from Stratagene) contained 20 mM Tris-HCl (pH 8.8), 2 mM MgSO4, 10 mM KCl, 10 mM (NH4)2SO4, 0.1% Triton X- 100, and 0.1 mg/ml BSA. The reaction buffer for Pfu-Sso7d, Taq, and Sso7d-Taq was the above buffer with an additional 40 mM of KCl. Two cycling programs with a 1 min or a 5 min extension time were used for PCR amplification. Each cycling program was composed of 94°C for 20 sec, hot start at 80°C by the addition of the polymerase, 20 cycles of 94°C for 10 sec followed by 72°C for 1 or 5 min, and 72°C for 5 min. The results showed that a Pfu-Sso7d fusion protein was able to amplify both the 1 kb and 5 kb fragments using a 1 min extension time, and was also able to amplify the 10 kb fragment using a 5 min extension time. In contrast, Pfu polymerase amplified only the 1 kb fragment using either a 1 min or a 5 min extension time. Similarly, the Sso7d-Taq fusion protein amplified the lkb fragment using a 1 min extension time, and both the 1 kb and 5 kb fragments with a 5 min extension time, whereas Taq polymerase amplified only the 1 kb fragment with a 5 min extension time.
Thus, the presence of Sso7d in the fusion protein results in shorter extension times in PCR reactions compared to the unmodified protein.
Example 6-2. Pfu-Sso7d fusion polymerase outperforms existing long PCR enzyme mixture Currently, PCR amplification of long DNA fragments requires the use of an enzyme mixture containing both a non-proofreading polymerase (e.g. Taq or DyNAzyme II) and a small amount of proofreading polymerase (e.g. Pfu or Deep Vent). We have compared a single fusion enzyme, Pfu-Sso7d, to one of the high performance, long PCR enzymes DyNAzyme EXT (from Finnzymes) in long PCR, and demonstrated that Pfu-Sso7d outperforms DyNAzyme EXT, especially with limited extension time.
Lambda DNA (2.25 pM) was used as a PCR template. Four pairs of primers L71F (5'-CCTGCTCTGCCGCTTCACGC-3') and L71R (5'-GCACAGCGGCTGGCTGAG GA-3'), L30350F (5'-CCTGCTCTGCCGCTTCACGC-3') and L35121R (5'- CACATGGTACAGCAAGCCTGGC-3'), L2089F (5'-CCCGTATCTGCTGGGA TACTGGC-3') and L7112R (5'-CAGCGGTGCTGACTGAATCATGG-3'), and L30350F (5'-CCTGCCTGCCGCTTCACGC-3') and L40547R (5'-CCAATACCCGTTTCA TCGCGGC-3') were used to amplify DNA fragments of the size of 0.9 kb, 4.8 kb, 5.0 kb and 10.2 kb, respectively. Four concentrations (10 unit/ml, 20 unit/ml, 40 unit/ml and 80 unit/ml) of Pfu-Sso7d were used, and two concentrations (20 unit/ml and 40 unit/ml) of DyNAzyme EXT were used. Each reaction contained 0.36 mM of each of the four dNTPs. The reaction buffer for Pfu-Sso7d was as described in Example 6-1. The reaction buffer for DyNAzyme EXT contained 20 mM Tris (pH 9.0), 2 mM MgCl2, 15 mM (NH4)2SO4, and 0.1 % Triton X- 100 (provided by Finnzymes). All reaction components were first mixed on ice, and the reactions were initiated by placing the sample plates into a thermal cycler (MJ Research) preheated to over 90°C. The PCR cycling program consists of 95°C for 20 sec, 20 cycles of 94°C for 10 sec and 70°C for 1 or 1.5 min, and 1 cycle of 72°C for 10 min.
As shown in Figure 3, a 1 min extension time using Pfu-Sso7d generated significant amounts of the 0.9 kb product in the presence of 10, 20, 40 and 80 unit/ml of polymerase. The 4.8 kb and 5.0 kb products were also produced, although at a lower level, in the presence of 40 and 80 unit/ml of polymerase. Using a 1.5 min extension, the 4.8 kb and 5.0 kb products were generated with 10 unit/ml or higher Pfu-Sso7d, and the 10.2 kb fragment was produced in a significant amount with 40 and 80 unit/ml of Pfu-Sso7d. In contrast, when DyNAzyme EXT was used, only the lkb and 4.8 kb products were generated using 1.5 min extension time in the presence of 40 unit/ml of polymerase, and no 10 kb product was detected.
Thus, the fusion polymerase Pfu-Sso7d is notably more efficient as a single enzyme than an enzyme mixture such as DyNAzyme EXT in long PCR.
Example 7. Sso7d fusion proteins are more sensitive in PCR amplification
This example demonstrates that an Sso7d fusion polymerase can amplify a target that is present at a lower copy number compared to the unmodified polymerases. Plasmid DNA was used as a PCR template with T3 and T7 as the primers, which amplify a 500 bp fragment. The amount of plasmid DNA was varied so that the number of copies of DNA template present in the PCR reaction ranged from 108 to 1. The cycling program was 94°C for 3 min, 25 or 35 cycles of 96°C for 1 sec, 50°C for 15 sec, and 68°C for 30 sec, followed by 1 cycle at 68°C for 5 min. For template copy numbers from 104 to 10s (per 25 μl reaction), 25 cycles of amplification were performed; for template copy numbers from 1 to 104 (per 25 μl reaction), 35 cycles of amplification were performed.
The Sso7d fusion polymerase was compared to the unmodified polymerase in the requirements for minimum copies of template for efficient amplification. As shown in Table V, Pfu-Sso7d is significantly more sensitive than Pfu in its ability to amplify a low copy number of DNA template, showing that fusion polymerase of the invention can increase the sensitivity of PCR reactions by as much as five orders of magnitude.
Table V. Sso7d fusion protein can amplify usin a lower number of co ies of DNA tem late
Example 8. Sso7d fusion polymerases maintain high specificity in a PCR reaction
As shown in Example 3, Sso7d-ΔTaq fusion protein stabilizes primer-template interactions, as reflected by its ability to allow higher annealing temperature and/or shorter primers in PCR amplification. To assess whether this property of the fusion protein would result in nonspecific amplification in PCR, a complex DNA template (e.g. human genomic DNA) was used as the target template. The following two examples demonstrate that the specificity of amplification achieved using Pfu-Sso7d is no less than that Taq, the most commonly used PCR enzyme.
Example 8-1. Amplification of a gender-specific marker from human DNA using Pfu-Sso7d Human female or male type DNA (concentration, 1 fM) from placenta or chorionic tissue (from Sigma) was used as the template. Primers H-Amelo-Y (5'- CCACCTCATCCTGG GCACC-3') and H-Amelo-YR (5'-GCTTGAGGCCAACCATCA GAGC-3') were used to amplify a 212 bp amplicon from X chromosome and a 218 bp amplicon from Y chromosome. A single 212 bp fragment should be amplified from female typed DNA, whereas three fragments (212 bp, 218 bp, and the 212 bp/218 bp heterozygote) were expected from male typed DNA. Each reaction contained 20 unit/ml of polymerase and 0.36 mM of each of the four dNTPs. The reaction buffer for Taq included 10 mM Tris (pH 8.8), 50 mM KCl, 1.5 mM MgC12 and 0.1% Triton X-100 (provided by Amersham). The reaction buffer for Pfu-Sso7d contains was performed using DyNAzyme EXT buffer (see Example 6-2) with an additional 40 mM KCl. All reaction components were mixed on ice, and the reaction was initiated by placing the plates into a thermal cycler preheated to above 65°C. The cycling program consisted of 95°C for 2 min, 30 cycles of 94°C for 5 sec, 64°C for 10 sec, and 72°C for 10 sec, followed by 1 cycle of 7 min at 72°C. Specific amplicons of expected sizes were amplified by both Pfu-Sso7d and Taq polymerase.
Example 8-2. Amplification ofβ-globin gene from human DNA using Pfu-Sso7d
Human DNA (1 fM) from placenta or chorionic tissue (from Sigma) was used as the template. Three pairs of primers, Bglbn536F (5'-GGTTGGCCAATCTA
CTCCCAGG-3') and Bglbn536R (5'-GCTCACTCAGTGTGGCAAAG-3'), Bglbn536F and Bglbnl083R, and Bglbn536F and Bglbnl408R (5'-GATTAGCAAAAGGGCCTAGCTTGG- 3') were used to amplify DNA fragments of the size of 0.5, 1.1 and 1.4 kb, respectively. Each reaction contained 20 unit/ml of polymerase and 0.36 mM of each of the four dNTPs. The reaction buffers for Taq and Pfu-Sso7d were as described in Example 8-1. All reaction components were first mixed on ice, and the reactions were initiated by placing the plates into a thermal cycler preheated to above 65°C. The cycling program consists of 95°C for 2 min, 30 cycles of 94°C for 45 sec, 64°C for 45 sec, and 72°C for 1 min, followed by 1 cycle of 7 min at 72C. With each of the three pair of primers used, an amplified product of the expected size was produced using Pfu-Sso7d. These results show that the specificity of amplification achieved by using Pfu-Sso7d is equal or better than that with Taq polymerase.
SEQUENCE LISTING
SEQ ID NO: 1 Synthetic Sso7d gene
GCAACCGTAAAGTTCAAGTACAAAGGCGAAGAAAAAGAGGTAGACATCTCCAA GATCAAGAAAGTATGGCGTGTGGGCAAGATGATCTCCTTCACCTACGACGAGGG CGGTGGCAAGACCGGCCGTGGTGCGGTAAGCGAAAAGGACGCGCCGAAGGAGC TGCTGCAGATGCTGGAGAAG CAGAAAAAG
SEQ ID NO-.2 The amino acid sequence of Sso7d.
ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQ MLEKQKK
SEQ ID NO:3 The DNA sequence encoding the Sso7d-ΔTaq fusion protein ATGATTACGAATTCGAGCGCAACCGTAAAGTTCAAGTACAAAGGCGAAGAAAAA GAGGTAGACATCTCCAAGATCAAGAAAGTATGGCGTGTGGGCAAGATGATCTCC TTCACCTACGACGAGGGCGGTGGCAAGACCGGCCGTGGTGCGGTAAGCGAAAAG GACGCGCCGAAGGAGCTGCTGCAGATGCTGGAGAAGCAGAAAAAGGGCGGCGG TGTCACTAGTCCCAAGGCcCTGGAGGAGGCCCCCTGGCCCCCGCCGGAAGGGGCC TTCGTGGGCTTTGTGCTTTCCCGCAAGGAGCCCATGTGGGCCGATCTTCTGGCCCT GGCCGCCGCCAGGGGGGGCCGGGTCCACCGGGCCCCCGAGCCTTATAAAGCCCT CAGGGACCTGAAGGAGGCGCGGGGGCTTCTCGCCAAAGACCTGAGCGTTCTGGC CCTGAGGGAAGGCCTTGGCCTCCCGCCCGGCGACGACCCCATGCTCCTCGCCTAC CTCCTGGACCCTTCCAACACCACCCCCGAGGGGGTGGCCCGGCGCTACGGCGGG GAGTGGACGGAGGAGGCGGGGGAGCGGGCCGCCCTTTCCGAGAGGCTCTTCGCC AACCTGTGGGGGAGGCTTGAGGGGGAGGAGAGGCTCCTTTGGCTTTACCGGGAG GTGGAGAGGCCCCTTTCCGCTGTCCTGGCCCACATGGAGGCCACGGGGGTGCGC CTGGACGTGGCCTATCTCAGGGCCTTGTCCCTGGAGGTGGCCGAGGAGATCGCCC GCCTCGAGGCCGAGGTCTTCCGCCTGGCCGGCCACCCCTTCAACCTCAACTCCCG GGACCAGCTGGAAAGGGTCCTCTTTGACGAGCTAGGGCTTCCCGCCATCGGCAA GACGGAGAAGACCGGCAAGCGCTCCACCAGCGCCGCCGTCCTGGAGGCCCTCCG CGAGGCCCACCCCATCGTGGAGAAGATCCTGCAGTACCGGGAGCTCACCAAGCT GAAGAGCACCTACATTGACCCCTTGCCGGACCTCATCCACCCCAGGACGGGCCG CCTCCACACCCGCTTCAACCAGACGGCCACGGCCACGGGCAGGCTAAGTAGCTC CGATCCCAACCTCCAGAACATCCCCGTCCGCACCCCGCTTGGGCAGAGGATCCGC CGGGCCTTCATCGCCGAGGAGGGGTGGCTATTGGTGGCCCTGGACTATAGCCAG ATAGAGCTCAGGGTGCTGGCCCACCTCTCCGGCGACGAGAACCTGATCCGGGTCT TCCAGGAGGGGCGGGACATCCACACGGAGACCGCCAGCTGGATGTTCGGCGTCC CCCGGGAGGCCGTGGACCCCCTGATGCGCCGGGCGGCCAAGACCATCAACTTCG GGGTCCTCTACGGCATGTCGGCCCACCGCCTCTCCCAGGAGCTAGCCATCCCTTA CGAGGAGGCCCAGGCCTTCATTGAGCGCTACTTTCAGAGCTTCCCCAAGGTGCGG GCCTGGATTGAGAAGACCCTGGAGGAGGGCAGGAGGCGGGGGTACGTGGAGAC CCTCTTCGGCCGCCGCCGCTACGTGCCAGACCTAGAGGCCCGGGTGAAGAGCGT GCGGGAGGCGGCCGAGCGCATGGCCTTC AAC ATGCCCGTCCAGGGC ACCGCCGC CGACCTCATGAAGCTGGCTATGGTGAAGCTCTTCCCCAGGCTGGAGGAAATGGG GGCCAGGATGCTCCTTCAGGTCCACGACGAGCTGGTCCTCGAGGCCCCAAAAGA GAGGGCGGAGGCCGTGGCCCGGCTGGCCAAGGAGGTCATGGAGGGGGTGTATCC CCTGGCCGTGCCCCTGGAGGTGGAGGTGGGGATAGGGGAGGACTGGCTCTCCGC CAAGGAGGGCATTGATGGCCGCGGCGGAGGCGGGCATCATCATCATCATCATTA A
SEQ ID NO:4 The amino acid sequence of Sso7d-ΔTaq fusion protein
MITNSSATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDA PKELLQMLEKQKKGGGVTSPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAA ARGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLAYLLDP SNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLLWLYREVERPLS AVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVFRLAGHPFNLNSRDQLERVLF DELGLPAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLPDLIH PRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYS QIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTΓNFGV LYGMSAHRLSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRR RYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEEMGARMLL QVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEGIDGR GGGGHHHHHH
SEQ ID NO:5 The DNA sequence encoding the Sso7d-Taq fusion protein
ATGATTACGAATTCGAGCGCAACCGTAAAGTTCAAGTACAAAGGCGAAGAAAAA GAGGTAGACATCTCCAAGATCAAGAAAGTATGGCGTGTGGGCAAGATGATCTCC TTCACCTACGACGAGGGCGGTGGCAAGACCGGCCGTGGTGCGGTAAGCGAAAAG GACGCGCCGAAGGAGCTGCTGCAGATGCTGGAGAAGCAGAAAAAGGGCGGCGG TGTCACTAGTGGGATGCTGCCCCTCTTTGAGCCCAAGGGCCGGGTCCTCCTGGTG GACGGCCACCACCTGGCCTACCGCACCTTCCACGCCCTGAAGGGCCTCACCACCA GCCGGGGGGAGCCGGTGCAGGCGGTCTACGGCTTCGCCAAGAGCCTCCTCAAGG CCCTCAAGGAGGACGGGGACGCGGTGATCGTGGTCTTTGACGCCAAGGCCCCCT CCTTCCGCCACGAGGCCTACGGGGGGTACAAGGCGGGCCGGGCCCCCACGCCAG AGGACTTTCCCCGGCAACTCGCCCTCATCAAGGAGCTGGTGGACCTCCTGGGGCT GGCGCGCCTCGAGGTCCCGGGCTACGAGGCGGACGACGTCCTGGCCAGCCTGGC CAAGAAGGCGGAAAAGGAGGGCTACGAGGTCCGCATCCTCACCGCCGACAAAG ACCTTTACCAGCTCCTTTCCGACCGCATCCACGTCCTCCACCCCGAGGGGTACCT CATCACCCCGGCCTGGCTTTGGGAAAAGTACGGCCTGAGGCCCGACCAGTGGGC CGACTACCGGGCCCTGACCGGGGACGAGTCCGACAACCTTCCCGGGGTCAAGGG C ATCGGGGAGAAGACGGCGAGGAAGCTTCTGGAGGAGTGGGGGAGCCTGGAAG CCCTCCTCAAGAACCTGGACCGGCTGAAGCCCGCCATCCGGGAGAAGATCCTGG CCCACATGGACGATCTGAAGCTCTCCTGGGACCTGGCCAAGGTGCGCACCGACCT GCCCCTGGAGGTGGACTTCGCCAAAAGGCGGGAGCCCGACCGGGAGAGGCTTAG GGCCTTTCTGGAGAGGCTTGAGTTTGGCAGCCTCCTCCACGAGTTCGGCCTTCTG GAAAGCCCCAAGGCcCTGGAGGAGGCCCCCTGGCCCCCGCCGGAAGGGGCCTTC GTGGGCTTTGTGCTTTCCCGCAAGGAGCCCATGTGGGCCGATCTTCTGGCCCTGG CCGCCGCCAGGGGGGGCCGGGTCCACCGGGCCCCCGAGCCTTATAAAGCCCTCA GGGACCTGAAGGAGGCGCGGGGGCTTCTCGCCAAAGACCTGAGCGTTCTGGCCC TGAGGGAAGGCCTTGGCCTCCCGCCCGGCGACGACCCCATGCTCCTCGCCTACCT CCTGGACCCTTCCAACACCACCCCCGAGGGGGTGGCCCGGCGCTACGGCGGGGA GTGGACGGAGGAGGCGGGGGAGCGGGCCGCCCTTTCCGAGAGGCTCTTCGCCAA CCTGTGGGGGAGGCTTGAGGGGGAGGAGAGGCTCCTTTGGCTTTACCGGGAGGT GGAGAGGCCCCTTTCCGCTGTCCTGGCCCACATGGAGGCCACGGGGGTGCGCCT GGACGTGGCCTATCTCAGGGCCTTGTCCCTGGAGGTGGCCGAGGAGATCGCCCG CCTCGAGGCCGAGGTCTTCCGCCTGGCCGGCCACCCCTTCAACCTCAACTCCCGG GACCAGCTGGAAAGGGTCCTCTTTGACGAGCTAGGGCTTCCCGCCATCGGCAAG ACGGAGAAGACCGGCAAGCGCTCCACCAGCGCCGCCGTCCTGGAGGCCCTCCGC GAGGCCCACCCCATCGTGGAGAAGATCCTGCAGTACCGGGAGCTCACCAAGCTG AAGAGCACCTACATTGACCCCTTGCCGGACCTCATCCACCCCAGGACGGGCCGCC TCCACACCCGCTTCAACCAGACGGCCACGGCCACGGGCAGGCTAAGTAGCTCCG ATCCCAACCTCCAGAACATCCCCGTCCGCACCCCGCTTGGGCAGAGGATCCGCCG GGCCTTCATCGCCGAGGAGGGGTGGCTATTGGTGGCCCTGGACTATAGCCAGAT AGAGCTCAGGGTGCTGGCCCACCTCTCCGGCGACGAGAACCTGATCCGGGTCTTC CAGGAGGGGCGGGACATCCACACGGAGACCGCCAGCTGGATGTTCGGCGTCCCC CGGGAGGCCGTGGACCCCCTGATGCGCCGGGCGGCCAAGACCATCAACTTCGGG GTCCTCTACGGCATGTCGGCCCACCGCCTCTCCCAGGAGCTAGCCATCCCTTACG AGGAGGCCCAGGCCTTCATTGAGCGCTACTTTCAGAGCTTCCCCAAGGTGCGGGC CTGGATTGAGAAGACCCTGGAGGAGGGCAGGAGGCGGGGGTACGTGGAGACCC TCTTCGGCCGCCGCCGCTACGTGCC AGACCTAGAGGCCCGGGTGAAGAGCGTGC GGGAGGCGGCCGAGCGCATGGCCTTCAACATGCCCGTCCAGGGCACCGCCGCCG ACCTCATGAAGCTGGCTATGGTGAAGCTCTTCCCCAGGCTGGAGGAAATGGGGG CCAGGATGCTCCTTCAGGTCCACGACGAGCTGGTCCTCGAGGCCCCAAAAGAGA GGGCGGAGGCCGTGGCCCGGCTGGCCAAGGAGGTCATGGAGGGGGTGTATCCCC TGGCCGTGCCCCTGGAGGTGGAGGTGGGGATAGGGGAGGACTGGCTCTCCGCC A AGGAGGGCATTGATGGCCGCGGCGGAGGCGGGCATCATCATCATCATCATTAA
SEQ H) NO:6 The amino acid sequence of Sso7d-Taq fusion protein.
MITNSSATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDA PKELLQMLEKQKKGGGVTSGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGE PVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQ LALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSDR IHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTARKLL EEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVRTDLPLEVDFAKRREP DRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWPPPEGAFVGFVLSRKEPMWADL LALAAARGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLA YLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLLWLYREV ERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVFRLAGHPFNLNSRDQL ERVLFDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPL PDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVA LDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTI NFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVΈTL FGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEEMGA RMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKE GIDGRGGGGHHHHHH
SEQ ID NO:7 The DNA sequence encoding the Pfu-Sso7d fusion protein ATGATTTTAGATGTGGATTACATAACTGAAGAAGGAAAACCTGTTATTAGGCTAT TCAAAAAAGAGAACGGAAAATTTAAGATAGAGCATGATAGAACTTTTAGACCAT ACATTTACGCTCTTCTCAGGGATGATTCAAAGATTGAAGAAGTTAAGAAAATAAC GGGGGAAAGGCATGGAAAGATTGTGAGAATTGTTGATGTAGAGAAGGTTGAGAA AAAGTTTCTCGGCAAGCCTATTACCGTGTGGAAACTTTATTTGGAACATCCCCAA GATGTTCCCACTATTAGAGAAAAAGTTAGAGAACATCCAGCAGTTGTGGACATCT TCGAATACGATATTCCATTTGCAAAGAGATACCTCATCGACAAAGGCCTAATACC AATGGAGGGGGAAGAAGAGCTAAAGATTCTTGCCTTCGATATAGAAACCCTCTA TCACGAAGGAGAAGAGTTTGGAAAAGGCCCAATTATAATGATTAGTTATGCAGA TGAAAATGAAGCAAAGGTGATTACTTGGAAAAACATAGATCTTCCATACGTTGA GGTTGTATCAAGCGAGAGAGAGATGATAAAGAGATTTCTC AGGATTATC AGGGA GAAGGATCCTGACATTATAGTTACTTATAATGGAGACTCATTCGACTTCCCATAT TTAGCGAAAAGGGCAGAAAAACTTGGGATTAAATTAACCATTGGAAGAGATGGA AGCGAGCCCAAGATGCAGAGAATAGGCGATATGACGGCTGTAGAAGTCAAGGG AAGAATACATTTCGACTTGTATCATGTAATAACAAGGACAATAAATCTCCCAACA TACACACTAGAGGCTGTATATGAAGCAATTTTTGGAAAGCCAAAGGAGAAGGTA TACGCCGACGAGATAGCAAAAGCCTGGGAAAGTGGAGAGAACCTTGAGAGAGTT GCCAAATACTCGATGGAAGATGCAAAGGCAACTTATGAACTCGGGAAAGAATTC CTTCCAATGGAAATTCAGCTTTCAAGATTAGTTGGACAACCTTTATGGGATGTTT CAAGGTCAAGCACAGGGAACCTTGTAGAGTGGTTCTTACTTAGGAAAGCCTACG AAAGAAACGAAGTAGCTCCAAACAAGCCAAGTGAAGAGGAGTATCAAAGAAGG CTCAGGGAGAGCTACACAGGTGGATTCGTTAAAGAGCCAGAAAAGGGGTTGTGG GAAAACATAGTATACCTAGATTTTAGAGCCCTATATCCCTCGATTATAATTACCC ACAATGTTTCTCCCGATACTCTAAATCTTGAGGGATGCAAGAACTATGATATCGC TCCTCAAGTAGGCCACAAGTTCTGCAAGGACATCCCTGGTTTTATACCAAGTCTC TTGGGACATTTGTTAGAGGAAAGACAAAAGATTAAGACAAAAATGAAGGAAACT CAAGATCCTATAGAAAAAATACTCCTTGACTATAGACAAAAAGCGATAAAACTC TTAGCAAATTCTTTCTACGGATATTATGGCTATGCAAAAGCAAGATGGTACTGTA AGGAGTGTGCTGAGAGCGTTACTGCCTGGGGAAGAAAGTACATCGAGTTAGTAT GGAAGGAGCTCGAAGAAAAGTTTGGATTTAAAGTCCTCTACATTGACACTGATG GTCTCTATGCAACTATCCCAGGAGGAGAAAGTGAGGAAATAAAGAAAAAGGCTC TAGAATTTGTAAAATACATAAATTCAAAGCTCCCTGGACTGCTAGAGCTTGAATA TGAAGGGTTTTATAAGAGGGGATTCTTCGTTACGAAGAAGAGGTATGCAGTAAT AGATGAAGAAGGAAAAGTCATTACTCGTGGTTTAGAGATAGTTAGGAGAGATTG GAGTGAAATTGCAAAAGAAACTCAAGCTAGAGTTTTGGAGACAATACTAAAACA CGGAGATGTTGAAGAAGCTGTGAGAATAGTAAAAGAAGTAATACAAAAGCTTGC CAATTATGAAATTCCACCAGAGAAGCTCGCAATATATGAGCAGATAACAAGACC ATTACATGAGTATAAGGCGATAGGTCCTCACGTAGCTGTTGCAAAGAAACTAGCT GCTAAAGGAGTTAAAATAAAGCCAGGAATGGTAATTGGATACATAGTACTTAGA GGCGATGGTCC AATTAGC AATAGGGC AATTCT AGCTGAGG AATACGATCCCAAA AAGCACAAGTATGACGCAGAATATTACATTGAGAACCAGGTTCTTCCAGCGGTA CTTAGGATATTGGAGGGATTTGGATACAGAAAGGAAGACCTCAGATACCAAAAG ACAAGACAAGTCGGCCTAACTTCCTGGCTTAACATTAAAAAATCCGGTACCGGC GGTGGCGGTGCAACCGTAAAGTTCAAGTACAAAGGCGAAGAAAAAGAGGTAGA CATCTCCAAGATC AAGAAAGTATGGCGTGTGGGC AAGATGATCTCCTTC ACCTAC GACGAGGGCGGTGGCAAGACCGGCCGTGGTGCGGTAAGCGAAAAGGACGCGCC GAAGGAGCTGCTGCAGATGCTGGAGAAGCAGAAAAAGTGA
SEQ ID NO:8 The amino acid sequence of the Pfu-Sso7d fusion protein MILDVDYITEEGKPVIRLFKKENGKFKIEHDRTFRPYIYALLRDDSKIEEVKKITGERH GKIVRIVDVEKVEKKFLGKPITVWKLYLEHPQDVPTIREKVREHPAWDIFEYDIPFA KRYLIDKGLIPMEGEEELKILAFDIETLYHEGEEFGKGPIIMISYADENEAKVITWKNID LPYVEWSSEREMIKRFLRIIREKDPDIIVTYNGDSFDFPYLAKRAEKLGIKLTIGRDGS EPKMQPJGDMTAVEVKGRIHFDLYHVITRTΓNLPTYTLEAVYEAIFGKPKEKVΎADEI AKAWESGENLERVAKYSMEDAKATYELGKEFLPMEIQLSRLVGQPLWDVSRSSTGN LVEWFLLRKAYΈRNEVAPNKPSEEEYQRRLRESYTGGFVKEPEKGLWENTVΎLDFR ALYPSIΠTHNVSPDTLNLEGCKNYDIAPQVGHKFCKDIPGFIPSLLGHLLEERQKIKTK
MKETQDPIEKILLDYRQKAIKLLANSFYGYYGYAKARWYCKECAESVTAWGRKYIE LVWKELEEKFGFKVLYmTDGLYATPGGESEEIKKKALEFVKYINSKLPGLLELEYE GFYKRGFFVTKKRYAVIDEEGKVITRGLEIVRRDWSEIAKETQARVLETILKHGDVEE
AVPJVKEVIQKLANYEIPPEKLAIYEQITRPLHEYKAIGPHVAVAKKLAAKGVKIKPG MVIGYIVLRGDGPISNRAJLAEEYDPKKHKYDAEYYIENQVLPAVLRILEGFGYRKED LRYQKTRQVGLTSWLNIKKSGTGGGGATVKFKYKGEEKEVDISKIKKVWRVGKMIS FTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK SEQ D3 NO:9 The DNA sequence encoding the Sac7d-ΔTaq fusion protein
ATGATTACGAATTCGACGGTGAAGGTAAAGTTCAAGTATAAGGGTGAAGAGAAA GAAGTAGACACTTCAAAGATAAAGAAGGTTTGGAGAGTAGGCAAAATGGTGTCC TTTACCTATGACGACAATGGTAAGACAGGTAGAGGAGCTGTAAGCGAGAAAGAT GCTCCAAAAGAATTATTAGACATGTTAGCAAGAGCAGAAAGAGAGAAGAAAGG CGGCGGTGTCACTAGTCCCAAGGCCCTGGAGGAGGCCCCCTGGCCCCCGCCGGA AGGGGCCTTCGTGGGCTTTGTGCTTTCCCGCAAGGAGCCCATGTGGGCCGATCTT CTGGCCCTGGCCGCCGCCAGGGGGGGCCGGGTCCACCGGGCCCCCGAGCCTTAT AAAGCCCTCAGGGACCTGAAGGAGGCGCGGGGGCTTCTCGCCAAAGACCTGAGC GTTCTGGCCCTGAGGGAAGGCCTTGGCCTCCCGCCCGGCGACGACCCCATGCTCC TCGCCTACCTCCTGGACCCTTCCAACACCACCCCCGAGGGGGTGGCCCGGCGCTA CGGCGGGGAGTGGACGGAGGAGGCGGGGGAGCGGGCCGCCCTTTCCGAGAGGC TCTTCGCCAACCTGTGGGGGAGGCTTGAGGGGGAGGAGAGGCTCCTTTGGCTTTA CCGGGAGGTGGAGAGGCCCCTTTCCGCTGTCCTGGCCC AC ATGGAGGCC ACGGG GGTGCGCCTGGACGTGGCCTATCTCAGGGCCTTGTCCCTGGAGGTGGCCGAGGA GATCGCCCGCCTCGAGGCCGGGTCTTCCGCCTGGCCGGCCACCCCTTCAACCTCA ACTCCCGGGACCAGCTGGAAAGGGTCCTCTTTGACGAGCTAGGGCTTCCCGCCAT CGGCAAGACGGAGAAGACCGGCAAGCGCTCCACCAGCGCCGCCGTCCTGGAGGC CCTCCGCGAGGCCCACCCCATCGTGGAGAAGATCCTGCAGTACCGGGAGCTCAC CAAGCTGAAGAGCACCTACATTGACCCCTTGCCGGACCTCATCCACCCCAGGACG GGCCGCCTCCACACCCGCTTCAACCAGACGGCCACGGCCACGGGCAGGCTAAGT AGCTCCGATCCCAACCTCCAGAACATCCCCGTCCGCACCCCGCTTGGGCAGAGGA TCCGCCGGGCCTTCATCGCCGAGGAGGGGTGGCTATTGGTGGCCCTGGACTATAG CCAGATAGAGCTCAGGGTGCTGGCCCACCTCTCCGGCGACGAGAACCTGATCCG GGTCTTCCAGGAGGGGCGGGACATCCACACGGAGACCGCCAGCTGGATGTTCGG CGTCCCCCGGGAGGCCGTGGACCCCCTGATGCGCCGGGCGGCCAAGACCATCAA CTTCGGGGTCCTCTACGGCATGTCGGCCCACCGCCTCTCCCAGGAGCTAGCCATC CCTTACGAGGAGGCCCAGGCCTTCATTGAGCGCTACTTTCAGAGCTTCCCCAAGG TGCGGGCCTGGATTGAGAAGACCCTGGAGGAGGGCAGGAGGCGGGGGTACGTG GAGACCCTCTTCGGCCGCCGCCGCTACGTGCCAGACCTAGAGGCCCGGGTGAAG AGCGTGCGGGAGGCGGCCGAGCGCATGGCCTTCAACATGCCCGTCCAGGGCACC GCCGCCGACCTCATGAAGCTGGCTATGGTGAAGCTCTTCCCCAGGCTGGAGGAA ATGGGGGCCAGGATGCTCCTTCAGGTCCACGACGAGCTGGTCCTCGAGGCCCCA AAAGAGAGGGCGGAGGCCGTGGCCCGGCTGGCCAAGGAGGTCATGGAGGGGGT GTATCCCCTGGCCGTGCCCCTGGAGGTGGAGGTGGGGATAGGGGAGGACTGGCT CTCCGCCAAGGAGGGCATTGATGGCCGCGGCGGAGGCGGGCATCATCATCATCA TCATTAA
SEQ D3 NO:10 The amino acid sequence of the Sac7d-ΔTaq fusion protein
MITNSTVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDA PKELLDMLARAEREKKGGGVTSPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLAL AAARGGRVHRAPEP YKALRDLKEARGLLAKDLS VLALREGLGLPPGDDPMLLAYLL DPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLLWLYREVERP LSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVFRLAGHPFNLNSRDQLERV LFDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLPDLI HPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDY SQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTΓNFG VLYGMSAHRLSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGR RRYWDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEEMGARML LQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEGIDG RGGGGHHHHHH
SEQ ID NO.ll The DNA sequence encoding the PL-ΔTaq fusion protein
ATGATTACGAATTCGAAGAAAAAGAAAAAGAAAAAGCGTAAGAAACGCAAAAA GAAAAAGAAAGGCGGCGGTGTCACTAGTGGCGCAACCGTAAAGTTCAAGTACAA AGGCGAAGAAAAAGAGGTAGACATCTCCAAGATCAAGAAAGTATGGCGTGTGG GCAAGATGATCTCCTTCACCTACGACGAGGGCGGTGGCAAGACCGGCCGTGGTG CGGTAAGCGAAAAGGACGCGCCGAAGGAGCTGCTGCAGATGCTGGAGAAGCAG AAAAAGGGCGGCGGTGTCACCAGTCCCAAGGCCCTGGAGGAGGCCCCCTGGCCC CCGCCGGAAGGGGCCTTCGTGGGCTTTGTGCTTTCCCGCAAGGAGCCCATGTGGG CCGATCTTCTGGCCCTGGCCGCCGCCAGGGGGGGCCGGGTCCACCGGGCCCCCG AGCCTTATAAAGCCCTCAGGGACCTGAAGGAGGCGCGGGGGCTTCTCGCCAAAG ACCTGAGCGTTCTGGCCCTGAGGGAAGGCCTTGGCCTCCCGCCCGGCGACGACCC CATGCTCCTCGCCTACCTCCTGGACCCTTCCAACACCACCCCCGAGGGGGTGGCC CGGCGCTACGGCGGGGAGTGGACGGAGGAGGCGGGGGAGCGGGCCGCCCTTTCC GAGAGGCTCTTCGCCAACCTGTGGGGGAGGCTTGAGGGGGAGGAGAGGCTCCTT TGGCTTTACCGGGAGGTGGAGAGGCCCCTTTCCGCTGTCCTGGCCCACATGGAGG CCACGGGGGTGCGCCTGGACGTGGCCTATCTCAGGGCCTTGTCCCTGGAGGTGGC CGAGGAGATCGCCCGCCTCGAGGCCGAGGTCTTCCGCCTGGCCGGCCACCCCTTC AACCTCAACTCCCGGGACCAGCTGGAAAGGGTCCTCTTTGACGAGCTAGGGCTTC CCGCCATCGGCAAGACGGAGAAGACCGGCAAGCGCTCCACCAGCGCCGCCGTCC TGGAGGCCCTCCGCGAGGCCCACCCCATCGTGGAGAAGATCCTGCAGTACCGGG AGCTCACCAAGCTGAAGAGCACCTACATTGACCCCTTGCCGGACCTCATCCACCC CAGGACGGGCCGCCTCCACACCCGCTTCAACCAGACGGCCACGGCCACGGGCAG GCTAAGTAGCTCCGATCCC AACCTCC AGAACATCCCCGTCCGC ACCCCGCTTGGG CAGAGGATCCGCCGGGCCTTCATCGCCGAGGAGGGGTGGCTATTGGTGGCCCTG GACTATAGCCAGATAGAGCTCAGGGTGCTGGCCCACCTCTCCGGCGACGAGAAC CTGATCCGGGTCTTCCAGGAGGGGCGGGACATCCACACGGAGACCGCCAGCTGG ATGTTCGGCGTCCCCCGGGAGGCCGTGGACCCCCTGATGCGCCGGGCGGCCAAG ACC ATC AACTTCGGGGTCCTCTACGGC ATGTCGGCCCACCGCCTCTCCC AGGAGC TAGCCATCCCTTACGAGGAGGCCCAGGCCTTCATTGAGCGCTACTTTCAGAGCTT CCCCAAGGTGCGGGCCTGGATTGAGAAGACCCTGGAGGAGGGCAGGAGGCGGG GGTACGTGGAGACCCTCTTCGGCCGCCGCCGCTACGTGCCAGACCTAGAGGCCC GGGTGAAGAGCGTGCGGGAGGCGGCCGAGCGCATGGCCTTCAACATGCCCGTCC AGGGCACCGCCGCCGACCTCATGAAGCTGGCTATGGTGAAGCTCTTCCCCAGGCT GGAGGAAATGGGGGCCAGGATGCTCCTTCAGGTCCACGACGAGCTGGTCCTCGA GGCCCCAAAAGAGAGGGCGGAGGCCGTGGCCCGGCTGGCCAAGGAGGTCATGG AGGGGGTGTATCCCCTGGCCGTGCCCCTGGAGGTGGAGGTGGGGATAGGGGAGG ACTGGCTCTCCGCCAAGGAGGGCATTGATGGCCGCGGCGGAGGCGGGCATCATC ATCATCATCATTAA
SEQ H) NO:12 The amino acid sequence of PL-ΔTaq fusion protein
MITNSKKKKKKKRKKRKKKKKGGGVTSGATVKPKYKGEEKEVDISKIKKVWRVGK MISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKKGGGVTSPKALEEAPWPPPEG AFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLAKDLSVL ALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFAN LWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLE AEVFRLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIV EKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTP LGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMF
GVPREAVDPLMRRAAKTΓNFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSFPKVR AWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAAD LMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPL AVPLEVEVGIGEDWLSAKEGIDGRGGGGHHHHHH
SEQ ID NO:13 PRIMER L71F
5 '-CCTGCTCTGCCGCTTCACGC-3 '
SEQ ID NO-.14 PRIMER L71R
5 '-GCACAGCGGCTGGCTGAGGA-3 '
SEQ ID NO:15 PRIMER L18015F 5'-TGACGGAGGATAACGCCAGCAG-3'
SEQ H) NO:16 PRIMER L23474R
5'-GAAAGACGA TGGGTCGCTAATACGC-3'
SEQ ID NO:17 PRIMER L18015F
5'-TGACGGAGGATAAC GCCAGCAG-3'
SEQ ID NO:18 PRIMER L29930R
5 '-GGGGTTGGAGGTCAATGGGTTC-3 '
SEQ ID NO:19 PRIMER L30350F 5 '-CCTGCTCTGCCGCTTCACGC-3 '
SEQ D3 NO:20 PRIMER L35121R 5'-CACATGGTACAGCAAGCCTGGC-3'
SEQ ID NO:21 PRIMER L2089F
5'-CCCGTATCTGCTGGGA TACTGGC-3 SEQ ID NO: 22 PRIMER L7112R
5 '-CAGCGGTGCTGACTGAATCATGG-3
SEQ ID NO:23 PRIMER L30350F 5'-CCTGCCTGCCGCTTCACGC-3'
SEQ ID NO.-24 PRIMER L40547R
5'-CCAATACCCGTTTCA TCGCGGC-3'
SEQ ID NO:25 PRIMER H-Amelo-Y
5'-CCACCTCATCCTGG GCACC-3'
SEQ ID NO:26 PRIMER H-Amelo-YR
5'-GCTTGAGGCCAACCATCAGAGC-3'
SEQ ID NO:27 Human beta-globin primer 536F 5 '-GGTTGGCCAATCTACTCCCAGG-3 '
SEQ H) NO:28 Human beta-globin primer 536R 5'-GCTCACTCAGTGTGGCAAAG-3'
SEQ JD NO:29 Human beta-globin primer 1408R
5 '-GATTAGCAAAAGGGCCTAGCTTGG-3 '

Claims

WHAT IS CLAIMED IS:
1. A protein consisting of at least two heterologous domains wherein a first domain that is a sequence-non-specific double-stranded nucleic-acid-binding domain is joined to a second domain that is a catalytic nucleic-acid-modifying domain having a processive nature, where the presence of the sequence-non-specific double-stranded nucleic- acid-binding domain enhances the processive nature of the nucleic-acid-modifying domain compared to an identical protein not having a sequence-non-specific nucleic-acid-binding domain joined thereto.
2. A protein of claim 1 wherein the nucleic-acid-modifying domain has polymerase activity.
3. A protein of claim 1 wherein the nucleic-acid-modifying domain has thermally stable polymerase activity.
4. A protein of claim 1 wherein the nucleic-acid-modifying domain comprises a Thermus polymerase domain.
5. A protein of claim 1 wherein the nucleic-acid modifying domain comprises a Pyrococcus polymerase domain.
6. A protein of claim 1 wherein the nucleic-acid-modifying domain has RNA polymerase, reverse transcriptase, methylase, 3' or 5' exonuclease, gyrase, or topoisomerase activity.
7. A protein of claim 1 wherein the sequence-non-specific nucleic-acid- binding domain specifically binds to polyclonal antibodies generated against either Sac7d or Sso7d.
8. A protein of claim 1 wherein the sequence-non-specific nucleic-acid- binding domain contains a 50 amino acid subsequence containing 50% amino acid similarity to Sso7d.
9. A protein of claim 1 wherein the sequence-non-specific nucleic-acid- binding domain specifically binds to polyclonal antibodies generated against Sso7d.
10. A protein of claim 1 wherein the sequence-non-specific nucleic-acid- binding domain is Sso7d.
11. A protein of claim 10 wherein the the nucleic-acid modifying domain comprises a Pyrococcus polymerase domain
12. A protein of claim 1 wherein the sequence-non-specific nucleic-acid- binding domain specifically binds to polyclonal antibodies generated against the PCNA homolog of Pyrococcus furiosus.
13. A protein of claim 1 wherein the sequence-non-specific nucleic-acid- binding domain is the PCNA homolog of Pyrococcus furiosus.
14. A protein consisting of at least two heterologous domains, wherein a first domain that is a sequence-non-specific double-stranded nucleic-acid-binding domain is joined to a second domain that is a catalytic nucleic-acid-modifying domain, where the presence of the sequence-non-specific nucleic-acid-binding domain stabilizes the double- stranded conformation of a nucleic acid by at least 1°C compared to an identical protein not having a sequence-non-specific nucleic acid-binding domain joined thereto.
15. A protein of claim 14 wherein the nucleic-acid-modifying domain has polymerase activity.
16. A protein of claim 14 wherein the nucleic-acid-modifying domain has thermally stable polymerase activity.
17. A protein of claim 14 wherein the nucleic-acid-modifying domain has an RNA polymerase, a reverse transcriptase, a methylase, a 3' or 5' exonuclease, a gyrase, or a topoisomerase activity.
18. A protein of claim 14 wherein the sequence-non-specific nucleic-acid- binding domain specifically binds to polyclonal antibodies generated against either Sac7d or Sso7d.
19. A protein of claim 14 wherein the sequence-non-specific nucleic-acid- binding domain contains a 50 amino acid subsequence containing 50% amino acid similarity to Sso7d.
20. A protein of claim 14 wherein the sequence-non-specific nucleic-acid- binding domain specifically binds to polyclonal antibodies generated against Sso7d.
21. A protein of claim 14 wherein the sequence-non-specific nucleic-acid- binding domain is Sso7d.
22. A protein of claim 14 wherein the sequence-non-specific nucleic-acid- binding domain specifically binds to polyclonal antibodies generated against the PCNA homolog of Pyrococcus furiosus.
23. A protein of claim 14 wherein the sequence-non-specific nucleic-acid- binding domain is the PCNA homolog of Pyrococcus furiosus.
24. A method of modifying a nucleic acid in an aqueous solution by: (i) contacting the nucleic acid with a protein comprising at least two heterologous domains, wherein a first domain that is a sequence-non-specific nucleic-acid- binding domain is joined to a second domain that is a catalytic nucleic-acid-modifying domain having a processive nature, where the sequence non-specific nucleic-acid-binding domain: a. binds to double-stranded nucleic acid, and b. enhances the processivity of the enzyme compared to an identical enzyme not having the sequence non-specific nucleic-acid-binding domain fused to it, and wherein the solution is at a temperature and of a composition that permits the binding domain to bind to the nucleic acid and the enzyme to function in a catalytic manner, and
(ii) permitting the catalytic domain to modify the nucleic acid in the solution.
25. A method of claim 24 wherein the nucleic-acid-modifying domain has polymerase activity.
26. A method of claim 24 wherein the nucleic-acid-modifying domain has thermally stable polymerase activity.
27. A method of claim 26 wherein the nucleic-acid-modifying domain comprises a Thermus polymerase domain.
28. A method of claim 26 wherein the nucleic-acid-modifying domain comprises a Pyrococcus polymerase domain.
29. A method of claim 24 wherein the nucleic-acid-modifying enzyme has an RNA polymerase, a reverse transcriptase, a methylase, an exonuclease, a gyrase, a topoisomerase, or other processive enzyme activity that interacts with nucleic acid.
30. A method of claim 24 wherein the sequence-non-specific nucleic-acid- binding domain specifically binds to polyclonal antibodies generated against either Sac7d or Sso7d.
31. A method of claim 24 wherein the sequence-non-specific nucleic-acid- binding domain contains a 50 amino acid subsequence containing 50% amino acid similarity to Sso7D.
32. A method of claim 24 wherein the sequence-non-specific nucleic-acid- binding domain specifically binds to polyclonal antibodies generated against Sso7d.
33. A method of claim 24 wherein the sequence-non-specific nucleic-acid- binding domain is Sso7d.
34. A method of modifying a nucleic acid by:
(i) contacting the nucleic acid with an aqueous solution containing a protein having at least two heterologous domains, wherein a first domain that is a sequence-nonspecific double-stranded nucleic acid-binding domain is joined to a second domain that is a catalytic nucleic-acid-modifying domain, where the presence of the sequence-non-specific nucleic-acid-binding domain s stabilizes the double-stranded conformation of a nucleic acid by at least 1 °C compared to an otherwise identical protein not having the sequence-nonspecific nucleic-acid-binding domain joined to it; and, wherein the solution is at a temperature and of a composition that permits the binding domain to bind to the nucleic acid and the enzyme to function in a catalytic manner; and,
(ii) permitting the catalytic domain to modify the nucleic acid in the solution.
35. A method of claim 34 wherein the nucleic-acid-modifying domain has polymerase activity.
36. A method of claim 34 wherein the nucleic-acid-modifying domain has thermally stable polymerase activity.
37. A method of claim 36 wherein the nucleic-acid-modifying domain comprises a Thermus polymerase domain.
38. A method of claim 34 wherein the nucleic-acid-modifying enzyme has an RNA polymerase, a reverse transcriptase, a methylase, a exonuclease, a gyrase, or a topoisomerase activity.
39. A method of claim 34 wherein the sequence-non-specific nucleic-acid- binding domain specifically binds to polyclonal antibodies generated against either Sac7d or Sso7d.
40. A method of claim 34 wherein the sequence-non-specific nucleic-acid- binding domain contains a 50 amino acid subsequence containing 50% amino acid similarity to Sso7D.
41. A method of claim 34 wherein the sequence-non-specific nucleic-acid- binding domain contains a 50 amino acid subsequence containing 75% amino acid similarity to Sso7D.
42. A method of claim 34 wherein the sequence-non-specific nucleic-acid- binding domain specifically binds to polyclonal antibodies generated against Sso7d.
43. A method of claim 34 wherein the sequence-non-specific nucleic-acid- binding domain is Sso7d.
44. A method of amplifying a subsequence of a target nucleic acid using a polymerase chain reaction, the method comprising:
(i) contacting the target nucleic acid in an aqueous solution with a protein of claim 1 or claim 14, wherein the aqueous solution is of a composition that permits the binding domain to bind to the target nucleic acid and the polymerase domain to extend a primer that is hybridized to the target nucleic acid sequence;
(ii) incubating the solution using a polymerase chain reaction temperature profile that amplifies the subsequence.
EP01941707A 2000-05-26 2001-05-29 Improved nucleic acid modifying enzymes Expired - Lifetime EP1283875B1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
EP07009588.0A EP1832652B1 (en) 2000-05-26 2001-05-29 Improved nucleic acid modifying enzymes

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
US20756700P 2000-05-26 2000-05-26
US207567P 2000-05-26
US09/640,958 US6627424B1 (en) 2000-05-26 2000-08-16 Nucleic acid modifying enzymes
US640958 2000-08-16
PCT/US2001/017492 WO2001092501A1 (en) 2000-05-26 2001-05-29 Improved nucleic acid modifying enzymes

Related Child Applications (1)

Application Number Title Priority Date Filing Date
EP07009588.0A Division EP1832652B1 (en) 2000-05-26 2001-05-29 Improved nucleic acid modifying enzymes

Publications (3)

Publication Number Publication Date
EP1283875A1 true EP1283875A1 (en) 2003-02-19
EP1283875A4 EP1283875A4 (en) 2004-12-29
EP1283875B1 EP1283875B1 (en) 2007-07-25

Family

ID=26902363

Family Applications (1)

Application Number Title Priority Date Filing Date
EP01941707A Expired - Lifetime EP1283875B1 (en) 2000-05-26 2001-05-29 Improved nucleic acid modifying enzymes

Country Status (10)

Country Link
US (10) US6627424B1 (en)
EP (1) EP1283875B1 (en)
JP (2) JP4405725B2 (en)
AT (1) ATE368104T1 (en)
AU (2) AU7503901A (en)
CA (1) CA2409417C (en)
DE (1) DE60129549T2 (en)
DK (1) DK1283875T3 (en)
ES (1) ES2291322T3 (en)
WO (1) WO2001092501A1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013019960A1 (en) 2011-08-03 2013-02-07 Bio-Rad Laboratories, Inc. Filtering small nucleic acids using permeabilized cells

Families Citing this family (125)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8268605B2 (en) 1999-10-29 2012-09-18 Agilent Technologies, Inc. Compositions and methods utilizing DNA polymerases
US20040009486A1 (en) * 1999-10-29 2004-01-15 Sorge Joseph A. Compositions and methods utilizing DNA polymerases
US20050123940A1 (en) * 1999-10-29 2005-06-09 Stratagene California Compositions and methods for synthesizing cDNA
US20030228616A1 (en) * 1999-10-29 2003-12-11 Stratagene DNA polymerase mutants with reverse transcriptase activity
ATE491031T1 (en) * 2000-02-17 2010-12-15 Qiagen Gmbh THERMOSTABLE CHIMERIC NUCLEIC ACID POLYMERASES AND USES THEREOF
US6627424B1 (en) * 2000-05-26 2003-09-30 Mj Bioworks, Inc. Nucleic acid modifying enzymes
DE10049211A1 (en) * 2000-10-05 2002-04-18 Qiagen Gmbh Thermostable polymerase from Thermococcus pacificus
AU2002227156A1 (en) 2000-12-01 2002-06-11 Visigen Biotechnologies, Inc. Enzymatic nucleic acid synthesis: compositions and methods for altering monomer incorporation fidelity
EP1456394B2 (en) * 2001-11-28 2011-04-27 Bio-Rad Laboratories, Inc. Methods of using improved polymerases
DE60235491D1 (en) * 2001-11-28 2010-04-08 Bio Rad Laboratories PARALLEL SCORING OF POLYMORPHISMS WITH AMPLIFICATION AND ERROR CORRECTION
US20060234227A1 (en) * 2002-05-14 2006-10-19 Alexei Slesarev Helix-hairpin-helix motifs to manipulate properties of dna processing enzymes
ATE486931T1 (en) 2002-07-25 2010-11-15 Bio Rad Laboratories HYBRID POLYMERASE METHODS AND COMPOSITIONS
US7560260B2 (en) 2002-07-25 2009-07-14 Bio-Rad Laboratories, Inc. Compositions with polymerase activity
US7666645B2 (en) * 2002-10-23 2010-02-23 Bio-Rad Laboratories, Inc. Sso7-polymerase conjugate proteins
WO2004038007A2 (en) * 2002-10-25 2004-05-06 Stratagene Dna polymerases with reduced base analog detection activity
US8283148B2 (en) 2002-10-25 2012-10-09 Agilent Technologies, Inc. DNA polymerase compositions for quantitative PCR and methods thereof
US7960157B2 (en) * 2002-12-20 2011-06-14 Agilent Technologies, Inc. DNA polymerase blends and uses thereof
AU2004225520A1 (en) * 2003-03-25 2004-10-14 Stratagene DNA polymerase fusions and uses thereof
US7417133B2 (en) * 2004-02-27 2008-08-26 Institut Pasteur Methods for obtaining thermostable enzymes, DNA polymerase I variants from Thermus aquaticus having new catalytic activities, methods for obtaining the same, and applications of the same
JP2008507288A (en) * 2004-07-23 2008-03-13 アクセルロン ファーマ インコーポレーテッド ActRII receptor polypeptides, methods, and compositions
US20060105348A1 (en) * 2004-11-15 2006-05-18 Lee Jun E Compositions and methods for the detection and discrimination of nucleic acids
US20060228726A1 (en) * 2005-01-06 2006-10-12 Martin Patrick K Polypeptides having nucleic acid binding activity and compositions and methods for nucleic acid amplification
US8349600B2 (en) * 2005-01-06 2013-01-08 Applied Biosystems, Llc Polypeptides having nucleic acid binding activity
WO2007050125A2 (en) * 2005-05-27 2007-05-03 William Marsh Rice University High processivity polymerases
AU2006269282B2 (en) * 2005-07-07 2013-10-24 Quanta Biosciences, Inc. Compositions and methods for increasing amplification efficiency
CA2615151A1 (en) 2005-07-15 2007-01-25 Stratagene California Dna binding protein-polymerase chimeras
US20070059713A1 (en) * 2005-09-09 2007-03-15 Lee Jun E SSB-DNA polymerase fusion proteins
US8128933B2 (en) 2005-11-23 2012-03-06 Acceleron Pharma, Inc. Method of promoting bone growth by an anti-activin B antibody
ES2649983T3 (en) 2005-11-23 2018-01-16 Acceleron Pharma, Inc. Activin-ActRIIa antagonists in their use to promote bone growth
JP5106416B2 (en) * 2006-01-06 2012-12-26 アジレント・テクノロジーズ・インク Reaction buffer composition for nucleic acid replication comprising packed DNA polymerase
EP2057289B1 (en) 2006-08-09 2016-08-10 Univ Singapore METHOD FOR MOLECULAR BIOLOGY APPLICATIONS
US8895016B2 (en) * 2006-12-18 2014-11-25 Acceleron Pharma, Inc. Antagonists of activin-actriia and uses for increasing red blood cell levels
MX2009008222A (en) 2007-02-01 2009-10-12 Acceleron Pharma Inc Activin-actriia antagonists and uses for treating or preventing breast cancer.
TW201803890A (en) 2007-02-02 2018-02-01 艾瑟勒朗法瑪公司 Variants derived from ActRIIB and their uses
EA018221B1 (en) 2007-02-09 2013-06-28 Акселерон Фарма Инк. ACTIVIN-ActRIIa ANTAGONISTS AND USES FOR PROMOTING BONE GROWTH IN CANCER PATIENTS
CN101861161B (en) 2007-09-18 2017-04-19 阿塞勒隆制药公司 ACTIN-ACTRIIA ANTAGONISTS AND USE FOR REDUCING OR INHIBITING FSH SECRETION
CA2706444C (en) 2007-11-27 2017-06-06 Bio-Rad Laboratories, Inc. Reduced inhibition of one-step rt-pcr
WO2009087394A1 (en) * 2008-01-11 2009-07-16 Genesys Ltd Cren7 chimeric protein
GB0803628D0 (en) 2008-02-28 2008-04-02 Genesys Ltd Enzyme
GB0804721D0 (en) * 2008-03-14 2008-04-16 Genesys Ltd Enzyme
GB0804722D0 (en) * 2008-03-14 2008-04-16 Genesys Ltd Enzyme
TW201803586A (en) 2008-08-14 2018-02-01 艾瑟勒朗法瑪公司 Use GDF traps to increase red blood cell levels
US8216997B2 (en) 2008-08-14 2012-07-10 Acceleron Pharma, Inc. Methods for increasing red blood cell levels and treating anemia using a combination of GDF traps and erythropoietin receptor activators
JP5258512B2 (en) * 2008-10-30 2013-08-07 株式会社日立製作所 DNA polymerase mutant with enhanced exonuclease activity
WO2010062777A2 (en) 2008-11-03 2010-06-03 Kapabiosystems Modified type a dna polymerases
CA2742593C (en) 2008-11-03 2020-05-05 Kapa Biosystems, Inc. Chimeric dna polymerases
JP5818688B2 (en) * 2009-01-08 2015-11-18 バイオ−ラッド ラボラトリーズ インコーポレーティッド Methods and compositions for improving the efficiency of nucleic acid amplification reactions
US10113156B2 (en) * 2009-03-04 2018-10-30 Board Of Regents, The University Of Texas System Stabilized reverse transcriptase fusion proteins
US9778188B2 (en) 2009-03-11 2017-10-03 Industrial Technology Research Institute Apparatus and method for detection and discrimination molecular object
WO2010111674A2 (en) 2009-03-27 2010-09-30 Life Technologies Corporation Methods and apparatus for single molecule sequencing using energy transfer detection
US8535925B2 (en) 2009-04-10 2013-09-17 Bio-Rad Laboratories, Inc. Modified DNase compositions and methods of use thereof
KR20120049214A (en) 2009-06-08 2012-05-16 악셀레론 파마 인코포레이티드 Methods for increasing thermogenic adipocytes
KR20180026795A (en) 2009-06-12 2018-03-13 악셀레론 파마 인코포레이티드 TRUNCATED ActRIIB-FC FUSION PROTEINS
US8889394B2 (en) * 2009-09-07 2014-11-18 Empire Technology Development Llc Multiple domain proteins
EP3202459B1 (en) * 2009-09-09 2021-04-14 Acceleron Pharma Inc. Actriib antagonists and dosing and uses thereof for treating obesity or type 2 diabetes by regulating body fat content
SG179200A1 (en) * 2009-09-16 2012-04-27 Univ Massey Fusion polypeptides and uses thereof
EP3332796A1 (en) 2009-11-17 2018-06-13 Acceleron Pharma Inc. Actriib proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy
US9321999B2 (en) * 2009-11-19 2016-04-26 Solis Biodyne Oü Compositions for increasing polypeptide stability and activity, and related methods
EP2539471B1 (en) 2010-02-26 2014-08-06 Life Technologies Corporation Method for sequencing using a modified polymerase
US9482615B2 (en) 2010-03-15 2016-11-01 Industrial Technology Research Institute Single-molecule detection system and methods
US9670243B2 (en) 2010-06-02 2017-06-06 Industrial Technology Research Institute Compositions and methods for sequencing nucleic acids
US8865078B2 (en) 2010-06-11 2014-10-21 Industrial Technology Research Institute Apparatus for single-molecule detection
US20120070829A1 (en) 2010-09-10 2012-03-22 Bio-Rad Laboratories, Inc. Size selection of dna for chromatin analysis
US9617588B2 (en) 2010-10-05 2017-04-11 Thermo Fisher Scientific Baltics Uab Enzyme mixture
AU2011326586A1 (en) 2010-11-08 2013-05-30 Acceleron Pharma, Inc. ActRIIA binding agents and uses thereof
WO2012097318A2 (en) 2011-01-14 2012-07-19 Kap Abiosystems Modified dna polymerases for improved amplification
WO2012109315A1 (en) 2011-02-08 2012-08-16 Life Technologies Corporation Linking methods, compositions, systems, kits and apparatuses
WO2012112606A1 (en) 2011-02-15 2012-08-23 Bio-Rad Laboratories, Inc. Detecting methylati0n in a subpopulation of genomic dna
SG10201601853XA (en) 2011-03-11 2016-04-28 Univ Singapore Pericyte progenitors from peripheral blood
CN103703141B (en) 2011-04-08 2016-08-17 伯乐实验室公司 There is the PCR reactant mixture of the nonspecific activity of reduction
US8715987B2 (en) 2011-05-02 2014-05-06 New England Biolabs, Inc. Solubilized phospholipids for stabilizing nucleic acid polymerases
US8921044B2 (en) 2011-05-11 2014-12-30 New England Biolabs, Inc. DNA polymerase variants with reduced exonuclease activity and uses thereof
US8921043B2 (en) 2011-05-11 2014-12-30 New England Biolabs, Inc. DNA polymerase variants with reduced exonuclease activity and uses thereof
US8470573B2 (en) * 2011-06-21 2013-06-25 Bio-Rad Laboratories, Inc. Hybrid polymerases having the ability to produce long amplicons
US10195249B2 (en) 2012-11-02 2019-02-05 Celgene Corporation Activin-ActRII antagonists and uses for treating bone and other disorders
CN105452451B (en) 2013-12-06 2020-06-05 生物辐射实验室股份有限公司 fusion polymerase
CN114699529A (en) 2014-06-13 2022-07-05 阿塞勒隆制药公司 Methods and compositions for treating ulcers
US10131898B2 (en) 2014-07-22 2018-11-20 Bio-Rad Laboratories, Inc. Buffers for use with polymerases
WO2016028671A1 (en) * 2014-08-19 2016-02-25 Bio-Rad Laboratories, Inc. Rna amplification methods
MA41052A (en) 2014-10-09 2017-08-15 Celgene Corp TREATMENT OF CARDIOVASCULAR DISEASE USING ACTRII LIGAND TRAPS
US10329545B2 (en) 2014-11-14 2019-06-25 Illumina, Inc. Polymerases
US10053676B2 (en) 2014-11-25 2018-08-21 Bio-Rad Laboratories, Inc. Arginine improves polymerase storage stability
JP2018501307A (en) 2014-12-03 2018-01-18 セルジーン コーポレイション Activin-ActRII antagonist and use for treating anemia
WO2016124543A1 (en) 2015-02-02 2016-08-11 F. Hoffmann-La Roche Ag Polymerase variants
WO2016134059A1 (en) 2015-02-17 2016-08-25 Bio-Rad Laboratories, Inc. Small nucleic acid quantification using split cycle amplification
WO2017050723A1 (en) 2015-09-22 2017-03-30 Genia Technologies, Inc. Pol7 polymerase variants
JP7067737B2 (en) * 2015-11-27 2022-05-16 国立大学法人九州大学 DNA polymerase mutant
CN116144626A (en) 2016-01-13 2023-05-23 新英格兰生物实验室公司 Thermostable variants of T7 RNA polymerase
WO2017121836A1 (en) 2016-01-15 2017-07-20 Thermo Fisher Scientific Baltics Uab Thermophilic dna polymerase mutants
WO2017121843A1 (en) 2016-01-15 2017-07-20 Thermo Fisher Scientific Baltics Uab Antibodies that bind thermophilic dna polymerases
CN108699539B (en) 2016-02-29 2022-11-18 吉尼亚科技公司 Exonuclease deficient polymerases
ES2880331T3 (en) 2016-02-29 2021-11-24 Genia Tech Inc Polymerase variants
US20170268052A1 (en) 2016-02-29 2017-09-21 Genia Technologies, Inc. Polymerase-template complexes
JP6720632B2 (en) * 2016-03-29 2020-07-08 東洋紡株式会社 Fusion protein
JP7157048B2 (en) 2016-09-22 2022-10-19 エフ.ホフマン-ラ ロシュ アーゲー POL6 polymerase variant
EP3645710A1 (en) * 2017-06-26 2020-05-06 Thermo Fisher Scientific Baltics Uab Thermophilic dna polymerase mutants
US20200392562A1 (en) 2017-12-22 2020-12-17 Thermo Fisher Scientific Baltics Uab Polymerase chain reaction composition comprising amines
US20230011240A1 (en) 2018-09-11 2023-01-12 Singular Genomics Systems, Inc. Modified archaeal family b polymerases
CN109266628B (en) * 2018-10-09 2020-04-14 南京市胸科医院 Fused TaqDNA polymerase and application thereof
US10934533B1 (en) 2018-10-10 2021-03-02 New England Biolabs, Inc. Variant DNA polymerases having improved properties and method for improved isothermal amplification of a target DNA
CN109679932B (en) * 2018-12-05 2020-03-17 广州奇辉生物科技有限公司 DNA polymerase, recombinant vector, and preparation method and application thereof
CN112175091A (en) * 2019-07-05 2021-01-05 赛纳生物科技(北京)有限公司 Method for improving activity of polymerase large fragment by functional domain grafting and application
US12163164B2 (en) 2019-07-15 2024-12-10 Bio-Rad Laboratories, Inc. Hybrid reverse transcriptases
US11512295B2 (en) 2019-09-12 2022-11-29 Singular Genomics Systems, Inc. Modified thermoccocus polymerases
US12173335B2 (en) * 2020-01-06 2024-12-24 Pairwise Plants Services, Inc. Recruitment of DNA polymerase for templated editing
WO2021163561A1 (en) 2020-02-13 2021-08-19 New England Biolabs, Inc. Variant family d dna polymerases
WO2021163559A1 (en) 2020-02-13 2021-08-19 New England Biolabs, Inc. Variant family d dna polymerases
US20230086471A1 (en) * 2020-02-15 2023-03-23 Agency For Science, Technology And Research A method to amplify a nucleic acid
US11034942B1 (en) 2020-02-27 2021-06-15 Singular Genomics Systems, Inc. Modified pyrococcus polymerases and uses thereof
CN116209756A (en) 2020-03-04 2023-06-02 旗舰先锋创新Vi有限责任公司 Methods and compositions for modulating genome
CN111518873B (en) * 2020-05-11 2024-07-09 上海羿鸣生物科技有限公司 Optimized method for amplifying target nucleic acid and application
PL241698B1 (en) * 2021-01-27 2022-11-21 Inst Biotechnologii I Medycyny Molekularnej Pwo-NeqSSB polymerase, method of its preparation, recombinant plasmid, primers and use of polymerase
EP4251770A4 (en) 2021-02-08 2024-05-29 Singular Genomics Systems, Inc. Methods and compositions for sequencing complementary polynucleotides
WO2022250676A1 (en) 2021-05-27 2022-12-01 New England Biolabs, Inc. Dnase i variants, compositions, methods, and kits
US11667968B2 (en) 2021-05-27 2023-06-06 New England Biolabs, Inc. Fragmentation of DNA
US11993792B2 (en) 2021-05-27 2024-05-28 New England Biolabs, Inc. DNase I variants, compositions, methods, and kits
WO2022249133A1 (en) 2021-05-28 2022-12-01 Erebus Enzymes Inc. Ultra-processive, stutter-resistant polymerase system
AU2022343268A1 (en) 2021-09-08 2024-03-28 Flagship Pioneering Innovations Vi, Llc Methods and compositions for modulating a genome
EP4437090A1 (en) 2021-11-22 2024-10-02 F. Hoffmann-La Roche AG Thermostable polymerase variants
US20250145989A1 (en) 2022-01-26 2025-05-08 Seegene, Inc. Method for detecting target nucleic acids in sample
US20250305027A1 (en) 2022-05-13 2025-10-02 Seegene, Inc. Method for preparing reaction mixtures for amplifying nucleic acids present in samples using a sample handling system
EP4658673A1 (en) 2023-02-01 2025-12-10 New England Biolabs, Inc. Duplex-specific dnases
CN121241132A (en) * 2023-06-02 2025-12-30 武汉华大智造科技有限公司 DNA polymerase mutants used for sequencing
WO2025137293A2 (en) 2023-12-22 2025-06-26 Roche Sequencing Solutions, Inc. Enhancement of nucleic acid polymerization by aromatic compounds
WO2025227034A1 (en) 2024-04-26 2025-10-30 New England Biolabs, Inc. Salt active nuclease compositions and methods

Family Cites Families (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPH05503011A (en) * 1989-12-01 1993-05-27 ザ ボード オブ トラスティーズ オブ リーランド スタンフォード ジュニア ユニバーシティ Promotion of highly specific molecular assemblies
US5747911A (en) 1994-09-30 1998-05-05 Itt Automotive Electrical Systems, Inc. Brush holder
US5972603A (en) * 1996-02-09 1999-10-26 President And Fellows Of Harvard College DNA polymerase with modified processivity
US6228628B1 (en) 1997-07-09 2001-05-08 Roche Molecular Systems Mutant chimeric DNA polymerase
DE19810879A1 (en) * 1998-03-13 1999-09-16 Roche Diagnostics Gmbh New chimeric polymerase with 5'-3'-polymerase activity, and optionally proofreading activity, used for polymerase chain reactions and sequencing
DE19840771A1 (en) * 1998-08-06 2000-02-10 Lion Bioscience Ag A thermostable in vitro polymerase complex for template-dependent elongation of nucleic acids in amplification or reverse transcription methods
CA2338185A1 (en) * 1998-08-06 2000-02-17 Lion Bioscience Ag Thermostable in vitro complex with polymerase activity
ATE491031T1 (en) 2000-02-17 2010-12-15 Qiagen Gmbh THERMOSTABLE CHIMERIC NUCLEIC ACID POLYMERASES AND USES THEREOF
US6627424B1 (en) * 2000-05-26 2003-09-30 Mj Bioworks, Inc. Nucleic acid modifying enzymes

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013019960A1 (en) 2011-08-03 2013-02-07 Bio-Rad Laboratories, Inc. Filtering small nucleic acids using permeabilized cells

Also Published As

Publication number Publication date
EP1283875A4 (en) 2004-12-29
JP4405725B2 (en) 2010-01-27
US8895283B2 (en) 2014-11-25
US7670808B2 (en) 2010-03-02
DK1283875T3 (en) 2007-11-26
US9453208B2 (en) 2016-09-27
DE60129549D1 (en) 2007-09-06
US7919296B2 (en) 2011-04-05
AU7503901A (en) 2001-12-11
US20130203119A1 (en) 2013-08-08
US6627424B1 (en) 2003-09-30
ATE368104T1 (en) 2007-08-15
WO2001092501A1 (en) 2001-12-06
JP2003534796A (en) 2003-11-25
US10954495B2 (en) 2021-03-23
US20110165654A1 (en) 2011-07-07
US7541170B2 (en) 2009-06-02
US20190078066A1 (en) 2019-03-14
US20170198267A1 (en) 2017-07-13
US20150218536A1 (en) 2015-08-06
CA2409417C (en) 2014-12-09
US20140038237A1 (en) 2014-02-06
US20030162173A1 (en) 2003-08-28
US8415129B2 (en) 2013-04-09
JP2010000089A (en) 2010-01-07
CA2409417A1 (en) 2001-12-06
AU2001275039B2 (en) 2006-07-13
US20040191825A1 (en) 2004-09-30
EP1283875B1 (en) 2007-07-25
US20030148330A1 (en) 2003-08-07
DE60129549T2 (en) 2008-04-24
US8900846B2 (en) 2014-12-02
US10066218B2 (en) 2018-09-04
ES2291322T3 (en) 2008-03-01

Similar Documents

Publication Publication Date Title
US10954495B2 (en) Nucleic acid modifying enzymes
AU2001275039A1 (en) Improved nucleic acid modifying enzymes
AU2003284265B2 (en) Improved Sso7-polymerase conjugate proteins
EP2723880B1 (en) Hybrid polymerases having the ability to produce long amplicons
US20040219558A1 (en) Novel compositions with polymerase activity
EP1832652B1 (en) Improved nucleic acid modifying enzymes
AU2006228065A1 (en) Improved nucleic acid modifying enzymes

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20021202

AK Designated contracting states

Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE TR

AX Request for extension of the european patent

Extension state: AL LT LV MK RO SI

A4 Supplementary search report drawn up and despatched

Effective date: 20041112

17Q First examination report despatched

Effective date: 20050225

RAP1 Party data changed (applicant data changed or rights of an application transferred)

Owner name: BIO-RAD LABORATORIES, INC.

GRAP Despatch of communication of intention to grant a patent

Free format text: ORIGINAL CODE: EPIDOSNIGR1

GRAS Grant fee paid

Free format text: ORIGINAL CODE: EPIDOSNIGR3

GRAA (expected) grant

Free format text: ORIGINAL CODE: 0009210

AK Designated contracting states

Kind code of ref document: B1

Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE TR

AX Request for extension of the european patent

Extension state: AL LT LV MK RO SI

REG Reference to a national code

Ref country code: GB

Ref legal event code: FG4D

REG Reference to a national code

Ref country code: CH

Ref legal event code: EP

REG Reference to a national code

Ref country code: IE

Ref legal event code: FG4D

REF Corresponds to:

Ref document number: 60129549

Country of ref document: DE

Date of ref document: 20070906

Kind code of ref document: P

REG Reference to a national code

Ref country code: SE

Ref legal event code: TRGR

REG Reference to a national code

Ref country code: DK

Ref legal event code: T3

LTIE Lt: invalidation of european patent or patent extension

Effective date: 20070725

ET Fr: translation filed
PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: PT

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20071226

REG Reference to a national code

Ref country code: ES

Ref legal event code: FG2A

Ref document number: 2291322

Country of ref document: ES

Kind code of ref document: T3

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: GR

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20071026

PLBE No opposition filed within time limit

Free format text: ORIGINAL CODE: 0009261

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: NO OPPOSITION FILED WITHIN TIME LIMIT

26N No opposition filed

Effective date: 20080428

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: MC

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20080531

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: CY

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20070725

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: LU

Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES

Effective date: 20080529

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: TR

Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT

Effective date: 20070725

REG Reference to a national code

Ref country code: FR

Ref legal event code: PLFP

Year of fee payment: 16

REG Reference to a national code

Ref country code: FR

Ref legal event code: PLFP

Year of fee payment: 17

REG Reference to a national code

Ref country code: FR

Ref legal event code: PLFP

Year of fee payment: 18

PGFP Annual fee paid to national office [announced via postgrant information from national office to epo]

Ref country code: ES

Payment date: 20200609

Year of fee payment: 20

Ref country code: DK

Payment date: 20200526

Year of fee payment: 20

Ref country code: FI

Payment date: 20200520

Year of fee payment: 20

Ref country code: NL

Payment date: 20200526

Year of fee payment: 20

Ref country code: CH

Payment date: 20200527

Year of fee payment: 20

Ref country code: FR

Payment date: 20200527

Year of fee payment: 20

Ref country code: IE

Payment date: 20200520

Year of fee payment: 20

PGFP Annual fee paid to national office [announced via postgrant information from national office to epo]

Ref country code: GB

Payment date: 20200528

Year of fee payment: 20

Ref country code: SE

Payment date: 20200526

Year of fee payment: 20

Ref country code: IT

Payment date: 20200522

Year of fee payment: 20

Ref country code: BE

Payment date: 20200527

Year of fee payment: 20

PGFP Annual fee paid to national office [announced via postgrant information from national office to epo]

Ref country code: AT

Payment date: 20200522

Year of fee payment: 20

PGFP Annual fee paid to national office [announced via postgrant information from national office to epo]

Ref country code: DE

Payment date: 20200728

Year of fee payment: 20

REG Reference to a national code

Ref country code: DE

Ref legal event code: R071

Ref document number: 60129549

Country of ref document: DE

REG Reference to a national code

Ref country code: DK

Ref legal event code: EUP

Expiry date: 20210529

Ref country code: CH

Ref legal event code: PL

REG Reference to a national code

Ref country code: NL

Ref legal event code: MK

Effective date: 20210528

REG Reference to a national code

Ref country code: FI

Ref legal event code: MAE

REG Reference to a national code

Ref country code: GB

Ref legal event code: PE20

Expiry date: 20210528

Ref country code: IE

Ref legal event code: MK9A

REG Reference to a national code

Ref country code: BE

Ref legal event code: MK

Effective date: 20210529

REG Reference to a national code

Ref country code: SE

Ref legal event code: EUG

REG Reference to a national code

Ref country code: AT

Ref legal event code: MK07

Ref document number: 368104

Country of ref document: AT

Kind code of ref document: T

Effective date: 20210529

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: GB

Free format text: LAPSE BECAUSE OF EXPIRATION OF PROTECTION

Effective date: 20210528

Ref country code: IE

Free format text: LAPSE BECAUSE OF EXPIRATION OF PROTECTION

Effective date: 20210529

REG Reference to a national code

Ref country code: ES

Ref legal event code: FD2A

Effective date: 20210903

PG25 Lapsed in a contracting state [announced via postgrant information from national office to epo]

Ref country code: ES

Free format text: LAPSE BECAUSE OF EXPIRATION OF PROTECTION

Effective date: 20210530