EP1281755A2 - Variants of the human cyp2d6 gene - Google Patents
Variants of the human cyp2d6 gene Download PDFInfo
- Publication number
- EP1281755A2 EP1281755A2 EP02254972A EP02254972A EP1281755A2 EP 1281755 A2 EP1281755 A2 EP 1281755A2 EP 02254972 A EP02254972 A EP 02254972A EP 02254972 A EP02254972 A EP 02254972A EP 1281755 A2 EP1281755 A2 EP 1281755A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- cyp2d6
- seq
- sequence
- gene
- nucleic acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 101100329196 Homo sapiens CYP2D6 gene Proteins 0.000 title description 11
- 108010001237 Cytochrome P-450 CYP2D6 Proteins 0.000 claims abstract description 382
- 102100021704 Cytochrome P450 2D6 Human genes 0.000 claims abstract description 355
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 200
- 238000000034 method Methods 0.000 claims abstract description 162
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 148
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 130
- 229920001184 polypeptide Polymers 0.000 claims abstract description 118
- 239000003814 drug Substances 0.000 claims abstract description 70
- 229940079593 drug Drugs 0.000 claims abstract description 69
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 61
- 150000007523 nucleic acids Chemical class 0.000 claims description 151
- 102000039446 nucleic acids Human genes 0.000 claims description 129
- 108020004707 nucleic acids Proteins 0.000 claims description 129
- 239000000523 sample Substances 0.000 claims description 105
- 108700028369 Alleles Proteins 0.000 claims description 99
- 125000003729 nucleotide group Chemical group 0.000 claims description 98
- 239000002773 nucleotide Substances 0.000 claims description 95
- 108020004414 DNA Proteins 0.000 claims description 79
- 101150010738 CYP2D6 gene Proteins 0.000 claims description 77
- 102000053602 DNA Human genes 0.000 claims description 74
- 238000001514 detection method Methods 0.000 claims description 51
- 108091034117 Oligonucleotide Proteins 0.000 claims description 50
- 230000000295 complement effect Effects 0.000 claims description 50
- 230000002068 genetic effect Effects 0.000 claims description 35
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 34
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 33
- 150000001413 amino acids Chemical class 0.000 claims description 21
- 230000007812 deficiency Effects 0.000 claims description 18
- 238000002560 therapeutic procedure Methods 0.000 claims description 9
- 230000001413 cellular effect Effects 0.000 claims description 6
- 210000004899 c-terminal region Anatomy 0.000 claims description 3
- 239000003298 DNA probe Substances 0.000 claims description 2
- 108020004682 Single-Stranded DNA Proteins 0.000 claims description 2
- 239000013598 vector Substances 0.000 abstract description 24
- 230000035945 sensitivity Effects 0.000 abstract description 15
- 239000000556 agonist Substances 0.000 abstract description 13
- 239000005557 antagonist Substances 0.000 abstract description 11
- 238000011282 treatment Methods 0.000 abstract description 11
- 102000054767 gene variant Human genes 0.000 abstract 1
- 101150053185 P450 gene Proteins 0.000 description 86
- 230000035772 mutation Effects 0.000 description 76
- 239000013615 primer Substances 0.000 description 66
- 210000004027 cell Anatomy 0.000 description 63
- 230000014509 gene expression Effects 0.000 description 60
- 230000000694 effects Effects 0.000 description 58
- 235000018102 proteins Nutrition 0.000 description 58
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 50
- 239000012634 fragment Substances 0.000 description 47
- 238000003199 nucleic acid amplification method Methods 0.000 description 45
- 238000003752 polymerase chain reaction Methods 0.000 description 45
- 230000003321 amplification Effects 0.000 description 44
- 239000002299 complementary DNA Substances 0.000 description 42
- 239000000047 product Substances 0.000 description 38
- 102000004190 Enzymes Human genes 0.000 description 36
- 108090000790 Enzymes Proteins 0.000 description 36
- 201000010099 disease Diseases 0.000 description 36
- 229940088598 enzyme Drugs 0.000 description 36
- 241001465754 Metazoa Species 0.000 description 35
- 238000009396 hybridization Methods 0.000 description 31
- 238000002493 microarray Methods 0.000 description 27
- 230000027455 binding Effects 0.000 description 25
- 229920002477 rna polymer Polymers 0.000 description 24
- 230000001594 aberrant effect Effects 0.000 description 23
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 22
- 108020004999 messenger RNA Proteins 0.000 description 22
- 235000001014 amino acid Nutrition 0.000 description 21
- 230000000875 corresponding effect Effects 0.000 description 21
- 229940024606 amino acid Drugs 0.000 description 20
- 230000009261 transgenic effect Effects 0.000 description 20
- 210000001519 tissue Anatomy 0.000 description 19
- 238000004458 analytical method Methods 0.000 description 18
- 238000003556 assay Methods 0.000 description 16
- -1 for example Substances 0.000 description 16
- 108020001507 fusion proteins Proteins 0.000 description 16
- 102000037865 fusion proteins Human genes 0.000 description 16
- 239000000758 substrate Substances 0.000 description 16
- 230000036267 drug metabolism Effects 0.000 description 15
- 230000006870 function Effects 0.000 description 15
- 230000004075 alteration Effects 0.000 description 14
- 230000004071 biological effect Effects 0.000 description 14
- 238000006243 chemical reaction Methods 0.000 description 14
- 208000035475 disorder Diseases 0.000 description 14
- 102000054765 polymorphisms of proteins Human genes 0.000 description 14
- 239000003795 chemical substances by application Substances 0.000 description 13
- 239000000203 mixture Substances 0.000 description 13
- 238000006467 substitution reaction Methods 0.000 description 13
- 241000124008 Mammalia Species 0.000 description 12
- 150000001875 compounds Chemical class 0.000 description 12
- 238000012217 deletion Methods 0.000 description 11
- 230000037430 deletion Effects 0.000 description 11
- 230000004060 metabolic process Effects 0.000 description 11
- 238000012216 screening Methods 0.000 description 11
- 238000012360 testing method Methods 0.000 description 11
- 108020004635 Complementary DNA Proteins 0.000 description 10
- 206010028980 Neoplasm Diseases 0.000 description 10
- 238000003491 array Methods 0.000 description 10
- 239000013604 expression vector Substances 0.000 description 10
- 102000040430 polynucleotide Human genes 0.000 description 10
- 108091033319 polynucleotide Proteins 0.000 description 10
- 239000002157 polynucleotide Substances 0.000 description 10
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 9
- 230000008859 change Effects 0.000 description 9
- 230000037433 frameshift Effects 0.000 description 9
- 238000012163 sequencing technique Methods 0.000 description 9
- 230000000890 antigenic effect Effects 0.000 description 8
- 239000012071 phase Substances 0.000 description 8
- 239000002987 primer (paints) Substances 0.000 description 8
- 239000000126 substance Substances 0.000 description 8
- 238000003786 synthesis reaction Methods 0.000 description 8
- 108010015742 Cytochrome P-450 Enzyme System Proteins 0.000 description 7
- 239000000427 antigen Substances 0.000 description 7
- 108091007433 antigens Proteins 0.000 description 7
- 102000036639 antigens Human genes 0.000 description 7
- 238000003776 cleavage reaction Methods 0.000 description 7
- 239000013068 control sample Substances 0.000 description 7
- 230000002950 deficient Effects 0.000 description 7
- 230000002255 enzymatic effect Effects 0.000 description 7
- 239000003550 marker Substances 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- 238000005259 measurement Methods 0.000 description 7
- 230000004044 response Effects 0.000 description 7
- 108091008146 restriction endonucleases Proteins 0.000 description 7
- 238000007894 restriction fragment length polymorphism technique Methods 0.000 description 7
- 208000024172 Cardiovascular disease Diseases 0.000 description 6
- 108091026890 Coding region Proteins 0.000 description 6
- 108700019146 Transgenes Proteins 0.000 description 6
- 230000000692 anti-sense effect Effects 0.000 description 6
- 210000004369 blood Anatomy 0.000 description 6
- 239000008280 blood Substances 0.000 description 6
- 239000003153 chemical reaction reagent Substances 0.000 description 6
- 230000007614 genetic variation Effects 0.000 description 6
- 238000003205 genotyping method Methods 0.000 description 6
- 230000002163 immunogen Effects 0.000 description 6
- 238000011065 in-situ storage Methods 0.000 description 6
- 150000003839 salts Chemical class 0.000 description 6
- 230000007017 scission Effects 0.000 description 6
- 206010071601 CYP2D6 polymorphism Diseases 0.000 description 5
- 102000002004 Cytochrome P-450 Enzyme System Human genes 0.000 description 5
- 108060002716 Exonuclease Proteins 0.000 description 5
- 108020004511 Recombinant DNA Proteins 0.000 description 5
- 238000004422 calculation algorithm Methods 0.000 description 5
- 230000003197 catalytic effect Effects 0.000 description 5
- 238000002742 combinatorial mutagenesis Methods 0.000 description 5
- 238000002405 diagnostic procedure Methods 0.000 description 5
- 102000013165 exonuclease Human genes 0.000 description 5
- 108091008053 gene clusters Proteins 0.000 description 5
- 230000004077 genetic alteration Effects 0.000 description 5
- 231100000118 genetic alteration Toxicity 0.000 description 5
- 210000004408 hybridoma Anatomy 0.000 description 5
- 238000003018 immunoassay Methods 0.000 description 5
- 238000003780 insertion Methods 0.000 description 5
- 230000037431 insertion Effects 0.000 description 5
- 238000002372 labelling Methods 0.000 description 5
- 239000012528 membrane Substances 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 238000000746 purification Methods 0.000 description 5
- 238000003757 reverse transcription PCR Methods 0.000 description 5
- 150000003384 small molecules Chemical class 0.000 description 5
- 239000007787 solid Substances 0.000 description 5
- 239000007790 solid phase Substances 0.000 description 5
- 208000024891 symptom Diseases 0.000 description 5
- 230000001225 therapeutic effect Effects 0.000 description 5
- 230000002103 transcriptional effect Effects 0.000 description 5
- 230000014616 translation Effects 0.000 description 5
- 108700024394 Exon Proteins 0.000 description 4
- 108091092195 Intron Proteins 0.000 description 4
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 4
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 4
- 101710163270 Nuclease Proteins 0.000 description 4
- 239000004677 Nylon Substances 0.000 description 4
- 108700026244 Open Reading Frames Proteins 0.000 description 4
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 4
- 108010029485 Protein Isoforms Proteins 0.000 description 4
- 102000001708 Protein Isoforms Human genes 0.000 description 4
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 4
- 238000002105 Southern blotting Methods 0.000 description 4
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 4
- 239000004473 Threonine Substances 0.000 description 4
- 230000002159 abnormal effect Effects 0.000 description 4
- 239000002253 acid Substances 0.000 description 4
- 238000007792 addition Methods 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 230000033228 biological regulation Effects 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 201000011510 cancer Diseases 0.000 description 4
- 231100000357 carcinogen Toxicity 0.000 description 4
- 238000003935 denaturing gradient gel electrophoresis Methods 0.000 description 4
- 239000007850 fluorescent dye Substances 0.000 description 4
- 102000054766 genetic haplotypes Human genes 0.000 description 4
- 239000011521 glass Substances 0.000 description 4
- 230000001900 immune effect Effects 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 210000004379 membrane Anatomy 0.000 description 4
- 229920001778 nylon Polymers 0.000 description 4
- 230000003647 oxidation Effects 0.000 description 4
- 238000007254 oxidation reaction Methods 0.000 description 4
- 239000000816 peptidomimetic Substances 0.000 description 4
- 239000013612 plasmid Substances 0.000 description 4
- 229920002401 polyacrylamide Polymers 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 230000010076 replication Effects 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 238000013519 translation Methods 0.000 description 4
- 238000005406 washing Methods 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- 238000001262 western blot Methods 0.000 description 4
- 239000002676 xenobiotic agent Substances 0.000 description 4
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 3
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 3
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Natural products NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 3
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 3
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 3
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- 108010004729 Phycoerythrin Proteins 0.000 description 3
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 3
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 3
- 238000012300 Sequence Analysis Methods 0.000 description 3
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 3
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 3
- 230000005856 abnormality Effects 0.000 description 3
- 150000007513 acids Chemical class 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 230000003042 antagnostic effect Effects 0.000 description 3
- 230000003466 anti-cipated effect Effects 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 229940009098 aspartate Drugs 0.000 description 3
- 230000000975 bioactive effect Effects 0.000 description 3
- 210000001124 body fluid Anatomy 0.000 description 3
- 239000003183 carcinogenic agent Substances 0.000 description 3
- 239000000969 carrier Substances 0.000 description 3
- 210000000349 chromosome Anatomy 0.000 description 3
- JWPGJSVJDAJRLW-UHFFFAOYSA-N debrisoquin Chemical compound C1=CC=C2CN(C(=N)N)CCC2=C1 JWPGJSVJDAJRLW-UHFFFAOYSA-N 0.000 description 3
- 229960004096 debrisoquine Drugs 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 238000013461 design Methods 0.000 description 3
- 230000029087 digestion Effects 0.000 description 3
- 238000001962 electrophoresis Methods 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 239000003256 environmental substance Substances 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 238000010353 genetic engineering Methods 0.000 description 3
- 229930195712 glutamate Natural products 0.000 description 3
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 238000002649 immunization Methods 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 230000000415 inactivating effect Effects 0.000 description 3
- 238000010348 incorporation Methods 0.000 description 3
- 230000003993 interaction Effects 0.000 description 3
- 238000002955 isolation Methods 0.000 description 3
- 229960000310 isoleucine Drugs 0.000 description 3
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 3
- 238000007834 ligase chain reaction Methods 0.000 description 3
- 150000002632 lipids Chemical class 0.000 description 3
- 229910052751 metal Inorganic materials 0.000 description 3
- 239000002184 metal Substances 0.000 description 3
- 238000002703 mutagenesis Methods 0.000 description 3
- 231100000350 mutagenesis Toxicity 0.000 description 3
- 101150091879 neo gene Proteins 0.000 description 3
- 230000036961 partial effect Effects 0.000 description 3
- 239000013610 patient sample Substances 0.000 description 3
- 230000002974 pharmacogenomic effect Effects 0.000 description 3
- 230000004481 post-translational protein modification Effects 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 208000020016 psychiatric disease Diseases 0.000 description 3
- 230000002285 radioactive effect Effects 0.000 description 3
- 238000003127 radioimmunoassay Methods 0.000 description 3
- 239000011541 reaction mixture Substances 0.000 description 3
- 108020003175 receptors Proteins 0.000 description 3
- 102000005962 receptors Human genes 0.000 description 3
- 230000006798 recombination Effects 0.000 description 3
- 238000005215 recombination Methods 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 230000002441 reversible effect Effects 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 238000007619 statistical method Methods 0.000 description 3
- 150000003431 steroids Chemical class 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 238000012546 transfer Methods 0.000 description 3
- 239000004474 valine Substances 0.000 description 3
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 2
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 2
- 241000269858 Anarhichas lupus Species 0.000 description 2
- 108020005544 Antisense RNA Proteins 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 241000271566 Aves Species 0.000 description 2
- 102100026189 Beta-galactosidase Human genes 0.000 description 2
- 206010006187 Breast cancer Diseases 0.000 description 2
- 208000026310 Breast neoplasm Diseases 0.000 description 2
- 108090000565 Capsid Proteins Proteins 0.000 description 2
- 108090000994 Catalytic RNA Proteins 0.000 description 2
- 102000053642 Catalytic RNA Human genes 0.000 description 2
- 102100023321 Ceruloplasmin Human genes 0.000 description 2
- 108091033380 Coding strand Proteins 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 229920000742 Cotton Polymers 0.000 description 2
- 102000018832 Cytochromes Human genes 0.000 description 2
- 108010052832 Cytochromes Proteins 0.000 description 2
- 239000003155 DNA primer Substances 0.000 description 2
- 238000009007 Diagnostic Kit Methods 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 108091060211 Expressed sequence tag Proteins 0.000 description 2
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 2
- 206010064571 Gene mutation Diseases 0.000 description 2
- 206010071602 Genetic polymorphism Diseases 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 108091027305 Heteroduplex Proteins 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- AVXURJPOCDRRFD-UHFFFAOYSA-N Hydroxylamine Chemical compound ON AVXURJPOCDRRFD-UHFFFAOYSA-N 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 208000026350 Inborn Genetic disease Diseases 0.000 description 2
- 108010044467 Isoenzymes Proteins 0.000 description 2
- 102000004195 Isomerases Human genes 0.000 description 2
- 108090000769 Isomerases Proteins 0.000 description 2
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 2
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 108010021466 Mutant Proteins Proteins 0.000 description 2
- 102000008300 Mutant Proteins Human genes 0.000 description 2
- QPCDCPDFJACHGM-UHFFFAOYSA-N N,N-bis{2-[bis(carboxymethyl)amino]ethyl}glycine Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(=O)O)CCN(CC(O)=O)CC(O)=O QPCDCPDFJACHGM-UHFFFAOYSA-N 0.000 description 2
- 239000000020 Nitrocellulose Substances 0.000 description 2
- 238000000636 Northern blotting Methods 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- 102000057297 Pepsin A Human genes 0.000 description 2
- 108090000284 Pepsin A Proteins 0.000 description 2
- 108091093037 Peptide nucleic acid Proteins 0.000 description 2
- 239000004743 Polypropylene Substances 0.000 description 2
- 239000004793 Polystyrene Substances 0.000 description 2
- 108010083644 Ribonucleases Proteins 0.000 description 2
- 102000006382 Ribonucleases Human genes 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 108010090804 Streptavidin Proteins 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 108010005774 beta-Galactosidase Proteins 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 244000309464 bull Species 0.000 description 2
- 239000003593 chromogenic compound Substances 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- OROGSEYTTFOCAN-DNJOTXNNSA-N codeine Chemical compound C([C@H]1[C@H](N(CC[C@@]112)C)C3)=C[C@H](O)[C@@H]1OC1=C2C3=CC=C1OC OROGSEYTTFOCAN-DNJOTXNNSA-N 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 230000002596 correlated effect Effects 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000002526 effect on cardiovascular system Effects 0.000 description 2
- 239000012636 effector Substances 0.000 description 2
- 230000008030 elimination Effects 0.000 description 2
- 238000003379 elimination reaction Methods 0.000 description 2
- 230000007613 environmental effect Effects 0.000 description 2
- 230000005284 excitation Effects 0.000 description 2
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 238000012224 gene deletion Methods 0.000 description 2
- 230000004545 gene duplication Effects 0.000 description 2
- 208000016361 genetic disease Diseases 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- LNEPOXFFQSENCJ-UHFFFAOYSA-N haloperidol Chemical compound C1CC(O)(C=2C=CC(Cl)=CC=2)CCN1CCCC(=O)C1=CC=C(F)C=C1 LNEPOXFFQSENCJ-UHFFFAOYSA-N 0.000 description 2
- 208000002672 hepatitis B Diseases 0.000 description 2
- 238000002744 homologous recombination Methods 0.000 description 2
- 230000006801 homologous recombination Effects 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 238000010166 immunofluorescence Methods 0.000 description 2
- 238000007901 in situ hybridization Methods 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 238000004020 luminiscence type Methods 0.000 description 2
- 229920002521 macromolecule Polymers 0.000 description 2
- 238000013507 mapping Methods 0.000 description 2
- 239000011159 matrix material Substances 0.000 description 2
- 230000035800 maturation Effects 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 238000002844 melting Methods 0.000 description 2
- 150000002739 metals Chemical class 0.000 description 2
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 238000000386 microscopy Methods 0.000 description 2
- 230000003278 mimic effect Effects 0.000 description 2
- 230000033607 mismatch repair Effects 0.000 description 2
- 108091005601 modified peptides Proteins 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 238000007857 nested PCR Methods 0.000 description 2
- 229920001220 nitrocellulos Polymers 0.000 description 2
- 238000002966 oligonucleotide array Methods 0.000 description 2
- 229910000489 osmium tetroxide Inorganic materials 0.000 description 2
- 239000012285 osmium tetroxide Substances 0.000 description 2
- 230000002018 overexpression Effects 0.000 description 2
- 229940094443 oxytocics prostaglandins Drugs 0.000 description 2
- 229940111202 pepsin Drugs 0.000 description 2
- 125000001151 peptidyl group Chemical group 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 229920001155 polypropylene Polymers 0.000 description 2
- 229920002223 polystyrene Polymers 0.000 description 2
- 230000002028 premature Effects 0.000 description 2
- 230000037452 priming Effects 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- AQHHHDLHHXJYJD-UHFFFAOYSA-N propranolol Chemical compound C1=CC=C2C(OCC(O)CNC(C)C)=CC=CC2=C1 AQHHHDLHHXJYJD-UHFFFAOYSA-N 0.000 description 2
- 150000003180 prostaglandins Chemical class 0.000 description 2
- 238000010839 reverse transcription Methods 0.000 description 2
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 2
- 108091092562 ribozyme Proteins 0.000 description 2
- QZAYGJVTTNCVMB-UHFFFAOYSA-N serotonin Chemical compound C1=C(O)C=C2C(CCN)=CNC2=C1 QZAYGJVTTNCVMB-UHFFFAOYSA-N 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 238000000123 temperature gradient gel electrophoresis Methods 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 210000002845 virion Anatomy 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- 230000000007 visual effect Effects 0.000 description 2
- 230000002034 xenobiotic effect Effects 0.000 description 2
- AHOUBRCZNHFOSL-YOEHRIQHSA-N (+)-Casbol Chemical compound C1=CC(F)=CC=C1[C@H]1[C@H](COC=2C=C3OCOC3=CC=2)CNCC1 AHOUBRCZNHFOSL-YOEHRIQHSA-N 0.000 description 1
- DBGIVFWFUFKIQN-VIFPVBQESA-N (+)-Fenfluramine Chemical compound CCN[C@@H](C)CC1=CC=CC(C(F)(F)F)=C1 DBGIVFWFUFKIQN-VIFPVBQESA-N 0.000 description 1
- CEMAWMOMDPGJMB-UHFFFAOYSA-N (+-)-Oxprenolol Chemical compound CC(C)NCC(O)COC1=CC=CC=C1OCC=C CEMAWMOMDPGJMB-UHFFFAOYSA-N 0.000 description 1
- XEEQGYMUWCZPDN-DOMZBBRYSA-N (-)-(11S,2'R)-erythro-mefloquine Chemical compound C([C@@H]1[C@@H](O)C=2C3=CC=CC(=C3N=C(C=2)C(F)(F)F)C(F)(F)F)CCCN1 XEEQGYMUWCZPDN-DOMZBBRYSA-N 0.000 description 1
- SSEBTPPFLLCUMN-CYBMUJFWSA-N (1r)-2-(tert-butylamino)-1-(7-ethyl-1-benzofuran-2-yl)ethanol Chemical compound CCC1=CC=CC2=C1OC([C@H](O)CNC(C)(C)C)=C2 SSEBTPPFLLCUMN-CYBMUJFWSA-N 0.000 description 1
- XMAYWYJOQHXEEK-OZXSUGGESA-N (2R,4S)-ketoconazole Chemical compound C1CN(C(=O)C)CCN1C(C=C1)=CC=C1OC[C@@H]1O[C@@](CN2C=NC=C2)(C=2C(=CC(Cl)=CC=2)Cl)OC1 XMAYWYJOQHXEEK-OZXSUGGESA-N 0.000 description 1
- VLPIATFUUWWMKC-SNVBAGLBSA-N (2r)-1-(2,6-dimethylphenoxy)propan-2-amine Chemical compound C[C@@H](N)COC1=C(C)C=CC=C1C VLPIATFUUWWMKC-SNVBAGLBSA-N 0.000 description 1
- FELGMEQIXOGIFQ-CYBMUJFWSA-N (3r)-9-methyl-3-[(2-methylimidazol-1-yl)methyl]-2,3-dihydro-1h-carbazol-4-one Chemical compound CC1=NC=CN1C[C@@H]1C(=O)C(C=2C(=CC=CC=2)N2C)=C2CC1 FELGMEQIXOGIFQ-CYBMUJFWSA-N 0.000 description 1
- KPJZHOPZRAFDTN-ZRGWGRIASA-N (6aR,9R)-N-[(2S)-1-hydroxybutan-2-yl]-4,7-dimethyl-6,6a,8,9-tetrahydroindolo[4,3-fg]quinoline-9-carboxamide Chemical compound C1=CC(C=2[C@H](N(C)C[C@@H](C=2)C(=O)N[C@H](CO)CC)C2)=C3C2=CN(C)C3=C1 KPJZHOPZRAFDTN-ZRGWGRIASA-N 0.000 description 1
- RXZBMPWDPOLZGW-XMRMVWPWSA-N (E)-roxithromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=N/OCOCCOC)/[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 RXZBMPWDPOLZGW-XMRMVWPWSA-N 0.000 description 1
- RTHCYVBBDHJXIQ-MRXNPFEDSA-N (R)-fluoxetine Chemical compound O([C@H](CCNC)C=1C=CC=CC=1)C1=CC=C(C(F)(F)F)C=C1 RTHCYVBBDHJXIQ-MRXNPFEDSA-N 0.000 description 1
- PVHUJELLJLJGLN-INIZCTEOSA-N (S)-nitrendipine Chemical compound CCOC(=O)C1=C(C)NC(C)=C(C(=O)OC)[C@@H]1C1=CC=CC([N+]([O-])=O)=C1 PVHUJELLJLJGLN-INIZCTEOSA-N 0.000 description 1
- TWBNMYSKRDRHAT-RCWTXCDDSA-N (S)-timolol hemihydrate Chemical compound O.CC(C)(C)NC[C@H](O)COC1=NSN=C1N1CCOCC1.CC(C)(C)NC[C@H](O)COC1=NSN=C1N1CCOCC1 TWBNMYSKRDRHAT-RCWTXCDDSA-N 0.000 description 1
- PLRACCBDVIHHLZ-UHFFFAOYSA-N 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine Chemical compound C1N(C)CCC(C=2C=CC=CC=2)=C1 PLRACCBDVIHHLZ-UHFFFAOYSA-N 0.000 description 1
- BFPYWIDHMRZLRN-UHFFFAOYSA-N 17alpha-ethynyl estradiol Natural products OC1=CC=C2C3CCC(C)(C(CC4)(O)C#C)C4C3CCC2=C1 BFPYWIDHMRZLRN-UHFFFAOYSA-N 0.000 description 1
- SVUOLADPCWQTTE-UHFFFAOYSA-N 1h-1,2-benzodiazepine Chemical compound N1N=CC=CC2=CC=CC=C12 SVUOLADPCWQTTE-UHFFFAOYSA-N 0.000 description 1
- 108020005065 3' Flanking Region Proteins 0.000 description 1
- SHXWCVYOXRDMCX-UHFFFAOYSA-N 3,4-methylenedioxymethamphetamine Chemical compound CNC(C)CC1=CC=C2OCOC2=C1 SHXWCVYOXRDMCX-UHFFFAOYSA-N 0.000 description 1
- JXZZEXZZKAWDSP-UHFFFAOYSA-N 3-(2-(4-Benzamidopiperid-1-yl)ethyl)indole Chemical compound C1CN(CCC=2C3=CC=CC=C3NC=2)CCC1NC(=O)C1=CC=CC=C1 JXZZEXZZKAWDSP-UHFFFAOYSA-N 0.000 description 1
- UIAGMCDKSXEBJQ-IBGZPJMESA-N 3-o-(2-methoxyethyl) 5-o-propan-2-yl (4s)-2,6-dimethyl-4-(3-nitrophenyl)-1,4-dihydropyridine-3,5-dicarboxylate Chemical compound COCCOC(=O)C1=C(C)NC(C)=C(C(=O)OC(C)C)[C@H]1C1=CC=CC([N+]([O-])=O)=C1 UIAGMCDKSXEBJQ-IBGZPJMESA-N 0.000 description 1
- XMIIGOLPHOKFCH-UHFFFAOYSA-N 3-phenylpropionic acid Chemical compound OC(=O)CCC1=CC=CC=C1 XMIIGOLPHOKFCH-UHFFFAOYSA-N 0.000 description 1
- GIKNHHRFLCDOEU-UHFFFAOYSA-N 4-(2-aminopropyl)phenol Chemical compound CC(N)CC1=CC=C(O)C=C1 GIKNHHRFLCDOEU-UHFFFAOYSA-N 0.000 description 1
- DWAOUXYZOSPAOH-UHFFFAOYSA-N 4-[2-(diethylamino)ethoxy]furo[3,2-g]chromen-7-one;hydrochloride Chemical compound [Cl-].O1C(=O)C=CC2=C1C=C1OC=CC1=C2OCC[NH+](CC)CC DWAOUXYZOSPAOH-UHFFFAOYSA-N 0.000 description 1
- HUDPLKWXRLNSPC-UHFFFAOYSA-N 4-aminophthalhydrazide Chemical compound O=C1NNC(=O)C=2C1=CC(N)=CC=2 HUDPLKWXRLNSPC-UHFFFAOYSA-N 0.000 description 1
- 108020005029 5' Flanking Region Proteins 0.000 description 1
- LSLYOANBFKQKPT-DIFFPNOSSA-N 5-[(1r)-1-hydroxy-2-[[(2r)-1-(4-hydroxyphenyl)propan-2-yl]amino]ethyl]benzene-1,3-diol Chemical compound C([C@@H](C)NC[C@H](O)C=1C=C(O)C=C(O)C=1)C1=CC=C(O)C=C1 LSLYOANBFKQKPT-DIFFPNOSSA-N 0.000 description 1
- 101150052384 50 gene Proteins 0.000 description 1
- 102100031126 6-phosphogluconolactonase Human genes 0.000 description 1
- 108010029731 6-phosphogluconolactonase Proteins 0.000 description 1
- 108010022752 Acetylcholinesterase Proteins 0.000 description 1
- 102000012440 Acetylcholinesterase Human genes 0.000 description 1
- 108010000239 Aequorin Proteins 0.000 description 1
- 102000007698 Alcohol dehydrogenase Human genes 0.000 description 1
- 108010021809 Alcohol dehydrogenase Proteins 0.000 description 1
- 102000013142 Amylases Human genes 0.000 description 1
- 108010065511 Amylases Proteins 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- 102000015790 Asparaginase Human genes 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- VOVIALXJUBGFJZ-KWVAZRHASA-N Budesonide Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1C[C@H]3OC(CCC)O[C@@]3(C(=O)CO)[C@@]1(C)C[C@@H]2O VOVIALXJUBGFJZ-KWVAZRHASA-N 0.000 description 1
- 229930008564 C01BA04 - Sparteine Natural products 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 208000005623 Carcinogenesis Diseases 0.000 description 1
- 206010007559 Cardiac failure congestive Diseases 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 108010053835 Catalase Proteins 0.000 description 1
- 102100035882 Catalase Human genes 0.000 description 1
- GDLIGKIOYRNHDA-UHFFFAOYSA-N Clomipramine Chemical compound C1CC2=CC=C(Cl)C=C2N(CCCN(C)C)C2=CC=CC=C21 GDLIGKIOYRNHDA-UHFFFAOYSA-N 0.000 description 1
- GJSURZIOUXUGAL-UHFFFAOYSA-N Clonidine Chemical compound ClC1=CC=CC(Cl)=C1NC1=NCCN1 GJSURZIOUXUGAL-UHFFFAOYSA-N 0.000 description 1
- 241000557626 Corvus corax Species 0.000 description 1
- 108010051219 Cre recombinase Proteins 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- 108020001738 DNA Glycosylase Proteins 0.000 description 1
- 108020003215 DNA Probes Proteins 0.000 description 1
- 102000028381 DNA glycosylase Human genes 0.000 description 1
- 238000000018 DNA microarray Methods 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- HCYAFALTSJYZDH-UHFFFAOYSA-N Desimpramine Chemical compound C1CC2=CC=CC=C2N(CCCNC)C2=CC=CC=C21 HCYAFALTSJYZDH-UHFFFAOYSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- SHIBSTMRCDJXLN-UHFFFAOYSA-N Digoxigenin Natural products C1CC(C2C(C3(C)CCC(O)CC3CC2)CC2O)(O)C2(C)C1C1=CC(=O)OC1 SHIBSTMRCDJXLN-UHFFFAOYSA-N 0.000 description 1
- 108010016626 Dipeptides Proteins 0.000 description 1
- 244000148064 Enicostema verticillatum Species 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- BFPYWIDHMRZLRN-SLHNCBLASA-N Ethinyl estradiol Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@](CC4)(O)C#C)[C@@H]4[C@@H]3CCC2=C1 BFPYWIDHMRZLRN-SLHNCBLASA-N 0.000 description 1
- OGDVEMNWJVYAJL-LEPYJNQMSA-N Ethyl morphine Chemical compound C([C@H]1[C@H](N(CC[C@@]112)C)C3)=C[C@H](O)[C@@H]1OC1=C2C3=CC=C1OCC OGDVEMNWJVYAJL-LEPYJNQMSA-N 0.000 description 1
- OGDVEMNWJVYAJL-UHFFFAOYSA-N Ethylmorphine Natural products C1C(N(CCC234)C)C2C=CC(O)C3OC2=C4C1=CC=C2OCC OGDVEMNWJVYAJL-UHFFFAOYSA-N 0.000 description 1
- 108091029865 Exogenous DNA Proteins 0.000 description 1
- 108010046276 FLP recombinase Proteins 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- DJBNUMBKLMJRSA-UHFFFAOYSA-N Flecainide Chemical compound FC(F)(F)COC1=CC=C(OCC(F)(F)F)C(C(=O)NCC2NCCCC2)=C1 DJBNUMBKLMJRSA-UHFFFAOYSA-N 0.000 description 1
- PLDUPXSUYLZYBN-UHFFFAOYSA-N Fluphenazine Chemical compound C1CN(CCO)CCN1CCCN1C2=CC(C(F)(F)F)=CC=C2SC2=CC=CC=C21 PLDUPXSUYLZYBN-UHFFFAOYSA-N 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- 206010056740 Genital discharge Diseases 0.000 description 1
- 108010073178 Glucan 1,4-alpha-Glucosidase Proteins 0.000 description 1
- 102100022624 Glucoamylase Human genes 0.000 description 1
- 108010015776 Glucose oxidase Proteins 0.000 description 1
- 239000004366 Glucose oxidase Substances 0.000 description 1
- 108010018962 Glucosephosphate Dehydrogenase Proteins 0.000 description 1
- 102000005720 Glutathione transferase Human genes 0.000 description 1
- 108010070675 Glutathione transferase Proteins 0.000 description 1
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 1
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 1
- 206010019280 Heart failures Diseases 0.000 description 1
- 101000896576 Homo sapiens Putative cytochrome P450 2D7 Proteins 0.000 description 1
- 206010020772 Hypertension Diseases 0.000 description 1
- 208000001953 Hypotension Diseases 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- PWWVAXIEGOYWEE-UHFFFAOYSA-N Isophenergan Chemical compound C1=CC=C2N(CC(C)N(C)C)C3=CC=CC=C3SC2=C1 PWWVAXIEGOYWEE-UHFFFAOYSA-N 0.000 description 1
- UETNIIAIRMUTSM-UHFFFAOYSA-N Jacareubin Natural products CC1(C)OC2=CC3Oc4c(O)c(O)ccc4C(=O)C3C(=C2C=C1)O UETNIIAIRMUTSM-UHFFFAOYSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- MKXZASYAUGDDCJ-SZMVWBNQSA-N LSM-2525 Chemical compound C1CCC[C@H]2[C@@]3([H])N(C)CC[C@]21C1=CC(OC)=CC=C1C3 MKXZASYAUGDDCJ-SZMVWBNQSA-N 0.000 description 1
- KGPAYJZAMGEDIQ-KRWDZBQOSA-N Laudanosine Chemical compound C1=C(OC)C(OC)=CC=C1C[C@H]1C2=CC(OC)=C(OC)C=C2CCN1C KGPAYJZAMGEDIQ-KRWDZBQOSA-N 0.000 description 1
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 108010047357 Luminescent Proteins Proteins 0.000 description 1
- 102000006830 Luminescent Proteins Human genes 0.000 description 1
- 102000013460 Malate Dehydrogenase Human genes 0.000 description 1
- 108010026217 Malate Dehydrogenase Proteins 0.000 description 1
- WJAJPNHVVFWKKL-UHFFFAOYSA-N Methoxamine Chemical compound COC1=CC=C(OC)C(C(O)C(C)N)=C1 WJAJPNHVVFWKKL-UHFFFAOYSA-N 0.000 description 1
- UEQUQVLFIPOEMF-UHFFFAOYSA-N Mianserin Chemical compound C1C2=CC=CC=C2N2CCN(C)CC2C2=CC=CC=C21 UEQUQVLFIPOEMF-UHFFFAOYSA-N 0.000 description 1
- 108010059724 Micrococcal Nuclease Proteins 0.000 description 1
- 102000008109 Mixed Function Oxygenases Human genes 0.000 description 1
- 108010074633 Mixed Function Oxygenases Proteins 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 101001135571 Mus musculus Tyrosine-protein phosphatase non-receptor type 2 Proteins 0.000 description 1
- 241001045988 Neogene Species 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- YSEXMKHXIOCEJA-FVFQAYNVSA-N Nicergoline Chemical compound C([C@@H]1C[C@]2([C@H](N(C)C1)CC=1C3=C2C=CC=C3N(C)C=1)OC)OC(=O)C1=CN=CC(Br)=C1 YSEXMKHXIOCEJA-FVFQAYNVSA-N 0.000 description 1
- PHVGLTMQBUFIQQ-UHFFFAOYSA-N Nortryptiline Chemical compound C1CC2=CC=CC=C2C(=CCCNC)C2=CC=CC=C21 PHVGLTMQBUFIQQ-UHFFFAOYSA-N 0.000 description 1
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- AHOUBRCZNHFOSL-UHFFFAOYSA-N Paroxetine hydrochloride Natural products C1=CC(F)=CC=C1C1C(COC=2C=C3OCOC3=CC=2)CNCC1 AHOUBRCZNHFOSL-UHFFFAOYSA-N 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- RGCVKNLCSQQDEP-UHFFFAOYSA-N Perphenazine Chemical compound C1CN(CCO)CCN1CCCN1C2=CC(Cl)=CC=C2SC2=CC=CC=C21 RGCVKNLCSQQDEP-UHFFFAOYSA-N 0.000 description 1
- 108010053210 Phycocyanin Proteins 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 102100021702 Putative cytochrome P450 2D7 Human genes 0.000 description 1
- 108010066717 Q beta Replicase Proteins 0.000 description 1
- REFJWTPEDVJJIY-UHFFFAOYSA-N Quercetin Chemical compound C=1C(O)=CC(O)=C(C(C=2O)=O)C=1OC=2C1=CC=C(O)C(O)=C1 REFJWTPEDVJJIY-UHFFFAOYSA-N 0.000 description 1
- 108091034057 RNA (poly(A)) Proteins 0.000 description 1
- 108091028733 RNTP Proteins 0.000 description 1
- NCDNCNXCDXHOMX-UHFFFAOYSA-N Ritonavir Natural products C=1C=CC=CC=1CC(NC(=O)OCC=1SC=NC=1)C(O)CC(CC=1C=CC=CC=1)NC(=O)C(C(C)C)NC(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-UHFFFAOYSA-N 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 241000225041 Roestes Species 0.000 description 1
- 241000702670 Rotavirus Species 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- KLBQZWRITKRQQV-UHFFFAOYSA-N Thioridazine Chemical compound C12=CC(SC)=CC=C2SC2=CC=CC=C2N1CCC1CCCCN1C KLBQZWRITKRQQV-UHFFFAOYSA-N 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- 101710198378 Uncharacterized 10.8 kDa protein in cox-rep intergenic region Proteins 0.000 description 1
- 108010046334 Urease Proteins 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- ZVNYJIZDIRKMBF-UHFFFAOYSA-N Vesnarinone Chemical compound C1=C(OC)C(OC)=CC=C1C(=O)N1CCN(C=2C=C3CCC(=O)NC3=CC=2)CC1 ZVNYJIZDIRKMBF-UHFFFAOYSA-N 0.000 description 1
- 108010087302 Viral Structural Proteins Proteins 0.000 description 1
- 241000269370 Xenopus <genus> Species 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 229940022698 acetylcholinesterase Drugs 0.000 description 1
- DZBUGLKDJFMEHC-UHFFFAOYSA-N acridine Chemical class C1=CC=CC2=CC3=CC=CC=C3N=C21 DZBUGLKDJFMEHC-UHFFFAOYSA-N 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 230000001270 agonistic effect Effects 0.000 description 1
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 108010004469 allophycocyanin Proteins 0.000 description 1
- AWUCVROLDVIAJX-UHFFFAOYSA-N alpha-glycerophosphate Natural products OCC(O)COP(O)(O)=O AWUCVROLDVIAJX-UHFFFAOYSA-N 0.000 description 1
- SLRCCWJSBJZJBV-UHFFFAOYSA-N alpha-isosparteine Natural products C1N2CCCCC2C2CN3CCCCC3C1C2 SLRCCWJSBJZJBV-UHFFFAOYSA-N 0.000 description 1
- 229960002213 alprenolol Drugs 0.000 description 1
- PAZJSJFMUHDSTF-UHFFFAOYSA-N alprenolol Chemical compound CC(C)NCC(O)COC1=CC=CC=C1CC=C PAZJSJFMUHDSTF-UHFFFAOYSA-N 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 210000001776 amniocyte Anatomy 0.000 description 1
- 235000019418 amylase Nutrition 0.000 description 1
- 229940025131 amylases Drugs 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000002788 anti-peptide Effects 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 210000000628 antibody-producing cell Anatomy 0.000 description 1
- KZNIFHPLKGYRTM-UHFFFAOYSA-N apigenin Chemical compound C1=CC(O)=CC=C1C1=CC(=O)C2=C(O)C=C(O)C=C2O1 KZNIFHPLKGYRTM-UHFFFAOYSA-N 0.000 description 1
- 229940117893 apigenin Drugs 0.000 description 1
- XADJWCRESPGUTB-UHFFFAOYSA-N apigenin Natural products C1=CC(O)=CC=C1C1=CC(=O)C2=CC(O)=C(O)C=C2O1 XADJWCRESPGUTB-UHFFFAOYSA-N 0.000 description 1
- 235000008714 apigenin Nutrition 0.000 description 1
- 238000010420 art technique Methods 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 229960003272 asparaginase Drugs 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-M asparaginate Chemical compound [O-]C(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-M 0.000 description 1
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 1
- VHGCDTVCOLNTBX-QGZVFWFLSA-N atomoxetine Chemical compound O([C@H](CCNC)C=1C=CC=CC=1)C1=CC=CC=C1C VHGCDTVCOLNTBX-QGZVFWFLSA-N 0.000 description 1
- 229960002430 atomoxetine Drugs 0.000 description 1
- 238000000376 autoradiography Methods 0.000 description 1
- XYOVOXDWRFGKEX-UHFFFAOYSA-N azepine Chemical compound N1C=CC=CC=C1 XYOVOXDWRFGKEX-UHFFFAOYSA-N 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 229940049706 benzodiazepine Drugs 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 238000005415 bioluminescence Methods 0.000 description 1
- 230000029918 bioluminescence Effects 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- 230000036983 biotransformation Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 229960004436 budesonide Drugs 0.000 description 1
- 229950006886 bufuralol Drugs 0.000 description 1
- HQIRNZOQPUAHHV-UHFFFAOYSA-N bupranolol Chemical compound CC1=CC=C(Cl)C(OCC(O)CNC(C)(C)C)=C1 HQIRNZOQPUAHHV-UHFFFAOYSA-N 0.000 description 1
- 229960000330 bupranolol Drugs 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 230000036952 cancer formation Effects 0.000 description 1
- 230000000711 cancerogenic effect Effects 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 239000002327 cardiovascular agent Substances 0.000 description 1
- 229940125692 cardiovascular agent Drugs 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000007910 cell fusion Effects 0.000 description 1
- 230000004700 cellular uptake Effects 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- UKTAZPQNNNJVKR-KJGYPYNMSA-N chembl2368925 Chemical compound C1=CC=C2C(C(O[C@@H]3C[C@@H]4C[C@H]5C[C@@H](N4CC5=O)C3)=O)=CNC2=C1 UKTAZPQNNNJVKR-KJGYPYNMSA-N 0.000 description 1
- 239000012707 chemical precursor Substances 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- RNFNDJAIBTYOQL-UHFFFAOYSA-N chloral hydrate Chemical compound OC(O)C(Cl)(Cl)Cl RNFNDJAIBTYOQL-UHFFFAOYSA-N 0.000 description 1
- 229960002327 chloral hydrate Drugs 0.000 description 1
- 229960001076 chlorpromazine Drugs 0.000 description 1
- ZPEIMTDSQAKGNT-UHFFFAOYSA-N chlorpromazine Chemical compound C1=C(Cl)C=C2N(CCCN(C)C)C3=CC=CC=C3SC2=C1 ZPEIMTDSQAKGNT-UHFFFAOYSA-N 0.000 description 1
- 210000004252 chorionic villi Anatomy 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 230000008711 chromosomal rearrangement Effects 0.000 description 1
- PUFQVTATUTYEAL-UHFFFAOYSA-N cinchocaine Chemical compound C1=CC=CC2=NC(OCCCC)=CC(C(=O)NCCN(CC)CC)=C21 PUFQVTATUTYEAL-UHFFFAOYSA-N 0.000 description 1
- 229960001747 cinchocaine Drugs 0.000 description 1
- 229960004606 clomipramine Drugs 0.000 description 1
- 229960002896 clonidine Drugs 0.000 description 1
- VNFPBHJOKIVQEB-UHFFFAOYSA-N clotrimazole Chemical compound ClC1=CC=CC=C1C(N1C=NC=C1)(C=1C=CC=CC=1)C1=CC=CC=C1 VNFPBHJOKIVQEB-UHFFFAOYSA-N 0.000 description 1
- 229960004022 clotrimazole Drugs 0.000 description 1
- 229960004170 clozapine Drugs 0.000 description 1
- QZUDBNBUXVUHMW-UHFFFAOYSA-N clozapine Chemical compound C1CN(C)CCN1C1=NC2=CC(Cl)=CC=C2NC2=CC=CC=C12 QZUDBNBUXVUHMW-UHFFFAOYSA-N 0.000 description 1
- 229960004126 codeine Drugs 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000004737 colorimetric analysis Methods 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 238000012937 correction Methods 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 238000009402 cross-breeding Methods 0.000 description 1
- 238000009109 curative therapy Methods 0.000 description 1
- JURKNVYFZMSNLP-UHFFFAOYSA-N cyclobenzaprine Chemical compound C1=CC2=CC=CC=C2C(=CCCN(C)C)C2=CC=CC=C21 JURKNVYFZMSNLP-UHFFFAOYSA-N 0.000 description 1
- 229960003572 cyclobenzaprine Drugs 0.000 description 1
- 229940104302 cytosine Drugs 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 239000003398 denaturant Substances 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 230000008021 deposition Effects 0.000 description 1
- 229960003914 desipramine Drugs 0.000 description 1
- 238000001784 detoxification Methods 0.000 description 1
- 229960004597 dexfenfluramine Drugs 0.000 description 1
- 229960001985 dextromethorphan Drugs 0.000 description 1
- 239000005546 dideoxynucleotide Substances 0.000 description 1
- 230000009274 differential gene expression Effects 0.000 description 1
- QONQRTHLHBTMGP-UHFFFAOYSA-N digitoxigenin Natural products CC12CCC(C3(CCC(O)CC3CC3)C)C3C11OC1CC2C1=CC(=O)OC1 QONQRTHLHBTMGP-UHFFFAOYSA-N 0.000 description 1
- SHIBSTMRCDJXLN-KCZCNTNESA-N digoxigenin Chemical compound C1([C@@H]2[C@@]3([C@@](CC2)(O)[C@H]2[C@@H]([C@@]4(C)CC[C@H](O)C[C@H]4CC2)C[C@H]3O)C)=CC(=O)OC1 SHIBSTMRCDJXLN-KCZCNTNESA-N 0.000 description 1
- HESHRHUZIWVEAJ-JGRZULCMSA-N dihydroergotamine Chemical compound C([C@H]1C(=O)N2CCC[C@H]2[C@]2(O)O[C@@](C(N21)=O)(C)NC(=O)[C@H]1CN([C@H]2[C@@H](C3=CC=CC4=NC=C([C]34)C2)C1)C)C1=CC=CC=C1 HESHRHUZIWVEAJ-JGRZULCMSA-N 0.000 description 1
- 229960004704 dihydroergotamine Drugs 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- DLNKOYKMWOXYQA-UHFFFAOYSA-N dl-pseudophenylpropanolamine Natural products CC(N)C(O)C1=CC=CC=C1 DLNKOYKMWOXYQA-UHFFFAOYSA-N 0.000 description 1
- 229960003413 dolasetron Drugs 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 238000001647 drug administration Methods 0.000 description 1
- 238000000295 emission spectrum Methods 0.000 description 1
- PJWPNDMDCLXCOM-UHFFFAOYSA-N encainide Chemical compound C1=CC(OC)=CC=C1C(=O)NC1=CC=CC=C1CCC1N(C)CCCC1 PJWPNDMDCLXCOM-UHFFFAOYSA-N 0.000 description 1
- 229960001142 encainide Drugs 0.000 description 1
- 230000002124 endocrine Effects 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 239000002375 environmental carcinogen Substances 0.000 description 1
- 239000003239 environmental mutagen Substances 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 229960002568 ethinylestradiol Drugs 0.000 description 1
- 229960004578 ethylmorphine Drugs 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 229960001022 fenoterol Drugs 0.000 description 1
- 230000004720 fertilization Effects 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 229960000449 flecainide Drugs 0.000 description 1
- ZFKJVJIDPQDDFY-UHFFFAOYSA-N fluorescamine Chemical compound C12=CC=CC=C2C(=O)OC1(C1=O)OC=C1C1=CC=CC=C1 ZFKJVJIDPQDDFY-UHFFFAOYSA-N 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 238000001215 fluorescent labelling Methods 0.000 description 1
- 229960002464 fluoxetine Drugs 0.000 description 1
- 229960002690 fluphenazine Drugs 0.000 description 1
- 229960004038 fluvoxamine Drugs 0.000 description 1
- CJOFXWAVKWHTFT-XSFVSMFZSA-N fluvoxamine Chemical compound COCCCC\C(=N/OCCN)C1=CC=C(C(F)(F)F)C=C1 CJOFXWAVKWHTFT-XSFVSMFZSA-N 0.000 description 1
- BPZSYCZIITTYBL-UHFFFAOYSA-N formoterol Chemical compound C1=CC(OC)=CC=C1CC(C)NCC(O)C1=CC=C(O)C(NC=O)=C1 BPZSYCZIITTYBL-UHFFFAOYSA-N 0.000 description 1
- 229960002848 formoterol Drugs 0.000 description 1
- 238000005194 fractionation Methods 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 125000001965 gamma-lactamyl group Chemical group 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 238000001641 gel filtration chromatography Methods 0.000 description 1
- 230000009395 genetic defect Effects 0.000 description 1
- 238000010448 genetic screening Methods 0.000 description 1
- 229940116332 glucose oxidase Drugs 0.000 description 1
- 235000019420 glucose oxidase Nutrition 0.000 description 1
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 1
- 125000003147 glycosyl group Chemical group 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000005090 green fluorescent protein Substances 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- HIUVKVDQFXDZHU-UHFFFAOYSA-N guanoxan Chemical compound C1=CC=C2OC(CNC(=N)N)COC2=C1 HIUVKVDQFXDZHU-UHFFFAOYSA-N 0.000 description 1
- 229960000760 guanoxan Drugs 0.000 description 1
- 229960003878 haloperidol Drugs 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000002064 heart cell Anatomy 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 238000003268 heterogeneous phase assay Methods 0.000 description 1
- 238000012188 high-throughput screening assay Methods 0.000 description 1
- OROGSEYTTFOCAN-UHFFFAOYSA-N hydrocodone Natural products C1C(N(CCC234)C)C2C=CC(O)C3OC2=C4C1=CC=C2OC OROGSEYTTFOCAN-UHFFFAOYSA-N 0.000 description 1
- 230000036543 hypotension Effects 0.000 description 1
- 238000005286 illumination Methods 0.000 description 1
- BCGWQEUPMDMJNV-UHFFFAOYSA-N imipramine Chemical compound C1CC2=CC=CC=C2N(CCCN(C)C)C2=CC=CC=C21 BCGWQEUPMDMJNV-UHFFFAOYSA-N 0.000 description 1
- 229960004801 imipramine Drugs 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 229960002056 indoramin Drugs 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- SZVJSHCCFOBDDC-UHFFFAOYSA-N iron(II,III) oxide Inorganic materials O=[Fe]O[Fe]O[Fe]=O SZVJSHCCFOBDDC-UHFFFAOYSA-N 0.000 description 1
- 229960004125 ketoconazole Drugs 0.000 description 1
- 229910052747 lanthanoid Inorganic materials 0.000 description 1
- 150000002602 lanthanoids Chemical class 0.000 description 1
- KGPAYJZAMGEDIQ-UHFFFAOYSA-N laudanosine Natural products C1=C(OC)C(OC)=CC=C1CC1C2=CC(OC)=C(OC)C=C2CCN1C KGPAYJZAMGEDIQ-UHFFFAOYSA-N 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 150000002634 lipophilic molecules Chemical class 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 238000001459 lithography Methods 0.000 description 1
- 230000033001 locomotion Effects 0.000 description 1
- JCCNYMKQOSZNPW-UHFFFAOYSA-N loratadine Chemical compound C1CN(C(=O)OCC)CCC1=C1C2=NC=CC=C2CCC2=CC(Cl)=CC=C21 JCCNYMKQOSZNPW-UHFFFAOYSA-N 0.000 description 1
- 229960003088 loratadine Drugs 0.000 description 1
- HWYHZTIRURJOHG-UHFFFAOYSA-N luminol Chemical compound O=C1NNC(=O)C2=C1C(N)=CC=C2 HWYHZTIRURJOHG-UHFFFAOYSA-N 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 238000007403 mPCR Methods 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 230000000873 masking effect Effects 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 230000008774 maternal effect Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 229960001962 mefloquine Drugs 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- VRQVVMDWGGWHTJ-CQSZACIVSA-N methotrimeprazine Chemical compound C1=CC=C2N(C[C@H](C)CN(C)C)C3=CC(OC)=CC=C3SC2=C1 VRQVVMDWGGWHTJ-CQSZACIVSA-N 0.000 description 1
- 229940042053 methotrimeprazine Drugs 0.000 description 1
- 229960005192 methoxamine Drugs 0.000 description 1
- OEHAYUOVELTAPG-UHFFFAOYSA-N methoxyphenamine Chemical compound CNC(C)CC1=CC=CC=C1OC OEHAYUOVELTAPG-UHFFFAOYSA-N 0.000 description 1
- 229960005405 methoxyphenamine Drugs 0.000 description 1
- SQBBOVROCFXYBN-UHFFFAOYSA-N methoxypsoralen Natural products C1=C2OC(=O)C(OC)=CC2=CC2=C1OC=C2 SQBBOVROCFXYBN-UHFFFAOYSA-N 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 229960001186 methysergide Drugs 0.000 description 1
- TTWJBBZEZQICBI-UHFFFAOYSA-N metoclopramide Chemical compound CCN(CC)CCNC(=O)C1=CC(Cl)=C(N)C=C1OC TTWJBBZEZQICBI-UHFFFAOYSA-N 0.000 description 1
- 229960004503 metoclopramide Drugs 0.000 description 1
- IUBSYMUCCVWXPE-UHFFFAOYSA-N metoprolol Chemical compound COCCC1=CC=C(OCC(O)CNC(C)C)C=C1 IUBSYMUCCVWXPE-UHFFFAOYSA-N 0.000 description 1
- 229960002237 metoprolol Drugs 0.000 description 1
- 229960003404 mexiletine Drugs 0.000 description 1
- 229960003955 mianserin Drugs 0.000 description 1
- 230000002906 microbiologic effect Effects 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- LDMWSLGGVTVJPG-UHFFFAOYSA-N minaprine Chemical compound CC1=CC(C=2C=CC=CC=2)=NN=C1NCCN1CCOCC1 LDMWSLGGVTVJPG-UHFFFAOYSA-N 0.000 description 1
- 229960004758 minaprine Drugs 0.000 description 1
- YHXISWVBGDMDLQ-UHFFFAOYSA-N moclobemide Chemical compound C1=CC(Cl)=CC=C1C(=O)NCCN1CCOCC1 YHXISWVBGDMDLQ-UHFFFAOYSA-N 0.000 description 1
- 229960004644 moclobemide Drugs 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 238000002887 multiple sequence alignment Methods 0.000 description 1
- 101150029137 mutY gene Proteins 0.000 description 1
- 231100000219 mutagenic Toxicity 0.000 description 1
- 230000003505 mutagenic effect Effects 0.000 description 1
- 230000000869 mutational effect Effects 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 239000002581 neurotoxin Substances 0.000 description 1
- 231100000618 neurotoxin Toxicity 0.000 description 1
- 229960003642 nicergoline Drugs 0.000 description 1
- 229960000715 nimodipine Drugs 0.000 description 1
- 229960005425 nitrendipine Drugs 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 238000010606 normalization Methods 0.000 description 1
- 238000007899 nucleic acid hybridization Methods 0.000 description 1
- 239000002853 nucleic acid probe Substances 0.000 description 1
- 238000001821 nucleic acid purification Methods 0.000 description 1
- 238000011330 nucleic acid test Methods 0.000 description 1
- KVWDHTXUZHCGIO-UHFFFAOYSA-N olanzapine Chemical compound C1CN(C)CCN1C1=NC2=CC=CC=C2NC2=C1C=C(C)S2 KVWDHTXUZHCGIO-UHFFFAOYSA-N 0.000 description 1
- 229960005017 olanzapine Drugs 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 229960005343 ondansetron Drugs 0.000 description 1
- 229960004570 oxprenolol Drugs 0.000 description 1
- 238000002638 palliative care Methods 0.000 description 1
- 229960002296 paroxetine Drugs 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- CYXKNKQEMFBLER-UHFFFAOYSA-N perhexiline Chemical compound C1CCCNC1CC(C1CCCCC1)C1CCCCC1 CYXKNKQEMFBLER-UHFFFAOYSA-N 0.000 description 1
- 229960000989 perhexiline Drugs 0.000 description 1
- 229960000762 perphenazine Drugs 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- ICFJFFQQTFMIBG-UHFFFAOYSA-N phenformin Chemical compound NC(=N)NC(=N)NCCC1=CC=CC=C1 ICFJFFQQTFMIBG-UHFFFAOYSA-N 0.000 description 1
- 229960003243 phenformin Drugs 0.000 description 1
- RXNXLAHQOVLMIE-UHFFFAOYSA-N phenyl 10-methylacridin-10-ium-9-carboxylate Chemical compound C12=CC=CC=C2[N+](C)=C2C=CC=CC2=C1C(=O)OC1=CC=CC=C1 RXNXLAHQOVLMIE-UHFFFAOYSA-N 0.000 description 1
- 229960000395 phenylpropanolamine Drugs 0.000 description 1
- DLNKOYKMWOXYQA-APPZFPTMSA-N phenylpropanolamine Chemical compound C[C@@H](N)[C@H](O)C1=CC=CC=C1 DLNKOYKMWOXYQA-APPZFPTMSA-N 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- PTMHPRAIXMAOOB-UHFFFAOYSA-L phosphoramidate Chemical compound NP([O-])([O-])=O PTMHPRAIXMAOOB-UHFFFAOYSA-L 0.000 description 1
- ZWLUXSQADUDCSB-UHFFFAOYSA-N phthalaldehyde Chemical compound O=CC1=CC=CC=C1C=O ZWLUXSQADUDCSB-UHFFFAOYSA-N 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 229960004215 prajmaline Drugs 0.000 description 1
- UAUHEPXILIZYCU-ALHOSYKFSA-N prajmalium Chemical compound CN([C@H]12)C3=CC=CC=C3[C@]11C[C@@H]3[N@@+](CCC)([C@@H]([C@H]4CC)O)[C@H]2C[C@@H]4[C@@H]3[C@H]1O UAUHEPXILIZYCU-ALHOSYKFSA-N 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 238000003793 prenatal diagnosis Methods 0.000 description 1
- 238000009598 prenatal testing Methods 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 238000007639 printing Methods 0.000 description 1
- REQCZEXYDRLIBE-UHFFFAOYSA-N procainamide Chemical compound CCN(CC)CCNC(=O)C1=CC=C(N)C=C1 REQCZEXYDRLIBE-UHFFFAOYSA-N 0.000 description 1
- 229960000244 procainamide Drugs 0.000 description 1
- 231100000586 procarcinogen Toxicity 0.000 description 1
- 229960003910 promethazine Drugs 0.000 description 1
- 239000003891 promutagen Substances 0.000 description 1
- JWHAUXFOSRPERK-UHFFFAOYSA-N propafenone Chemical compound CCCNCC(O)COC1=CC=CC=C1C(=O)CCC1=CC=CC=C1 JWHAUXFOSRPERK-UHFFFAOYSA-N 0.000 description 1
- 229960000203 propafenone Drugs 0.000 description 1
- 229960003712 propranolol Drugs 0.000 description 1
- 238000002331 protein detection Methods 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 239000012521 purified sample Substances 0.000 description 1
- WKSAUQYGYAYLPV-UHFFFAOYSA-N pyrimethamine Chemical compound CCC1=NC(N)=NC(N)=C1C1=CC=C(Cl)C=C1 WKSAUQYGYAYLPV-UHFFFAOYSA-N 0.000 description 1
- 229960000611 pyrimethamine Drugs 0.000 description 1
- 235000005875 quercetin Nutrition 0.000 description 1
- 239000002287 radioligand Substances 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 238000002271 resection Methods 0.000 description 1
- JQXXHWHPUNPDRT-WLSIYKJHSA-N rifampicin Chemical compound O([C@](C1=O)(C)O/C=C/[C@@H]([C@H]([C@@H](OC(C)=O)[C@H](C)[C@H](O)[C@H](C)[C@@H](O)[C@@H](C)\C=C\C=C(C)/C(=O)NC=2C(O)=C3C([O-])=C4C)C)OC)C4=C1C3=C(O)C=2\C=N\N1CC[NH+](C)CC1 JQXXHWHPUNPDRT-WLSIYKJHSA-N 0.000 description 1
- 229960001225 rifampicin Drugs 0.000 description 1
- 229960001534 risperidone Drugs 0.000 description 1
- RAPZEAPATHNIPO-UHFFFAOYSA-N risperidone Chemical compound FC1=CC=C2C(C3CCN(CC3)CCC=3C(=O)N4CCCCC4=NC=3C)=NOC2=C1 RAPZEAPATHNIPO-UHFFFAOYSA-N 0.000 description 1
- NCDNCNXCDXHOMX-XGKFQTDJSA-N ritonavir Chemical compound N([C@@H](C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](CC=1C=CC=CC=1)NC(=O)OCC=1SC=NC=1)CC=1C=CC=CC=1)C(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-XGKFQTDJSA-N 0.000 description 1
- 229960000311 ritonavir Drugs 0.000 description 1
- 229960005224 roxithromycin Drugs 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 229940076279 serotonin Drugs 0.000 description 1
- 229960002073 sertraline Drugs 0.000 description 1
- VGKDLMBJGBXTGI-SJCJKPOMSA-N sertraline Chemical compound C1([C@@H]2CC[C@@H](C3=CC=CC=C32)NC)=CC=C(Cl)C(Cl)=C1 VGKDLMBJGBXTGI-SJCJKPOMSA-N 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- AWUCVROLDVIAJX-GSVOUGTGSA-N sn-glycerol 3-phosphate Chemical compound OC[C@@H](O)COP(O)(O)=O AWUCVROLDVIAJX-GSVOUGTGSA-N 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- SLRCCWJSBJZJBV-AJNGGQMLSA-N sparteine Chemical compound C1N2CCCC[C@H]2[C@@H]2CN3CCCC[C@H]3[C@H]1C2 SLRCCWJSBJZJBV-AJNGGQMLSA-N 0.000 description 1
- 229960001945 sparteine Drugs 0.000 description 1
- 230000037436 splice-site mutation Effects 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- NCEXYHBECQHGNR-QZQOTICOSA-N sulfasalazine Chemical compound C1=C(O)C(C(=O)O)=CC(\N=N\C=2C=CC(=CC=2)S(=O)(=O)NC=2N=CC=CC=2)=C1 NCEXYHBECQHGNR-QZQOTICOSA-N 0.000 description 1
- 229960001940 sulfasalazine Drugs 0.000 description 1
- NCEXYHBECQHGNR-UHFFFAOYSA-N sulfasalazine Natural products C1=C(O)C(C(=O)O)=CC(N=NC=2C=CC(=CC=2)S(=O)(=O)NC=2N=CC=CC=2)=C1 NCEXYHBECQHGNR-UHFFFAOYSA-N 0.000 description 1
- 230000019635 sulfation Effects 0.000 description 1
- 238000005670 sulfation reaction Methods 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 229960001685 tacrine Drugs 0.000 description 1
- YLJREFDVOIBQDA-UHFFFAOYSA-N tacrine Chemical compound C1=CC=C2C(N)=C(CCCC3)C3=NC2=C1 YLJREFDVOIBQDA-UHFFFAOYSA-N 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 125000005931 tert-butyloxycarbonyl group Chemical group [H]C([H])([H])C(OC(*)=O)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 229960002784 thioridazine Drugs 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 229960004605 timolol Drugs 0.000 description 1
- 231100000027 toxicology Toxicity 0.000 description 1
- 238000012549 training Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 229960002341 trifluperidol Drugs 0.000 description 1
- GPMXUUPHFNMNDH-UHFFFAOYSA-N trifluperidol Chemical compound C1CC(O)(C=2C=C(C=CC=2)C(F)(F)F)CCN1CCCC(=O)C1=CC=C(F)C=C1 GPMXUUPHFNMNDH-UHFFFAOYSA-N 0.000 description 1
- 229960002431 trimipramine Drugs 0.000 description 1
- ZSCDBOWYZJWBIY-UHFFFAOYSA-N trimipramine Chemical compound C1CC2=CC=CC=C2N(CC(CN(C)C)C)C2=CC=CC=C21 ZSCDBOWYZJWBIY-UHFFFAOYSA-N 0.000 description 1
- 229960003688 tropisetron Drugs 0.000 description 1
- UIVFDCIXTSJXBB-ITGUQSILSA-N tropisetron Chemical compound C1=CC=C[C]2C(C(=O)O[C@H]3C[C@H]4CC[C@@H](C3)N4C)=CN=C21 UIVFDCIXTSJXBB-ITGUQSILSA-N 0.000 description 1
- 230000007306 turnover Effects 0.000 description 1
- 230000034512 ubiquitination Effects 0.000 description 1
- 238000010798 ubiquitination Methods 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 230000009452 underexpressoin Effects 0.000 description 1
- 230000031143 xenobiotic glucuronidation Effects 0.000 description 1
- 229960004141 zuclopenthixol Drugs 0.000 description 1
- WFPIAZLQTJBIFN-DVZOWYKESA-N zuclopenthixol Chemical compound C1CN(CCO)CCN1CC\C=C\1C2=CC(Cl)=CC=C2SC2=CC=CC=C2/1 WFPIAZLQTJBIFN-DVZOWYKESA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0071—Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14)
- C12N9/0077—Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14) with a reduced iron-sulfur protein as one donor (1.14.15)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
- C12Q1/6883—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/106—Pharmacogenomics, i.e. genetic variability in individual responses to drugs and drug metabolism
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/156—Polymorphic or mutational markers
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/172—Haplotypes
Definitions
- the present invention relates to interindividual variation in drug metabolism.
- the present invention also relates to genetic variation and attendant genetic markers. More specifically, the present invention relates to the identification of a novel mutant allele of the CYP2D6 gene locus that results in a frameshift in a critical region of the gene which, in the wild-type enzyme, is required for catalytic activity.
- the mutant allele is associated with a genetic deficiency for metabolizing agents that are substrates of P450 CYP2D6.
- Polymorphic genes have been identified that result in interindividual variation in drug metabolism. See, for example, U.S. Patent No. 5,648,482. Interest remains in identifying genetic factors that influence or give rise to such interindividual variation.
- cytochrome P450 genes which encode products involved in Phase I drug metabolism have been identified. These enzymes are involved in the metabolism of numerous other xenobiotics such as, for example, carcinogens, environmental chemicals, and several classes of endobiotics, e.g., steroids and prostaglandins.
- cytochrome P450 2D6 The cytochrome P450 2D6 gene (CYP2D6), localized to chromosome 22, encodes a major Phase I drug metabolizing enzyme, debrisoquine hydroxylase, the polymorphic oxidation of which is one of the most characterized interindividual variations of drug metabolism. See, for example, Lancet : 584-586 (1977); Eur. J. Clin. Pharmacol. 16: 183-187 (1979); Genomics 2: 174-179 (1988); Nature 331: 442-446 (1998).
- genotypes Several mutant alleles of the CYP2D6 gene associated with the PM phenotype have been reported (i.e., genotypes). See, for example, Proc. Natl. Acad. Sci. USA 85: 5240-5243 (1988). Identification of such genotypes, and screening therefor, could enable one to predict an individual's metabolism of certain drugs, and thus assist in avoidance of, e.g., the exaggerated pharmacological responses mentioned hereinabove. Such genotype identification can be advantageous over administering the drug to the individual and assessing the phenotype resultant therefrom.
- CYP2D6 encodes a major Phase I drug metabolizing enzyme which is involved in the metabolism of numerous drugs, and that mutant alleles of the CYP2D6 gene are associated with the debrisoquine PM phenotype, a need remains to continue to identify novel PM alleles for the CYP2D6 gene, and assays for screening of the such genotypes.
- the present invention furthers this work by providing a novel mutant allele of the CYP2D6 gene locus.
- This mutation results in a frameshift in a critical region of the gene which, in the wild-type enzyme, is required for catalytic activity.
- this mutant allele is associated with a genetic deficiency for metabolizing agents that are substrates of P450 CYP2D6, e.g., the PM phenotype, and, as such, can assist the art in further deciphering of interindividual variation in drug metabolism.
- the present invention relates to novel CYP2D6 polymorphic variants that are linked or associated with a genetic deficiency for metabolizing certain drugs; specifically, individuals having differing variants of CYP2D6 may differ in their ability to metabolize drugs that are the substrates for P450CYP2D6 enzymes.
- Examples include variations at position 5816 and position 5799 of the CYP2D6 gene.
- the variation at position 5816 corresponds to a substitution of the sequence "TA" for the "C" of the CYP2D6 genomic sequence (GenBank Accession No. M33388; SEQ ID NO. 1 shown in FIGURE 2) and at position 1474 of the CYP2D6 cDNA sequence (GenBank Accession No. NM_000106; SEQ ID NO. 3 shown in FIGURE 4).
- the variation at position 5799 corresponds to the substitution of G at this position of the genomic sequence with a C.
- this invention provides nucleic acids comprising the CYP2D6 gene, preferably nucleic acid molecules comprising at least 20 consecutive nucleotides of an allele of a CYP2D6 gene having SEQ ID NO: 1, wherein the nucleotide sequence differs at either nucleotide position 5816 or position 5799 or at both positions from the nucleotide sequence of SEQ ID NO: 1.
- the nucleotide C at position 5816 is replaced by TA.
- C replaces the G at position 5799.
- this invention includes nucleic acid sequence comprising both a TA at position 5816 and a C at position 5799 of SEQ ID No: 1.
- nucleic acids include: SEQ ID No: 2 (C5816TA mutant genomic sequence), SEQ ID No: 4 (C5816TA mutant cDNA sequence), SEQ ID No: 7 (double mutant cDNA), SEQ ID No. 29 (G5799C mutant cDNA sequence), and SEQ ID No. 33 (mutant exon 9 sequence).
- the invention provides probes and primers to detect a genetic deficiency for metabolizing drugs, e.g., a poor metabolizer genotype.
- the nucleic acids of the invention can be used, for e.g., in prognostic, diagnostic, and therapeutic methods.
- the nucleic acids of the invention can be used as probes or primers to determine whether a subject has a genetic deficiency for metabolizing certain drugs.
- this invention provides an array of nucleic acid molecules attached to a support, wherein the array has an oligonucleotide that will hybridize to an allelic variant of CYP2D6 but will not substantially hybridize to the wild type sequence.
- the array has an oligonucleotide that will hybridize to SEQ ID NO. 2, but will not substantially hybridize to the nucleic acid sequence of SEQ ID NO. 1.
- the invention further provides vectors comprising the nucleic acids of this invention; host cells transfected with said vectors whether prokaryotic or eukaryotic; and transgenic non-human animals which contain a heterologous form of a CYP2D6 P450 C(5816) variant described herein.
- a transgenic animal can serve as an animal model for studying, e.g., the effects of specific allelic variations, including mutations of the CYP2D6 gene in drug metabolism.
- This invention also provides polypeptides encoded by the allelic variants of this invention.
- such polypeptides have a C-terminus comprising the amino acid sequence of YLCCAPLEWGT.
- the invention also provides purified antibodies that selectively bind to the mutant CYP2D6 amino acid sequence but do not substantially bind the wild type polypeptide sequence.
- such antibodies selectively bind an epitope comprising residues 481-502 of the amino acid sequence of SEQ ID NO. 6.
- the antibodies selectively bind an epitope which comprises the amino acid sequence of YLCCAPLEWGT.
- the methods of this invention can be used, e.g., for determining the identity of the allelic variant of a polymorphic region of a human CYP2D6 gene present in a subject.
- the methods of the invention can be useful for determining whether a subject has a genetic deficiency for metabolizing certain drugs, for example drugs that are substrates of P450 CYP2D6.
- Genetic variations of this gene locus result in a genetic deficiency in drug metabolism or a drug sensitivity condition because of the altered enzymatic activities of the variant CYP2D6 gene products.
- the genetic variations at this gene locus are linked to aberrant CYP2D6 levels or aberrant CYP2D6 bioactivities.
- CYP2D6 poor metabolizers a majority of individuals possess normal activity (extensive metabolizers), some individuals possess slightly reduced activity (intermediate metabolizers) and some individuals show increased enzyme activity, in part due to gene duplications (rapid metabolizers). Individuals who lack enzyme activity, due to inactivating mutations in both copies of the CYP2D6 gene, are unable to metabolize drugs that require the CYP2D6 enzyme and are referred to as CYP2D6 poor metabolizers.
- the present methods provide means for determining if a subject has (diagnostic), or is at risk of developing (prognostic), a drug sensitivity condition or disorder that is associated with an aberrant CYP2D6 activity, e.g., an aberrant level of a CYP2D6 protein or an aberrant CYP2D6 bioactivity.
- the identity of a polymorphic region of a CYP2D6 gene may be determined by contacting a sample nucleic acid with a probe or a primer which hybridizes to a polymorphic region selected from the group consisting of nucleotides 5816 and 5799 of SEQ ID NO. 1.
- Exemplary known methods for determining the identity of a polymorphic region include: determining the nucleotide content of the polymorphic region by sequencing or by performing a restriction enzyme site analysis, by single-stranded conformation polymorphism, allele specific hybridization, primer specific extension, oligonucleotide ligation assay, and such methods may readily be performed by those skilled in the art based upon the present description.
- this invention provides methods for genotyping an individual by obtaining a sample of DNA from an individual and determining the identity of the nucleotide at position 5816 of the genomic sequence of CYP2D6.
- Other embodiments include methods for evaluating therapy with a drug metabolized by P450 CYP2D6., for example, evaluating therapy for a patient having a cardiovascular or psychiatric disorder with a drug metabolized by P450 CYP2D6.
- Exemplary methods include obtaining a sample of DNA from an individual, determining the identity of the nucleotide at position 5816 of the genomic sequence of CYP2D6, and then determining whether or not that patient should undergo therapy with a drug metabolized by P450 CYP2D6 if the nucleotide at position 5816 is not a cytosine.
- the methods of the invention can therefore be used, e.g., in selecting the appropriate drugs or determining the course of treatment to administer to a subject to treat cardiovascular or psychiatric disorders.
- the invention provides a method for treating a subject having a drug sensitivity or disorder associated with a specific allelic variant of a polymorphic region of the CYP2D6 gene.
- the drug sensitivity condition or disorder is associated with an aberrant CYP2D6 activity, e.g., an aberrant level or aberrant bioactivity.
- the method comprises (a) determining the identity of the allelic variant; and (b) administering to the subject a compound that compensates for the effect of the specific allelic variant.
- the specific allelic variant is a mutation.
- the compound modulates (e.g., agonizes, antagonizes, inversely antagonizes) a CYP2D6 protein level or bioactivity.
- the compound is selected from the group consisting of a nucleic acid, a protein, a peptidomimetic, and a small molecule.
- the invention provides a kit for determining DNA variations in the CYP2D6 gene in a subject, comprising: a) at least one of PCR primer sets; and b) at least one of the allele-specific oligonucleotide (ASO) probe.
- kits e.g., for amplifying and/or determining the identity or structure of a portion of the CYP2D6 gene comprising a probe or a primer capable of hybridizing to an allelic variant of a polymorphic region.
- the polymorphic region is located in an exon, such as exon 9.
- determining the molecular structure of a region of the CYP2D6 gene comprises determining the identity of at least one nucleotide or determining the nucleotide composition, e.g., the nucleotide sequence.
- kits of the invention can be used, e.g., for determining whether a subject has a genetic deficiency associated with a specific allelic variant of a polymorphic region of a CYP2D6 gene.
- the invention provides a kit for determining whether a subject has a genetic deficiency for metabolizing certain agents, such as drugs that are substrates for P450 CYP2D6.
- the kits of the invention can also be used, for example, in selecting the appropriate drug to administer to a subject having a drug sensitivity or condition associated with aberrant CYP2D6 activity or aberrant CYP2D6 levels.
- determining the allelic variants of CYP2D6 polymorphic regions of an individual can be useful in predicting how an individual will respond to a specific agent, e.g, a drug that is a substrate for P450CYP2D6.
- Aberrant activity refers to an activity which differs from the activity of a polypeptide encoded by the wild-type or most common allele or which differs from the activity of the polypeptide in a healthy subject.
- An activity of a polypeptide can be aberrant, for example, because it is stronger than the activity of its native counterpart.
- an activity can be aberrant because it is weaker or absent relative to the activity of its native counterpart.
- An aberrant activity can also be a change in an activity.
- an aberrant polypeptide can have altered substrate specificity.
- a cell can have an aberrant CYP2D6 P450 activity, e.g., due to overexpression or under expression of a gene encoding CYP2D6 P450, or due to expression of a CYP2D6 allelic variant that alters the sequence of the encoded P450 polypeptide;
- allele refers to the different sequence variants found at different polymorphic regions.
- CYP2D6 P450 exon 9 has at least two different alleles (the wild type allele (see FIGURE 2) and the CYP2D6 C5816TA mutant allele (see FIGURE 3).
- the sequence variants may be single or multiple base changes, including without limitation insertions, deletions, or substitutions, or may be a variable number of sequence repeats;
- amplification in reference to nucleic acids encompasses essentially any method of generating many copies of a nucleic acid, either in single or double stranded form. Such methods include but are not limited to polymerase chain reaction (PCR) and replication of the nucleic acid in cells;
- PCR polymerase chain reaction
- antibody refers to a binding agent including a whole antibody or a binding fragment thereof, which is specifically reactive with a wild type or mutant CYP2D6 P450 polypeptide.
- Antibodies can be fragmented using conventional techniques and the fragments screened for utility in the same manner as described above for whole antibodies. For example, F(ab)2 fragments can be generated by treating an antibody with pepsin. The resulting F(ab)2 fragment can be treated to reduce disulfide bridges to produce Fab fragments.
- the antibody of the present invention is further intended to include bispecific, single-chain, and chimeric and humanized molecules having affinity for a CYP2D6 P450 polypeptide conferred by at least one CDR region of the antibody;
- bioactive portion of CYP2D6 P450 refers to a fragment of a full-length CYP2D6 P450, wherein the fragment specifically mimics or antagonizes at least one activity of a wild-type CYP2D6 P450;
- biological activity or “bioactivity” or “activity” or “biological function,” which are used interchangeably, for the purposes herein when applied to CYP2D6 P450 means an effector or antigenic function that is directly or indirectly performed by a CYP2D6 P450 (whether in its native or denatured conformation), or by any subsequence (fragment) thereof.
- a biological activity can include binding substrate, causing the transfer of lipids, effecting signal transduction from a receptor, modulation of gene expression or an antigenic effector function;
- cells are terms used interchangeably herein to refer not only to the particular subject cell, but to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact be identical to the parent cell, but is still included within the scope of the term as used herein;
- CYP2D6 P450 refers to the cytochrome P450 2D6 isozyme.
- the CYP2D6 P450 isozyme is also known as debrisoquine hydroxylase based upon a catalytic activity, is a monooygenase enzyme that catalyzes the oxidation and eventual elimination of a large number of pharmaceutical agents;
- CYP2D6 P450 agonist refers to an agent that mimics, upregulates (potentiates or supplements) or otherwise increases a CYP2D6 P450 bioactivity.
- CYP2D6 P450 agonists may act on any of a variety of different levels, including regulation of CYP2D6 P450 gene expression, regulation of mRNA splicing mechanisms, stabilization of mRNA, or maturation CYP2D6 P450, or by affecting the biochemical activities of CYP2D6 P450;
- CYP2D6 P450 antagonist refers to an agent that downregulates or otherwise decreases a CYP2D6 P450 bioactivity.
- CYP2D6 P450 agonists may act on any of a variety of different levels, including regulation of CYP2D6 P450 gene expression, regulation of mRNA splicing mechanisms, stabilization of mRNA, or maturation of CYP2D6 P450, or by affecting the biochemical activities of CYP2D6 P450;
- CYP2D6 P450 loci include all the nucleic acid sequence at or near the CYP2D6 P450 gene, introns, exons and 5' and 3' untranslated regions.
- GenBank Accession Nos. for the CYP2D6 P450 gene include M33388 (the CYP2D6 genomic sequence) and NM_000106 (the CYP2D6 cDNA sequence);
- CYP2D6 P450 functional mutation refers to a mutation within or near the CYP2D6 P450 gene that results in an altered phenotype
- CYP2D6 X (position #A) Y refers to a particular allelic form of the CYP2D6 gene, wherein the nucleotide X of SEQ ID NO. 1 (GenBank M33388; FIGURE 2; ) present at position #A has been changed to nucleotide Y.
- CYP2D6 C5816TA refers to a substitution at position 5816 of the CYP2D6 genomic sequence (and as shown in FIGURE 3; SEQ ID NO. 2).
- CYP2D6 P450 polypeptide and "CYP2D6 P450 protein” are intended to encompass polypeptides comprising the amino acid sequence encoded by the CYP2D6 P450 genomic DNA sequences or fragments thereof, and homologs thereof and include agonist and antagonist polypeptides;
- chimera refers to a transgenic mammal with a knock-out or knock-in construct in at least some of its genome-containing cells;
- control or control sample refer to any sample appropriate to the detection technique employed.
- the control sample may contain the products of the allele detection technique employed or the material to be tested. Further, the controls may be positive or negative controls.
- the control sample may comprise DNA fragments of an appropriate size.
- the control sample may comprise a sample of a mutant protein.
- the control sample comprises the material to be tested.
- the controls may be a sample of genomic DNA or a cloned portion of the CYP2D6 P450 gene.
- the control sample is preferably a highly purified sample of genomic DNA;
- disorder associated allele or "an allele associated with a disorder” refers to an allele whose presence in a subject indicates that the subject has or has an increased propensity for developing a particular disorder.
- An allele associated with the CYP2D6 C5816TA mutant polymorphic allele of the invention is the CYP2D6 G5799C polymorphism;
- disruption of the gene and “targeted disruption” or any similar phrase refers to the site specific interruption of a DNA sequence so as to prevent expression of that gene in the cell as compared to the non-disrupted copy of the gene.
- the interruption may be caused by deletions, insertions or modifications to the gene, or any combination thereof;
- “evolutionarily related to,” with respect to amino acid sequences of CYP2D6 proteins, refers to both polypeptides having amino acid sequences which have arisen naturally, and also to mutational variants of human CYP2D6 polypeptides which are derived, for example, by combinatorial mutagenesis;
- haplotype is intended to refer to a set of alleles that are inherited together as a group (are in linkage disequilibrium) at statistically significant levels (pcorr ⁇ 0.05).
- a CYP2D6 P450 haplotype refers to a haplotype including CYP2D6 P450 loci;
- genetic deficiency for drug metabolism refers to an altered level of drug metabolism in certain individuals, particularly, of drugs that are substrates of P450CYP2D6, when compared to the majority of the population.
- the majority of the population may be characterized as "extensive metabolizers” and exhibit normal activity of the CYP2D6 enzyme.
- genetic variation of this gene locus results in altered enzymatic activity, and some individuals possess slightly reduced activity (intermediate metabolizers) and some individuals lack enzyme activity (poor metabolizers).
- homology or “identity” or “similarity” refers to sequence similarity between two peptides or between two nucleic acid molecules. Homology can be determined by comparing a position in each sequence that may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are identical at that position.
- a degree of homology or similarity or identity between nucleic acid sequences is a function of the number of identical or matching nucleotides at positions shared by the nucleic acid sequences.
- a degree of identity of amino acid sequences is a function of the number of identical amino acids at positions shared by the amino acid sequences.
- a degree of homology or similarity of amino acid sequences is a function of the number of amino acids, i.e. structurally related, at positions shared by the amino acid sequences.
- An "unrelated" or “non-homologous” sequence shares less than 40% identity, though preferably less than 25 % identity, with one of the sequences of the present invention;
- “increased risk” refers to a higher frequency of occurrence of the disease or disorder in an individual in comparison to the frequency of occurrence of the disease or disorder in a population.
- a factor identified to be associated with increased risk is termed a "risk factor.”
- Carrying a particular polymorphic allele is a risk factor for a particular condition such as drug sensitivity;
- interact is meant to include detectable relationships or associations (e.g., biochemical interactions) between molecules, such as interactions between protein-protein, protein-nucleic acid, nucleic acid-nucleic acid and protein-small molecule or nucleic acid-small molecule in nature;
- an isolated nucleic acid encoding CYP2D6 P450 preferably includes no more than 10 kilobases (kb) of nucleic acid sequence which naturally immediately flanks the CYP2D6 P450 gene in genomic DNA, more preferably no more than 5 kb of such naturally occurring flanking sequences, and most preferably less than 1.5 kb of such naturally occurring flanking sequence.
- kb kilobases
- isolated also refers to a nucleic acid or peptide that is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized.
- isolated nucleic acid is meant to include nucleic acid fragments, which are not naturally occurring as fragments and would not be found in the natural state.
- isolated also refers to polypeptides that are isolated from other cellular proteins and is meant to encompass both purified and recombinant polypeptides;
- knock-in transgenic animal refers to an animal that has had a modified gene introduced into its genome and the modified gene can be of exogenous or endogenous origin;
- knock-out transgenic animal refers to an animal in which there is partial or complete suppression of the expression of an endogenous gene (e.g., based on deletion of at least a portion of the gene, replacement of at least a portion of the gene with a second sequence, introduction of stop codons, the mutation of bases encoding critical amino acids, or the removal of an intron junction, etc.);
- knock-out construct refers to a nucleic acid sequence that can be used to decrease or suppress expression of a protein encoded by endogenous DNA sequences in a cell.
- the knock-out construct is comprised of a gene, such as the CYP2D6 P450 gene, with a deletion in a critical portion of the gene so that active protein cannot be expressed therefrom.
- a number of termination codons can be added to the native gene to cause early termination of the protein or an intron junction can be inactivated.
- a selectable marker such as the neo gene
- the gene can be represented as follows: CYP2D6 P450 5'/neo/ CYP2D6 P450 3', where 5' and 3', refer to genomic or cDNA sequences which are, respectively, upstream and downstream relative to a portion of the CYP2D6 P450 gene and where neo refers to a neomycin resistance gene.
- a second selectable marker is added in a flanking position so that the gene can be represented as: CYP2D6 P450 5'/neo/CYP2D6 P450 3'/TK, where TK is a thymidine kinase gene which can be added to either the 5' or 3' sequence of the preceding construct and which further can be selected against (i.e., is a negative selectable marker) in appropriate media.
- TK is a thymidine kinase gene which can be added to either the 5' or 3' sequence of the preceding construct and which further can be selected against (i.e., is a negative selectable marker) in appropriate media.
- This two-marker construct allows the selection of homologous recombination events, which removes the flanking TK marker, from non-homologous recombination events which typically retain the TK sequences.
- the gene deletion and/or replacement can be from the exons, introns, especially intron junctions, and/
- linkage disequilibrium refers to co-inheritance of two alleles at frequencies greater than would be expected from the separate frequencies of occurrence of each allele in a given control population.
- the expected frequency of occurrence of two alleles that are inherited independently is the frequency of the first allele multiplied by the frequency of the second allele. Alleles that co-occur at expected frequencies are said to be in "linkage disequilibrium”.
- the cause of linkage disequilibrium is often unclear. It can be due to selection for certain allele combinations or to recent admixture of genetically heterogeneous populations.
- an association of an allele (or group of linked alleles) with the disease gene is expected if the disease mutation occurred in the recent past, so that sufficient time has not elapsed for equilibrium to be achieved through recombination events in the specific chromosomal region.
- allelic patterns that are comprised of more than one allele a first allelic pattern is in linkage disequilibrium with a second allelic pattern if all the alleles that comprise the first allelic pattern are in linkage disequilibrium with at least one of the alleles of the second allelic pattern;
- marker refers to a sequence in the genome that is known to vary among individuals.
- modulate refers to the ability of a substance to affect bioactivity.
- an agonist or antagonist can modulate bioactivity for example by agonizing or antagonizing a CYP2D6 P450 synthesis, or monooxygenase activity;
- non-human animal includes mammals such as rodents, non-human primates, sheep, dogs, cows, goats, etc., amphibians, such as members of the Xenopus genus, and transgenic avians (e.g., chickens, birds, etc.).
- chimeric animal is used herein to refer to animals in which the recombinant gene is found, or in which the recombinant gene is expressed in some but not all cells of the animal.
- tissue-specific chimeric animal indicates that one of the recombinant CYP2D6 P450 genes is present and/or expressed or disrupted in some tissues but not others.
- non-human mammal refers to any member of the class Mammalia, except for humans;
- nucleic acid refers to polynucleotides or oligonucleotides such as deoxyribonucleic acid (DNA), and, where appropriate, ribonucleic acid (RNA).
- DNA deoxyribonucleic acid
- RNA ribonucleic acid
- the term should also be understood to include, as equivalents, analogs of either RNA or DNA made from nucleotide analogs (e.g., peptide nucleic acids) and as applicable to the embodiment being described, single (sense or antisense) and double-stranded polynucleotides;
- nucleotide sequence complementary to the nucleotide sequence set forth in SEQ ID NO. x refers to the nucleotide sequence of the complementary strand of a nucleic acid strand having SEQ ID NO. x.
- complementary strand is used herein interchangeably with the term “complement”.
- the complement of a nucleic acid strand can be the complement of a coding strand or the complement of a noncoding strand.
- the complement of a nucleic acid having SEQ ID NO. x refers to the complementary strand of the strand having SEQ ID NO. x or to any nucleic acid having the nucleotide sequence of the complementary strand of SEQ ID NO.
- nucleic acid having the nucleotide sequence SEQ ID NO. x When referring to a single stranded nucleic acid having the nucleotide sequence SEQ ID NO. x, the complement of this nucleic acid is a nucleic acid having a nucleotide sequence which is complementary to that of SEQ ID NO. x.
- the nucleotide sequences and complementary sequences thereof are always given in the 5' to 3' direction;
- percent identical refers to sequence identity between two amino acid sequences or between two nucleotide sequences. Identity can each be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When an equivalent position in the compared sequences is occupied by the same base or amino acid, then the molecules are identical at that position; when the equivalent site occupied by the same or a similar amino acid residue (e.g., similar in steric and/or electronic nature), then the molecules can be referred to as homologous (similar) at that position.
- Expression as a percentage of homology, similarity, or identity refers to a function of the number of identical or similar amino acids at positions shared by the compared sequences.
- FASTA FASTA
- BLAST BLAST
- ENTREZ is available through the National Center for Biotechnology Information, National Library of Medicine, National Institutes of Health, Bethesda, Md.
- the percent identity of two sequences can be determined by the GCG program with a gap weight of 1, e.g., each amino acid gap is weighted as if it were a single amino acid or nucleotide mismatch between the two sequences; other techniques for alignment are described in Methods in Enzymology , vol. 266: Computer Methods for Macromolecular Sequence Analysis (1996), ed. Doolittle, Academic Press, Inc., a division of Harcourt Brace & Co., San Diego, California, USA.
- an alignment program that permits gaps in the sequence is utilized to align the sequences.
- the Smith-Waterman is one type of algorithm that permits gaps in sequence alignments. See Meth. Mol . Biol.
- the GAP program using the Needleman and Wunsch alignment method can be utilized to align sequences.
- An alternative search strategy uses MPSRCH software, which runs on a MASPAR computer.
- MPSRCH uses a Smith-Waterman algorithm to score sequences on a massively parallel computer. This approach improves ability to pick up distantly related matches, and is especially tolerant of small gaps and nucleotide sequence errors.
- Nucleic acid-encoded amino acid sequences can be used to search both protein and DNA databases; Databases with individual sequences are described in Methods in Enzymology , ed. Doolittle, supra.
- nucleic acids include Genbank, EMBL, and DNA Database of Japan (DDBJ); preferred nucleic acids have a sequence at least 70%, and more preferably 80% identical and more preferably 90% and even more preferably at least 95% identical to an nucleic acid sequence of a sequence shown in one of SEQ ID NOs. of the invention. Nucleic acids at least 90%, more preferably 95%, and most preferably at least about 98-99% identical with a nucleic sequence represented in one of SEQ ID NOs: 1-4 are of course also within the scope of the invention. In preferred embodiments, the nucleic acid is mammalian. In comparing a new nucleic acid with known sequences, several alignment tools are available.
- Examples include PileUp, which creates a multiple sequence alignment, and is described in Feng et al., J. Mol. Evol. (1987) 25:351-360.
- Another method, GAP uses the alignment method of Needleman et al., J. Mol. Biol. (1970) 48:443-453. GAP is best suited for global alignment of sequences.
- a third method, BestFit functions by inserting gaps to maximize the number of matches using the local homology algorithm of Smith and Waterman, Adv. Appl. Math. (1981) 2:482-489.
- polymorphism refers to the coexistence of more than one form of a gene, or portion (e.g., allelic variant) thereof, in a given population.
- a portion of a gene of which there are at least two different forms, i.e., two different nucleotide sequences, is referred to as a "polymorphic region of a gene".
- a polymorphic region can be a single nucleotide, the identity of which differs in different alleles.
- a polymorphic region can also be several nucleotides long;
- promoter means a DNA sequence that regulates expression of a selected DNA sequence operably linked to the promoter, and which effects expression of the selected DNA sequence in cells.
- tissue specific i.e. promoters, which effect expression of the selected DNA sequence only in specific cells (e.g. cells of a specific tissue).
- leaky so-called “leaky” promoters, which regulate expression of a selected DNA primarily in one tissue, but cause expression in other tissues as well.
- the term also encompasses non-tissue specific promoters and promoters that constitutively express or that are inducible (i.e. expression levels can be controlled);
- protein protein
- polypeptide peptide
- recombinant protein refers to a polypeptide of the present invention which is produced by recombinant DNA techniques, wherein generally, DNA encoding a polypeptide is inserted into a suitable expression vector which is in turn used to transform a host cell to produce the heterologous protein.
- the phrase "derived from”, with respect to a recombinant gene is meant to include within the meaning of "recombinant protein” those proteins having an amino acid sequence of a native polypeptide, or an amino acid sequence similar thereto which is generated by mutations including substitutions and deletions (including truncation) of a naturally occurring form of the polypeptide;
- nucleic acid molecule of the invention specifically hybridizes or “specifically detects” refers to the ability of a nucleic acid molecule of the invention to hybridize to at least approximately 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 45, 50, 100, 150, 200, 300, 350, or 400 consecutive nucleotides of a vertebrate, preferably a CYP2D6 gene.
- the invention provides nucleic acids which hybridize under stringent conditions to a nucleic acid represented by SEQ ID Nos. 1, 2, 3, or 4 or complement thereof or the nucleic acids.
- Appropriate stringency conditions which promote DNA hybridization for example, 6.0 x sodium chloride/sodium citrate (SSC) at about 45° C, followed by a wash of 2.0 x SSC at 50°C, are known to those skilled in the art or can be found in Current Protocols in Molecular Biology , John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6 or in Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press (1989).
- the salt concentration in the wash step can be selected from a low stringency of about 2.0 x SSC at 50°C to a high stringency of about 0.2 x SSC at 50°C.
- the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22°C, to high stringency conditions at about 65°C. Both temperature and salt may be varied, or temperature and salt concentration may be held constant while the other variable is changed.
- an htrb nucleic acid of the present invention will bind to one of SEQ ID NOs. 1, 2, 3, or 4 or complement thereof under moderately stringent conditions, for example at about 2.0 x SSC and about 40° C.
- a CYP2D6 nucleic acid of the present invention will bind to one of SEQ ID NOs. 1, 2, 3, or 4, or complement thereof, under high stringency conditions.
- a CYP2D6 nucleic acid sequence of the present invention will bind to one of SEQ ID NO. 1, 2, 3, or 4 which correspond to the CYP2D6 cDNA, preferably open reading frame (ORF) nucleic acid sequences, under high stringency conditions;
- ORF open reading frame
- “susceptibility" to disease or condition or any similar phrase means that certain alleles are hereby discovered to be associated with or predictive of a subject's incidence of developing a particular disease or condition (particularly a sensitivity to drugs). The alleles are thus over-represented in frequency in individuals with drug sensitivity as compared to normal individuals. These alleles are understood to relate to the drug sensitivity condition;
- small molecule as used herein, is meant to refer to a composition, which preferably has a molecular weight of less than about 5kD and most preferably less than about 4kD.
- Small molecules include nucleic acids, peptides, peptidomimetics, carbohydrates, lipids and other organic and inorganic molecules;
- “specifically hybridizes” or “specifically detects” refers to the ability of a nucleic acid molecule to hybridize to at least approximately 6 consecutive nucleotides of a sample nucleic acid.
- transcriptional regulatory sequence is a generic term used throughout the specification to refer to DNA sequences, such as initiation signals, enhancers, and promoters, which induce or control transcription of protein coding sequences with which they are operably linked;
- transfection means the introduction of a nucleic acid, e.g., via an expression vector, into a recipient cell by nucleic acid-mediated gene transfer.
- transformation refers to a process in which a cell's genotype is changed as a result of the cellular uptake of exogenous DNA or RNA, and, for example, the transformed cell expresses a recombinant form of a polypeptide or, in the case of anti-sense expression from the transferred gene, the expression of a naturally-occurring form of a polypeptide is disrupted;
- transgene means a nucleic acid sequence (encoding, e.g., one of the CYP2D6 P450 polypeptides, or an antisense transcript thereto) which has been introduced into a cell.
- a transgene could be partly or entirely heterologous, i.e., foreign, to the transgenic animal or cell into which it is introduced, or, is homologous to an endogenous gene of the transgenic animal or cell into which it is introduced, but which is designed to be inserted, or is inserted, into the animal's genome in such a way as to alter the genome of the cell into which it is inserted (e.g., it is inserted at a location which differs from that of the natural gene or its insertion results in a knockout).
- a transgene can also be present in a cell in the form of an episome.
- a transgene can include one or more transcriptional regulatory sequences and any other nucleic acid, such as introns, that may be necessary for optimal expression of a selected nucleic acid;
- transgenic animal refers to any animal, preferably a non-human mammal, bird or an amphibian, in which one or more of the cells of the animal contain heterologous nucleic acid introduced by way of human intervention, such as by transgenic techniques well known in the art.
- the nucleic acid is introduced into the cell, directly or indirectly by introduction into a precursor of the cell, by way of deliberate genetic manipulation, such as by microinjection or by infection with a recombinant virus.
- the term genetic manipulation does not include classical cross-breeding, or in vitro fertilization, but rather is directed to the introduction of a recombinant DNA molecule. This molecule may be integrated within a chromosome, or it may be extrachromosomally replicating DNA.
- transgene causes cells to express a recombinant form of one of a CYP2D6 P450 polypeptide, e.g., either agonistic or antagonistic forms.
- transgenic animals in which the recombinant gene is silent are also contemplated, as for example, the FLP or CRE recombinase dependent constructs described below.
- transgenic animal also includes those recombinant animals in which gene disruption of one or more genes is caused by human intervention, including both recombination or antisense techniques. The term is intended to include all progeny generations. Thus, the founder animal and all F1, F2, F3, and so on, progeny thereof are included;
- treating includes, inter alia, preventative (e.g., prophylactic), palliative and curative treatment, including, for example, ameliorating at least one symptom of a disease or at least one abnormality associated with a condition or disorder, e.g., decreased or over expression of a peptide of the invention.
- Treating a cardiovascular disorder can take place, for example, by administering a cardiovascular disorder therapeutic. Treating a cardiovascular disorder can also take place, for example, by modifying risk factors that are related to the cardiovascular disorder;
- vector refers to a nucleic acid molecule, which is capable of transporting another nucleic acid to which it has been linked.
- One type of preferred vector is an episome, i.e., a nucleic acid capable of extra-chromosomal replication.
- Preferred vectors are those capable of autonomous replication and/or expression of nucleic acids to which they are linked.
- Vectors capable of directing the expression of genes to which they are operatively linked are referred to herein as "expression vectors”.
- expression vectors of utility in recombinant DNA techniques are often in the form of "plasmids" which refer generally to circular double stranded DNA loops which, in their vector form are not bound to the chromosome.
- plasmid and "vector” are used interchangeably as the plasmid is the most commonly used form of vector.
- vector is intended to include such other forms of expression vectors which serve equivalent functions and which become known in the art subsequently hereto;
- wild-type allele or "normal allele” refer to an allele of a gene which, when present in two copies in a subject results in a wild-type phenotype. There can be several different wild-type alleles of a specific gene, since certain nucleotide changes in a gene may not affect the phenotype of a subject having two copies of the gene with the nucleotide changes. In general a "wild-type allele” is the most common allele in a population; and
- xenobiotic refers to any substance that does not occur naturally but will affect living systems.
- the cytochrome P450 family of enzymes is primarily responsible for the metabolism of xenobiotics such as drugs, carcinogens and environmental chemicals, as well as several classes of endobiotics such as steroids and prostaglandins. These generally lipophilic compounds must be metabolized to more polar products before they can be excreted.
- This metabolic process which is primarily catalyzed by hepatic enzymes, consists of a sequence of enzymatic steps that includes oxidation by a member of the cytochrome P450-dependent monooxygenases (phase I metabolism), followed by conjugation involving sulfation, glucoronidation or acetylation (phase II metabolism).
- cytochrome P450 genes which encodes products involved in phase I metabolism are known. There are multiple forms of these P450s, and each of these individual forms exhibit degrees of specificity towards individual chemicals in the above classes of compounds. In some cases, a substrate, whether it be a drug or a carcinogen, is metabolized by more then one of the cytochrome P450s. Genetic polymorphisms of cytochrome P450s result in phenotypically-distinct subpopulations that differ in their ability to metabolize particular drugs and other chemical compounds. As those skilled in the art will understand, these phenotypic distinctions have important implications for the selection of drugs for any given patient.
- Cytochrome P450 2D6 (or P450IID6), also known as debrisoquine hydroxylase, is the best characterized polymorphic P450 in the human population (see e.g. Gonzalez et al. (1998)).
- the cytochrome P450 2D6 gene represents a major Phase I drug metabolizing enzyme and is involved in the metabolism of numerous drugs. While CYP2D6 contributes only approximately 1.5% of the P450 protein present in human liver, it is responsible for approximately 24% of P450 drug metabolism activity (see Wolf & Smith (2000) Brit Med Bull 55: 366-386). The CYP2D6-encoded P450 appears to be particularly important in the metabolism of drugs targeted to the central nervous system. CYP2D6 is found in the brain (Gilham et al. (1997) Xenobiotica 27: 111-25) and may, therefore, have evolved to protect cells from environmental neurotoxins (Smith et al. (1992) Lancet 339: 1365-72).
- this gene locus results in various altered enzymatic activities of this gene with the majority of individuals possessing normal activity (extensive metabolizers), some individuals possessing slightly reduced activity (intermediate metabolizers), and some individuals with increased enzyme activity, in part due to gene duplications (rapid metabolizers). Individuals who lack enzyme activity, due to inactivating mutations in both copies of the CYP2D6 gene, are unable to metabolize drugs that require the CYP2D6 enzyme and are referred to as CYP2D6 poor metabolizers.
- Genetic screening involves testing to determine if a patient has mutations (or alleles or polymorphisms) that either cause a disease state, contribute to a disease state (i.e., are a risk factor associated with a disease state), are "linked” to the mutation causing a disease state, or are "linked” to the mutation which contributes to the disease state.
- Linkage refers to the phenomenon wherein DNA sequences that are close together in the genome have a tendency to be inherited together. Two sequences may be linked because of some selective advantage of co-inheritance. More typically, however, two polymorphic sequences are co-inherited because of the relative infrequency with which meiotic recombination events occur within the region between the two polymorphisms. The co-inherited polymorphic alleles are said to be in linkage disequilibrium with one another because, in a given human population, they tend to either both occur together or else not occur at all in any particular member of the population.
- the present invention provides a novel human CYP2D6 polymorphic variation, i.e., at position 5816 of the CYP2D6 gene corresponding to a substitution of the sequence "TA" for the "C” at position 5816 of the CYP2D6 genomic sequence (GenBank Accession No. M33388; SEQ ID NO. 1 shown in FIGURE 2) and at position 1474 of the CYP2D6 cDNA sequence (GenBank Accession No. NM_000106; SEQ ID NO. 3 shown in FIGURE 4).
- the cytochrome P450 2D6 gene represents a major phase I drug metabolizing enzyme and is involved in the metabolism of numerous drugs.
- the present invention provides a novel mutation in the CYP2D6 gene that is an insertion of two nucleotides in exon 9 of the gene. This mutation results in a frameshift within the critical carboxy-terminal region of the gene which, in the wild-type enzyme, is required for catalytic activity.
- an individual who possesses this C5816TA CYP2D6 gene mutation was found to further carry a nucleotide change of G to C at position 5799 of the CYP2D6 genomic sequence (GenBank Accession No. M33388; SEQ ID NO. 1 shown in FIGURE 2) and at position 1457 of the CYP2D6 cDNA sequence (GenBank Accession No. NM_000106; SEQ ID NO. 3 shown in FIGURE 4).
- the present invention provides methods and reagents for predicting susceptibility to diminished metabolism of drugs by detecting a cytochrome P450 CYP2D6 polymorphism of the invention.
- the present invention provides CYP2D6 genomic and cDNA nucleic acids, homologs thereof, and portions thereof.
- Preferred nucleic acids have a sequence at least about 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, and more preferably 85% homologous and more preferably 90% and more preferably 95% and even more preferably at least 99% homologous with a nucleotide sequence of a CYP2D6 gene, e.g., such as a sequence shown in one of SEQ ID NOs: 1, 2, 3, or 4 or complement thereof of the CYP2D6 nucleic acids having the GenBank Accession Nos.
- nucleic acid is human, preferably mammalian and in a particularly preferred embodiment, includes all or a portion of the nucleotide sequence corresponding to the coding region of the CYP2D6 P450 polypeptide, or mutant variant thereof, such as the nucleic acid set forth in SEQ ID NOs. 1-4.
- the invention also provides isolated nucleic acids comprising a nucleotide sequence encoding CYP2D6 polypeptides, variants and/or equivalents of such nucleic acids.
- the term equivalent is understood to include nucleotide sequences encoding functionally equivalent CYP2D6 polypeptides or functionally equivalent peptides having an activity of an CYP2D6 protein such as described herein.
- equivalent nucleotide sequences will include sequences that differ by one or more nucleotide substitution, addition or deletion, such as allelic variants; and will, therefore, include sequences that differ from the nucleotide sequence of the CYP2D6 gene shown in SEQ ID NOs. 1, 2, 3, or 4 due to the degeneracy of the genetic code.
- the nucleic acids are vertebrate CYP2D6 nucleic acids.
- the nucleic acids are mammalian CYP2D6 nucleic acids. Regardless of species, particularly preferred CYP2D6 nucleic acids encode polypeptides that are at least 60%, 65%, 70%, 72%, 74%, 76%, 78%, 80%, 90%, or 95% similar or identical to an amino acid sequence of a vertebrate CYP2D6 protein.
- the nucleic acid is a cDNA encoding a polypeptide having at least one bio-activity of the subject CYP2D6 polypeptide.
- the nucleic acid includes all or a portion of the nucleotide sequence corresponding to the nucleic acid of SEQ ID NOs. 1, 2, 3 or 4.
- nucleic acids of the present invention encode CYP2D6 polypeptides which are comprised of at least 2, 5, 10, 25, 50, 100, 150 or 200 amino acid residues.
- nucleic acids can comprise about 50, 60, 70, 80, 90, or 100 base pairs.
- nucleic acid molecules for use as probes/primer or antisense molecules i.e. noncoding nucleic acid molecules, which can comprise at least about 6, 12, 20, 30, 50, 60, 70, 80, 90 or 100 base pairs in length.
- nucleic acid which hybridizes under stringent conditions to a nucleic acid represented by SEQ ID NOs. 1, 2, 3, or 4 or complement thereof.
- Appropriate stringency conditions which promote DNA hybridization for example, 6.0 x SSC at about 45° C, followed by a wash of 2.0 x SSC at 50°C, are known to those skilled in the art or can be found in Current Protocols in Molecular Biology , John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6 or in Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press (1989).
- the salt concentration in the wash step can be selected from a low stringency of about 2.0 x SSC at 50°C to a high stringency of about 0.2 x SSC at 50°C.
- the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22°C, to high stringency conditions at about 65°C. Both temperature and salt may be varied, or temperature and salt concentration may be held constant while the other variable is changed.
- an CYP2D6 nucleic acid of the present invention will bind to one of SEQ ID NOs. 1, 2, 3, or 4 or complement thereof under moderately stringent conditions, for example at about 2.0 x SSC and about 40° C.
- a CYP2D6 nucleic acid of the present invention will bind to one of SEQ ID NOs. 1, 2, 3, or 4 or complement thereof under high stringency conditions.
- a CYP2D6 nucleic acid sequence of the present invention will bind to one of SEQ ID NOs. 3, which correspond to CYP2D6 ORF nucleic acid sequences, under high stringency conditions.
- Nucleic acids having a sequence that differs from the nucleotide sequences shown in one of SEQ ID NOs. of the present invention, or complement thereof, due to degeneracy in the genetic code are also within the scope of the invention.
- Such nucleic acids encode functionally equivalent peptides (i.e., peptides having a biological activity of a CYP2D6 polypeptide) but differ in sequence from the sequence shown in the sequence listing due to degeneracy in the genetic code. For example, a number of amino acids are designated by more than one triplet.
- Codons that specify the same amino acid, or synonyms may result in "silent" mutations which do not affect the amino acid sequence of a CYP2D6 polypeptide.
- DNA sequence polymorphisms that do lead to changes in the amino acid sequences of the subject CYP2D6 polypeptides will exist among mammals.
- these variations in one or more nucleotides (e.g., up to about 3-5% of the nucleotides) of the nucleic acids encoding polypeptides having an activity of an CYP2D6 polypeptide may exist among individuals of a given species due to natural allelic variation.
- the nucleotide sequences determined from the cloning of CYP2D6 genes from mammalian organisms will further allow for the generation of probes and primers designed for detecting a CYP2D6 C5816TA allelic variant by any means such as by detection of an amplification product using a C5816TA allele-specific primer or by detecting the presence of the CYP2D6 C5816TA allelic variant using an ASO detector probe.
- probes and primers designed for detecting a CYP2D6 C5816TA allelic variant by any means such as by detection of an amplification product using a C5816TA allele-specific primer or by detecting the presence of the CYP2D6 C5816TA allelic variant using an ASO detector probe.
- RFLP restriction fragment length polymorphism
- the CYP2D6 primers are designed so as to optimize specificity and avoid secondary structures which affect the efficiency of priming.
- Optimized CYP2D6 primers may also be designed by using various programs, such as "Primer3" provided by the Whitehead Institute for Biomedical Research at http://www-genome.wi.mit.edu/cgi-bin/primer/primer3.cgi.
- the CYP2D6 probes and primers can be used to detect CYP2D6 locus polymorphisms which occur within and surrounding the CYP2D6 gene sequence, in particular the C5816TA and/or the G5799C wild-type and mutant polymorphic alleles. Genetic variations within the CYP2D6 locus are associated with sensitivity to drugs metabolized by the CYP2D6 P450 monooxygenase. Accordingly, the invention provides probes and primers for CYP2D6 locus polymorphisms, including polymorphisms associated with the human and mouse CYP2D6 gene.
- PCR primers of the invention include those which flank an CYP2D6 human polymorphism and allow amplification and analysis of this region of the genome. Analysis of polymorphic allele identity may be conducted, for example, by direct sequencing or by the use of allele-specific capture probes or by the use of molecular beacon probes.
- the polymorphic allele may allow for direct detection by the creation or elimination of a restriction endonuclease recognition site(s) within the PCR product or after an appropriate sequence modification is designed into at least one of the primers such that the altered sequence of the primer, when incorporated into the PCR product resulting from amplification of a specific CYP2D6 polymorphic allele, creates a unique restriction site in combination with at least one allele but not with at least one other allele of that polymorphism.
- CYP2D6 polymorphisms corresponding to variable number of tandem repeat (VNTR) polymorphisms may be detected by the electrophoretic mobility and hence size of a PCR product obtained using primers which flank the VNTR.
- Still other CYP2D6 polymorphisms corresponding to RFLPs may be detected directly by the mobility of bands on a Southern blot using appropriate CYP2D6 locus probes and genomic DNA or cDNA obtained from an appropriate sample organism such as a human or a non-human animal.
- probes based on the subject CYP2D6 sequences can be used to detect transcripts or genomic sequences encoding the same or homologous proteins, for use, e.g, in prognostic or diagnostic assays (further described below).
- the present invention provides probes which are common to alternatively-spliced variants of the CYP2D6 transcript, such as those corresponding to at least 12 consecutive nucleotides complementary to a sequence found in any of SEQ ID NOs. of the present invention.
- the present nvention provides probes which hybridize specifically to alternatively spliced forms of the CYP2D6 transcript.
- any suitable probes and primers can be prepared and modified, e.g., as previously described herein for other types of nucleic acids.
- the present invention provides methods for determining whether an individual has a genetic deficiency for metabolizing certain agents, e.g., has a poor metabolizer genetype by detecting the presence of a cytochrome P450 CYP2D6 gene C5816TA polymorphism in a genomic DNA or cDNA sample from the individual.
- Any suitable methods for detecting the presence of this polymorphism are included within the scope of the instant invention; however, in a particularly preferred embodiment of such methods, the method includes the step of an initial amplification, preferably by PCR, of a segment of the CYP2D6 gene which includes the 5816 polymorphic locus, and the subsequent detection of an amplification product which includes the C5816TA sequence change.
- such amplification is achieved with allele specific oligonucleotide primers having 3' terminal nucleotide sequence which correspond to the wild-type 5816 nucleotide sequence (i.e. "C"), or complement thereof, or at least one nucleotide of the mutant 5816-5817 TA sequence.
- allele-specific amplification primers fail to produce an amplification product unless the allele which they are specific for is present in the patient genomic or cDNA sample.
- Suitable C5816TA- specific amplification primers comprise a sequence of at least 10 consecutive nucleotides of SEQ ID NO. 2 or SEQ ID NO. 4, or complement thereof, and further feature a 3' terminal nucleotide which is the T at position 5816 of SEQ ID NO. 2, the T at position 1474 of SEQ ID NO. 4, the A at position 5817 of SEQ ID NO. 2, or the A at position 1475 of SEQ ID NO. 4.
- Particularly preferred C5816TA- specific amplification primers of the invention include, for example, the sequences CATCCCCCTATGAGT (SEQ ID NO. 11), ATCCCCCTATGAGTA (SEQ ID NO. 12), GGGCACAGCACAAAT (SEQ ID NO. 13), or GGCACAGCACAAATA (SEQ ID NO. 14).
- the presence of the C5816TA polymorphism in a patient's genomic or cDNA sample is indicated by the production of an amplification product with the C5816TA allele specific primer; however, other suitable methods of detecting the C5816TA polymorphic variation are also included in the present invention.
- an allele-specific oligonucleotide (ASO) detector that includes the TA sequence at position 5816-5817 of SEQ ID NO. 2 may be used to detect the C5816TA mutation.
- Preferred ASO detector oligonucleotides of the invention include: CCTATGAGTATTTGTGCT (SEQ ID NO. 21) and AGCACAAATACTCATAGG (SEQ ID NO. 22).
- detection of the C5816TA allelic variant may be achieved by a restriction endonuclease analysis such as by RFLP analysis (i.e. a Southern blot following restriction digestion of an unamplified genomic or cDNA sample) or by restriction of an appropriate amplification product.
- RFLP analysis i.e. a Southern blot following restriction digestion of an unamplified genomic or cDNA sample
- restriction of an appropriate amplification product i.e. a Southern blot following restriction digestion of an unamplified genomic or cDNA sample.
- a second alteration in susceptibility to restriction endonuclease digestion is caused by a G5799C mutation which was found associated with the C5816TA mutation in a patient sample.
- the presence of the G5799C allelic variant of CYP2D6 exon 9 is indicated by the loss of Ban II, CviJI, or Bsp1286I restriction sites which are present in the corresponding position of a wild type CYP2D6 DNA.
- primers capable of amplifying the C5816TA allelic variant.
- such primers include a sequence of at least 10 consecutive nucleotides of SEQ ID NO. 2 or SEQ ID NO. 4, or complement thereof, and further possess a 3' terminal nucleotide that is C5816TA allele-specific such as the T at position 5816 of SEQ ID NO. 2, the T at position 1474 of SEQ ID NO. 4, the A at position 5817 of SEQ ID NO. 2, or the A at position 1475 of SEQ ID NO. 4.
- Particularly preferred mutant allele-specific primers feature a 3' sequence such as CATCCCCCTATGAGT (SEQ ID NO. 11), ATCCCCCTATGAGTA (SEQ ID NO.
- allele specific oligonucleotide for the detection of the C5816TA allelic variant include a sequence of at least 10 consecutive nucleotides of SEQ ID NO. 2 or SEQ ID NO. 4, or complement thereof, and further feature the nucleotide pair TA at position 5816-5817 of SEQ ID NO. 2 and position 1474-1475 of SEQ ID NO. 4, or complement thereof.
- Preferred allele specific oligonucleotides of this type include, for example, sequences CCTATGAGTATTTGTGCT (SEQ ID NO. 21) or AGCACAAATACTCATAGG (SEQ ID NO. 22).
- the present invention also provides methods for determining whether an individual is susceptible to being a PM of drugs by detecting the presence of a G5799C sequence change which was found associated with the cytochrome P450 CYP2D6 gene C5816TA polymorphic change in a patient sample.
- a PM phenotype resulting from the C5816TA P450 2D6-inactivating mutation is inferred from the presence of the closely linked G5799C mutation.
- a further application of this principle may be employed to determine an entire C5816TA haplotype of polymorphisms associated with the C5816TA inactivating mutation.
- Primers of the present invention which are capable of amplifying the G5799C allelic variant of CYP2D6 exon 9 preferably include a 3'oligonucleotide sequence such as TGCTTTCCTGGTGAC (SEQ ID NO. 17) or CATAGGGGGATGGGG (SEQ ID NO. 18). Detection of amplified DNA that codes for the G5799C allelic variant of CYP2D6 exon 9, can also be achieved using allele specific oligonucleotides such as CCTGGTGACCCCATCCC (SEQ ID NO. 25), or GGGATGGGGTCACCAGG (SEQ ID NO. 26).
- the present invention provides protein-based methods for detecting the C5816TA PM polymorphism.
- the C5816TA mutation results in a frame shift in the critical carboxy-terminal domain of this P450 open reading frame.
- the frame-shift results in the production of a mutant polypeptide with an altered carboxy-terminus (i.e., YLCCAPLEWGT (SEQ ID NO. 27) in place of the normal CYP2D6 carboxy-terminal sequence LCAVPR (SEQ ID NO. 28), see FIGURE 6).
- a stable mutant CYP2D6 C5816TA polypeptide can be detected in a patient protein sample by the use of an appropriate antibody, such as a monoclonal antibody that recognizes an epitope of the YLCCAPLEWGT mutant carboxy-terminal sequence, prepared based upon the present description.
- the present invention relates to the discovery of a novel genetic polymorphism in exon 9 of the CYP2D6 gene that results in a frame shift in the CYP2D6 P450 gene product and loss of P450 enzymatic activity.
- the sequence change corresponds to a mutation at position 5816 of the CYP2D6 gene as numbered in GenBank Accession No. M33388 and as depicted in FIGURE 2.
- the mutant frame-shifted allele contains the sequence "TA" inserted in place of the "C” at position 5816 of the wild type CYP2D6 genomic sequence (FIGURE 2, SEQ ID NO. 1), resulting in the creation of a mutant C5816TA genomic sequence (FIGURE 3, SEQ ID NO. 2).
- the mutant frame-shift is within exon 9 of the CYP2D6 gene and occurs at position 1474 of the CYP2D6 cDNA (FIGURE 4; GenBank Accession No. NM_000106; and SEQ ID NO. 3), resulting in the creation of a mutant C5816TA cDNA sequence (FIGURE 5; SEQ ID NO. 4).
- CYP2D6 C5816TA mutant allele is associated with an altered enzyme activity potentially leading (i) to undesirable effects when individuals are treated with standard doses of certain agents; (ii) to increased susceptibility to cancer following environmental exposures; or (iii) other clinical conditions. Detection of DNA variants at the CYP2D6 locus offers a strategy for identifying individuals at risk based on their genotype, prior to treatment.
- the detection of the CYP2D6 C5816TA mutant allele may be effected using any known state-of-the-art hybridization approaches, including, but not limited to, Southern blot, reverse dot-blot and liquid phase hybridization, as those skilled in the art will understand how to perform based upon the present description.
- Reverse dot blot refers to a treatment of a support (such as nylon membrane) to which is attached an ASO capable of hybridizing with a labeled complementary probe (such as amplified DNA).
- a labeled complementary probe such as amplified DNA
- the detection of specific mutations within a gene of interest is through hybridization of PCR products with ASO probes for the wild type or variant alleles utilized in parallel hybridizations. Only the oligonucleotide that precisely hybridizes to the target sequences produces a signal from a labeled probe.
- This genotyping method which require small amounts of nucleated cells derived from a variety of sources, is not affected by the underlying disease or by drugs taken by the patient, and it provides results within a suitable period of time, such as, for example, within about 24-48 hours, thus allowing for relatively rapid intervention.
- the present invention provides diagnostic tests, e.g., to identify individuals with altered xenobiotics-metabolizing activities based on their genotypes. Such diagnostic tests to determine the genotypes of individuals are advantageous, e.g., because, as those skilled in the art will appreciate, the measurement of enzymatic activities can have many undesirable limitations. Accordingly, tests are provided for detecting mutations in the CYP2D6 gene.
- these tests involve the amplification of all, or a portion of, the CYP269 genomic locus, or cDNA, where the mutations of interest are found. Following amplification, the amplified fragments can then be assayed for the presence, or absence, of the specific mutation of interest (i.e. at least one of the mutations) by using hybridization with ASO probes.
- the present invention provides isolated oligonucleotide molecules comprising sequences hybridizing to genes encoding xenobiotic metabolizing enzyme CYP2D6, wild type and mutant alleles thereof; wherein said sequences are sufficiently complementary to said genes to hybridize therewith, respectively.
- an isolated oligonucleotide molecule comprising a mutant allele of CYP2D6 which contains a point mutation at position 5816 corresponding to a C to TA substitution and which, further, may optionally also contain a point mutation at position 5799 corresponding to a G to C substitution.
- mutant oligonucleotide molecules of the present invention include, for example, those having a nucleic acid sequence of at least about 10 to 25 consecutive nucleotides of SEQ ID NO. 2 or 4; while preferred wild type oligonucleotide molecules include, for example, those having a nucleic acid sequence of at least about 10 to 25 consecutive nucleotides of SEQ ID NO. 1 or 3.
- diagnostic assays for determining genetic variants in a CYP2D6 gene in a subject comprise the steps of: a) obtaining a genomic DNA sample of said subject; b) using the DNA sample of step a), amplifying a fragment comprising a polymorphic site of the CYP2D6 genes; c) hybridizing the amplified fragment of step b) with ASO probes corresponding to wild type and variant alleles to determine the CYP2D6 genotype of the subject.
- the amplifying step b) is effected with PCR primers as set forth below.
- the method further comprises a step i) before step c) consisting in subjecting the amplified fragment of step b) to Southern dot blot transfer on membrane, and wherein step c) is effected by hybridizing the dot blots with the oligonucleotide.
- a labeled ASO probe is used in step c) and is selected from the sequences set forth below and hybridizes under stringent conditions.
- the invention further provides diagnostic kits for determining DNA variations in the CYP2D6 gene in a subject, which comprises: a) at least one of PCR primer sets; and b) at least one of the ASO probe.
- the invention utilizes methods of detecting the presence of other CYP2D6 polymorphisms, in combination with the CYP2D6 C5816TA polymorphic variation of the invention.
- CYP2D6 polymorphisms Several null CYP2D6 alleles have been characterized and PCR-RFLP assays have been developed for convenient genotyping (Gonzalez and Meyer 1991). The most common alleles are CYP2D6 *3 (1bp deletion at pos. A2637) and *4 (splice-site mutation G1934A), accounting for over 96% of all null alleles ( as described in WO/0024926, the content of which are incorporated herein by reference).
- the methods of the present invention provide means for determining if a subject has (diagnostic) or is at risk of developing (prognostic) aan agent sensitivity condition or disorder that is associated with an aberrant CYP2D6 activity, e.g., an aberrant level of CYP2D6 protein or an aberrant CYP2D6 bioactivity.
- aan agent sensitivity condition or disorder that is associated with an aberrant CYP2D6 activity, e.g., an aberrant level of CYP2D6 protein or an aberrant CYP2D6 bioactivity.
- drugs to which CYP2D6 mutations cause sensitivity include: chlorpromazine, clomipramine, clozapine, desipramine, fluoxetine, fluphenazine, fluvoxamine, haloperidol, levopromazine, mianserin, nortryptiline, paroxetine, perphenazine, risperidone, sertraline, thioridazine, trifluperidol, trimipramine and zuclopenthixol (see Wolf & Smith (1999) Brit Med Bull 55: 366-86).
- drugs metabolized by P450 CYP2D6 include: alprenolol, amiflavine, amiodorone, amitryptline, apigenin, budesonide, bufuralol, bupranolol, chloral hydrate, clonidine, clotrimazole, codeine, cyclobenzaprine, dexfenfluramine, dextromethorphan, dibucaine, dihydroergotamine, dolasetron, doxorubicin, encainide, ethinylestradiol, ethylmorphine, fenoterol, flecainide, formoterol, guanoxan, 4-hydroxy amphetamine, imipramine, indoramine, ketoconazole, laudanosine, loratadine, MDMA (ecstacy), mefloquine, methoxamine HCI, methoxyphenamine, methoxypsoralen, me
- Preferred methods for detecting altered CYP2D6 activity resulting from a CYP2D6 polymorphism include genetic assays such as RFLP (restriction fragment length polymorphism), ASO PCR (allele specific oligonucleotide hybridization to PCR products or PCR using mutant/wildtype specific oligo primers), SSCP (single stranded conformation polymorphism) and TGGE/DGGE (temperature or denaturing gradient gel electrophoresis), and MDE (mutation detection electrophoresis).
- RFLP restriction fragment length polymorphism
- ASO PCR allele specific oligonucleotide hybridization to PCR products or PCR using mutant/wildtype specific oligo primers
- SSCP single stranded conformation polymorphism
- TGGE/DGGE temperature or denaturing gradient gel electrophoresis
- MDE mutant detection electrophoresis
- the invention provides methods for determining whether a subject has or is likely to develop, a disease or condition that is caused by or contributed to by an abnormal CYP2D6 level or bioactivity, for example, comprising determining the level of a CYP2D6 gene or protein, a CYP2D6 bioactivity and/or the presence of a mutation or particular polymorphic variant in the CYP2D6 gene.
- the method comprises determining whether a subject has an abnormal mRNA and/or protein level of CYP2D6, such as by Northern blot analysis, reverse transcription-polymerase chain reaction (RT-PCR), in situ hybridization, immunoprecipitation, Western blot hybridization, or immunohistochemistry.
- a subject has an abnormal mRNA and/or protein level of CYP2D6, such as by Northern blot analysis, reverse transcription-polymerase chain reaction (RT-PCR), in situ hybridization, immunoprecipitation, Western blot hybridization, or immunohistochemistry.
- RT-PCR reverse transcription-polymerase chain reaction
- immunoprecipitation e.g., Western blot hybridization
- Western blot hybridization e.g., Western blot hybridization, or immunohistochemistry.
- cells are obtained from a subject and the CYP2D6 protein or mRNA level is determined and compared to the level of CYP2D6 protein or mRNA level in a healthy subject
- the method comprises measuring at least one activity of CYP2D6, such as a monoxygenase activity, using techniques known in the art, and those skilled in the art based upon the present description will understand how to perform such measurements. Comparison of the results obtained with results from similar analysis performed on CYP2D6 proteins from healthy subjects is indicative of whether a subject has an abnormal CYP2D6 activity.
- the methods for determining whether a subject has or is at risk for developing a disease, which is caused by or contributed to by an aberrant CYP2D6 activity is characterized as comprising detecting, in a sample of cells from the subject, the presence or absence of a genetic alteration characterized by at least one of (i) an alteration affecting the integrity of a gene encoding a CYP2D6 polypeptide, particularly a C5816TA mutation, or (ii) the mis-expression of the CYP2D6 gene.
- such genetic alterations can be detected by ascertaining the existence of at least one of (i) a deletion of one or more nucleotides from a CYP2D6 gene, (ii) an addition of one or more nucleotides to a CYP2D6 gene, (iii) a substitution of one or more nucleotides of a CYP2D6 gene, (iv) a gross chromosomal rearrangement of a CYP2D6 gene, (v) a gross alteration in the level of a messenger RNA transcript of a CYP2D6 gene, (vii) aberrant modification of a CYP2D6 gene, such as of the methylation pattern of the genomic DNA, (vii) the presence of a non-wild type splicing pattern of a messenger RNA transcript of a CYP2D6 gene, (viii) a non-wild type level of a CYP2D6 polypeptide, (ix) allelic loss of a CYP
- the present invention provides a large number of assay techniques for detecting alterations in a CYP2D6 gene. These methods include, but are not limited to, methods involving sequence analysis, Southern blot hybridization, restriction enzyme site mapping, and methods involving detection of absence of nucleotide pairing between the nucleic acid to be analyzed and a probe. These and other methods are further described infra.
- Specific diseases or disorders e.g., genetic diseases or disorders
- specific allelic variants of polymorphic regions of certain genes which do not necessarily encode a mutated protein.
- SNP single nucleotide polymorphism
- Polymorphic regions in genes e.g, CYP2D6 genes, can be identified, by determining the nucleotide sequence of genes in populations of individuals.
- a polymorphic region e.g., SNP
- the link with a specific disease can be determined by studying specific populations of individuals, e.g, individuals which developed a specific disease, such as congestive heart failure, hypertension, hypotension, or a cancer (e.g. a cancer involving growth of a steroid responsive tumor or tumors).
- a polymorphic region can be located in any region of a gene, e.g., exons, in coding or non coding regions of exons, introns, and promoter region.
- CYP2D6 genes comprise polymorphic regions, specific alleles of which may be associated with specific diseases or conditions or with an increased likelihood of developing such diseases or conditions.
- the invention provides methods for determining the identity of the allele or allelic variant of a polymorphic region of a CYP2D6 gene in a subject, to thereby determine whether the subject has or is at risk of developing a disease or disorder associated with a specific allelic variant of a polymorphic region.
- a nucleic acid composition comprising a nucleic acid probe including a region of nucleotide sequence which is capable of hybridizing to a sense or antisense sequence of a CYP2D6 gene or naturally occurring mutants thereof, or 5' or 3' flanking sequences or intronic sequences naturally associated with the subject CYP2D6 genes or naturally occurring mutants thereof.
- the nucleic acid of a cell is rendered accessible for hybridization, the probe is contacted with the nucleic acid of the sample, and the hybridization of the probe to the sample nucleic acid is detected.
- Such techniques can be used to detect alterations or allelic variants at either the genomic or mRNA level, including deletions, substitutions, etc., as well as to determine mRNA transcript levels.
- a preferred detection method is allele specific hybridization using probes overlapping the mutation or polymorphic site and having about 5, 10, 20, 25, or 30 nucleotides around the mutation or polymorphic region.
- several probes capable of hybridizing specifically to allelic variants, such as single nucleotide polymorphisms, are attached to a solid phase support, e.g., a "chip".
- Oligonucleotides can be bound to a solid support by a variety of processes, including lithography. For example a chip can hold up to 250,000 oligonucleotides.
- a chip comprises all the allelic variants of at least one polymorphic region of a gene.
- the solid phase support is then contacted with a test nucleic acid and hybridization to the specific probes is detected. Accordingly, the methods of the present invention provide for the identification of numerous allelic variants of one or more genes in a simple hybridization experiment.
- detection of the alteration comprises utilizing the probe/primer in a PCR (see, e.g. U.S. Patent Nos. 4,683,195 and 4,683,202), such as anchor PCR or RACE PCR, or, alternatively, in a ligase chain reaction (LCR) (see, e.g., Landegran et al. (1988) Science 241:1077-1080; and Nakazawa et al. (1994) PNAS 91:360-364), the latter of which can be particularly useful for detecting point mutations in the CYP2D6 gene (see Abravaya et al. (1995) Nuc Acid Res 23:675-682).
- a PCR see, e.g. U.S. Patent Nos. 4,683,195 and 4,683,202
- LCR ligase chain reaction
- the method includes the steps of (i) collecting a sample of cells from a patient, (ii) isolating nucleic acid (e.g., genomic, mRNA or both) from the cells of the sample, (iii) contacting the nucleic acid sample with one or more primers which specifically hybridize to a CYP2D6 gene under conditions such that hybridization and amplification of the CYP2D6 gene (if present) occurs, and (iv) detecting the presence or absence of an amplification product, or detecting the size of the amplification product and comparing the length to a control sample.
- nucleic acid e.g., genomic, mRNA or both
- Alternative amplification methods for use in the present invention include: self sustained sequence replication (Guatelli, J.C. et al., 1990, Proc. Natl. Acad. Sci. USA 87:1874-1878), transcriptional amplification system (Kwoh, D.Y. et al., 1989, Proc. Natl. Acad. Sci. USA 86:1173-1177), Q-Beta Replicase (Lizardi, P.M. et al., 1988, Bio / Technology 6:1197), or any other nucleic acid amplification method, followed by the detection of the amplified molecules using techniques well known to those of skill in the art. These detection schemes are especially useful for the detection of nucleic acid molecules if such molecules are present in very low numbers.
- mutations in, or allelic variants, of a CYP2D6 gene from a sample cell are identified by alterations in restriction enzyme cleavage patterns.
- sample and control DNA is isolated, amplified (optionally), digested with one or more restriction endonucleases, and fragment length sizes are determined by gel electrophoresis.
- sequence specific ribozymes see, for example, U.S. Patent No. 5,498,531 can be used to score for the presence of specific mutations by development or loss of a ribozyme cleavage site.
- any of a variety of sequencing reactions known in the art can be used to directly sequence the CYP2D6 gene and detect mutations by comparing the sequence of the sample CYP2D6 with the corresponding wild-type (control) sequence.
- Exemplary sequencing reactions include those based on techniques developed by Maxim and Gilbert ( Proc. Natl Acad Sci USA (1977) 74:560) or Sanger (Sanger et al (1977) Proc . Nat. Acad. Sci 74:5463).
- any of a variety of automated sequencing procedures may be utilized when performing the subject assays ( Biotechniques (1995) 19:448), including sequencing by mass spectrometry (see, for example PCT publication WO 94/16101; Cohen et al. (1996) Adv Chromatogr 36:127-162; and Griffin et al. (1993) Appl Biochem Biotechnol 38:147-159).
- sequencing by mass spectrometry see, for example PCT publication WO 94/16101; Cohen et al. (1996) Adv Chromatogr 36:127-162; and Griffin et al. (1993) Appl Biochem Biotechnol 38:147-159.
- the occurrence of only one, two or three of the nucleic acid bases need be determined in the sequencing reaction. For instance, A-track or the like, e.g., where only one nucleic acid is detected, can be carried out.
- protection from cleavage agents can be used to detect mismatched bases in RNA/RNA or RNA/DNA or DNA/DNA heteroduplexes (Myers, et al. (1985) Science 230:1242).
- cleavage agents such as a nuclease, hydroxylamine or osmium tetroxide and with piperidine
- cleavage agents such as a nuclease, hydroxylamine or osmium tetroxide and with piperidine
- RNA/DNA duplexes can be treated with RNase and DNA/DNA hybrids treated with S1 nuclease to enzymatically digest the mismatched regions.
- either DNA/DNA or RNA/DNA duplexes can be treated with hydroxylamine or osmium tetroxide and with piperidine in order to digest mismatched regions. After digestion of the mismatched regions, the resulting material is then separated by size on denaturing polyacrylamide gels to determine the site of mutation.
- control DNA or RNA can be labeled for detection using methods known in the art based upon the present description.
- the mismatch cleavage reaction employs one or more proteins that recognize mismatched base pairs in double-stranded DNA (so called "DNA mismatch repair" enzymes) in defined systems for detecting and mapping point mutations in CYP2D6 cDNAs obtained from samples of cells.
- DNA mismatch repair enzymes
- the mutY enzyme of E. coli cleaves A at G/A mismatches and the thymidine DNA glycosylase from HeLa cells cleaves T at G/T mismatches (Hsu et al. (1994) Carcinogenesis 15:1657-1662).
- a probe based on a CYP2D6 sequence e.g., a wild-type CYP2D6 sequence
- a cDNA or other DNA product from a test cell(s).
- the duplex is treated with a DNA mismatch repair enzyme, and the cleavage products, if any, can be detected from electrophoresis protocols or the like. See, for example, U.S. Patent No. 5,459,039.
- alterations in electrophoretic mobility will be used to identify mutations or the identity of the allelic variant of a polymorphic region in CYP2D6 genes.
- SSCP may be used to detect differences in electrophoretic mobility between mutant and wild type nucleic acids (Orita et al. (1989) Proc Natl . Acad. Sci USA 86:2766, see also Cotton (1993) Mutat Res 285:125-144; and Hayashi (1992) Genet Anal Tech Appl 9:73-79). Single-stranded DNA fragments of sample and control CYP2D6 nucleic acids are denatured and allowed to renature.
- the secondary structure of single-stranded nucleic acids varies according to sequence, the resulting alteration in electrophoretic mobility enables the detection of even a single base change.
- the DNA fragments may be labelled or detected with labelled probes.
- the sensitivity of the assay may be enhanced by using RNA (rather than DNA), in which the secondary structure is more sensitive to a change in sequence.
- the subject method utilizes heteroduplex analysis to separate double stranded heteroduplex molecules on the basis of changes in electrophoretic mobility (Keen et al. (1991) Trends Genet 7:5).
- the movement of mutant or wild-type fragments in polyacrylamide gels containing a gradient of denaturant is assayed using denaturing gradient gel electrophoresis (DGGE) (Myers et al (1985) Nature 313:495).
- DGGE denaturing gradient gel electrophoresis
- DNA will be modified to insure that it does not completely denature, for example by adding a GC clamp of approximately 40 bp of high-melting GC-rich DNA by PCR.
- a temperature gradient is used in place of a denaturing agent gradient to identify differences in the mobility of control and sample DNA (Rosenbaum and Reissner (1987) Biophys Chem 265:12753).
- oligonucleotide primers may be prepared in which the known mutation or nucleotide difference (e.g., in allelic variants) is placed centrally and then hybridized to target DNA under conditions which permit hybridization only if a perfect match is found (Saiki et al. (1986) Nature 324:163); Saiki et al (1989) Proc. Natl Acad. Sci USA 86:6230).
- Such allele specific oligonucleotide hybridization techniques may be used to test one mutation or polymorphic region per reaction when oligonucleotides are hybridized to PCR amplified target DNA or a number of different mutations or polymorphic regions when the oligonucleotides are attached to the hybridizing membrane and hybridized with labelled target DNA.
- Oligonucleotides used as primers for specific amplification may carry the mutation or polymorphic region of interest in the center of the molecule (so that amplification depends on differential hybridization) (Gibbs et al (1989) Nucleic Acids Res. 17:2437-2448) or at the extreme 3' end of one primer where, under appropriate conditions, mismatch can prevent, or reduce polymerase extension (Prossner (1993) Tibtech 11:238.
- amplification may also be performed using Taq ligase for amplification (Barany (1991) Proc. Natl. Acad. Sci USA 88:189). In such cases, ligation will occur only if there is a perfect match at the 3' end of the 5' sequence making it possible to detect the presence of a known mutation at a specific site by looking for the presence or absence of amplification.
- identification of the allelic variant is carried out using an oligonucleotide ligation assay (OLA), as described, e.g., in U.S. Pat. No. 4,998,617 and in Landegren, U. et al., Science 241:1077-1080 (1988).
- OLA oligonucleotide ligation assay
- the OLA protocol uses two oligonucleotides which are designed to be capable of hybridizing to abutting sequences of a single strand of a target.
- One of the oligonucleotides is linked to a separation marker, e.g,. biotinylated, and the other is detectably labeled.
- oligonucleotides will hybridize such that their termini abut, and create a ligation substrate. Ligation then permits the labeled oligonucleotide to be recovered using avidin, or another biotin ligand.
- Nickerson, D. A. et al. have described a nucleic acid detection assay that combines attributes of PCR and OLA (Nickerson, D. A. et al., Proc. Natl . Acad. Sci. ( U.S.A. ) 87:8923-8927 (1990). In this method, PCR is used to achieve the exponential amplification of target DNA, which is then detected using OLA.
- U.S. Patent No. 5,593,826 discloses an OLA using an oligonucleotide having 3'-amino group and a 5'-phosphorylated oligonucleotide to form a conjugate having a phosphoramidate linkage.
- OLA OLA combined with PCR permits typing of two alleles in a single microtiter well. By marking each of the allele-specific primers with a unique hapten, i.e.
- each OLA reaction can be detected by using hapten specific antibodies that are labeled with different enzyme reporters, alkaline phosphatase or horseradish peroxidase.
- This system permits the detection of the two alleles using a high throughput format that leads to the production of two different colors.
- the invention further provides methods for detecting single nucleotide polymorphisms in a CYP2D6 gene. Because single nucleotide polymorphisms constitute sites of variation flanked by regions of invariant sequence, their analysis requires no more than the determination of the identity of the single nucleotide present at the site of variation and it is unnecessary to determine a complete gene sequence for each patient. Several methods have been developed to facilitate the analysis of such single nucleotide polymorphisms.
- the single base polymorphism can be detected by using a specialized exonuclease-resistant nucleotide, as disclosed, e.g., in Mundy, C. R. (U.S. Pat. No.4,656,127).
- a primer complementary to the allelic sequence immediately 3' to the polymorphic site is permitted to hybridize to a target molecule obtained from a particular animal or human. If the polymorphic site on the target molecule contains a nucleotide that is complementary to the particular exonuclease-resistant nucleotide derivative present, then that derivative will be incorporated onto the end of the hybridized primer. Such incorporation renders the primer resistant to exonuclease, and thereby permits its detection.
- a solution-based method is used for determining the identity of the nucleotide of a polymorphic site.
- Cohen, D. et al. (French Patent 2,650,840; PCT Appln. No. WO91/02087).
- a primer is employed that is complementary to allelic sequences immediately 3' to a polymorphic site. The method determines the identity of the nucleotide of that site using labeled dideoxynucleotide derivatives, which, if complementary to the nucleotide of the polymorphic site will become incorporated onto the terminus of the primer.
- GBATM Genetic Bit Analysis
- Goelet, P. et al. PCT Appln. No. WO92/15712, and U.S. Patent Nos. 5,762,876, 5,888,819, and 6,004,744.
- the method of Goelet, P. et al. uses mixtures of labeled terminators and a primer that is complementary to the sequence 3' to a polymorphic site.
- the labeled terminator that is incorporated is thus determined by, and complementary to, the nucleotide present in the polymorphic site of the target molecule being evaluated.
- the method of Goelet, P. et al. is preferably a heterogeneous phase assay, in which the primer or the target molecule is immobilized to a solid phase.
- RNA is initially isolated from available tissue and reverse-transcribed, and the segment of interest is amplified by PCR. The products of reverse transcription PCR are then used as a template for nested PCR amplification with a primer that contains an RNA polymerase promoter and a sequence for initiating eukaryotic translation.
- the unique motifs incorporated into the primer permit sequential in vitro transcription and translation of the PCR products.
- the appearance of truncated polypeptides signals the presence of a mutation that causes premature termination of translation.
- DNA as opposed to RNA is used as a PCR template when the target region of interest is derived from a single exon.
- the methods described herein may be performed, for example, by utilizing pre-packaged diagnostic kits comprising at least one probe nucleic acid, primer set; and/or antibody reagent described herein, which may be conveniently used, e.g. , in clinical settings to diagnose patients exhibiting symptoms or family history of a disease or illness involving a CYP2D6 polypeptide.
- a bodily fluid e.g., blood
- a bodily fluid e.g., blood
- a bodily fluid can be obtained by known techniques (e.g. venipuncture).
- nucleic acid tests can be performed on dry samples (e.g. hair or skin).
- fetal nucleic acid samples can be obtained from maternal blood as described in International Patent Application No. WO91/07660 (and counterpart U.S. Patent No. 5,641,628).
- amniocytes or chorionic villi may be obtained using methods known in the art for performing prenatal testing.
- RNA or protein When using RNA or protein to determine the presence of a mutation or of a specific allelic variant of a polymorphic region of a CYP2D6 gene, the cells or tissues that may be utilized must express the CYP2D6 gene. Preferred cells for use in these methods include, for example, cardiac cells (see EXAMPLES). Alternative cells or tissues that can be used, can be identified by determining the expression pattern of the specific CYP2D6 gene in a subject, such as by Northern blot analysis, based upon the present description.
- Diagnostic procedures may also be performed in situ directly upon tissue sections (fixed and/or frozen) of patient tissue obtained from biopsies or resections, such that no, or substantially no, nucleic acid purification would be deemed necessary by those skilled in the art.
- Nucleic acid reagents may be used as probes and/or primers for such in situ procedures (see, for example, Nuovo, G.J., 1992, PCR i n situ hybridization: protocols and applications, Raven Press, NY).
- Fingerprint profiles may be generated, for example, by utilizing a differential display procedure, Northern analysis and/or RT-PCR, based upon the present description.
- Antibodies directed against wild type or mutant CYP2D6 polypeptides or allelic variants thereof, which are discussed above, may also be used in disease diagnostics and prognostics. Such diagnostic methods, may be used to detect abnormalities in the level of CYP2D6 polypeptide expression, or abnormalities in the structure and/or tissue, cellular, or subcellular location of a CYP2D6 polypeptide. Structural differences may include, for example, differences in the size, electronegativity, or antigenicity of the mutant CYP2D6 polypeptide relative to the normal CYP2D6 polypeptide.
- Protein from the tissue or cell type to be analyzed may be detected or isolated using techniques which are well known to one of skill in the art, including but not limited to western blot analysis.
- western blot analysis For a detailed explanation of methods for carrying out Western blot analysis, see Sambrook et al, 1989, supra, at Chapter 18.
- the protein detection and isolation methods employed herein may also be such as those described in Harlow and Lane, for example, (Harlow, E. and Lane, D., 1988, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York).
- immunofluorescence techniques employing a fluorescently labeled antibody (see below) coupled with light microscopic, flow cytometric, or fluorimetric detection.
- the antibodies (or fragments thereof) useful in the present invention may, additionally, be employed histologically, as in immunofluorescence or immunoelectron microscopy, for in situ detection of CYP2D6 polypeptides. In situ detection may be accomplished by removing a histological specimen from a patient, and applying thereto a labeled antibody of the present invention.
- the antibody (or fragment) is preferably applied by overlaying the labeled antibody (or fragment) onto a biological sample.
- a solid phase support or carrier is used as a support capable of binding an antigen or an antibody.
- supports or carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, gabbros, and magnetite.
- the nature of the carrier can be either soluble to some extent or insoluble for the purposes of the present invention.
- the support material may have virtually any possible structural configuration so long as the coupled molecule is capable of binding to an antigen or antibody.
- the support configuration may be spherical, as in a bead, or cylindrical, as in the inside surface of a test tube, or the external surface of a rod.
- the surface may be flat such as a sheet, test strip, etc.
- Preferred supports include, for example, polystyrene beads. Those skilled in the art will know many other suitable carriers for binding antibody or antigen, or will be able to ascertain the same by use of routine experimentation.
- EIA enzyme immunoassay
- Enzymes which can be used to detectably label the antibody include, but are not limited to, malate dehydrogenase, staphylococcal nuclease, delta-5-steroid isomerase, yeast alcohol dehydrogenase, alpha-glycerophosphate, dehydrogenase, triose phosphate isomerase, horseradish peroxidase, alkaline phosphatase, asparaginase, glucose oxidase, beta-galactosidase, ribonuclease, urease, catalase, glucose-6-phosphate dehydrogenase, glucoamylase and acetylcholinesterase.
- the detection can be accomplished by colorimetric methods which employ a chromogenic substrate for the enzyme. Detection may also be accomplished by visual comparison of the extent of enzymatic reaction of a substrate in comparison with similarly prepared standards.
- Detection may also be accomplished using any of a variety of other immunoassays.
- a radioimmunoassay RIA
- the radioactive isotope can be detected by such means as the use of a gamma counter or a scintillation counter or by autoradiography.
- fluorescent labeling compounds fluorescein isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, o -phthaldehyde and fluorescamine.
- the antibody can also be detectably labeled using fluorescence emitting metals such as 152Eu, or others of the lanthanide series. These metals can be attached to the antibody using such metal chelating groups as diethylenetriaminepentacetic acid (DTPA) or ethylenediaminetetraacetic acid (EDTA).
- DTPA diethylenetriaminepentacetic acid
- EDTA ethylenediaminetetraacetic acid
- the antibody also can be detectably labeled by coupling it to a chemiluminescent compound.
- the presence of the chemiluminescent-tagged antibody is then determined by detecting the presence of luminescence that arises during the course of a chemical reaction.
- chemiluminescent labeling compounds are luminol, isoluminol, theromatic acridinium ester, imidazole, acridinium salt and oxalate ester.
- Bioluminescence is a type of chemiluminescence found in biological systems in, which a catalytic protein increases the efficiency of the chemiluminescent reaction. The presence of a bioluminescent protein is determined by detecting the presence of luminescence. Important bioluminescent compounds for purposes of labeling are luciferin, luciferase and aequorin.
- any of the above methods for detecting alterations in a gene or gene product or polymorphic variants can be used to monitor the course of treatment or therapy.
- probes are generated by amplifying or synthesizing a substantial portion of the coding regions of various genes of interest. These genes are then spotted onto a solid support. mRNA samples are obtained, converted to cDNA, amplified and labeled (usually with a fluorescence label). The labeled cDNAs are then applied to the array, and cDNAs hybridize to their respective probes in a manner that is linearly related to their concentration. Detection of the label allows measurement of the amount of each cDNA adhered to the array.
- Arrays are often divided into microarrays and macroarrays, where microarrays have a much higher density of individual probe species per area. Microarrays may have as many as 1000 or more different probes in a 1 cm 2 area. There is no concrete cut-off to demarcate the difference between micro- and macroarrays, and both types of arrays are contemplated for use with the invention. However, because of their small size, microarrays provide great advantages in speed, automation and cost-effectiveness.
- Microarrays are known in the art and consist of a surface to which probes that correspond in sequence to gene products (e.g., cDNAs, mRNAs, oligonucleotides) are bound at known positions.
- the microarray is an array (i.e., a matrix) in which each position represents a discrete binding site for a product encoded by a gene (e.g., a protein or RNA), and in which binding sites are present for products of most or almost all of the genes in the organism's genome.
- the "binding site” (hereinafter, "site") is a nucleic acid or nucleic acid analogue to which a particular cognate cDNA can specifically hybridize.
- the nucleic acid or analogue of the binding site can be, e.g., a synthetic oligomer, a full-length cDNA, a less-than full length cDNA, or a gene fragment.
- the microarray contains binding sites for products of all or almost all genes in the target organism's genome, such comprehensiveness is not necessarily required.
- the microarray will have binding sites corresponding to at least 100 genes and more preferably, 500, 1000, 4000 or more. In certain embodiments, the most preferred arrays will have about 98-100% of the genes of a particular organism represented.
- the invention provides customized microarrays that have binding sites corresponding to fewer, specifically selected genes. Microarrays with fewer binding sites are cheaper, smaller and easier to produce. In particular, the invention provides microarrays customized for the determination of graft status.
- customized microarrays comprise binding sites for fewer than 4000, fewer than 1000, fewer than 200 or fewer than 50 genes, and comprise binding sites for at least 2, preferably at least 3, 4, 5 or more genes of any of clusters A, B, C, D, E, F or G.
- the microarray has binding sites for genes relevant to testing and confirming a biological network model of interest.
- human microarrays are publically available.
- the Affymetrix GeneChip HUM 6.8K is an oligonucleotide array composed of 7,070 genes.
- a microarray with 8,150 human cDNAs was developed and published by Research Genetics (Bittner et al., 2000, Nature 406:443-546).
- the probes to be affixed to the arrays are typically polynucleotides. These DNAs can be obtained by, e.g., polymerase chain reaction (PCR) amplification of gene segments from genomic DNA, cDNA (e.g., by RT-PCR), or cloned sequences. PCR primers are chosen, based on the known sequence of the genes or cDNA, that result in amplification of unique fragments (i.e. fragments that do not share more than 10 bases of contiguous identical sequence with any other fragment on the microarray). Computer programs are useful in the design of primers with the required specificity and optimal amplification properties. See, e.g., Oligo pl version 5.0 (National Biosciences).
- Random oligo-dT priming may also be used to obtain cDNAs corresponding to as yet unknown genes, known as ESTs.
- Certain arrays use many small oligonucleotides corresponding to overlapping portions of genes. Such oligonucleotides may be chemically synthesized by a variety of well known methods. Synthetic sequences are between about 15 and about 500 bases in length, more typically between about 20 and about 50 bases.
- synthetic nucleic acids include non-natural bases, e.g., inosine.
- nucleic acid analogues may be used as binding sites for hybridization.
- An example of a suitable nucleic acid analogue is peptide nucleic acid (see, e.g., Egholm et al., 1993, PNA hybridizes to complementary oligonucleotides obeying the Watson-Crick hydrogen-bonding rules, Nature 365:566-568; see also U.S. Pat. No. 5,539,083).
- the binding (hybridization) sites are made from plasmid or phage clones of genes, cDNAs (e.g., expressed sequence tags), or inserts therefrom (Nguyen et al., 1995, Differential gene expression in the murine thymus assayed by quantitative hybridization of arrayed cDNA clones, Genomics 29:207-209).
- the polynucleotide of the binding sites is RNA.
- the nucleic acids or analogues are attached to a solid support, which may be made from glass, plastic (e.g., polypropylene, nylon), polyacrylamide, nitrocellulose, or other materials.
- a preferred method for attaching the nucleic acids to a surface is by printing on glass plates, as is described generally by Schena et al., 1995, Science 270:467-470. This method is especially useful for preparing microarrays of cDNA. (See also DeRisi et al., 1996, Nature Genetics 14:457-460; Shalon et al., 1996, Genome Res . 6:639-645; and Schena et al., 1995, Proc. Natl. Acad. Sci. USA 93:10539-11286).
- a second preferred method for making microarrays is by making high-density oligonucleotide arrays.
- Techniques are known for producing arrays containing thousands of oligonucleotides complementary to defined sequences, at defined locations on a surface using photolithographic techniques for synthesis in situ (see, Fodor et al., 1991, Science 251:767-773; Pease et al., 1994, Proc. Natl. Acad. Sci. USA 91:5022-5026; Lockhart et al., 1996, Nature Biotech 14:1675; U.S. Pat. Nos.
- oligonucleotides of known sequence are synthesized directly on a surface such as a derivatized glass slide. Usually, the array produced is redundant, with several oligonucleotide molecules per RNA. Oligonucleotide probes can be chosen to detect alternatively spliced mRNAs. More recently, microarrays have been made using an ink-jet oligonucleotide synthesizer (Hughes et al., Nat. Biotechnol. April 2001, 19(4): 342-347).
- microarrays e.g., by masking
- any type of array for example, dot blots on a nylon hybridization membrane (see Sambrook et al., Molecular Cloning--A Laboratory Manual (2nd Ed.), Vol. 1-3, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y., 1989), could be used, although, as will be recognized by those of skill in the art, very small arrays will be preferred because hybridization volumes will be smaller.
- the nucleic acids to be contacted with the microarray may be prepared in a variety of ways. Methods for preparing total and poly(A)+ RNA are well known and are described generally in Sambrook et al., supra. Labeled cDNA is prepared from mRNA by oligo dT-primed or random-primed reverse transcription, both of which are well known in the art (see e.g., Klug and Berger, 1987, Methods Enzymol. 152:316-325). Reverse transcription may be carried out in the presence of a dNTP conjugated to a detectable label, most preferably a fluorescently labeled dNTP.
- isolated mRNA can be converted to labeled antisense RNA synthesized by in vitro transcription of double-stranded cDNA in the presence of labeled dNTPs (Lockhart et al., 1996, Nature Biotech. 14:1675).
- the cDNAs or RNAs can be synthesized in the absence of detectable label and may be labeled subsequently, e.g., by incorporating biotinylated dNTPs or rNTP, or some similar means (e.g., photo-cross-linking a psoralen derivative of biotin to RNAs), followed by addition of labeled streptavidin (e.g., phycoerythrin-conjugated streptavidin) or the equivalent.
- labeled streptavidin e.g., phycoerythrin-conjugated streptavidin
- fluorophores include fluorescein, lissamine, phycoerythrin, rhodamine (Perkin Elmer Cetus, Toronto, Canada), Cy2, Cy3, Cy3.5, Cy5, Cy5.5, Cy7, FluorX (Amersham, Piscataway, New Jersey, USA) and others (see, e.g., Kricka, 1992, Academic Press San Diego, Calif., USA).
- a label other than a fluorescent label is used.
- a radioactive label or a pair of radioactive labels with distinct emission spectra, can be used (see Zhao et al., 1995, Gene 156:207; Pietu et al., 1996, Genome Res. 6:492).
- use of radioisotopes is a less-preferred embodiment.
- Nucleic acid hybridization and wash conditions are chosen so that the population of labeled nucleic acids will specifically hybridize to appropriate, complementary nucleic acids affixed to the matrix.
- one polynucleotide sequence is considered complementary to another when, if the shorter of the polynucleotides is less than or equal to 25 bases, there are no mismatches using standard base-pairing rules or, if the shorter of the polynucleotides is longer than 25 bases, there is no more than a 5% mismatch.
- the polynucleotides are perfectly complementary (no mismatches).
- Optimal hybridization conditions will depend on the length (e.g., oligomer versus polynucleotide greater than 200 bases) and type (e.g., RNA, DNA, PNA) of labeled nucleic acids and immobilized polynucleotide or oligonucleotide.
- length e.g., oligomer versus polynucleotide greater than 200 bases
- type e.g., RNA, DNA, PNA
- Specific hybridization conditions for nucleic acids are described in Sambrook et al., supra, and in Ausubel et al., 1987, Current Protocols in Molecular Biology, Greene Publishing and Wiley-lnterscience, New York, which is incorporated in its entirety for all purposes.
- Non-specific binding of the labeled nucleic acids to the array can be decreased by treating the array with a large quantity of non-specific DNA -- a so-called "blocking" step.
- the fluorescence emissions at each site of a transcript array can be, preferably, detected by scanning confocal laser microscopy.
- a separate scan using the appropriate excitation line, is carried out for each of the two fluorophores used.
- a laser can be used that allows simultaneous specimen illumination at wavelengths specific to the two fluorophores and emissions from the two fluorophores can be analyzed simultaneously (see Shalon et al., 1996, Genome Research 6:639-645).
- the arrays are scanned with a laser fluorescent scanner with a computer controlled X-Y stage and a microscope objective.
- Fluorescence laser scanning devices are described in Schena et al., 1996, Genome Res. 6:639-645 and in other references cited herein.
- the fiber-optic bundle described by Ferguson et al., 1996, Nature Biotech. 14:1681-1684 may be used to monitor mRNA abundance levels at a large number of sites simultaneously.
- Fluorescent microarray scanners are commercially available from Affymetrix, Packard BioChip Technologies, BioRobotics and many other suppliers.
- Signals are recorded, quantitated and analyzed using a variety of computer software.
- the scanned image is despeckled using a graphics program (e.g., Hijaak Graphics Suite) and then analyzed using an image gridding program that creates a spreadsheet of the average hybridization at each wavelength at each site. If necessary, an experimentally determined correction for "cross talk" (or overlap) between the channels for the two fluors may be made.
- a ratio of the emission of the two fluorophores is preferably calculated. The ratio is independent of the absolute expression level of the cognate gene, but is useful for genes whose expression is significantly modulated by drug administration, gene deletion, or any other tested event.
- the relative abundance of an mRNA in two samples is scored as a perturbation and its magnitude determined (i.e., the abundance is different in the two sources of mRNA tested), or as not perturbed (i.e., the relative abundance is the same).
- a difference between the two sources of RNA of at least a factor of about 25% RNA from one source is 25% more abundant in one source than the other source), more usually about 50%, even more often by a factor of about 2 (twice as abundant), 3 (three times as abundant) or 5 (five times as abundant) is scored as a perturbation.
- Present detection methods allow reliable detection of difference of an order of about 2-fold to about 5-fold, but more sensitive methods are expected to be developed.
- a perturbation in addition to identifying a perturbation as positive or negative, it is advantageous to determine the magnitude of the perturbation. This can be carried out, as noted above, by calculating the ratio of the emission of the two fluorophores used for differential labeling, or by analogous methods that will be readily apparent to those of skill in the art.
- transcript arrays reflecting the transcriptional state of a cell of interest are made by hybridizing a mixture of two differently labeled sets of cDNAs, to the microarray.
- One cell is a cell of interest, while the other is used as a standardizing control.
- the relative hybridization of each cell's cDNA to the microarray then reflects the relative expression of each gene in the two cell.
- Perou et al. 2000, supra
- the data obtained from such experiments reflects the relative expression of each gene represented in the microarray. Expression levels in different samples and conditions may be compared using a variety of statistical methods.
- a variety of statistical methods are available to assess the degree of relatedness in expression patterns of different genes.
- the statistical methods may be broken into two related portions: metrics for determining the relatedness of the expression pattern of one or more gene, and clustering methods, for organizing and classifying expression data based on a suitable metric (Sherlock, 2000, Curr. Opin. Immunol. 12:201-205; Butte et al., 2000, Pacific Symposium on Biocomputing , Hawaii, World Scientific, p.418-29).
- Pearson correlation may be used as a metric.
- each data point of gene expression level defines a vector describing the deviation of the gene expression from the overall mean of gene expression level for that gene across all conditions.
- Each gene's expression pattern can then be viewed as a series of positive and negative vectors.
- a Pearson correlation coefficient can then be calculated by comparing the vectors of each gene to each other. An example of such a method is described in Eisen et al. (1998, supra). Pearson correlation coefficients account for the direction of the vectors, but not the magnitudes.
- Euclidean distance measurements may be used as a metric.
- vectors are calculated for each gene in each condition and compared on the basis of the absolute distance in multidimensional space between the points described by the vectors for the gene.
- the relatedness of gene expression patterns may be determined by entropic calculations (Butte et al. 2000, supra). Entropy is calculated for each gene's expression pattern. The calculated entropy for two genes is then compared to determine the mutual information. Mutual information is calculated by subtracting the entropy of the joint gene expression patterns from the entropy for calculated for each gene individually. The more different two gene expression patterns are, the higher the joint entropy will be and the lower the calculated mutual information. Therefore, high mutual information indicates a non-random relatedness between the two expression patterns.
- the different metrics for relatedness may be used in various ways to identify clusters of genes.
- comprehensive pairwise comparisons of entropic measurements will identify clusters of genes with particularly high mutual information.
- expression patterns for two genes are correlated if the normalized mutual information score is greater than or equal to 0.7, and preferably greater than 0.8, greater than 0.9 or greater than 0.95.
- a statistical significance for mutual information may be obtained by randomly permuting the expression measurements 30 times and determining the highest mutual information measurement obtained from such random associations. All clusters with a mutual information higher than can be obtained randomly after 30 permutations are statistically significant.
- expression patterns for two genes are correlated if the correlation coefficient is greater than or equal to 0.8, and preferably greater than 0.85, 0.9 or, most preferably greater than 0.95.
- agglomerative clustering methods may be used to identify gene clusters.
- Pearson correlation coefficients or Euclidean metrics are determined for each gene and then used as a basis for forming a dendrogram.
- genes were scanned for pairs of genes with the closest correlation coefficient. These genes are then placed on two branches of a dendrogram connected by a node, with the distance between the depth of the branches proportional to the degree of correlation. This process continues, progressively adding branches to the tree.
- a tree is formed in which genes connected by short branches represent clusters, while genes connected by longer branches represent genes that are not clustered together.
- the points in multidimensional space by Euclidean metrics may also be used to generate dendrograms.
- divisive clustering methods may be used. For example, vectors are assigned to each gene's expression pattern, and two random vectors are generated. Each gene is then assigned to one of the two random vectors on the basis of probability of matching that vector. The random vectors are iteratively recalculated to generate two centroids that split the genes into two groups. This split forms the major branch at the bottom of a dendrogram. Each group is then further split in the same manner, ultimately yielding a fully branched dendrogram.
- self-organizing maps may be used to generate clusters.
- the gene expression patterns are plotted in n-dimensional space, using a metric such as the Euclidean metrics described above.
- a grid of centroids is then placed onto the n-dimensional space and the centroids are allowed to migrate towards clusters of points, representing clusters of gene expression.
- the centroids represent a gene expression pattern that is a sort of average of a gene cluster.
- SOM may be used to generate centroids, and the genes clustered at each centroid may be further represented by a dendrogram. An exemplary method is described in Tamayo et al., 1999, PNAS 96:2907-12. Once centroids are formed, correlation must be evaluated by one of the methods described supra.
- the invention provides probe sets.
- Preferred probe sets are designed to detect expression of multiple genes and provide information about the status of a graft.
- Preferred probe sets of the invention comprise probes that are useful for the detection of at least two genes belonging to gene clusters A, B, C, D, E, F or G.
- Particularly preferred probe sets will comprise probes useful for the detection of at least three, at least four or at least five genes belonging to gene clusters A, B, C, D, E, F or G.
- Certain probe sets may additionally comprise probes that are useful for the detection of one or more genes of gene cluster H.
- Probe sets of the invention do not comprise probes useful for the detection of more than 10,000 gene transcripts, and preferred probe sets will comprise probes useful for the detection of fewer than 4000, fewer than 1000, fewer than 200, and most preferably fewer than 50 gene transcripts. Probe sets of the invention are particularly useful because they are smaller and cheaper than probe sets that are intended to detect as many genes as possible in a particular genome.
- the probe sets of the invention are targeted at the detection of gene transcripts that are informative about transplant status.
- Probe sets of the invention may comprise a large or small number of probes that detect gene transcripts that are not informative about transplant status. Such probes are useful as controls and for normalization. Probe sets may be a dry mixture or a mixture in solution. In preferred embodiments, probe sets of the invention are affixed to a solid substrate to form an array of probes. It is anticipated that probe sets may also be useful for multiplex PCR.
- the present invention provides wild-type and mutant CYP2D6 polypeptides which are isolated from, or otherwise substantially free of other cellular proteins.
- the term "substantially free of other cellular proteins" (also referred to herein as "contaminating proteins") or “substantially pure or purified preparations” are defined as encompassing preparations of CYP2D6 polypeptides having less than about 20% (by dry weight) contaminating protein, and preferably having less than about 5% contaminating protein.
- Functional forms of the subject polypeptides can be prepared, for the first time, as purified preparations by using a cloned gene as described herein.
- Preferred CYP2D6 proteins of the invention have an amino acid sequence which is at least about 60%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 85%, 90%, or 95% identical or homologous to an amino acid sequence of the CYP2D6 P450 polypeptide.
- Even more preferred CYP2D6 proteins comprise an amino acid sequence of at least 10, 20, 30, or 50 residues which is at least about 70, 80, 90, 95, 97, 98, or 99% homologous or identical to an amino acid sequence of CYP2D6.
- Such proteins can be recombinant proteins, and can be, e.g., produced in vitro from nucleic acids comprising a nucleotide sequence set forth in SEQ ID Nos. 1,2, 3, or 4 or another nucleic acid SEQ ID No. of the invention or homologs thereof.
- recombinant polypeptides preferred by the present invention can be encoded by a nucleic acid, which is at least 85% homologous and more preferably 90% homologous and most preferably 95% homologous with a nucleotide sequence set forth in a SEQ ID Nos. of the invention.
- Polypeptides which are encoded by a nucleic acid that is at least about 98-99% homologous with the sequence of SEQ ID No. of the invention are also within the scope of the invention.
- a CYP2D6 protein of the present invention is a mammalia CYP2D6 protein.
- the CYP2D6 polypeptide includes a polypeptide segment of the carboxy-terminal segment of the wild type 2D6 P450 protein sequence RRACLGEPLARMELFLFFTSLL QHFSFSVPTGQPRPSHHGVFAFLVSPSPYELC-AVPR (SEQ ID NO. 32) or the CYP2D6 C5816TA mutant 2D6 P450 carboxy-terminal sequence RACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYEYLOCA PLEWGT (SEQ ID NO. 34).
- a CYP2D6 protein has a CYP2D6 bioactivity, such as a monoxygenase activity. It will be understood that certain post-translational modifications, e.g., phosphorylation and the like, can increase the apparent molecular weight of the CYP2D6 protein relative to the unmodified polypeptide chain.
- the invention also provides protein isoforms encoded by splice variants of the present invention.
- Such isoforms may have biological activities identical to or different from those possessed by the CYP2D6 proteins encoded by SEQ ID NOs. 1-4.
- Such isoforms may arise, for example, by alternative splicing of one or more CYP2D6 gene transcripts.
- CYP2D6 polypeptides preferably are capable of functioning as either an agonist or antagonist of at least one biological activity of a wild-type ("authentic") CYP2D6 protein of the appended sequence listing.
- Full length proteins or fragments corresponding to one or more particular motifs and/or domains or to arbitrary sizes, for example, at least 5, 10, 20, 25, 50, 75 and 100, amino acids in length are within the scope of the present invention.
- isolated CYP2D6 polypeptides can be encoded by all or a portion of a nucleic acid sequence shown in any of SEQ ID NOs. 1, 2, 3 or 4.
- Isolated peptidyl portions of CYP2D6 proteins can be obtained by screening peptides recombinantly produced from the corresponding fragment of the nucleic acid encoding such peptides.
- fragments can be chemically synthesized using techniques known in the art such as conventional Merrifield solid phase f-Moc or t-Boc chemistry.
- a CYP2D6 polypeptide of the present invention may be arbitrarily divided into fragments of desired length with no overlap of the fragments, or preferably divided into overlapping fragments of a desired length.
- the fragments can be produced (recombinantly or by chemical synthesis) and tested to identify those peptidyl fragments which can function as either agonists or antagonists of a wild-type (e.g., "authentic") CYP2D6 protein.
- a CYP2D6 polypeptide can be a membrane bound form or a soluble form.
- a preferred soluble CYP2D6 polypeptide is a polypeptide which does not contain a hydrophobic signal sequence domain.
- Such proteins can be created by genetic engineering by methods known in the art. The solubility of a recombinant polypeptide may be increased by deletion of hydrophobic domains, such as predicted transmembrane domains, of the wild type protein.
- polypeptides referred to herein as having an activity (e.g., are "bioactive") of a CYP2D6 protein are defined as polypeptides which include an amino acid sequence encoded by all or a portion of the nucleic acid sequences shown in one of SEQ ID No. 1, 2, 3 or 4 and which mimic or antagonize all or a portion of the blological/biochemlcal activities of a naturally occurring CYP2D6 protein.
- biological activity include a region of conserved structure such as the CYP2D6 carboxy-terminal conserved domain (see FIGURE 6A, CYP2D6 SEQ ID NO. 32).
- a polypeptide has biological activity if it is a specific agonist or antagonist of a naturally-occurring form of a CYP2D6 protein.
- fusion proteins e.g., CYP2D6 -immunoglobulin fusion proteins.
- fusion proteins can provide, e.g., enhanced stability and solubility of CYP2D6 proteins and may thus be useful in therapy.
- Fusion proteins can also be used to produce an immunogenic fragment of a CYP2D6 protein.
- the VP6 capsid protein of rotavirus can be used as an immunologic carrier protein for portions of the CYP2D6 polypeptide, either in the monomeric form or in the form of a viral particle.
- the nucleic acid sequences corresponding to the portion of a subject CYP2D6 protein to which antibodies are to be raised can be incorporated into a fusion gene construct which includes coding sequences for a late vaccinia virus structural protein to produce a set of recombinant viruses expressing fusion proteins comprising CYP2D6 epitopes as part of the virion. It has been demonstrated with the use of immunogenic fusion proteins utilizing the Hepatitis B surface antigen fusion proteins that recombinant Hepatitis B virions can be utilized in this role as well.
- chimeric constructs coding for fusion proteins containing a portion of a CYP2D6 protein and the poliovirus capsid protein can be created to enhance immunogenicity of the set of polypeptide antigens (see, for example, EP Publication No: 0259149; and Evans et al. (1989) Nature 339:385; Huang et al. (1988) J. Virol. 62:3855; and Schlienger et al. (1992) J . Virol. 66:2).
- the Multiple antigen peptide system for peptide-based immunization can also be utilized to generate an immunogen, wherein a desired portion of a CYP2D6 polypeptide is obtained directly from organo-chemical synthesis of the peptide onto an oligomeric branching lysine core (see, for example, Posnett et al. (1988) JBC 263:1719 and Nardelli et al. (1992) J . Immunol. 148:914).
- Antigenic determinants of CYP2D6 proteins can also be expressed and presented by bacterial cells.
- fusion proteins can also facilitate the expression of proteins, and accordingly, can be used in the expression of the CYP2D6 polypeptides of the present invention.
- CYP2D6 polypeptides can be generated as glutathione-S-transferase (GST-fusion) proteins.
- GST-fusion proteins can enable easy purification of the CYP2D6 polypeptide, as for example by the use of glutathione-derivatized matrices (see, for example, Current Protocols in Molecular Biology, eds. Ausubel et al. (N.Y.: John Wiley & Sons, 1991)).
- fusion of CYP2D6 polypeptides to small epitope tags can be used to simplify immunological purification of the resulting recombinant polypeptide or to facilitate immunological detection in a cell or tissue sample. Fusion to the green fluorescent protein, and recombinant versions thereof which are known in the art and available commercially, may further be used to localize CYP2D6 polypeptides within living cells and tissue.
- the present invention further pertains to methods of producing the subject CYP2D6 polypeptides.
- a host cell transfected with a nucleic acid vector directing expression of a nucleotide sequence encoding the subject polypeptides can be cultured under appropriate conditions to allow expression of the peptide to occur. Suitable media for cell culture are well known in the art.
- the recombinant CYP2D6 polypeptide can be isolated from cell culture medium, host cells, or both using techniques known in the art for purifying proteins including ion-exchange chromatography, gel filtration chromatography, ultrafiltration, electrophoresis, and immunoaffinity purification with antibodies specific for such peptide.
- the recombinant CYP2D6 polypeptide is a fusion protein containing a domain which facilitates its purification, such as GST fusion protein.
- CYP2D6 polypeptides which function in a limited capacity as one of either a CYP2D6 agonist (mimetic) or a CYP2D6 antagonist, in order to promote or inhibit only a subset of the biological activities of the naturally-occurring form of the protein.
- a CYP2D6 agonist mimetic
- a CYP2D6 antagonist a CYP2D6 antagonist
- Homologs of each of the subject CYP2D6 proteins can be generated by mutagenesis, such as by discrete point mutation(s), or by truncation. For instance, mutation can give rise to homologs which retain substantially the same, or merely a subset, of the biological activity of the CYP2D6 polypeptide from which it was derived.
- antagonistic forms of the protein can be generated which are able to inhibit the function of the naturally occurring form of the protein, such as by competitively binding to a CYP2D6 receptor.
- the recombinant CYP2D6 polypeptides of the present invention also include homologs of the wildtype CYP2D6 proteins, such as versions of those protein which are resistant to proteolytic cleavage, as for example, due to mutations which alter ubiquitination or other enzymatic targeting associated with the protein.
- CYP2D6 polypeptides may also be chemically modified to create CYP2D6 derivatives by forming covalent or aggregate conjugates with other chemical moieties, such as glycosyl groups, lipids, phosphate, acetyl groups and the like.
- Covalent derivatives of CYP2D6 proteins can be prepared by linking the chemical moieties to functional groups on amino acid sidechains of the protein or at the N-terminus or at the C-terminus of the polypeptide.
- Modification of the structure of the subject CYP2D6 polypeptides can be for such purposes as enhancing therapeutic or prophylactic efficacy, stability (e.g., ex vivo shelf life and resistance to proteolytic degradation), or post-translational modifications (e.g., to alter phosphorylation pattern of protein).
- Such modified peptides when designed to retain at least one activity of the naturally-occurring form of the protein, or to produce specific antagonists thereof, are considered functional equivalents of the CYP2D6 polypeptides described in more detail herein.
- Such modified peptides can be produced, for instance, by amino acid substitution, deletion, or addition.
- the substitutional variant may be a substituted conserved amino acid or a substituted non-conserved amino acid.
- Whether a change in the amino acid sequence of a peptide results in a functional CYP2D6 homolog can be readily determined by assessing the ability of the variant peptide to produce a response in cells in a fashion similar to the wild-type protein, or competitively inhibit such a response. Polypeptides in which more than one replacement has taken place can readily be tested in the same manner.
- This invention further contemplates a method for generating sets of combinatorial mutants of the subject CYP2D6 proteins as well as truncation mutants, and is especially useful for identifying potential variant sequences (e.g., homologs).
- the purpose of screening such combinatorial libraries is to generate, for example, novel CYP2D6 homologs which can act as, e.g., agonists or antagonist, or alternatively, possess novel activities all together.
- combinatorially-derived homologs can be generated to have an increased potency relative to a naturally occurring form of the protein.
- the variegated CYP2D6 libary of CYP2D6 variants is generated by combinatorial mutagenesis at the nucleic acid level, and is encoded by a variegated gene CYP2D6 library.
- a mixture of synthetic oligonucleotides can be enzymatically ligated into gene sequences such that the degenerate set of potential CYP2D6 sequences are expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display) containing the set of CYP2D6 sequences therein.
- a library of coding sequence fragments can be provided for a CYP2D6 clone in order to generate a variegated population of CYP2D6 fragments for screening and subsequent selection of bioactive fragments.
- a variety of techniques are known in the art for generating such libraries, including chemical synthesis.
- a library of coding sequence fragments can be generated by (i) treating a double stranded PCR fragment of a CYP2D6 coding sequence with a nuclease under conditions wherein nicking occurs only about once per molecule; (ii) denaturing the double stranded DNA; (iii) renaturing the DNA to form double stranded DNA which can include sense/antisense pairs from different nicked products; (iv) removing single stranded portions from reformed duplexes by treatment with S1 nuclease; and (v) ligating the resulting fragment library into an expression vector.
- an expression library can be derived which codes for N-terminal, C-terminal and internal fragments of various sizes.
- a wide range of techniques are known in the art for screening gene products of combinatorial libraries made by point mutations or truncation, and for screening cDNA libraries for gene products having a certain property. Such techniques will be generally adaptable for rapid screening of the gene libraries generated by the combinatorial mutagenesis of CYP2D6 homologs.
- the most widely used techniques for screening large gene libraries typically comprises cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting libraries of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates relatively easy isolation of the vector encoding the gene whose product was detected.
- Combinatorial mutagenesis has a potential to generate very large libraries of mutant proteins, e.g., in the order of 1026 molecules. Combinatorial libraries of this size may be technically challenging to screen even with high throughput screening assays.
- recrusive ensemble mutagenesis REM
- REM recrusive ensemble mutagenesis
- REM is an algorithm which enhances the frequency of functional mutants in a library when an appropriate selection or screening method is employed (Arkin and Yourvan, 1992, PNAS USA 89:7811-7815; Yourvan et al., 1992, Parallel Problem Solving from Nature, 2., In Maenner and Manderick, eds., Elsevir Publishing Co., Amsterdam, pp. 401-410; Delgrave et al., 1993, Protein Engineering 6(3):327-331).
- the invention also provides for reduction of the CYP2D6 proteins to generate mimetics, e.g., peptide or non-peptide agents, such as small molecules, which are able to disrupt binding of a CYP2D6 polypeptide of the present invention with a molecule, e.g. target peptide.
- mimetics e.g., peptide or non-peptide agents, such as small molecules
- a molecule e.g. target peptide.
- mutagenic techniques as described above are also useful to map the determinants of the CYP2D6 proteins which participate in protein-protein interactions involved in, for example, binding of the subject CYP2D6 polypeptide to a target peptide.
- the critical residues of a subject CYP2D6 polypeptide which are involved in molecular recognition of its receptor can be determined and used to generate CYP2D6 derived peptidomimetics or small molecules which competitively inhibit binding of the authentic CYP2D6 protein with that moiety.
- a subject CYP2D6 polypeptide which are involved in molecular recognition of its receptor can be determined and used to generate CYP2D6 derived peptidomimetics or small molecules which competitively inhibit binding of the authentic CYP2D6 protein with that moiety.
- peptidomimetic compounds can be generated which mimic those residues of the CYP2D6 protein which facilitate the interaction. Such mimetics may then be used to interfere with the normal function of a CYP2D6 protein.
- non-hydrolyzable peptide analogs of such residues can be generated using benzodiazepine (e.g., see Freidinger et al. in Peptides: Chemistry and Biology , G.R. Marshall ed., ESCOM Publisher: Leiden, Netherlands, 1988), azepine (e.g., see Huffman et al. in Peptides: Chemistry and Biology , G.R. Marshall ed., ESCOM Publisher: Leiden, Netherlands, 1988), substituted gamma lactam rings (Garvey et al. in Peptides: Chemistry and Biology , G.R.
- Another aspect of the invention pertains to an antibody specifically reactive with a mammalia CYP2D6 protein, e.g., a wild-type or mutated CYP2D6 protein, particularly to the wild-type (SEQ ID NO. 5) and mutant (SEQ ID NO. 6, 8, or 30) CYP2D6 P450 carboxy-terminal sequences shown in FIGURE 6.
- a mammalia CYP2D6 protein e.g., a wild-type or mutated CYP2D6 protein, particularly to the wild-type (SEQ ID NO. 5) and mutant (SEQ ID NO. 6, 8, or 30) CYP2D6 P450 carboxy-terminal sequences shown in FIGURE 6.
- CYP2D6 protein e.g., based on the cDNA sequences
- anti-protein/anti-peptide antisera or monoclonal antibodies can be made by standard protocols (See, for example, Antibodies: A Laboratory Manual ed. by Harlow and Lane (Cold
- a mammal such as a mouse, a hamster or rabbit can be immunized with an immunogenic form of the peptide (e.g., a mammalia CYP2D6 polypeptide or an antigenic fragment which is capable of eliciting an antibody response, or a fusion protein as described above).
- an immunogenic form of the peptide e.g., a mammalia CYP2D6 polypeptide or an antigenic fragment which is capable of eliciting an antibody response, or a fusion protein as described above.
- Techniques for conferring immunogenicity on a protein or peptide include conjugation to carriers or other techniques well known in the art.
- An immunogenic portion of a CYP2D6 protein can be administered in the presence of adjuvant. The progress of immunization can be monitored by detection of antibody titers in plasma or serum. Standard ELISA or other immunoassays can be used with the immunogen as antigen to assess the levels of antibodies.
- the subject antibodies are immunospecific for antigenic determinants of a CYP2D6 protein of a mammal, e.g., antigenic determinants of a protein set forth in SEQ ID No. 6 or 8 or closely related homologs (e.g., at least 90% homologous, and more preferably at least 94% homologous).
- anti-CYP2D6 antisera can be obtained and, if desired, polyclonal anti-CYP2D6 antibodies isolated from the serum.
- antibody-producing cells lymphocytes
- immortalizing cells such as myeloma cells to yield hybridoma cells.
- Hybridoma cells can be screened immunochemically for production of antibodies specifically reactive with a mammalia CYP2D6 polypeptide of the present invention and monoclonal antibodies isolated from a culture comprising such hybridoma cells.
- anti-human CYP2D6 antibodies specifically react with the protein encoded by a nucleic acid having SEQ ID NOs. 1, 2, 3 or 4.
- antibody as used herein is intended to include fragments thereof which are also specifically reactive with one of the subject mammalia CYP2D6 polypeptides.
- Antibodies can be fragmented using conventional techniques and the fragments screened for utility in the same manner as described above for whole antibodies. For example, F(ab)2 fragments can be generated by treating antibody with pepsin. The resulting F(ab)2 fragment can be treated to reduce disulfide bridges to produce Fab fragments.
- the antibody of the present invention is further intended to include bispecific, single-chain, and chimeric and humanized molecules having affinity for a CYP2D6 protein conferred by at least one CDR region of the antibody.
- the antibody further comprises a label attached thereto and able to be detected, (e.g., the label can be a radioisotope, fluorescent compound, enzyme or enzyme co-factor).
- Anti-CYP2D6 antibodies can be used, e.g., to monitor CYP2D6 protein levels in an individual for determining, e.g., whether a subject has a disease or condition associated with an aberrant CYP2D6 protein level, or allowing determination of the efficacy of a given treatment regimen for an individual afflicted with such a disorder.
- the level of CYP2D6 polypeptides may be measured from cells in bodily fluid, such as in blood samples.
- anti-CYP2D6 antibodies of the present invention is in the immunological screening of cDNA libraries constructed in expression vectors such as ⁇ gt11, ⁇ gt18-23, ⁇ ZAP, and ⁇ ORF8.
- Messenger libraries of this type having coding sequences inserted in the correct reading frame and orientation, can produce fusion proteins.
- ⁇ gt11 will produce fusion proteins whose amino termini consist of ⁇ -galactosidase amino acid sequences and whose carboxy termini consist of a foreign polypeptide.
- Antigenic epitopes of a CYP2D6 protein e.g., other orthologs of a particular CYP2D6 protein or other paralogs from the same species, can then be detected with antibodies, as, for example, reacting nitrocellulose filters lifted from infected plates with anti-CYP2D6 antibodies. Positive phage detected by this assay can then be isolated from the infected plate.
- CYP2D6 homologs can be detected and cloned from other animals, as can alternate isoforms (including splice variants) from humans.
- the invention further provides for transgenic animals.
- Transgenic animals of the invention include non-human animals containing an heterologous CYP2D6 P450 C(5816)TA variant or fragment thereof under the control of an CYP2D6 promoter or under the control of a heterologous promoter.
- the transgenic animals of the invention can be animals expressing a transgene encoding a polymorphic variant of the CYP2D6 gene.
- Such transgenic animals preferably, carry at least one heterologous replacement of the wild-type CYP2D6 P450 locus with an heterologous CYP2D6 P450 C(5816)TA variant allele.
- Such animals can be used, e.g., to determine the effects of such variants on drug metabolism.
- non-human animals within the scope of the invention include those in which at least one copy of the endogenous CYP2D6 P450 gene has been mutated or "knocked out".
- a CYP2D6 P450 C(5816)TA variant allele/ CYP2D6 P450 knock-out mutant animal having a poor metabolizer phenotype could be constructed and used to determine whether particular treatments, such as with a CYP2D6 P450 drug agonist compound or candidate, are capable of rescuing the poor metabolizer phenotype resulting from a CYP2D6 P450 C(5816)TA mutation.
- knock-out animals can be crossed with other transgenic animals expressing, e.g., a mutated form of another P450 gene, thus resulting in an animal which express multiple mutated P450 protein resulting in a complex poor metabolizer phenotype.
- Methods for obtaining transgenic and knockout non-human animals are well known in the art.
- CYP2D6 cytochrome P-450
- P450 cytochrome P-450
- CYP2D6 About 25% of prescribed drugs are metabolized by CYP2D6.
- the CYP2D6 C5816TA polymorphism appears to have clinical consequences in the use of cardiovascular drugs and drugs used for treatment of psychiatric disorders. Genotype has been shown to closely correlate with phenotype in this and other CYP2D6 mutations which have been examined.
- Subjects having a specific allele of a CYP2D6 gene may or may not exhibit symptoms of a drug sensitivity or be predisposed of developing symptoms of a particular disease, such as cancer resulting from the inability to adequately metabolize environmental mutagens or carcinogens.
- a CYP2D6 genetic profile (e.g., categorization of alterations in CYP2D6 genes which are associated with the development of a particular disease)
- a CYP2D6 genetic population profile e.g., categorization of alterations in CYP2D6 genes which are associated with the development of a particular disease
- a CYP2D6 genetic population profile e.g., categorization of alterations in CYP2D6 genes which are associated with the development of a particular disease
- a CYP2D6 genetic population profile e.g., categorization of alterations in CYP2D6 genes which are associated with the development of a particular disease
- a CYP2D6 genetic population profile permits the selection or design of drugs that are expected to be efficacious for a particular patient or patient population (i.e., a group of patients having the same genetic alteration).
- a CYP2D6 C5816TA population profile can be performed, by determining the CYP2D6 profile, e.g., the identity of a CYP2D6 C5816TA mutant gene in a patient population having a disease, which is caused by or contributed to by a defective or deficient CYP2D6 gene.
- the CYP2D6 population profile can further include information relating to the response of the population to a CYP2D6 therapeutic, using any of a variety of methods, including, monitoring: 1) the severity of symptoms associated with the CYP2D6 related disease, 2) CYP2D6 gene expression level, 3) CYP2D6 mRNA level, and/or 4) CYP2D6 protein level.
- CYP2D6 genetic population profile can also, optionally, indicate those particular alterations in which the patient was either responsive or non-responsive to a particular therapeutic. This information or population profile, is then useful for predicting which individuals should respond to particular drugs, based on their individual CYP2D6 profile.
- the CYP2D6 profile is a transcriptional or expression level profile and step (i) is comprised of determining the expression level of CYP2D6 proteins, alone or in conjunction with the expression level of other genes, known to contribute to the same disease.
- the CYP2D6 profile can be measured in many patients at various stages of the disease. Pharmacogenomic studies can also be performed using transgenic animals. For example, one can produce transgenic mice, e.g., as described herein, which contain a specific allelic variant of a CYP2D6 gene. These mice can be created, e.g, by replacing their wild-type CYP2D6 gene with an allele of the human CYP2D6 gene. The response of these mice to specific CYP2D6 therapeutics can then be determined.
- Genomic DNA from the subject identified as a poor metabolizer was isolated using Qiagen's QiaAMP Blood isolation kit according to manufacturer's protocol. Genomic DNA was extracted from 200 ul of whole blood. Amplification of the CYP2D6 locus was achieved in two steps. First, an initial amplification of the entire CYP2D6 gene to prevent amplification of CYP2D6 pseudogene in subsequent PCR.
- the PCR reaction mixture was subsequently sealed by adding one Ampliwax gem over this mixture in a PCR tube.
- the reaction mixture was heated to 80°C for 5 minutes, and then cooled to 25°C for 5 minutes.
- the following upper reaction mix was then added:
- the PCR reaction was performed using Perkin Elmer 9600 machine programmed as follows:
- This initial amplification product serves as the template for subsequent amplification of each exon of the CYP2D6 gene. While each exon was amplified and sequenced, only the method and reagents for Exon 9, the exon in which the mutation was detected, are described below:
- Nested PCR methodology was used to amplify CYP2D6 Exon 9 using M13-tagged primers as follows:
- the PCR reaction was performed using Perkin Elmer 9600 machine programmed as follows:
- the amplified product was sequenced as follows:
- the CYP2D6 mutations of the invention were cloned into a eukaryotic CMV-CYP2D6 expression vector to determine the biological activity associated with each mutation identified.
- CYP2D6 protein was evident based on Western blot analysis of the cell extracts. In comparison to the wild type construct the CYP2D6 activity was evident, however the turnover time was extremely rapid with the double mutant suggesting that the stability of the protein was affected by this frameshift.
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Wood Science & Technology (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Analytical Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Physics & Mathematics (AREA)
- Biophysics (AREA)
- Medicinal Chemistry (AREA)
- Biomedical Technology (AREA)
- Pathology (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Description
- The present invention relates to interindividual variation in drug metabolism. The present invention also relates to genetic variation and attendant genetic markers. More specifically, the present invention relates to the identification of a novel mutant allele of the CYP2D6 gene locus that results in a frameshift in a critical region of the gene which, in the wild-type enzyme, is required for catalytic activity. The mutant allele is associated with a genetic deficiency for metabolizing agents that are substrates of P450 CYP2D6.
- Polymorphic genes have been identified that result in interindividual variation in drug metabolism. See, for example, U.S. Patent No. 5,648,482. Interest remains in identifying genetic factors that influence or give rise to such interindividual variation.
- More than 200 cytochrome P450 genes which encode products involved in Phase I drug metabolism have been identified. These enzymes are involved in the metabolism of numerous other xenobiotics such as, for example, carcinogens, environmental chemicals, and several classes of endobiotics, e.g., steroids and prostaglandins.
- The cytochrome P450 2D6 gene (CYP2D6), localized to chromosome 22, encodes a major Phase I drug metabolizing enzyme, debrisoquine hydroxylase, the polymorphic oxidation of which is one of the most characterized interindividual variations of drug metabolism. See, for example, Lancet: 584-586 (1977); Eur. J. Clin. Pharmacol. 16: 183-187 (1979); Genomics 2: 174-179 (1988); Nature 331: 442-446 (1998).
- Genetic factors, e.g., the presence of mutated nucleotide sequences in certain genes, can play a role in interindividual variation in drug metabolism. In the case of debrisoquine polymorphism, the poor metabolizer (PM) phenotype is associated with an inability to efficiently metabolize several drugs, which can cause exaggerated pharmacological responses. See, for example, Pharmac. Ther. 46: 297-308 (1990). Deciphering the genetic basis for the debrisoquine PM phenotype has led to a report that the PM phenotype is caused by the absence in the liver of the enzyme encoded by the CYP2D6 gene. See, for example, DNA 8: 1-13 (1989); and Biochemistry 27: 5447-5454 (1988).
- Several mutant alleles of the CYP2D6 gene associated with the PM phenotype have been reported (i.e., genotypes). See, for example, Proc. Natl. Acad. Sci. USA 85: 5240-5243 (1988). Identification of such genotypes, and screening therefor, could enable one to predict an individual's metabolism of certain drugs, and thus assist in avoidance of, e.g., the exaggerated pharmacological responses mentioned hereinabove. Such genotype identification can be advantageous over administering the drug to the individual and assessing the phenotype resultant therefrom.
- Given the interindividual variation in drug metabolism, and that genetic factors have been shown to influence the individual response to drugs, and that CYP2D6 encodes a major Phase I drug metabolizing enzyme which is involved in the metabolism of numerous drugs, and that mutant alleles of the CYP2D6 gene are associated with the debrisoquine PM phenotype, a need remains to continue to identify novel PM alleles for the CYP2D6 gene, and assays for screening of the such genotypes.
- The present invention furthers this work by providing a novel mutant allele of the CYP2D6 gene locus. This mutation results in a frameshift in a critical region of the gene which, in the wild-type enzyme, is required for catalytic activity. Importantly, this mutant allele is associated with a genetic deficiency for metabolizing agents that are substrates of P450 CYP2D6, e.g., the PM phenotype, and, as such, can assist the art in further deciphering of interindividual variation in drug metabolism.
- All of the documents cited herein, including the foregoing, are incorporated by reference herein in their entireties.
- The present invention relates to novel CYP2D6 polymorphic variants that are linked or associated with a genetic deficiency for metabolizing certain drugs; specifically, individuals having differing variants of CYP2D6 may differ in their ability to metabolize drugs that are the substrates for P450CYP2D6 enzymes. Examples include variations at position 5816 and position 5799 of the CYP2D6 gene. Specifically, the variation at position 5816 corresponds to a substitution of the sequence "TA" for the "C" of the CYP2D6 genomic sequence (GenBank Accession No. M33388; SEQ ID NO. 1 shown in FIGURE 2) and at position 1474 of the CYP2D6 cDNA sequence (GenBank Accession No. NM_000106; SEQ ID NO. 3 shown in FIGURE 4). The variation at position 5799 corresponds to the substitution of G at this position of the genomic sequence with a C.
- Accordingly, in one aspect, this invention provides nucleic acids comprising the CYP2D6 gene, preferably nucleic acid molecules comprising at least 20 consecutive nucleotides of an allele of a CYP2D6 gene having SEQ ID NO: 1, wherein the nucleotide sequence differs at either nucleotide position 5816 or position 5799 or at both positions from the nucleotide sequence of SEQ ID NO: 1. In one embodiment, the nucleotide C at position 5816 is replaced by TA. In another embodiment, C replaces the G at position 5799. In yet another embodiment, this invention includes nucleic acid sequence comprising both a TA at position 5816 and a C at position 5799 of SEQ ID No: 1. Other preferred nucleic acids include: SEQ ID No: 2 (C5816TA mutant genomic sequence), SEQ ID No: 4 (C5816TA mutant cDNA sequence), SEQ ID No: 7 (double mutant cDNA), SEQ ID No. 29 (G5799C mutant cDNA sequence), and SEQ ID No. 33 (
mutant exon 9 sequence). - In another aspect the invention provides probes and primers to detect a genetic deficiency for metabolizing drugs, e.g., a poor metabolizer genotype. The nucleic acids of the invention can be used, for e.g., in prognostic, diagnostic, and therapeutic methods. For instance, the nucleic acids of the invention can be used as probes or primers to determine whether a subject has a genetic deficiency for metabolizing certain drugs. In particular, for determining whether a subject has a genetic deficiency for metabolizing drugs that are substrates of P450CYP2D6.
- In yet another aspect, this invention provides an array of nucleic acid molecules attached to a support, wherein the array has an oligonucleotide that will hybridize to an allelic variant of CYP2D6 but will not substantially hybridize to the wild type sequence. In particular, the array has an oligonucleotide that will hybridize to SEQ ID NO. 2, but will not substantially hybridize to the nucleic acid sequence of SEQ ID NO. 1.
- The invention further provides vectors comprising the nucleic acids of this invention; host cells transfected with said vectors whether prokaryotic or eukaryotic; and transgenic non-human animals which contain a heterologous form of a CYP2D6 P450 C(5816) variant described herein. Such a transgenic animal can serve as an animal model for studying, e.g., the effects of specific allelic variations, including mutations of the CYP2D6 gene in drug metabolism.
- This invention also provides polypeptides encoded by the allelic variants of this invention. In a preferred embodiment, such polypeptides have a C-terminus comprising the amino acid sequence of YLCCAPLEWGT. The invention also provides purified antibodies that selectively bind to the mutant CYP2D6 amino acid sequence but do not substantially bind the wild type polypeptide sequence. In a preferred embodiment, such antibodies selectively bind an epitope comprising residues 481-502 of the amino acid sequence of SEQ ID NO. 6. In a more preferred embodiment, the antibodies selectively bind an epitope which comprises the amino acid sequence of YLCCAPLEWGT.
- The methods of this invention can be used, e.g., for determining the identity of the allelic variant of a polymorphic region of a human CYP2D6 gene present in a subject. For example, the methods of the invention can be useful for determining whether a subject has a genetic deficiency for metabolizing certain drugs, for example drugs that are substrates of P450 CYP2D6. Genetic variations of this gene locus result in a genetic deficiency in drug metabolism or a drug sensitivity condition because of the altered enzymatic activities of the variant CYP2D6 gene products. In particular, the genetic variations at this gene locus are linked to aberrant CYP2D6 levels or aberrant CYP2D6 bioactivities. As those skilled in the art will appreciate, a majority of individuals possess normal activity (extensive metabolizers), some individuals possess slightly reduced activity (intermediate metabolizers) and some individuals show increased enzyme activity, in part due to gene duplications (rapid metabolizers). Individuals who lack enzyme activity, due to inactivating mutations in both copies of the CYP2D6 gene, are unable to metabolize drugs that require the CYP2D6 enzyme and are referred to as CYP2D6 poor metabolizers. Accordingly, the present methods provide means for determining if a subject has (diagnostic), or is at risk of developing (prognostic), a drug sensitivity condition or disorder that is associated with an aberrant CYP2D6 activity, e.g., an aberrant level of a CYP2D6 protein or an aberrant CYP2D6 bioactivity.
- In one aspect of the present invention, the identity of a polymorphic region of a CYP2D6 gene may be determined by contacting a sample nucleic acid with a probe or a primer which hybridizes to a polymorphic region selected from the group consisting of nucleotides 5816 and 5799 of SEQ ID NO. 1. Exemplary known methods for determining the identity of a polymorphic region include: determining the nucleotide content of the polymorphic region by sequencing or by performing a restriction enzyme site analysis, by single-stranded conformation polymorphism, allele specific hybridization, primer specific extension, oligonucleotide ligation assay, and such methods may readily be performed by those skilled in the art based upon the present description.
- In another embodiment, this invention provides methods for genotyping an individual by obtaining a sample of DNA from an individual and determining the identity of the nucleotide at position 5816 of the genomic sequence of CYP2D6. Other embodiments include methods for evaluating therapy with a drug metabolized by P450 CYP2D6., for example, evaluating therapy for a patient having a cardiovascular or psychiatric disorder with a drug metabolized by P450 CYP2D6. Exemplary methods include obtaining a sample of DNA from an individual, determining the identity of the nucleotide at position 5816 of the genomic sequence of CYP2D6, and then determining whether or not that patient should undergo therapy with a drug metabolized by P450 CYP2D6 if the nucleotide at position 5816 is not a cytosine.
- The methods of the invention can therefore be used, e.g., in selecting the appropriate drugs or determining the course of treatment to administer to a subject to treat cardiovascular or psychiatric disorders. In a further embodiment, the invention provides a method for treating a subject having a drug sensitivity or disorder associated with a specific allelic variant of a polymorphic region of the CYP2D6 gene. In one embodiment, the drug sensitivity condition or disorder is associated with an aberrant CYP2D6 activity, e.g., an aberrant level or aberrant bioactivity. For example, in one aspect, the method comprises (a) determining the identity of the allelic variant; and (b) administering to the subject a compound that compensates for the effect of the specific allelic variant. In a preferred embodiment, the specific allelic variant is a mutation. In a preferred embodiment, the compound modulates (e.g., agonizes, antagonizes, inversely antagonizes) a CYP2D6 protein level or bioactivity. In a preferred embodiment, the compound is selected from the group consisting of a nucleic acid, a protein, a peptidomimetic, and a small molecule.
- In another embodiment, the invention provides a kit for determining DNA variations in the CYP2D6 gene in a subject, comprising: a) at least one of PCR primer sets; and b) at least one of the allele-specific oligonucleotide (ASO) probe. The invention also provides kits, e.g., for amplifying and/or determining the identity or structure of a portion of the CYP2D6 gene comprising a probe or a primer capable of hybridizing to an allelic variant of a polymorphic region. In a preferred embodiment, the polymorphic region is located in an exon, such as
exon 9. In a preferred embodiment, determining the molecular structure of a region of the CYP2D6 gene comprises determining the identity of at least one nucleotide or determining the nucleotide composition, e.g., the nucleotide sequence. - A kit of the invention can be used, e.g., for determining whether a subject has a genetic deficiency associated with a specific allelic variant of a polymorphic region of a CYP2D6 gene. In a preferred embodiment, the invention provides a kit for determining whether a subject has a genetic deficiency for metabolizing certain agents, such as drugs that are substrates for P450 CYP2D6. The kits of the invention can also be used, for example, in selecting the appropriate drug to administer to a subject having a drug sensitivity or condition associated with aberrant CYP2D6 activity or aberrant CYP2D6 levels. Thus, determining the allelic variants of CYP2D6 polymorphic regions of an individual can be useful in predicting how an individual will respond to a specific agent, e.g, a drug that is a substrate for P450CYP2D6.
- Other features and advantages of the invention will be apparent from the following detailed description and appendant claims.
-
- FIGURE 1 provides a preferred embodiment of a method of the present invention for identifying a novel CYP2D6 mutation.
- FIGURE 2 provides the sequence of the human CYP2D6 genomic locus (GenBank No. M33388; SEQ ID NO. 1).
- FIGURE 3 provide a preferred embodiment of a sequence of the present invention of a human CYP2D6 C5816TA mutant genomic locus (SEQ ID NO. 2).
- FIGURE 4 provides a sequence of a human CYP2D6 cDNA and the encoded polypeptide (GenBank No. NM_000106; SEQ ID NO. 3 & SEQ ID NO. 5)
- FIGURE 5 provides a preferred embodiment of a sequence of the present invention of a human CYP2D6 C5816TA mutant cDNA and encoded polypeptide (SEQ ID NO. 4 & SEQ ID NO. 6).
- FIGURE 6 shows the partial sequence of wild
type CYP2D6 exon 9 and the corresponding encoded P450 carboxy-terminal amino acid sequence (PANEL A), with the "C" at nucleotide 5816 highlighted (SEQ ID NO. 31 & SEQ ID NO. 32); the partial sequence of the CYP2D6C5816TA mutant exon 9 sequence and the corresponding encoded mutant P450 carboxy-terminal amino acid sequence (PANEL B), with the "TA" substitution at position 5816 highlighted (SEQ ID NO. 33 & SEQ ID NO. 34). Panel C depicts an alignment of the wild-type and predicted C5816TA mutant P450 carboxy-terminal polypeptide sequences. - FIGURE 7 provides a preferred embodiment of a sequence of the present invention of a human CYP2D6 G5799C mutant cDNA and encoded polypeptide (SEQ ID NO. 29 & SEQ ID NO. 30).
- FIGURE 8 provides a preferred embodiment of a sequence of the present invention of a human CYP2D6 G5799C and C5816TA double mutant cDNA and encoded polypeptide (SEQ ID NO. 7 & SEQ ID NO. 8).
-
- Unless described otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of ordinary skill in the art. For convenience, the meaning of certain terms and phrases employed in the description and appendant claims are provided below.
- "Aberrant activity," as applied to an activity of a polypeptide such as CYP2D6 P450, refers to an activity which differs from the activity of a polypeptide encoded by the wild-type or most common allele or which differs from the activity of the polypeptide in a healthy subject. An activity of a polypeptide can be aberrant, for example, because it is stronger than the activity of its native counterpart. Alternatively, an activity can be aberrant because it is weaker or absent relative to the activity of its native counterpart. An aberrant activity can also be a change in an activity. For example, an aberrant polypeptide can have altered substrate specificity. A cell can have an aberrant CYP2D6 P450 activity, e.g., due to overexpression or under expression of a gene encoding CYP2D6 P450, or due to expression of a CYP2D6 allelic variant that alters the sequence of the encoded P450 polypeptide;
- "allele" refers to the different sequence variants found at different polymorphic regions. For example,
CYP2D6 P450 exon 9 has at least two different alleles (the wild type allele (see FIGURE 2) and the CYP2D6 C5816TA mutant allele (see FIGURE 3). A third allele ofCYP2D6 P450 exon 9, consisting of an insertion/repetition of a 9 base sequence TCACCCGTG (SEQ ID No. 29), has also been reported in EP 0759476A1 ("A method of detecting human cytochrome P4502D6 (CYP2D6) gene polymorphism"). The sequence variants may be single or multiple base changes, including without limitation insertions, deletions, or substitutions, or may be a variable number of sequence repeats; - "amplification" in reference to nucleic acids encompasses essentially any method of generating many copies of a nucleic acid, either in single or double stranded form. Such methods include but are not limited to polymerase chain reaction (PCR) and replication of the nucleic acid in cells;
- "antibody " refers to a binding agent including a whole antibody or a binding fragment thereof, which is specifically reactive with a wild type or mutant CYP2D6 P450 polypeptide. Antibodies can be fragmented using conventional techniques and the fragments screened for utility in the same manner as described above for whole antibodies. For example, F(ab)2 fragments can be generated by treating an antibody with pepsin. The resulting F(ab)2 fragment can be treated to reduce disulfide bridges to produce Fab fragments. The antibody of the present invention is further intended to include bispecific, single-chain, and chimeric and humanized molecules having affinity for a CYP2D6 P450 polypeptide conferred by at least one CDR region of the antibody; "bioactive portion of CYP2D6 P450" refers to a fragment of a full-length CYP2D6 P450, wherein the fragment specifically mimics or antagonizes at least one activity of a wild-type CYP2D6 P450;
- "biological activity" or "bioactivity" or "activity" or "biological function," which are used interchangeably, for the purposes herein when applied to CYP2D6 P450 means an effector or antigenic function that is directly or indirectly performed by a CYP2D6 P450 (whether in its native or denatured conformation), or by any subsequence (fragment) thereof. A biological activity can include binding substrate, causing the transfer of lipids, effecting signal transduction from a receptor, modulation of gene expression or an antigenic effector function;
- "cells", "host cells" or "recombinant host cells" are terms used interchangeably herein to refer not only to the particular subject cell, but to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact be identical to the parent cell, but is still included within the scope of the term as used herein;
- "CYP2D6 P450" refers to the cytochrome P450 2D6 isozyme. The CYP2D6 P450 isozyme is also known as debrisoquine hydroxylase based upon a catalytic activity, is a monooygenase enzyme that catalyzes the oxidation and eventual elimination of a large number of pharmaceutical agents;
- "CYP2D6 P450 agonist" refers to an agent that mimics, upregulates (potentiates or supplements) or otherwise increases a CYP2D6 P450 bioactivity. CYP2D6 P450 agonists may act on any of a variety of different levels, including regulation of CYP2D6 P450 gene expression, regulation of mRNA splicing mechanisms, stabilization of mRNA, or maturation CYP2D6 P450, or by affecting the biochemical activities of CYP2D6 P450;
- "CYP2D6 P450 antagonist" refers to an agent that downregulates or otherwise decreases a CYP2D6 P450 bioactivity. CYP2D6 P450 agonists may act on any of a variety of different levels, including regulation of CYP2D6 P450 gene expression, regulation of mRNA splicing mechanisms, stabilization of mRNA, or maturation of CYP2D6 P450, or by affecting the biochemical activities of CYP2D6 P450;
- "CYP2D6 P450 loci" include all the nucleic acid sequence at or near the CYP2D6 P450 gene, introns, exons and 5' and 3' untranslated regions. The GenBank Accession Nos. for the CYP2D6 P450 gene include M33388 (the CYP2D6 genomic sequence) and NM_000106 (the CYP2D6 cDNA sequence);
- "CYP2D6 P450 functional mutation" refers to a mutation within or near the CYP2D6 P450 gene that results in an altered phenotype;
- "CYP2D6 X (position #A) Y" refers to a particular allelic form of the CYP2D6 gene, wherein the nucleotide X of SEQ ID NO. 1 (GenBank M33388; FIGURE 2; ) present at position #A has been changed to nucleotide Y. For example, CYP2D6 C5816TA refers to a substitution at position 5816 of the CYP2D6 genomic sequence (and as shown in FIGURE 3; SEQ ID NO. 2). When a subject has two different CYP2D6 P450 alleles, the subject is said to be heterozygous, or to have the heterozygous state;
- "CYP2D6 P450 polypeptide" and "CYP2D6 P450 protein" are intended to encompass polypeptides comprising the amino acid sequence encoded by the CYP2D6 P450 genomic DNA sequences or fragments thereof, and homologs thereof and include agonist and antagonist polypeptides;
- "chimera," "mosaic," "chimeric mammal," and the like, refer to a transgenic mammal with a knock-out or knock-in construct in at least some of its genome-containing cells;
- "control" or "control sample" refer to any sample appropriate to the detection technique employed. The control sample may contain the products of the allele detection technique employed or the material to be tested. Further, the controls may be positive or negative controls. By way of example, where the allele detection technique is PCR amplification, followed by size fractionation, the control sample may comprise DNA fragments of an appropriate size. Likewise, where the allele detection technique involves detection of a mutated protein, the control sample may comprise a sample of a mutant protein. However, it is preferred that the control sample comprises the material to be tested. For example, the controls may be a sample of genomic DNA or a cloned portion of the CYP2D6 P450 gene. However, where the sample to be tested is genomic DNA, the control sample is preferably a highly purified sample of genomic DNA;
- "disorder associated allele" or "an allele associated with a disorder" refers to an allele whose presence in a subject indicates that the subject has or has an increased propensity for developing a particular disorder. An allele associated with the CYP2D6 C5816TA mutant polymorphic allele of the invention is the CYP2D6 G5799C polymorphism;
- "disruption of the gene" and "targeted disruption" or any similar phrase refers to the site specific interruption of a DNA sequence so as to prevent expression of that gene in the cell as compared to the non-disrupted copy of the gene. The interruption may be caused by deletions, insertions or modifications to the gene, or any combination thereof;
- "evolutionarily related to," with respect to amino acid sequences of CYP2D6 proteins, refers to both polypeptides having amino acid sequences which have arisen naturally, and also to mutational variants of human CYP2D6 polypeptides which are derived, for example, by combinatorial mutagenesis;
- "haplotype" is intended to refer to a set of alleles that are inherited together as a group (are in linkage disequilibrium) at statistically significant levels (pcorr < 0.05). As used herein, the phrase "a CYP2D6 P450 haplotype" refers to a haplotype including CYP2D6 P450 loci;
- "genetic deficiency for drug metabolism" refers to an altered level of drug metabolism in certain individuals, particularly, of drugs that are substrates of P450CYP2D6, when compared to the majority of the population. To illustrate, the majority of the population may be characterized as "extensive metabolizers" and exhibit normal activity of the CYP2D6 enzyme. However, genetic variation of this gene locus results in altered enzymatic activity, and some individuals possess slightly reduced activity (intermediate metabolizers) and some individuals lack enzyme activity (poor metabolizers).
- "homology" or "identity" or "similarity" refers to sequence similarity between two peptides or between two nucleic acid molecules. Homology can be determined by comparing a position in each sequence that may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are identical at that position. A degree of homology or similarity or identity between nucleic acid sequences is a function of the number of identical or matching nucleotides at positions shared by the nucleic acid sequences. A degree of identity of amino acid sequences is a function of the number of identical amino acids at positions shared by the amino acid sequences. A degree of homology or similarity of amino acid sequences is a function of the number of amino acids, i.e. structurally related, at positions shared by the amino acid sequences. An "unrelated" or "non-homologous" sequence shares less than 40% identity, though preferably less than 25 % identity, with one of the sequences of the present invention;
- "increased risk" refers to a higher frequency of occurrence of the disease or disorder in an individual in comparison to the frequency of occurrence of the disease or disorder in a population. A factor identified to be associated with increased risk is termed a "risk factor." Carrying a particular polymorphic allele is a risk factor for a particular condition such as drug sensitivity;
- "interact" is meant to include detectable relationships or associations (e.g., biochemical interactions) between molecules, such as interactions between protein-protein, protein-nucleic acid, nucleic acid-nucleic acid and protein-small molecule or nucleic acid-small molecule in nature;
- "isolated" with respect to nucleic acids, such as DNA or RNA, refers to molecules separated from other DNAs, or RNAs, respectively that are present in the natural source of the macromolecule. For example, an isolated nucleic acid encoding CYP2D6 P450 preferably includes no more than 10 kilobases (kb) of nucleic acid sequence which naturally immediately flanks the CYP2D6 P450 gene in genomic DNA, more preferably no more than 5 kb of such naturally occurring flanking sequences, and most preferably less than 1.5 kb of such naturally occurring flanking sequence. The term isolated as used herein also refers to a nucleic acid or peptide that is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. Moreover, an "isolated nucleic acid" is meant to include nucleic acid fragments, which are not naturally occurring as fragments and would not be found in the natural state. "Isolated" also refers to polypeptides that are isolated from other cellular proteins and is meant to encompass both purified and recombinant polypeptides;
- "knock-in" transgenic animal refers to an animal that has had a modified gene introduced into its genome and the modified gene can be of exogenous or endogenous origin;
- "knock-out" transgenic animal refers to an animal in which there is partial or complete suppression of the expression of an endogenous gene (e.g., based on deletion of at least a portion of the gene, replacement of at least a portion of the gene with a second sequence, introduction of stop codons, the mutation of bases encoding critical amino acids, or the removal of an intron junction, etc.);
- "knock-out construct" refers to a nucleic acid sequence that can be used to decrease or suppress expression of a protein encoded by endogenous DNA sequences in a cell. In one example, the knock-out construct is comprised of a gene, such as the CYP2D6 P450 gene, with a deletion in a critical portion of the gene so that active protein cannot be expressed therefrom. Alternatively, a number of termination codons can be added to the native gene to cause early termination of the protein or an intron junction can be inactivated. In a typical knock-out construct, some portion of the gene is replaced with a selectable marker (such as the neo gene) so that the gene can be represented as follows: CYP2D6 P450 5'/neo/ CYP2D6 P450 3', where 5' and 3', refer to genomic or cDNA sequences which are, respectively, upstream and downstream relative to a portion of the CYP2D6 P450 gene and where neo refers to a neomycin resistance gene. In another knock-out construct, a second selectable marker is added in a flanking position so that the gene can be represented as: CYP2D6 P450 5'/neo/CYP2D6 P450 3'/TK, where TK is a thymidine kinase gene which can be added to either the 5' or 3' sequence of the preceding construct and which further can be selected against (i.e., is a negative selectable marker) in appropriate media. This two-marker construct allows the selection of homologous recombination events, which removes the flanking TK marker, from non-homologous recombination events which typically retain the TK sequences. The gene deletion and/or replacement can be from the exons, introns, especially intron junctions, and/or the regulatory regions such as promoters;
- "linkage disequilibrium" refers to co-inheritance of two alleles at frequencies greater than would be expected from the separate frequencies of occurrence of each allele in a given control population. The expected frequency of occurrence of two alleles that are inherited independently is the frequency of the first allele multiplied by the frequency of the second allele. Alleles that co-occur at expected frequencies are said to be in "linkage disequilibrium". The cause of linkage disequilibrium is often unclear. It can be due to selection for certain allele combinations or to recent admixture of genetically heterogeneous populations. In addition, in the case of markers that are very tightly linked to a disease gene, an association of an allele (or group of linked alleles) with the disease gene is expected if the disease mutation occurred in the recent past, so that sufficient time has not elapsed for equilibrium to be achieved through recombination events in the specific chromosomal region. When referring to allelic patterns that are comprised of more than one allele, a first allelic pattern is in linkage disequilibrium with a second allelic pattern if all the alleles that comprise the first allelic pattern are in linkage disequilibrium with at least one of the alleles of the second allelic pattern;
- "marker" refers to a sequence in the genome that is known to vary among individuals.
- "modulate" refers to the ability of a substance to affect bioactivity. When applied to a CYP2D6 P450 bioactivity, an agonist or antagonist can modulate bioactivity for example by agonizing or antagonizing a CYP2D6 P450 synthesis, or monooxygenase activity;
- "non-human animal" includes mammals such as rodents, non-human primates, sheep, dogs, cows, goats, etc., amphibians, such as members of the Xenopus genus, and transgenic avians (e.g., chickens, birds, etc.). The term "chimeric animal" is used herein to refer to animals in which the recombinant gene is found, or in which the recombinant gene is expressed in some but not all cells of the animal. The term "tissue-specific chimeric animal" indicates that one of the recombinant CYP2D6 P450 genes is present and/or expressed or disrupted in some tissues but not others. The term "non-human mammal" refers to any member of the class Mammalia, except for humans;
- "nucleic acid" refers to polynucleotides or oligonucleotides such as deoxyribonucleic acid (DNA), and, where appropriate, ribonucleic acid (RNA). The term should also be understood to include, as equivalents, analogs of either RNA or DNA made from nucleotide analogs (e.g., peptide nucleic acids) and as applicable to the embodiment being described, single (sense or antisense) and double-stranded polynucleotides;
- "nucleotide sequence complementary to the nucleotide sequence set forth in SEQ ID NO. x" refers to the nucleotide sequence of the complementary strand of a nucleic acid strand having SEQ ID NO. x. The term "complementary strand" is used herein interchangeably with the term "complement". The complement of a nucleic acid strand can be the complement of a coding strand or the complement of a noncoding strand. When referring to double stranded nucleic acids, the complement of a nucleic acid having SEQ ID NO. x refers to the complementary strand of the strand having SEQ ID NO. x or to any nucleic acid having the nucleotide sequence of the complementary strand of SEQ ID NO. x. When referring to a single stranded nucleic acid having the nucleotide sequence SEQ ID NO. x, the complement of this nucleic acid is a nucleic acid having a nucleotide sequence which is complementary to that of SEQ ID NO. x. The nucleotide sequences and complementary sequences thereof are always given in the 5' to 3' direction;
- "percent identical" refers to sequence identity between two amino acid sequences or between two nucleotide sequences. Identity can each be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When an equivalent position in the compared sequences is occupied by the same base or amino acid, then the molecules are identical at that position; when the equivalent site occupied by the same or a similar amino acid residue (e.g., similar in steric and/or electronic nature), then the molecules can be referred to as homologous (similar) at that position. Expression as a percentage of homology, similarity, or identity refers to a function of the number of identical or similar amino acids at positions shared by the compared sequences. Expression as a percentage of homology, similarity, or identity refers to a function of the number of identical or similar amino acids at positions shared by the compared sequences. Various alignment algorithms and/or programs may be used, including FASTA, BLAST, or ENTREZ. FASTA and BLAST are available as a part of the GCG sequence analysis package (University of Wisconsin, Madison, Wis.), and can be used with, e.g., default settings. ENTREZ is available through the National Center for Biotechnology Information, National Library of Medicine, National Institutes of Health, Bethesda, Md. In one embodiment, the percent identity of two sequences can be determined by the GCG program with a gap weight of 1, e.g., each amino acid gap is weighted as if it were a single amino acid or nucleotide mismatch between the two sequences; other techniques for alignment are described in Methods in Enzymology, vol. 266: Computer Methods for Macromolecular Sequence Analysis (1996), ed. Doolittle, Academic Press, Inc., a division of Harcourt Brace & Co., San Diego, California, USA. Preferably, an alignment program that permits gaps in the sequence is utilized to align the sequences. The Smith-Waterman is one type of algorithm that permits gaps in sequence alignments. See Meth. Mol. Biol. 70: 173-187 (1997). Also, the GAP program using the Needleman and Wunsch alignment method can be utilized to align sequences. An alternative search strategy uses MPSRCH software, which runs on a MASPAR computer. MPSRCH uses a Smith-Waterman algorithm to score sequences on a massively parallel computer. This approach improves ability to pick up distantly related matches, and is especially tolerant of small gaps and nucleotide sequence errors. Nucleic acid-encoded amino acid sequences can be used to search both protein and DNA databases; Databases with individual sequences are described in Methods in Enzymology, ed. Doolittle, supra. Databases include Genbank, EMBL, and DNA Database of Japan (DDBJ); preferred nucleic acids have a sequence at least 70%, and more preferably 80% identical and more preferably 90% and even more preferably at least 95% identical to an nucleic acid sequence of a sequence shown in one of SEQ ID NOs. of the invention. Nucleic acids at least 90%, more preferably 95%, and most preferably at least about 98-99% identical with a nucleic sequence represented in one of SEQ ID NOs: 1-4 are of course also within the scope of the invention. In preferred embodiments, the nucleic acid is mammalian. In comparing a new nucleic acid with known sequences, several alignment tools are available. Examples include PileUp, which creates a multiple sequence alignment, and is described in Feng et al., J. Mol. Evol. (1987) 25:351-360. Another method, GAP, uses the alignment method of Needleman et al., J. Mol. Biol. (1970) 48:443-453. GAP is best suited for global alignment of sequences. A third method, BestFit, functions by inserting gaps to maximize the number of matches using the local homology algorithm of Smith and Waterman, Adv. Appl. Math. (1981) 2:482-489.
- "polymorphism" refers to the coexistence of more than one form of a gene, or portion (e.g., allelic variant) thereof, in a given population. A portion of a gene of which there are at least two different forms, i.e., two different nucleotide sequences, is referred to as a "polymorphic region of a gene". A polymorphic region can be a single nucleotide, the identity of which differs in different alleles. A polymorphic region can also be several nucleotides long;
- "promoter" means a DNA sequence that regulates expression of a selected DNA sequence operably linked to the promoter, and which effects expression of the selected DNA sequence in cells. The term encompasses "tissue specific" promoters, i.e. promoters, which effect expression of the selected DNA sequence only in specific cells (e.g. cells of a specific tissue). The term also covers so-called "leaky" promoters, which regulate expression of a selected DNA primarily in one tissue, but cause expression in other tissues as well. The term also encompasses non-tissue specific promoters and promoters that constitutively express or that are inducible (i.e. expression levels can be controlled);
- "protein", "polypeptide" and "peptide" are used interchangeably herein when referring to a gene product;
- "recombinant protein" refers to a polypeptide of the present invention which is produced by recombinant DNA techniques, wherein generally, DNA encoding a polypeptide is inserted into a suitable expression vector which is in turn used to transform a host cell to produce the heterologous protein. Moreover, the phrase "derived from", with respect to a recombinant gene, is meant to include within the meaning of "recombinant protein" those proteins having an amino acid sequence of a native polypeptide, or an amino acid sequence similar thereto which is generated by mutations including substitutions and deletions (including truncation) of a naturally occurring form of the polypeptide;
- "specifically hybridizes" or "specifically detects" refers to the ability of a nucleic acid molecule of the invention to hybridize to at least approximately 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 45, 50, 100, 150, 200, 300, 350, or 400 consecutive nucleotides of a vertebrate, preferably a CYP2D6 gene. In certain instances the invention provides nucleic acids which hybridize under stringent conditions to a nucleic acid represented by SEQ ID Nos. 1, 2, 3, or 4 or complement thereof or the nucleic acids. Appropriate stringency conditions which promote DNA hybridization, for example, 6.0 x sodium chloride/sodium citrate (SSC) at about 45° C, followed by a wash of 2.0 x SSC at 50°C, are known to those skilled in the art or can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6 or in Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press (1989). For example, the salt concentration in the wash step can be selected from a low stringency of about 2.0 x SSC at 50°C to a high stringency of about 0.2 x SSC at 50°C. In addition, the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22°C, to high stringency conditions at about 65°C. Both temperature and salt may be varied, or temperature and salt concentration may be held constant while the other variable is changed. In a preferred embodiment, an htrb nucleic acid of the present invention will bind to one of SEQ ID NOs. 1, 2, 3, or 4 or complement thereof under moderately stringent conditions, for example at about 2.0 x SSC and about 40° C. In a particularly preferred embodiment, a CYP2D6 nucleic acid of the present invention will bind to one of SEQ ID NOs. 1, 2, 3, or 4, or complement thereof, under high stringency conditions. In another particularly preferred embodiment, a CYP2D6 nucleic acid sequence of the present invention will bind to one of SEQ ID NO. 1, 2, 3, or 4 which correspond to the CYP2D6 cDNA, preferably open reading frame (ORF) nucleic acid sequences, under high stringency conditions;
- "susceptibility" to disease or condition or any similar phrase, means that certain alleles are hereby discovered to be associated with or predictive of a subject's incidence of developing a particular disease or condition (particularly a sensitivity to drugs). The alleles are thus over-represented in frequency in individuals with drug sensitivity as compared to normal individuals. These alleles are understood to relate to the drug sensitivity condition;
- "small molecule" as used herein, is meant to refer to a composition, which preferably has a molecular weight of less than about 5kD and most preferably less than about 4kD. Small molecules include nucleic acids, peptides, peptidomimetics, carbohydrates, lipids and other organic and inorganic molecules;
- "specifically hybridizes" or "specifically detects" refers to the ability of a nucleic acid molecule to hybridize to at least approximately 6 consecutive nucleotides of a sample nucleic acid.
- "transcriptional regulatory sequence" is a generic term used throughout the specification to refer to DNA sequences, such as initiation signals, enhancers, and promoters, which induce or control transcription of protein coding sequences with which they are operably linked;
- "transfection" means the introduction of a nucleic acid, e.g., via an expression vector, into a recipient cell by nucleic acid-mediated gene transfer.
- "transformation" refers to a process in which a cell's genotype is changed as a result of the cellular uptake of exogenous DNA or RNA, and, for example, the transformed cell expresses a recombinant form of a polypeptide or, in the case of anti-sense expression from the transferred gene, the expression of a naturally-occurring form of a polypeptide is disrupted;
- "transgene" means a nucleic acid sequence (encoding, e.g., one of the CYP2D6 P450 polypeptides, or an antisense transcript thereto) which has been introduced into a cell. A transgene could be partly or entirely heterologous, i.e., foreign, to the transgenic animal or cell into which it is introduced, or, is homologous to an endogenous gene of the transgenic animal or cell into which it is introduced, but which is designed to be inserted, or is inserted, into the animal's genome in such a way as to alter the genome of the cell into which it is inserted (e.g., it is inserted at a location which differs from that of the natural gene or its insertion results in a knockout). A transgene can also be present in a cell in the form of an episome. A transgene can include one or more transcriptional regulatory sequences and any other nucleic acid, such as introns, that may be necessary for optimal expression of a selected nucleic acid;
- "transgenic animal" refers to any animal, preferably a non-human mammal, bird or an amphibian, in which one or more of the cells of the animal contain heterologous nucleic acid introduced by way of human intervention, such as by transgenic techniques well known in the art. The nucleic acid is introduced into the cell, directly or indirectly by introduction into a precursor of the cell, by way of deliberate genetic manipulation, such as by microinjection or by infection with a recombinant virus. The term genetic manipulation does not include classical cross-breeding, or in vitro fertilization, but rather is directed to the introduction of a recombinant DNA molecule. This molecule may be integrated within a chromosome, or it may be extrachromosomally replicating DNA. In the typical transgenic animals described herein, the transgene causes cells to express a recombinant form of one of a CYP2D6 P450 polypeptide, e.g., either agonistic or antagonistic forms. However, transgenic animals in which the recombinant gene is silent are also contemplated, as for example, the FLP or CRE recombinase dependent constructs described below. Moreover, "transgenic animal" also includes those recombinant animals in which gene disruption of one or more genes is caused by human intervention, including both recombination or antisense techniques. The term is intended to include all progeny generations. Thus, the founder animal and all F1, F2, F3, and so on, progeny thereof are included;
- "treating," "treat" or "treatment" includes, inter alia, preventative (e.g., prophylactic), palliative and curative treatment, including, for example, ameliorating at least one symptom of a disease or at least one abnormality associated with a condition or disorder, e.g., decreased or over expression of a peptide of the invention. Treating a cardiovascular disorder can take place, for example, by administering a cardiovascular disorder therapeutic. Treating a cardiovascular disorder can also take place, for example, by modifying risk factors that are related to the cardiovascular disorder;
- "vector" refers to a nucleic acid molecule, which is capable of transporting another nucleic acid to which it has been linked. One type of preferred vector is an episome, i.e., a nucleic acid capable of extra-chromosomal replication. Preferred vectors are those capable of autonomous replication and/or expression of nucleic acids to which they are linked. Vectors capable of directing the expression of genes to which they are operatively linked are referred to herein as "expression vectors". In general, expression vectors of utility in recombinant DNA techniques are often in the form of "plasmids" which refer generally to circular double stranded DNA loops which, in their vector form are not bound to the chromosome. In the present specification, "plasmid" and "vector" are used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such other forms of expression vectors which serve equivalent functions and which become known in the art subsequently hereto;
- "wild-type allele" or "normal allele" refer to an allele of a gene which, when present in two copies in a subject results in a wild-type phenotype. There can be several different wild-type alleles of a specific gene, since certain nucleotide changes in a gene may not affect the phenotype of a subject having two copies of the gene with the nucleotide changes. In general a "wild-type allele" is the most common allele in a population; and
- "xenobiotic" refers to any substance that does not occur naturally but will affect living systems.
- The cytochrome P450 family of enzymes is primarily responsible for the metabolism of xenobiotics such as drugs, carcinogens and environmental chemicals, as well as several classes of endobiotics such as steroids and prostaglandins. These generally lipophilic compounds must be metabolized to more polar products before they can be excreted. This metabolic process, which is primarily catalyzed by hepatic enzymes, consists of a sequence of enzymatic steps that includes oxidation by a member of the cytochrome P450-dependent monooxygenases (phase I metabolism), followed by conjugation involving sulfation, glucoronidation or acetylation (phase II metabolism).
- Many cytochrome P450 genes which encodes products involved in phase I metabolism are known. There are multiple forms of these P450s, and each of these individual forms exhibit degrees of specificity towards individual chemicals in the above classes of compounds. In some cases, a substrate, whether it be a drug or a carcinogen, is metabolized by more then one of the cytochrome P450s. Genetic polymorphisms of cytochrome P450s result in phenotypically-distinct subpopulations that differ in their ability to metabolize particular drugs and other chemical compounds. As those skilled in the art will understand, these phenotypic distinctions have important implications for the selection of drugs for any given patient.
- For example, some individuals may have a defect in an enzyme required for detoxification of a particular drug, while some individuals may lack an enzyme required for conversion of the drug to a metabolically active form. Further, individuals lacking a biotransformation enzyme are often susceptible to cancers from environmental chemicals due to inability to detoxify the chemicals (see Eichelbaum et al., (1992) Toxicology Letters 64165: 155-122). Accordingly, those skilled in the art will appreciate that it is advantageous to identify individuals who are deficient in a particular P450 enzyme. Cytochrome P450 2D6 (or P450IID6), also known as debrisoquine hydroxylase, is the best characterized polymorphic P450 in the human population (see e.g. Gonzalez et al. (1998)). The cytochrome P450 2D6 gene represents a major Phase I drug metabolizing enzyme and is involved in the metabolism of numerous drugs. While CYP2D6 contributes only approximately 1.5% of the P450 protein present in human liver, it is responsible for approximately 24% of P450 drug metabolism activity (see Wolf & Smith (2000) Brit Med Bull 55: 366-386). The CYP2D6-encoded P450 appears to be particularly important in the metabolism of drugs targeted to the central nervous system. CYP2D6 is found in the brain (Gilham et al. (1997) Xenobiotica 27: 111-25) and may, therefore, have evolved to protect cells from environmental neurotoxins (Smith et al. (1992) Lancet 339: 1365-72).
- Genetic variation of this gene locus results in various altered enzymatic activities of this gene with the majority of individuals possessing normal activity (extensive metabolizers), some individuals possessing slightly reduced activity (intermediate metabolizers), and some individuals with increased enzyme activity, in part due to gene duplications (rapid metabolizers). Individuals who lack enzyme activity, due to inactivating mutations in both copies of the CYP2D6 gene, are unable to metabolize drugs that require the CYP2D6 enzyme and are referred to as CYP2D6 poor metabolizers. A number of mutations in the CYP2D6 gene that result in poor or intermediate metabolizer phenotypes, depending upon whether only one or both copies of the CYP2D6 gene are affected by mutation, have already been described (see, for example, U.S. Patent No. 5,648,482).
- Genetic screening (or genotyping), involves testing to determine if a patient has mutations (or alleles or polymorphisms) that either cause a disease state, contribute to a disease state (i.e., are a risk factor associated with a disease state), are "linked" to the mutation causing a disease state, or are "linked" to the mutation which contributes to the disease state. Linkage refers to the phenomenon wherein DNA sequences that are close together in the genome have a tendency to be inherited together. Two sequences may be linked because of some selective advantage of co-inheritance. More typically, however, two polymorphic sequences are co-inherited because of the relative infrequency with which meiotic recombination events occur within the region between the two polymorphisms. The co-inherited polymorphic alleles are said to be in linkage disequilibrium with one another because, in a given human population, they tend to either both occur together or else not occur at all in any particular member of the population.
- The present invention provides a novel human CYP2D6 polymorphic variation, i.e., at position 5816 of the CYP2D6 gene corresponding to a substitution of the sequence "TA" for the "C" at position 5816 of the CYP2D6 genomic sequence (GenBank Accession No. M33388; SEQ ID NO. 1 shown in FIGURE 2) and at position 1474 of the CYP2D6 cDNA sequence (GenBank Accession No. NM_000106; SEQ ID NO. 3 shown in FIGURE 4). The cytochrome P450 2D6 gene represents a major phase I drug metabolizing enzyme and is involved in the metabolism of numerous drugs. The present invention provides a novel mutation in the CYP2D6 gene that is an insertion of two nucleotides in
exon 9 of the gene. This mutation results in a frameshift within the critical carboxy-terminal region of the gene which, in the wild-type enzyme, is required for catalytic activity. In addition, an individual who possesses this C5816TA CYP2D6 gene mutation was found to further carry a nucleotide change of G to C at position 5799 of the CYP2D6 genomic sequence (GenBank Accession No. M33388; SEQ ID NO. 1 shown in FIGURE 2) and at position 1457 of the CYP2D6 cDNA sequence (GenBank Accession No. NM_000106; SEQ ID NO. 3 shown in FIGURE 4). Analysis of the drug metabolizing phenotype of the individual who possesses this gene mutation, in combination with another CYP2D6 PM allele, revealed the individual to possess a PM phenotype indicating that this novel C5816TA allele also results in a non-functional CYP2D6 allele. Accordingly, the present invention provides methods and reagents for predicting susceptibility to diminished metabolism of drugs by detecting a cytochrome P450 CYP2D6 polymorphism of the invention. - The present invention provides CYP2D6 genomic and cDNA nucleic acids, homologs thereof, and portions thereof. Preferred nucleic acids have a sequence at least about 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, and more preferably 85% homologous and more preferably 90% and more preferably 95% and even more preferably at least 99% homologous with a nucleotide sequence of a CYP2D6 gene, e.g., such as a sequence shown in one of SEQ ID NOs: 1, 2, 3, or 4 or complement thereof of the CYP2D6 nucleic acids having the GenBank Accession Nos. M33388 (genomic CYP2D6 locus) or NM_000106 (CYP2D6 cDNA sequence). Nucleic acids at least 90%, more preferably 95%, and most preferably at least about 98-99% identical with a nucleic sequence represented in one of SEQ ID NOs. 1, 2, 3, or 4, or complement thereof, are of course also within the scope of the invention. In a preferred embodiment, the nucleic acid is human, preferably mammalian and in a particularly preferred embodiment, includes all or a portion of the nucleotide sequence corresponding to the coding region of the CYP2D6 P450 polypeptide, or mutant variant thereof, such as the nucleic acid set forth in SEQ ID NOs. 1-4.
- The invention also provides isolated nucleic acids comprising a nucleotide sequence encoding CYP2D6 polypeptides, variants and/or equivalents of such nucleic acids. The term equivalent is understood to include nucleotide sequences encoding functionally equivalent CYP2D6 polypeptides or functionally equivalent peptides having an activity of an CYP2D6 protein such as described herein. Those skilled in the art will understand that equivalent nucleotide sequences will include sequences that differ by one or more nucleotide substitution, addition or deletion, such as allelic variants; and will, therefore, include sequences that differ from the nucleotide sequence of the CYP2D6 gene shown in SEQ ID NOs. 1, 2, 3, or 4 due to the degeneracy of the genetic code.
- In a preferred embodiment, the nucleic acids are vertebrate CYP2D6 nucleic acids. In a particularly preferred embodiment, the nucleic acids are mammalian CYP2D6 nucleic acids. Regardless of species, particularly preferred CYP2D6 nucleic acids encode polypeptides that are at least 60%, 65%, 70%, 72%, 74%, 76%, 78%, 80%, 90%, or 95% similar or identical to an amino acid sequence of a vertebrate CYP2D6 protein. In one embodiment, the nucleic acid is a cDNA encoding a polypeptide having at least one bio-activity of the subject CYP2D6 polypeptide. Preferably, the nucleic acid includes all or a portion of the nucleotide sequence corresponding to the nucleic acid of SEQ ID NOs. 1, 2, 3 or 4.
- Still other preferred nucleic acids of the present invention encode CYP2D6 polypeptides which are comprised of at least 2, 5, 10, 25, 50, 100, 150 or 200 amino acid residues. For example, such nucleic acids can comprise about 50, 60, 70, 80, 90, or 100 base pairs. Also within the scope of the invention are nucleic acid molecules for use as probes/primer or antisense molecules (i.e. noncoding nucleic acid molecules), which can comprise at least about 6, 12, 20, 30, 50, 60, 70, 80, 90 or 100 base pairs in length.
- Another aspect of the invention provides a nucleic acid which hybridizes under stringent conditions to a nucleic acid represented by SEQ ID NOs. 1, 2, 3, or 4 or complement thereof. Appropriate stringency conditions which promote DNA hybridization, for example, 6.0 x SSC at about 45° C, followed by a wash of 2.0 x SSC at 50°C, are known to those skilled in the art or can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6 or in Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press (1989). For example, the salt concentration in the wash step can be selected from a low stringency of about 2.0 x SSC at 50°C to a high stringency of about 0.2 x SSC at 50°C. In addition, the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22°C, to high stringency conditions at about 65°C. Both temperature and salt may be varied, or temperature and salt concentration may be held constant while the other variable is changed. In a preferred embodiment, an CYP2D6 nucleic acid of the present invention will bind to one of SEQ ID NOs. 1, 2, 3, or 4 or complement thereof under moderately stringent conditions, for example at about 2.0 x SSC and about 40° C. In a particularly preferred embodiment, a CYP2D6 nucleic acid of the present invention will bind to one of SEQ ID NOs. 1, 2, 3, or 4 or complement thereof under high stringency conditions. In another particularly preferred embodiment, a CYP2D6 nucleic acid sequence of the present invention will bind to one of SEQ ID NOs. 3, which correspond to CYP2D6 ORF nucleic acid sequences, under high stringency conditions.
- Nucleic acids having a sequence that differs from the nucleotide sequences shown in one of SEQ ID NOs. of the present invention, or complement thereof, due to degeneracy in the genetic code are also within the scope of the invention. Such nucleic acids encode functionally equivalent peptides (i.e., peptides having a biological activity of a CYP2D6 polypeptide) but differ in sequence from the sequence shown in the sequence listing due to degeneracy in the genetic code. For example, a number of amino acids are designated by more than one triplet. Codons that specify the same amino acid, or synonyms (for example, CAU and CAC each encode histidine) may result in "silent" mutations which do not affect the amino acid sequence of a CYP2D6 polypeptide. However, it is expected that DNA sequence polymorphisms that do lead to changes in the amino acid sequences of the subject CYP2D6 polypeptides will exist among mammals. One skilled in the art will appreciate that these variations in one or more nucleotides (e.g., up to about 3-5% of the nucleotides) of the nucleic acids encoding polypeptides having an activity of an CYP2D6 polypeptide may exist among individuals of a given species due to natural allelic variation.
- The nucleotide sequences determined from the cloning of CYP2D6 genes from mammalian organisms will further allow for the generation of probes and primers designed for detecting a CYP2D6 C5816TA allelic variant by any means such as by detection of an amplification product using a C5816TA allele-specific primer or by detecting the presence of the CYP2D6 C5816TA allelic variant using an ASO detector probe. Those skilled in the art based upon the present description will understand how to design other probes including those for use in restriction fragment length polymorphism (RFLP) analyses to detect any of a number of restriction sites which are altered by the C5816TA mutation. TABLE 1 below is a listing of exemplary oligonucleotide sequences (or subsequences) for use in the present invention.
- In a preferred embodiment, the CYP2D6 primers are designed so as to optimize specificity and avoid secondary structures which affect the efficiency of priming. Optimized PCR primers of the present invention are designed so that "upstream" and "downstream" primers have approximately equal melting temperatures such as can be estimated using the formulae: Tm = 81.5° C - 16.6(log10[Na+]) + 0.41 (%G+C) - 0.63 (%formamide) - (600/length); or Tm(° C) = 2(A/T) + 4(G/C). Optimized CYP2D6 primers may also be designed by using various programs, such as "Primer3" provided by the Whitehead Institute for Biomedical Research at http://www-genome.wi.mit.edu/cgi-bin/primer/primer3.cgi.
- In preferred embodiments, the CYP2D6 probes and primers can be used to detect CYP2D6 locus polymorphisms which occur within and surrounding the CYP2D6 gene sequence, in particular the C5816TA and/or the G5799C wild-type and mutant polymorphic alleles. Genetic variations within the CYP2D6 locus are associated with sensitivity to drugs metabolized by the CYP2D6 P450 monooxygenase. Accordingly, the invention provides probes and primers for CYP2D6 locus polymorphisms, including polymorphisms associated with the human and mouse CYP2D6 gene. PCR primers of the invention include those which flank an CYP2D6 human polymorphism and allow amplification and analysis of this region of the genome. Analysis of polymorphic allele identity may be conducted, for example, by direct sequencing or by the use of allele-specific capture probes or by the use of molecular beacon probes. Alternatively, the polymorphic allele may allow for direct detection by the creation or elimination of a restriction endonuclease recognition site(s) within the PCR product or after an appropriate sequence modification is designed into at least one of the primers such that the altered sequence of the primer, when incorporated into the PCR product resulting from amplification of a specific CYP2D6 polymorphic allele, creates a unique restriction site in combination with at least one allele but not with at least one other allele of that polymorphism. CYP2D6 polymorphisms corresponding to variable number of tandem repeat (VNTR) polymorphisms may be detected by the electrophoretic mobility and hence size of a PCR product obtained using primers which flank the VNTR. Still other CYP2D6 polymorphisms corresponding to RFLPs may be detected directly by the mobility of bands on a Southern blot using appropriate CYP2D6 locus probes and genomic DNA or cDNA obtained from an appropriate sample organism such as a human or a non-human animal.
- Likewise, probes based on the subject CYP2D6 sequences can be used to detect transcripts or genomic sequences encoding the same or homologous proteins, for use, e.g, in prognostic or diagnostic assays (further described below). The present invention provides probes which are common to alternatively-spliced variants of the CYP2D6 transcript, such as those corresponding to at least 12 consecutive nucleotides complementary to a sequence found in any of SEQ ID NOs. of the present invention. In addition, the present nvention provides probes which hybridize specifically to alternatively spliced forms of the CYP2D6 transcript. As those skilled in the art will appreciate based upon the present description, any suitable probes and primers can be prepared and modified, e.g., as previously described herein for other types of nucleic acids.
- In one embodiment, the present invention provides methods for determining whether an individual has a genetic deficiency for metabolizing certain agents, e.g., has a poor metabolizer genetype by detecting the presence of a cytochrome P450 CYP2D6 gene C5816TA polymorphism in a genomic DNA or cDNA sample from the individual. Any suitable methods for detecting the presence of this polymorphism are included within the scope of the instant invention; however, in a particularly preferred embodiment of such methods, the method includes the step of an initial amplification, preferably by PCR, of a segment of the CYP2D6 gene which includes the 5816 polymorphic locus, and the subsequent detection of an amplification product which includes the C5816TA sequence change. In a preferred embodiment, such amplification is achieved with allele specific oligonucleotide primers having 3' terminal nucleotide sequence which correspond to the wild-type 5816 nucleotide sequence (i.e. "C"), or complement thereof, or at least one nucleotide of the mutant 5816-5817 TA sequence. As those skilled in the art will appreciate, in general, such allele-specific amplification primers fail to produce an amplification product unless the allele which they are specific for is present in the patient genomic or cDNA sample.
- Suitable C5816TA- specific amplification primers comprise a sequence of at least 10 consecutive nucleotides of SEQ ID NO. 2 or SEQ ID NO. 4, or complement thereof, and further feature a 3' terminal nucleotide which is the T at position 5816 of SEQ ID NO. 2, the T at position 1474 of SEQ ID NO. 4, the A at position 5817 of SEQ ID NO. 2, or the A at position 1475 of SEQ ID NO. 4. Particularly preferred C5816TA- specific amplification primers of the invention include, for example, the sequences CATCCCCCTATGAGT (SEQ ID NO. 11), ATCCCCCTATGAGTA (SEQ ID NO. 12), GGGCACAGCACAAAT (SEQ ID NO. 13), or GGCACAGCACAAATA (SEQ ID NO. 14).
- When such C5816TA allele-specific amplification primers are utilized, the presence of the C5816TA polymorphism in a patient's genomic or cDNA sample is indicated by the production of an amplification product with the C5816TA allele specific primer; however, other suitable methods of detecting the C5816TA polymorphic variation are also included in the present invention. For example, when the amplification primers are chosen so that an amplification product is obtained from either the wild-type or C5816TA mutant CYP2D6 locus, an allele-specific oligonucleotide (ASO) detector that includes the TA sequence at position 5816-5817 of SEQ ID NO. 2 may be used to detect the C5816TA mutation. Preferred ASO detector oligonucleotides of the invention include: CCTATGAGTATTTGTGCT (SEQ ID NO. 21) and AGCACAAATACTCATAGG (SEQ ID NO. 22). Alternatively, detection of the C5816TA allelic variant may be achieved by a restriction endonuclease analysis such as by RFLP analysis (i.e. a Southern blot following restriction digestion of an unamplified genomic or cDNA sample) or by restriction of an appropriate amplification product. This aspect of the invention is possible because the CYP2D6 C5816TA mutation destroys an Alul and a CviJl site which is present in the wild-type CYP2D6 sequence at this position. In addition, a second alteration in susceptibility to restriction endonuclease digestion is caused by a G5799C mutation which was found associated with the C5816TA mutation in a patient sample. In particular, the presence of the G5799C allelic variant of
CYP2D6 exon 9 is indicated by the loss of Ban II, CviJI, or Bsp1286I restriction sites which are present in the corresponding position of a wild type CYP2D6 DNA. - Another embodiment of the present invention provides primers capable of amplifying the C5816TA allelic variant. Generally, such primers include a sequence of at least 10 consecutive nucleotides of SEQ ID NO. 2 or SEQ ID NO. 4, or complement thereof, and further possess a 3' terminal nucleotide that is C5816TA allele-specific such as the T at position 5816 of SEQ ID NO. 2, the T at position 1474 of SEQ ID NO. 4, the A at position 5817 of SEQ ID NO. 2, or the A at position 1475 of SEQ ID NO. 4. Particularly preferred mutant allele-specific primers feature a 3' sequence such as CATCCCCCTATGAGT (SEQ ID NO. 11), ATCCCCCTATGAGTA (SEQ ID NO. 12), GGGCACAGCACAAAT (SEQ ID NO. 13), or GGCACAGCACAAATA (SEQ ID NO. 14). Other allele specific oligonucleotide for the detection of the C5816TA allelic variant include a sequence of at least 10 consecutive nucleotides of SEQ ID NO. 2 or SEQ ID NO. 4, or complement thereof, and further feature the nucleotide pair TA at position 5816-5817 of SEQ ID NO. 2 and position 1474-1475 of SEQ ID NO. 4, or complement thereof. Preferred allele specific oligonucleotides of this type include, for example, sequences CCTATGAGTATTTGTGCT (SEQ ID NO. 21) or AGCACAAATACTCATAGG (SEQ ID NO. 22).
- The present invention also provides methods for determining whether an individual is susceptible to being a PM of drugs by detecting the presence of a G5799C sequence change which was found associated with the cytochrome P450 CYP2D6 gene C5816TA polymorphic change in a patient sample. In this aspect of the invention, a PM phenotype resulting from the C5816TA P450 2D6-inactivating mutation is inferred from the presence of the closely linked G5799C mutation. A further application of this principle may be employed to determine an entire C5816TA haplotype of polymorphisms associated with the C5816TA inactivating mutation. Primers of the present invention which are capable of amplifying the G5799C allelic variant of
CYP2D6 exon 9 preferably include a 3'oligonucleotide sequence such as TGCTTTCCTGGTGAC (SEQ ID NO. 17) or CATAGGGGGATGGGG (SEQ ID NO. 18). Detection of amplified DNA that codes for the G5799C allelic variant ofCYP2D6 exon 9, can also be achieved using allele specific oligonucleotides such as CCTGGTGACCCCATCCC (SEQ ID NO. 25), or GGGATGGGGTCACCAGG (SEQ ID NO. 26). - In yet another embodiment, the present invention provides protein-based methods for detecting the C5816TA PM polymorphism. In particular, the C5816TA mutation results in a frame shift in the critical carboxy-terminal domain of this P450 open reading frame. The frame-shift results in the production of a mutant polypeptide with an altered carboxy-terminus (i.e., YLCCAPLEWGT (SEQ ID NO. 27) in place of the normal CYP2D6 carboxy-terminal sequence LCAVPR (SEQ ID NO. 28), see FIGURE 6). Accordingly, the presence of a stable mutant CYP2D6 C5816TA polypeptide can be detected in a patient protein sample by the use of an appropriate antibody, such as a monoclonal antibody that recognizes an epitope of the YLCCAPLEWGT mutant carboxy-terminal sequence, prepared based upon the present description.
- The present invention relates to the discovery of a novel genetic polymorphism in
exon 9 of the CYP2D6 gene that results in a frame shift in the CYP2D6 P450 gene product and loss of P450 enzymatic activity. The sequence change corresponds to a mutation at position 5816 of the CYP2D6 gene as numbered in GenBank Accession No. M33388 and as depicted in FIGURE 2. The mutant frame-shifted allele contains the sequence "TA" inserted in place of the "C" at position 5816 of the wild type CYP2D6 genomic sequence (FIGURE 2, SEQ ID NO. 1), resulting in the creation of a mutant C5816TA genomic sequence (FIGURE 3, SEQ ID NO. 2). The mutant frame-shift is withinexon 9 of the CYP2D6 gene and occurs at position 1474 of the CYP2D6 cDNA (FIGURE 4; GenBank Accession No. NM_000106; and SEQ ID NO. 3), resulting in the creation of a mutant C5816TA cDNA sequence (FIGURE 5; SEQ ID NO. 4). - The presence of the CYP2D6 C5816TA mutant allele is associated with an altered enzyme activity potentially leading (i) to undesirable effects when individuals are treated with standard doses of certain agents; (ii) to increased susceptibility to cancer following environmental exposures; or (iii) other clinical conditions. Detection of DNA variants at the CYP2D6 locus offers a strategy for identifying individuals at risk based on their genotype, prior to treatment. In accordance with the present invention, the detection of the CYP2D6 C5816TA mutant allele may be effected using any known state-of-the-art hybridization approaches, including, but not limited to, Southern blot, reverse dot-blot and liquid phase hybridization, as those skilled in the art will understand how to perform based upon the present description.
- Reverse dot blot refers to a treatment of a support (such as nylon membrane) to which is attached an ASO capable of hybridizing with a labeled complementary probe (such as amplified DNA). In accordance with another embodiment of the present invention, the detection of specific mutations within a gene of interest is through hybridization of PCR products with ASO probes for the wild type or variant alleles utilized in parallel hybridizations. Only the oligonucleotide that precisely hybridizes to the target sequences produces a signal from a labeled probe. This genotyping method, which require small amounts of nucleated cells derived from a variety of sources, is not affected by the underlying disease or by drugs taken by the patient, and it provides results within a suitable period of time, such as, for example, within about 24-48 hours, thus allowing for relatively rapid intervention. The present invention provides diagnostic tests, e.g., to identify individuals with altered xenobiotics-metabolizing activities based on their genotypes. Such diagnostic tests to determine the genotypes of individuals are advantageous, e.g., because, as those skilled in the art will appreciate, the measurement of enzymatic activities can have many undesirable limitations. Accordingly, tests are provided for detecting mutations in the CYP2D6 gene. In certain embodiments, these tests involve the amplification of all, or a portion of, the CYP269 genomic locus, or cDNA, where the mutations of interest are found. Following amplification, the amplified fragments can then be assayed for the presence, or absence, of the specific mutation of interest (i.e. at least one of the mutations) by using hybridization with ASO probes.
- Although much of these assays can be done in any molecular biology facilities, procedures and kits are designed that contain all the reagents, primers and solutions for the genotyping test to facilitate the procedure for use in general clinical laboratories, such as those found in a typical hospital, clinic and even private reference laboratories.
- The present invention provides isolated oligonucleotide molecules comprising sequences hybridizing to genes encoding xenobiotic metabolizing enzyme CYP2D6, wild type and mutant alleles thereof; wherein said sequences are sufficiently complementary to said genes to hybridize therewith, respectively. In accordance with the present invention, there is provided an isolated oligonucleotide molecule comprising a mutant allele of CYP2D6 which contains a point mutation at position 5816 corresponding to a C to TA substitution and which, further, may optionally also contain a point mutation at position 5799 corresponding to a G to C substitution. In Preferred mutant oligonucleotide molecules of the present invention include, for example, those having a nucleic acid sequence of at least about 10 to 25 consecutive nucleotides of SEQ ID NO. 2 or 4; while preferred wild type oligonucleotide molecules include, for example, those having a nucleic acid sequence of at least about 10 to 25 consecutive nucleotides of SEQ ID NO. 1 or 3.
- In accordance with the present invention there are provided diagnostic assays for determining genetic variants in a CYP2D6 gene in a subject, which comprise the steps of: a) obtaining a genomic DNA sample of said subject; b) using the DNA sample of step a), amplifying a fragment comprising a polymorphic site of the CYP2D6 genes; c) hybridizing the amplified fragment of step b) with ASO probes corresponding to wild type and variant alleles to determine the CYP2D6 genotype of the subject.
- In accordance with a preferred embodiment of the present invention, the amplifying step b) is effected with PCR primers as set forth below. In accordance with a preferred embodiment of the present invention, the method further comprises a step i) before step c) consisting in subjecting the amplified fragment of step b) to Southern dot blot transfer on membrane, and wherein step c) is effected by hybridizing the dot blots with the oligonucleotide. In accordance with a preferred embodiment of the present invention, a labeled ASO probe is used in step c) and is selected from the sequences set forth below and hybridizes under stringent conditions.
- The invention further provides diagnostic kits for determining DNA variations in the CYP2D6 gene in a subject, which comprises: a) at least one of PCR primer sets; and b) at least one of the ASO probe.
- In certain embodiments, the invention utilizes methods of detecting the presence of other CYP2D6 polymorphisms, in combination with the CYP2D6 C5816TA polymorphic variation of the invention. Several null CYP2D6 alleles have been characterized and PCR-RFLP assays have been developed for convenient genotyping (Gonzalez and Meyer 1991). The most common alleles are CYP2D6 *3 (1bp deletion at pos. A2637) and *4 (splice-site mutation G1934A), accounting for over 96% of all null alleles ( as described in WO/0024926, the content of which are incorporated herein by reference). Individuals homozygous for any of these null alleles, completely lacking CYP2D6 activity, will be considered phenotypically PMs. There are several other less common polymorphisms: C188T, C212A, insT226, G971C, C1111T, G1726C, delT1795, G1846T, G1846A, G2064A, delA2701-A2703, delG2702-G2704, and A3023C. There are significant interethnic differences in the prevalence of the PM phenotype of CYP2D6. For example, in North American and European Caucasian populations, the prevalence of poor metabolisers is about 5%. In contrast, the prevalence is about 1.8% in American blacks, about 1.0% in Chinese, and apparently absent in the Japanese population.
- The methods of the present invention provide means for determining if a subject has (diagnostic) or is at risk of developing (prognostic) aan agent sensitivity condition or disorder that is associated with an aberrant CYP2D6 activity, e.g., an aberrant level of CYP2D6 protein or an aberrant CYP2D6 bioactivity. Examples of drugs to which CYP2D6 mutations cause sensitivity include: chlorpromazine, clomipramine, clozapine, desipramine, fluoxetine, fluphenazine, fluvoxamine, haloperidol, levopromazine, mianserin, nortryptiline, paroxetine, perphenazine, risperidone, sertraline, thioridazine, trifluperidol, trimipramine and zuclopenthixol (see Wolf & Smith (1999) Brit Med Bull 55: 366-86). Still the drugs metabolized by P450 CYP2D6 include: alprenolol, amiflavine, amiodorone, amitryptline, apigenin, budesonide, bufuralol, bupranolol, chloral hydrate, clonidine, clotrimazole, codeine, cyclobenzaprine, dexfenfluramine, dextromethorphan, dibucaine, dihydroergotamine, dolasetron, doxorubicin, encainide, ethinylestradiol, ethylmorphine, fenoterol, flecainide, formoterol, guanoxan, 4-hydroxy amphetamine, imipramine, indoramine, ketoconazole, laudanosine, loratadine, MDMA (ecstacy), mefloquine, methoxamine HCI, methoxyphenamine, methoxypsoralen, methysergide HCI, metoclopramide, metoprolol, minaprine, moclobemide, MPTP, mexiletine, nicergoline, nimodipine, nitrendipine, olanzapine, ondansetron, oxprenolol, perhexiline, phenformin, phenylpropanolamine, procainamide, promethazine, N-propylajmaline, propafenone, propranolol, pyrimethamine, quercitin, rifampicin, ritonavir, roxithromycin, serotonin, sparteine, sulfasalazine, tacrine, tamoxifen, timolol, tomoxetine, tranylcypomine, and tropisetron. Preferred methods for detecting altered CYP2D6 activity resulting from a CYP2D6 polymorphism include genetic assays such as RFLP (restriction fragment length polymorphism), ASO PCR (allele specific oligonucleotide hybridization to PCR products or PCR using mutant/wildtype specific oligo primers), SSCP (single stranded conformation polymorphism) and TGGE/DGGE (temperature or denaturing gradient gel electrophoresis), and MDE (mutation detection electrophoresis).
- Accordingly, the invention provides methods for determining whether a subject has or is likely to develop, a disease or condition that is caused by or contributed to by an abnormal CYP2D6 level or bioactivity, for example, comprising determining the level of a CYP2D6 gene or protein, a CYP2D6 bioactivity and/or the presence of a mutation or particular polymorphic variant in the CYP2D6 gene.
- In one embodiment of the present invention, the method comprises determining whether a subject has an abnormal mRNA and/or protein level of CYP2D6, such as by Northern blot analysis, reverse transcription-polymerase chain reaction (RT-PCR), in situ hybridization, immunoprecipitation, Western blot hybridization, or immunohistochemistry. According to the method, cells are obtained from a subject and the CYP2D6 protein or mRNA level is determined and compared to the level of CYP2D6 protein or mRNA level in a healthy subject. An abnormal level of CYP2D6 polypeptide or mRNA level is likely to be indicative of an aberrant CYP2D6 activity. In particular, the invention provides methods and reagents for detecting CYP2D6 C5816TA nucleic acid or encoded protein sequence changes in a patient sample.
- In another embodiment of the present invention, the method comprises measuring at least one activity of CYP2D6, such as a monoxygenase activity, using techniques known in the art, and those skilled in the art based upon the present description will understand how to perform such measurements. Comparison of the results obtained with results from similar analysis performed on CYP2D6 proteins from healthy subjects is indicative of whether a subject has an abnormal CYP2D6 activity.
- In preferred embodiments, the methods for determining whether a subject has or is at risk for developing a disease, which is caused by or contributed to by an aberrant CYP2D6 activity is characterized as comprising detecting, in a sample of cells from the subject, the presence or absence of a genetic alteration characterized by at least one of (i) an alteration affecting the integrity of a gene encoding a CYP2D6 polypeptide, particularly a C5816TA mutation, or (ii) the mis-expression of the CYP2D6 gene. For example, such genetic alterations can be detected by ascertaining the existence of at least one of (i) a deletion of one or more nucleotides from a CYP2D6 gene, (ii) an addition of one or more nucleotides to a CYP2D6 gene, (iii) a substitution of one or more nucleotides of a CYP2D6 gene, (iv) a gross chromosomal rearrangement of a CYP2D6 gene, (v) a gross alteration in the level of a messenger RNA transcript of a CYP2D6 gene, (vii) aberrant modification of a CYP2D6 gene, such as of the methylation pattern of the genomic DNA, (vii) the presence of a non-wild type splicing pattern of a messenger RNA transcript of a CYP2D6 gene, (viii) a non-wild type level of a CYP2D6 polypeptide, (ix) allelic loss of a CYP2D6 gene, and/or (x) inappropriate post-translational modification of a CYP2D6 polypeptide. As set out below, the present invention provides a large number of assay techniques for detecting alterations in a CYP2D6 gene. These methods include, but are not limited to, methods involving sequence analysis, Southern blot hybridization, restriction enzyme site mapping, and methods involving detection of absence of nucleotide pairing between the nucleic acid to be analyzed and a probe. These and other methods are further described infra.
- Specific diseases or disorders, e.g., genetic diseases or disorders, are associated with specific allelic variants of polymorphic regions of certain genes, which do not necessarily encode a mutated protein. Thus, the presence of a specific allelic variant of a polymorphic region of a gene, such as a single nucleotide polymorphism ("SNP"), in a subject can render the subject susceptible to developing a specific disease or disorder. Polymorphic regions in genes, e.g, CYP2D6 genes, can be identified, by determining the nucleotide sequence of genes in populations of individuals. If a polymorphic region, e.g., SNP is identified, then the link with a specific disease can be determined by studying specific populations of individuals, e.g, individuals which developed a specific disease, such as congestive heart failure, hypertension, hypotension, or a cancer (e.g. a cancer involving growth of a steroid responsive tumor or tumors). A polymorphic region can be located in any region of a gene, e.g., exons, in coding or non coding regions of exons, introns, and promoter region.
- Those skilled in the art will understand that it is likely that CYP2D6 genes comprise polymorphic regions, specific alleles of which may be associated with specific diseases or conditions or with an increased likelihood of developing such diseases or conditions. Thus, the invention provides methods for determining the identity of the allele or allelic variant of a polymorphic region of a CYP2D6 gene in a subject, to thereby determine whether the subject has or is at risk of developing a disease or disorder associated with a specific allelic variant of a polymorphic region.
- In an exemplary embodiment, there is provided a nucleic acid composition comprising a nucleic acid probe including a region of nucleotide sequence which is capable of hybridizing to a sense or antisense sequence of a CYP2D6 gene or naturally occurring mutants thereof, or 5' or 3' flanking sequences or intronic sequences naturally associated with the subject CYP2D6 genes or naturally occurring mutants thereof. The nucleic acid of a cell is rendered accessible for hybridization, the probe is contacted with the nucleic acid of the sample, and the hybridization of the probe to the sample nucleic acid is detected. Such techniques can be used to detect alterations or allelic variants at either the genomic or mRNA level, including deletions, substitutions, etc., as well as to determine mRNA transcript levels.
- A preferred detection method is allele specific hybridization using probes overlapping the mutation or polymorphic site and having about 5, 10, 20, 25, or 30 nucleotides around the mutation or polymorphic region. In a preferred embodiment of the invention, several probes capable of hybridizing specifically to allelic variants, such as single nucleotide polymorphisms, are attached to a solid phase support, e.g., a "chip". Oligonucleotides can be bound to a solid support by a variety of processes, including lithography. For example a chip can hold up to 250,000 oligonucleotides. Mutation detection analysis using these chips comprising oligonucleotides, also termed "DNA probe arrays" is described e.g., in Cronin et al., (1996) Human Mutation 7:244. In one embodiment, a chip comprises all the allelic variants of at least one polymorphic region of a gene. The solid phase support is then contacted with a test nucleic acid and hybridization to the specific probes is detected. Accordingly, the methods of the present invention provide for the identification of numerous allelic variants of one or more genes in a simple hybridization experiment.
- In certain embodiments, detection of the alteration comprises utilizing the probe/primer in a PCR (see, e.g. U.S. Patent Nos. 4,683,195 and 4,683,202), such as anchor PCR or RACE PCR, or, alternatively, in a ligase chain reaction (LCR) (see, e.g., Landegran et al. (1988) Science 241:1077-1080; and Nakazawa et al. (1994) PNAS 91:360-364), the latter of which can be particularly useful for detecting point mutations in the CYP2D6 gene (see Abravaya et al. (1995) Nuc Acid Res 23:675-682). In a merely illustrative embodiment, the method includes the steps of (i) collecting a sample of cells from a patient, (ii) isolating nucleic acid (e.g., genomic, mRNA or both) from the cells of the sample, (iii) contacting the nucleic acid sample with one or more primers which specifically hybridize to a CYP2D6 gene under conditions such that hybridization and amplification of the CYP2D6 gene (if present) occurs, and (iv) detecting the presence or absence of an amplification product, or detecting the size of the amplification product and comparing the length to a control sample. It should be understood by those skilled in the art that it is anticipated that PCR and/or LCR may be desirable to use as a preliminary amplification step in conjunction with any of the techniques used for detecting mutations described herein.
- Alternative amplification methods for use in the present invention include: self sustained sequence replication (Guatelli, J.C. et al., 1990, Proc. Natl. Acad. Sci. USA 87:1874-1878), transcriptional amplification system (Kwoh, D.Y. et al., 1989, Proc. Natl. Acad. Sci. USA 86:1173-1177), Q-Beta Replicase (Lizardi, P.M. et al., 1988, Bio/Technology 6:1197), or any other nucleic acid amplification method, followed by the detection of the amplified molecules using techniques well known to those of skill in the art. These detection schemes are especially useful for the detection of nucleic acid molecules if such molecules are present in very low numbers.
- In a preferred embodiment of the subject assay, mutations in, or allelic variants, of a CYP2D6 gene from a sample cell are identified by alterations in restriction enzyme cleavage patterns. For example, sample and control DNA is isolated, amplified (optionally), digested with one or more restriction endonucleases, and fragment length sizes are determined by gel electrophoresis. Moreover, the use of sequence specific ribozymes (see, for example, U.S. Patent No. 5,498,531) can be used to score for the presence of specific mutations by development or loss of a ribozyme cleavage site.
- In yet another embodiment, any of a variety of sequencing reactions known in the art can be used to directly sequence the CYP2D6 gene and detect mutations by comparing the sequence of the sample CYP2D6 with the corresponding wild-type (control) sequence. Exemplary sequencing reactions include those based on techniques developed by Maxim and Gilbert (Proc. Natl Acad Sci USA (1977) 74:560) or Sanger (Sanger et al (1977) Proc. Nat. Acad. Sci 74:5463). It is also contemplated that any of a variety of automated sequencing procedures may be utilized when performing the subject assays (Biotechniques (1995) 19:448), including sequencing by mass spectrometry (see, for example PCT publication WO 94/16101; Cohen et al. (1996) Adv Chromatogr 36:127-162; and Griffin et al. (1993) Appl Biochem Biotechnol 38:147-159). It will be evident to one skilled in the art that, for certain embodiments, the occurrence of only one, two or three of the nucleic acid bases need be determined in the sequencing reaction. For instance, A-track or the like, e.g., where only one nucleic acid is detected, can be carried out.
- In a further embodiment, protection from cleavage agents (such as a nuclease, hydroxylamine or osmium tetroxide and with piperidine) can be used to detect mismatched bases in RNA/RNA or RNA/DNA or DNA/DNA heteroduplexes (Myers, et al. (1985) Science 230:1242). In general, the art technique of "mismatch cleavage" starts by providing heteroduplexes formed by hybridizing (labelled) RNA or DNA containing the wild-type CYP2D6 sequence with potentially mutant RNA or DNA obtained from a tissue sample. The double-stranded duplexes are treated with an agent which cleaves single-stranded regions of the duplex such as which will exist due to base pair mismatches between the control and sample strands. For instance, RNA/DNA duplexes can be treated with RNase and DNA/DNA hybrids treated with S1 nuclease to enzymatically digest the mismatched regions. In other embodiments, either DNA/DNA or RNA/DNA duplexes can be treated with hydroxylamine or osmium tetroxide and with piperidine in order to digest mismatched regions. After digestion of the mismatched regions, the resulting material is then separated by size on denaturing polyacrylamide gels to determine the site of mutation. See, for example, Cotton et al, (1988) Proc. Natl Acad Sci USA 85:4397; Saleeba et al, (1992) Methods Enzymol. 217:286-295. In a preferred embodiment, the control DNA or RNA can be labeled for detection using methods known in the art based upon the present description.
- In still another embodiment, the mismatch cleavage reaction employs one or more proteins that recognize mismatched base pairs in double-stranded DNA (so called "DNA mismatch repair" enzymes) in defined systems for detecting and mapping point mutations in CYP2D6 cDNAs obtained from samples of cells. For example, the mutY enzyme of E. coli cleaves A at G/A mismatches and the thymidine DNA glycosylase from HeLa cells cleaves T at G/T mismatches (Hsu et al. (1994) Carcinogenesis 15:1657-1662). According to an exemplary embodiment, a probe based on a CYP2D6 sequence, e.g., a wild-type CYP2D6 sequence, is hybridized to a cDNA or other DNA product from a test cell(s). The duplex is treated with a DNA mismatch repair enzyme, and the cleavage products, if any, can be detected from electrophoresis protocols or the like. See, for example, U.S. Patent No. 5,459,039.
- In other embodiments, alterations in electrophoretic mobility will be used to identify mutations or the identity of the allelic variant of a polymorphic region in CYP2D6 genes. For example, SSCP may be used to detect differences in electrophoretic mobility between mutant and wild type nucleic acids (Orita et al. (1989) Proc Natl. Acad. Sci USA 86:2766, see also Cotton (1993) Mutat Res 285:125-144; and Hayashi (1992) Genet Anal Tech Appl 9:73-79). Single-stranded DNA fragments of sample and control CYP2D6 nucleic acids are denatured and allowed to renature. The secondary structure of single-stranded nucleic acids varies according to sequence, the resulting alteration in electrophoretic mobility enables the detection of even a single base change. The DNA fragments may be labelled or detected with labelled probes. The sensitivity of the assay may be enhanced by using RNA (rather than DNA), in which the secondary structure is more sensitive to a change in sequence. In a preferred embodiment, the subject method utilizes heteroduplex analysis to separate double stranded heteroduplex molecules on the basis of changes in electrophoretic mobility (Keen et al. (1991) Trends Genet 7:5).
- In yet another embodiment, the movement of mutant or wild-type fragments in polyacrylamide gels containing a gradient of denaturant is assayed using denaturing gradient gel electrophoresis (DGGE) (Myers et al (1985) Nature 313:495). When DGGE is used as the method of analysis, DNA will be modified to insure that it does not completely denature, for example by adding a GC clamp of approximately 40 bp of high-melting GC-rich DNA by PCR. In a further embodiment, a temperature gradient is used in place of a denaturing agent gradient to identify differences in the mobility of control and sample DNA (Rosenbaum and Reissner (1987) Biophys Chem 265:12753).
- Examples of other techniques for detecting point mutations or the identity of the allelic variant of a polymorphic region include, but are not limited to, selective oligonucleotide hybridization, selective amplification, or selective primer extension. For example, oligonucleotide primers may be prepared in which the known mutation or nucleotide difference (e.g., in allelic variants) is placed centrally and then hybridized to target DNA under conditions which permit hybridization only if a perfect match is found (Saiki et al. (1986) Nature 324:163); Saiki et al (1989) Proc. Natl Acad. Sci USA 86:6230). Such allele specific oligonucleotide hybridization techniques may be used to test one mutation or polymorphic region per reaction when oligonucleotides are hybridized to PCR amplified target DNA or a number of different mutations or polymorphic regions when the oligonucleotides are attached to the hybridizing membrane and hybridized with labelled target DNA.
- Alternatively, allele specific amplification technology which depends on selective PCR amplification may be used in conjunction with the instant invention. Oligonucleotides used as primers for specific amplification may carry the mutation or polymorphic region of interest in the center of the molecule (so that amplification depends on differential hybridization) (Gibbs et al (1989) Nucleic Acids Res. 17:2437-2448) or at the extreme 3' end of one primer where, under appropriate conditions, mismatch can prevent, or reduce polymerase extension (Prossner (1993) Tibtech 11:238. In addition it may be desirable to introduce a novel restriction site in the region of the mutation to create cleavage-based detection (Gasparini et al (1992) Mol. Cell Probes 6:1). It is anticipated that in certain embodiments amplification may also be performed using Taq ligase for amplification (Barany (1991) Proc. Natl. Acad. Sci USA 88:189). In such cases, ligation will occur only if there is a perfect match at the 3' end of the 5' sequence making it possible to detect the presence of a known mutation at a specific site by looking for the presence or absence of amplification.
- In another embodiment, identification of the allelic variant is carried out using an oligonucleotide ligation assay (OLA), as described, e.g., in U.S. Pat. No. 4,998,617 and in Landegren, U. et al., Science 241:1077-1080 (1988). The OLA protocol uses two oligonucleotides which are designed to be capable of hybridizing to abutting sequences of a single strand of a target. One of the oligonucleotides is linked to a separation marker, e.g,. biotinylated, and the other is detectably labeled. If the precise complementary sequence is found in a target molecule, the oligonucleotides will hybridize such that their termini abut, and create a ligation substrate. Ligation then permits the labeled oligonucleotide to be recovered using avidin, or another biotin ligand. Nickerson, D. A. et al. have described a nucleic acid detection assay that combines attributes of PCR and OLA (Nickerson, D. A. et al., Proc. Natl. Acad. Sci. (U.S.A.) 87:8923-8927 (1990). In this method, PCR is used to achieve the exponential amplification of target DNA, which is then detected using OLA.
- Several techniques based on this OLA method have been developed and can be used to detect specific allelic variants of a polymorphic region of a CYP2D6 gene. For example, U.S. Patent No. 5,593,826 discloses an OLA using an oligonucleotide having 3'-amino group and a 5'-phosphorylated oligonucleotide to form a conjugate having a phosphoramidate linkage. In another variation of OLA described in Tobe et al. ((1996) Nucleic Acids Res 24: 3728), OLA combined with PCR permits typing of two alleles in a single microtiter well. By marking each of the allele-specific primers with a unique hapten, i.e. digoxigenin and fluorescein, each OLA reaction can be detected by using hapten specific antibodies that are labeled with different enzyme reporters, alkaline phosphatase or horseradish peroxidase. This system permits the detection of the two alleles using a high throughput format that leads to the production of two different colors.
- The invention further provides methods for detecting single nucleotide polymorphisms in a CYP2D6 gene. Because single nucleotide polymorphisms constitute sites of variation flanked by regions of invariant sequence, their analysis requires no more than the determination of the identity of the single nucleotide present at the site of variation and it is unnecessary to determine a complete gene sequence for each patient. Several methods have been developed to facilitate the analysis of such single nucleotide polymorphisms.
- In one embodiment, the single base polymorphism can be detected by using a specialized exonuclease-resistant nucleotide, as disclosed, e.g., in Mundy, C. R. (U.S. Pat. No.4,656,127). According to the method, a primer complementary to the allelic sequence immediately 3' to the polymorphic site is permitted to hybridize to a target molecule obtained from a particular animal or human. If the polymorphic site on the target molecule contains a nucleotide that is complementary to the particular exonuclease-resistant nucleotide derivative present, then that derivative will be incorporated onto the end of the hybridized primer. Such incorporation renders the primer resistant to exonuclease, and thereby permits its detection. Since the identity of the exonuclease-resistant derivative of the sample is known, a finding that the primer has become resistant to exonucleases reveals that the nucleotide present in the polymorphic site of the target molecule was complementary to that of the nucleotide derivative used in the reaction. This method has the advantage that it does not require the determination of large amounts of extraneous sequence data.
- In another embodiment of the invention, a solution-based method is used for determining the identity of the nucleotide of a polymorphic site. Cohen, D. et al. (French Patent 2,650,840; PCT Appln. No. WO91/02087). As in the Mundy method of U.S. Pat. No. 4,656,127, a primer is employed that is complementary to allelic sequences immediately 3' to a polymorphic site. The method determines the identity of the nucleotide of that site using labeled dideoxynucleotide derivatives, which, if complementary to the nucleotide of the polymorphic site will become incorporated onto the terminus of the primer.
- An alternative method, known as Genetic Bit Analysis or GBA™ is described by Goelet, P. et al., (PCT Appln. No. WO92/15712, and U.S. Patent Nos. 5,762,876, 5,888,819, and 6,004,744). The method of Goelet, P. et al., uses mixtures of labeled terminators and a primer that is complementary to the sequence 3' to a polymorphic site. The labeled terminator that is incorporated is thus determined by, and complementary to, the nucleotide present in the polymorphic site of the target molecule being evaluated. In contrast to the method of Cohen et al. (French Patent 2,650,840; PCT Appln. No. WO91/02087) the method of Goelet, P. et al. is preferably a heterogeneous phase assay, in which the primer or the target molecule is immobilized to a solid phase.
- Recently, several primer-guided nucleotide incorporation procedures for assaying polymorphic sites in DNA have been described (Komher, J. S. et al., Nucl. Acids. Res. 17:7779-7784 (1989); Sokolov, B. P., Nucl. Acids Res. 18:3671 (1990); Syvanen, A. -C., et al., Genomics 8:684-692 (1990); Kuppuswamy, M. N. et al., Proc. Natl. Acad. Sci. (U.S.A.) 88:1143-1147 (1991); Prezant, T. R. et al., Hum. Mutat. 1:159-164 (1992); Ugozzoli, L. et al., GATA 9:107-112 (1992); Nyren, P. et al., Anal. Biochem. 208:171-175 (1993)). These methods differ from GBA™ in that they all rely on the incorporation of labeled deoxynucleotides to discriminate between bases at a polymorphic site. In such a format, since the signal is proportional to the number of deoxynucleotides incorporated, polymorphisms that occur in runs of the same nucleotide can result in signals that are proportional to the length of the run (Syvanen, A. -C., et al., Amer.J. Hum. Genet. 52:46-59 (1993)).
- For mutations that produce premature termination of protein translation, the protein truncation test (PTT) offers an efficient diagnostic approach (Roest, et. al., (1993) Hum. Mol. Genet. 2:1719-21; van der Luijt, et. al., (1994) Genomics 20:1-4). For PTT, RNA is initially isolated from available tissue and reverse-transcribed, and the segment of interest is amplified by PCR. The products of reverse transcription PCR are then used as a template for nested PCR amplification with a primer that contains an RNA polymerase promoter and a sequence for initiating eukaryotic translation. After amplification of the region of interest, the unique motifs incorporated into the primer permit sequential in vitro transcription and translation of the PCR products. Upon sodium dodecyl sulfate-polyacrylamide gel electrophoresis of translation products, the appearance of truncated polypeptides signals the presence of a mutation that causes premature termination of translation. In a variation of this technique, DNA (as opposed to RNA) is used as a PCR template when the target region of interest is derived from a single exon.
- The methods described herein may be performed, for example, by utilizing pre-packaged diagnostic kits comprising at least one probe nucleic acid, primer set; and/or antibody reagent described herein, which may be conveniently used, e.g., in clinical settings to diagnose patients exhibiting symptoms or family history of a disease or illness involving a CYP2D6 polypeptide.
- Any cell type or tissue may be utilized in the diagnostics described below. In a preferred embodiment a bodily fluid, e.g., blood, is obtained from the subject to determine the presence of a mutation or the identity of the allelic variant of a polymorphic region of a CYP2D6 gene. A bodily fluid, e.g, blood, can be obtained by known techniques (e.g. venipuncture). Alternatively, nucleic acid tests can be performed on dry samples (e.g. hair or skin). For prenatal diagnosis, fetal nucleic acid samples can be obtained from maternal blood as described in International Patent Application No. WO91/07660 (and counterpart U.S. Patent No. 5,641,628). Alternatively, amniocytes or chorionic villi may be obtained using methods known in the art for performing prenatal testing.
- When using RNA or protein to determine the presence of a mutation or of a specific allelic variant of a polymorphic region of a CYP2D6 gene, the cells or tissues that may be utilized must express the CYP2D6 gene. Preferred cells for use in these methods include, for example, cardiac cells (see EXAMPLES). Alternative cells or tissues that can be used, can be identified by determining the expression pattern of the specific CYP2D6 gene in a subject, such as by Northern blot analysis, based upon the present description.
- Diagnostic procedures may also be performed in situ directly upon tissue sections (fixed and/or frozen) of patient tissue obtained from biopsies or resections, such that no, or substantially no, nucleic acid purification would be deemed necessary by those skilled in the art. Nucleic acid reagents may be used as probes and/or primers for such in situ procedures (see, for example, Nuovo, G.J., 1992, PCR in situ hybridization: protocols and applications, Raven Press, NY).
- In addition to methods which focus primarily on the detection of one nucleic acid sequence, profiles may also be assessed in such detection schemes. Fingerprint profiles may be generated, for example, by utilizing a differential display procedure, Northern analysis and/or RT-PCR, based upon the present description.
- Antibodies directed against wild type or mutant CYP2D6 polypeptides or allelic variants thereof, which are discussed above, may also be used in disease diagnostics and prognostics. Such diagnostic methods, may be used to detect abnormalities in the level of CYP2D6 polypeptide expression, or abnormalities in the structure and/or tissue, cellular, or subcellular location of a CYP2D6 polypeptide. Structural differences may include, for example, differences in the size, electronegativity, or antigenicity of the mutant CYP2D6 polypeptide relative to the normal CYP2D6 polypeptide. Protein from the tissue or cell type to be analyzed may be detected or isolated using techniques which are well known to one of skill in the art, including but not limited to western blot analysis. For a detailed explanation of methods for carrying out Western blot analysis, see Sambrook et al, 1989, supra, at Chapter 18. The protein detection and isolation methods employed herein may also be such as those described in Harlow and Lane, for example, (Harlow, E. and Lane, D., 1988, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York).
- This can be accomplished, for example, as will be appreciated by those skilled in the art based on the present description by immunofluorescence techniques employing a fluorescently labeled antibody (see below) coupled with light microscopic, flow cytometric, or fluorimetric detection. The antibodies (or fragments thereof) useful in the present invention may, additionally, be employed histologically, as in immunofluorescence or immunoelectron microscopy, for in situ detection of CYP2D6 polypeptides. In situ detection may be accomplished by removing a histological specimen from a patient, and applying thereto a labeled antibody of the present invention. The antibody (or fragment) is preferably applied by overlaying the labeled antibody (or fragment) onto a biological sample. Through the use of such a procedure, it is possible to determine not only the presence of the CYP2D6 polypeptide, but also its distribution in the examined tissue. Using the present invention, one of ordinary skill will readily perceive that any of a wide variety of histological methods (such as staining procedures) can be modified in order to achieve such in situ detection.
- Often a solid phase support or carrier is used as a support capable of binding an antigen or an antibody. Well-known supports or carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, gabbros, and magnetite. The nature of the carrier can be either soluble to some extent or insoluble for the purposes of the present invention. The support material may have virtually any possible structural configuration so long as the coupled molecule is capable of binding to an antigen or antibody. Thus, the support configuration may be spherical, as in a bead, or cylindrical, as in the inside surface of a test tube, or the external surface of a rod. Alternatively, the surface may be flat such as a sheet, test strip, etc. Preferred supports include, for example, polystyrene beads. Those skilled in the art will know many other suitable carriers for binding antibody or antigen, or will be able to ascertain the same by use of routine experimentation.
- One means for labeling an anti-CYP2D6 polypeptide specific antibody is via linkage to an enzyme and use in an enzyme immunoassay (EIA) (Voller, "The Enzyme Linked Immunosorbent Assay (ELISA)", Diagnostic Horizons 2:1-7, 1978, Microbiological Associates Quarterly Publication, Walkersville, MD; Voller, et al., J. Clin. Pathol. 31:507-520 (1978); Butler, Meth. Enzymol. 73:482-523 (1981); Maggio, (ed.) Enzyme Immunoassay, CRC Press, Boca Raton, FL, 1980; Ishikawa, et al., (eds.) Enzyme Immunoassay, Kgaku Shoin, Tokyo, 1981). The enzyme which is bound to the antibody will react with an appropriate substrate, preferably a chromogenic substrate, in such a manner as to produce a chemical moiety which can be detected, for example, by spectrophotometric, fluorimetric or by visual means. Enzymes which can be used to detectably label the antibody include, but are not limited to, malate dehydrogenase, staphylococcal nuclease, delta-5-steroid isomerase, yeast alcohol dehydrogenase, alpha-glycerophosphate, dehydrogenase, triose phosphate isomerase, horseradish peroxidase, alkaline phosphatase, asparaginase, glucose oxidase, beta-galactosidase, ribonuclease, urease, catalase, glucose-6-phosphate dehydrogenase, glucoamylase and acetylcholinesterase. The detection can be accomplished by colorimetric methods which employ a chromogenic substrate for the enzyme. Detection may also be accomplished by visual comparison of the extent of enzymatic reaction of a substrate in comparison with similarly prepared standards.
- Detection may also be accomplished using any of a variety of other immunoassays. For example, by radioactively labeling the antibodies or antibody fragments, it is possible to detect fingerprint gene wild type or mutant peptides through the use of a radioimmunoassay (RIA) (see, for example, Weintraub, B., Principles of Radioimmunoassays, Seventh Training Course on Radioligand Assay Techniques, The Endocrine Society, March, 1986). The radioactive isotope can be detected by such means as the use of a gamma counter or a scintillation counter or by autoradiography.
- It is also possible to label the antibody with a fluorescent compound. When the fluorescently labeled antibody is exposed to light of the proper wave length, its presence can then be detected due to fluorescence. Among the most commonly used fluorescent labeling compounds are fluorescein isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, o-phthaldehyde and fluorescamine.
- The antibody can also be detectably labeled using fluorescence emitting metals such as 152Eu, or others of the lanthanide series. These metals can be attached to the antibody using such metal chelating groups as diethylenetriaminepentacetic acid (DTPA) or ethylenediaminetetraacetic acid (EDTA).
- The antibody also can be detectably labeled by coupling it to a chemiluminescent compound. The presence of the chemiluminescent-tagged antibody is then determined by detecting the presence of luminescence that arises during the course of a chemical reaction. Examples of particularly useful chemiluminescent labeling compounds are luminol, isoluminol, theromatic acridinium ester, imidazole, acridinium salt and oxalate ester.
- Likewise, a bioluminescent compound may be used to label the antibody of the present invention. Bioluminescence is a type of chemiluminescence found in biological systems in, which a catalytic protein increases the efficiency of the chemiluminescent reaction. The presence of a bioluminescent protein is determined by detecting the presence of luminescence. Important bioluminescent compounds for purposes of labeling are luciferin, luciferase and aequorin.
- Moreover, it will be understood that any of the above methods for detecting alterations in a gene or gene product or polymorphic variants can be used to monitor the course of treatment or therapy.
- Large scale detection methods allow faster, less expensive analysis of the expression levels of many genes simultaneously. Such methods typically involve an ordered array of probes affixed to a solid substrate. Each probe is capable of hybridizing to a different set of nucleic acids. In one method, probes are generated by amplifying or synthesizing a substantial portion of the coding regions of various genes of interest. These genes are then spotted onto a solid support. mRNA samples are obtained, converted to cDNA, amplified and labeled (usually with a fluorescence label). The labeled cDNAs are then applied to the array, and cDNAs hybridize to their respective probes in a manner that is linearly related to their concentration. Detection of the label allows measurement of the amount of each cDNA adhered to the array.
- Many methods for performing such DNA array experiments are well known in the art. Exemplary methods are described below but are not intended to be limiting.
- Arrays are often divided into microarrays and macroarrays, where microarrays have a much higher density of individual probe species per area. Microarrays may have as many as 1000 or more different probes in a 1 cm2 area. There is no concrete cut-off to demarcate the difference between micro- and macroarrays, and both types of arrays are contemplated for use with the invention. However, because of their small size, microarrays provide great advantages in speed, automation and cost-effectiveness.
- Microarrays are known in the art and consist of a surface to which probes that correspond in sequence to gene products (e.g., cDNAs, mRNAs, oligonucleotides) are bound at known positions. In one embodiment, the microarray is an array (i.e., a matrix) in which each position represents a discrete binding site for a product encoded by a gene (e.g., a protein or RNA), and in which binding sites are present for products of most or almost all of the genes in the organism's genome. In a preferred embodiment, the "binding site" (hereinafter, "site") is a nucleic acid or nucleic acid analogue to which a particular cognate cDNA can specifically hybridize. The nucleic acid or analogue of the binding site can be, e.g., a synthetic oligomer, a full-length cDNA, a less-than full length cDNA, or a gene fragment.
- Although in a preferred embodiment the microarray contains binding sites for products of all or almost all genes in the target organism's genome, such comprehensiveness is not necessarily required. Usually the microarray will have binding sites corresponding to at least 100 genes and more preferably, 500, 1000, 4000 or more. In certain embodiments, the most preferred arrays will have about 98-100% of the genes of a particular organism represented. In other embodiments, the invention provides customized microarrays that have binding sites corresponding to fewer, specifically selected genes. Microarrays with fewer binding sites are cheaper, smaller and easier to produce. In particular, the invention provides microarrays customized for the determination of graft status. In preferred embodiments customized microarrays comprise binding sites for fewer than 4000, fewer than 1000, fewer than 200 or fewer than 50 genes, and comprise binding sites for at least 2, preferably at least 3, 4, 5 or more genes of any of clusters A, B, C, D, E, F or G. Preferably, the microarray has binding sites for genes relevant to testing and confirming a biological network model of interest. Several exemplary human microarrays are publically available. The Affymetrix GeneChip HUM 6.8K is an oligonucleotide array composed of 7,070 genes. A microarray with 8,150 human cDNAs was developed and published by Research Genetics (Bittner et al., 2000, Nature 406:443-546).
- The probes to be affixed to the arrays are typically polynucleotides. These DNAs can be obtained by, e.g., polymerase chain reaction (PCR) amplification of gene segments from genomic DNA, cDNA (e.g., by RT-PCR), or cloned sequences. PCR primers are chosen, based on the known sequence of the genes or cDNA, that result in amplification of unique fragments (i.e. fragments that do not share more than 10 bases of contiguous identical sequence with any other fragment on the microarray). Computer programs are useful in the design of primers with the required specificity and optimal amplification properties. See, e.g., Oligo pl version 5.0 (National Biosciences). In the case of binding sites corresponding to very long genes, it will sometimes be desirable to amplify segments near the 3' end of the gene so that when oligo-dT primed cDNA probes are hybridized to the microarray, less-than-full length probes will bind efficiently. Random oligo-dT priming may also be used to obtain cDNAs corresponding to as yet unknown genes, known as ESTs. Certain arrays use many small oligonucleotides corresponding to overlapping portions of genes. Such oligonucleotides may be chemically synthesized by a variety of well known methods. Synthetic sequences are between about 15 and about 500 bases in length, more typically between about 20 and about 50 bases. In some embodiments, synthetic nucleic acids include non-natural bases, e.g., inosine. As noted above, nucleic acid analogues may be used as binding sites for hybridization. An example of a suitable nucleic acid analogue is peptide nucleic acid (see, e.g., Egholm et al., 1993, PNA hybridizes to complementary oligonucleotides obeying the Watson-Crick hydrogen-bonding rules, Nature 365:566-568; see also U.S. Pat. No. 5,539,083).
- In an alternative embodiment, the binding (hybridization) sites are made from plasmid or phage clones of genes, cDNAs (e.g., expressed sequence tags), or inserts therefrom (Nguyen et al., 1995, Differential gene expression in the murine thymus assayed by quantitative hybridization of arrayed cDNA clones, Genomics 29:207-209). In yet another embodiment, the polynucleotide of the binding sites is RNA.
- The nucleic acids or analogues are attached to a solid support, which may be made from glass, plastic (e.g., polypropylene, nylon), polyacrylamide, nitrocellulose, or other materials. A preferred method for attaching the nucleic acids to a surface is by printing on glass plates, as is described generally by Schena et al., 1995, Science 270:467-470. This method is especially useful for preparing microarrays of cDNA. (See also DeRisi et al., 1996, Nature Genetics 14:457-460; Shalon et al., 1996, Genome Res. 6:639-645; and Schena et al., 1995, Proc. Natl. Acad. Sci. USA 93:10539-11286).
- A second preferred method for making microarrays is by making high-density oligonucleotide arrays. Techniques are known for producing arrays containing thousands of oligonucleotides complementary to defined sequences, at defined locations on a surface using photolithographic techniques for synthesis in situ (see, Fodor et al., 1991, Science 251:767-773; Pease et al., 1994, Proc. Natl. Acad. Sci. USA 91:5022-5026; Lockhart et al., 1996, Nature Biotech 14:1675; U.S. Pat. Nos. 5,578,832; 5,556,752; and 5,510,270), or other methods for rapid synthesis and deposition of defined oligonucleotides (Blanchard et al., 1996, "Sequence to array: probing the genome's secrets," Nat. Biotechnol. Dec 1996, 14(13): 1649)). When these methods are used, oligonucleotides of known sequence are synthesized directly on a surface such as a derivatized glass slide. Usually, the array produced is redundant, with several oligonucleotide molecules per RNA. Oligonucleotide probes can be chosen to detect alternatively spliced mRNAs. More recently, microarrays have been made using an ink-jet oligonucleotide synthesizer (Hughes et al., Nat. Biotechnol. April 2001, 19(4): 342-347).
- Other methods for making microarrays, e.g., by masking (Maskos and Southern, 1992, Nuc. Acids Res. 20:1679-1684), may also be used. In principal, any type of array, for example, dot blots on a nylon hybridization membrane (see Sambrook et al., Molecular Cloning--A Laboratory Manual (2nd Ed.), Vol. 1-3, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y., 1989), could be used, although, as will be recognized by those of skill in the art, very small arrays will be preferred because hybridization volumes will be smaller.
- The nucleic acids to be contacted with the microarray may be prepared in a variety of ways. Methods for preparing total and poly(A)+ RNA are well known and are described generally in Sambrook et al., supra. Labeled cDNA is prepared from mRNA by oligo dT-primed or random-primed reverse transcription, both of which are well known in the art (see e.g., Klug and Berger, 1987, Methods Enzymol. 152:316-325). Reverse transcription may be carried out in the presence of a dNTP conjugated to a detectable label, most preferably a fluorescently labeled dNTP. Alternatively, isolated mRNA can be converted to labeled antisense RNA synthesized by in vitro transcription of double-stranded cDNA in the presence of labeled dNTPs (Lockhart et al., 1996, Nature Biotech. 14:1675). The cDNAs or RNAs can be synthesized in the absence of detectable label and may be labeled subsequently, e.g., by incorporating biotinylated dNTPs or rNTP, or some similar means (e.g., photo-cross-linking a psoralen derivative of biotin to RNAs), followed by addition of labeled streptavidin (e.g., phycoerythrin-conjugated streptavidin) or the equivalent.
- When fluorescent labels are used, many suitable fluorophores are known, including fluorescein, lissamine, phycoerythrin, rhodamine (Perkin Elmer Cetus, Toronto, Canada), Cy2, Cy3, Cy3.5, Cy5, Cy5.5, Cy7, FluorX (Amersham, Piscataway, New Jersey, USA) and others (see, e.g., Kricka, 1992, Academic Press San Diego, Calif., USA).
- In another embodiment, a label other than a fluorescent label is used. For example, a radioactive label, or a pair of radioactive labels with distinct emission spectra, can be used (see Zhao et al., 1995, Gene 156:207; Pietu et al., 1996, Genome Res. 6:492). However, use of radioisotopes is a less-preferred embodiment.
- Nucleic acid hybridization and wash conditions are chosen so that the population of labeled nucleic acids will specifically hybridize to appropriate, complementary nucleic acids affixed to the matrix. As used herein, one polynucleotide sequence is considered complementary to another when, if the shorter of the polynucleotides is less than or equal to 25 bases, there are no mismatches using standard base-pairing rules or, if the shorter of the polynucleotides is longer than 25 bases, there is no more than a 5% mismatch. Preferably, the polynucleotides are perfectly complementary (no mismatches).
- Optimal hybridization conditions will depend on the length (e.g., oligomer versus polynucleotide greater than 200 bases) and type (e.g., RNA, DNA, PNA) of labeled nucleic acids and immobilized polynucleotide or oligonucleotide. General parameters for specific (i.e., stringent) hybridization conditions for nucleic acids are described in Sambrook et al., supra, and in Ausubel et al., 1987, Current Protocols in Molecular Biology, Greene Publishing and Wiley-lnterscience, New York, which is incorporated in its entirety for all purposes. Non-specific binding of the labeled nucleic acids to the array can be decreased by treating the array with a large quantity of non-specific DNA -- a so-called "blocking" step.
- When fluorescently labeled probes are used, the fluorescence emissions at each site of a transcript array can be, preferably, detected by scanning confocal laser microscopy. When two fluorophores are used, a separate scan, using the appropriate excitation line, is carried out for each of the two fluorophores used. Alternatively, a laser can be used that allows simultaneous specimen illumination at wavelengths specific to the two fluorophores and emissions from the two fluorophores can be analyzed simultaneously (see Shalon et al., 1996, Genome Research 6:639-645). In a preferred embodiment, the arrays are scanned with a laser fluorescent scanner with a computer controlled X-Y stage and a microscope objective. Sequential excitation of the two fluorophores is achieved with a multi-line, mixed gas laser and the emitted light is split by wavelength and detected with two photomultiplier tubes. Fluorescence laser scanning devices are described in Schena et al., 1996, Genome Res. 6:639-645 and in other references cited herein. Alternatively, the fiber-optic bundle described by Ferguson et al., 1996, Nature Biotech. 14:1681-1684, may be used to monitor mRNA abundance levels at a large number of sites simultaneously. Fluorescent microarray scanners are commercially available from Affymetrix, Packard BioChip Technologies, BioRobotics and many other suppliers.
- Signals are recorded, quantitated and analyzed using a variety of computer software. In one embodiment the scanned image is despeckled using a graphics program (e.g., Hijaak Graphics Suite) and then analyzed using an image gridding program that creates a spreadsheet of the average hybridization at each wavelength at each site. If necessary, an experimentally determined correction for "cross talk" (or overlap) between the channels for the two fluors may be made. For any particular hybridization site on the transcript array, a ratio of the emission of the two fluorophores is preferably calculated. The ratio is independent of the absolute expression level of the cognate gene, but is useful for genes whose expression is significantly modulated by drug administration, gene deletion, or any other tested event.
- According to the method of the invention, the relative abundance of an mRNA in two samples is scored as a perturbation and its magnitude determined (i.e., the abundance is different in the two sources of mRNA tested), or as not perturbed (i.e., the relative abundance is the same). As used herein, a difference between the two sources of RNA of at least a factor of about 25% (RNA from one source is 25% more abundant in one source than the other source), more usually about 50%, even more often by a factor of about 2 (twice as abundant), 3 (three times as abundant) or 5 (five times as abundant) is scored as a perturbation. Present detection methods allow reliable detection of difference of an order of about 2-fold to about 5-fold, but more sensitive methods are expected to be developed.
- Preferably, in addition to identifying a perturbation as positive or negative, it is advantageous to determine the magnitude of the perturbation. This can be carried out, as noted above, by calculating the ratio of the emission of the two fluorophores used for differential labeling, or by analogous methods that will be readily apparent to those of skill in the art.
- In one embodiment of the invention, transcript arrays reflecting the transcriptional state of a cell of interest are made by hybridizing a mixture of two differently labeled sets of cDNAs, to the microarray. One cell is a cell of interest, while the other is used as a standardizing control. The relative hybridization of each cell's cDNA to the microarray then reflects the relative expression of each gene in the two cell. For example, to assess gene expression in a variety of breast cancers, Perou et al. (2000, supra) hybridized fluorescently-labeled cDNA from each tumor to a microarray in conjunction with a standard mix of cDNAs obtained from a set of breast cancer cell lines. In this way, gene expression in each tumor sample was compared against the same standard, permitting easy comparisons between tumor samples.
- In preferred embodiments, the data obtained from such experiments reflects the relative expression of each gene represented in the microarray. Expression levels in different samples and conditions may be compared using a variety of statistical methods.
- A variety of statistical methods are available to assess the degree of relatedness in expression patterns of different genes. The statistical methods may be broken into two related portions: metrics for determining the relatedness of the expression pattern of one or more gene, and clustering methods, for organizing and classifying expression data based on a suitable metric (Sherlock, 2000, Curr. Opin. Immunol. 12:201-205; Butte et al., 2000, Pacific Symposium on Biocomputing, Hawaii, World Scientific, p.418-29).
- In one embodiment, Pearson correlation may be used as a metric. In brief, for a given gene, each data point of gene expression level defines a vector describing the deviation of the gene expression from the overall mean of gene expression level for that gene across all conditions. Each gene's expression pattern can then be viewed as a series of positive and negative vectors. A Pearson correlation coefficient can then be calculated by comparing the vectors of each gene to each other. An example of such a method is described in Eisen et al. (1998, supra). Pearson correlation coefficients account for the direction of the vectors, but not the magnitudes.
- In another embodiment, Euclidean distance measurements may be used as a metric. In these methods, vectors are calculated for each gene in each condition and compared on the basis of the absolute distance in multidimensional space between the points described by the vectors for the gene.
- In a further embodiment, the relatedness of gene expression patterns may be determined by entropic calculations (Butte et al. 2000, supra). Entropy is calculated for each gene's expression pattern. The calculated entropy for two genes is then compared to determine the mutual information. Mutual information is calculated by subtracting the entropy of the joint gene expression patterns from the entropy for calculated for each gene individually. The more different two gene expression patterns are, the higher the joint entropy will be and the lower the calculated mutual information. Therefore, high mutual information indicates a non-random relatedness between the two expression patterns.
- The different metrics for relatedness may be used in various ways to identify clusters of genes. In one embodiment, comprehensive pairwise comparisons of entropic measurements will identify clusters of genes with particularly high mutual information. In a preferred embodiment, expression patterns for two genes are correlated if the normalized mutual information score is greater than or equal to 0.7, and preferably greater than 0.8, greater than 0.9 or greater than 0.95. In alternative embodiments, a statistical significance for mutual information may be obtained by randomly permuting the
expression measurements 30 times and determining the highest mutual information measurement obtained from such random associations. All clusters with a mutual information higher than can be obtained randomly after 30 permutations are statistically significant. In a further embodiment, expression patterns for two genes are correlated if the correlation coefficient is greater than or equal to 0.8, and preferably greater than 0.85, 0.9 or, most preferably greater than 0.95. - In another embodiment, agglomerative clustering methods may be used to identify gene clusters. In one embodiment, Pearson correlation coefficients or Euclidean metrics are determined for each gene and then used as a basis for forming a dendrogram. In one example, genes were scanned for pairs of genes with the closest correlation coefficient. These genes are then placed on two branches of a dendrogram connected by a node, with the distance between the depth of the branches proportional to the degree of correlation. This process continues, progressively adding branches to the tree. Ultimately a tree is formed in which genes connected by short branches represent clusters, while genes connected by longer branches represent genes that are not clustered together. The points in multidimensional space by Euclidean metrics may also be used to generate dendrograms.
- In yet another embodiment, divisive clustering methods may be used. For example, vectors are assigned to each gene's expression pattern, and two random vectors are generated. Each gene is then assigned to one of the two random vectors on the basis of probability of matching that vector. The random vectors are iteratively recalculated to generate two centroids that split the genes into two groups. This split forms the major branch at the bottom of a dendrogram. Each group is then further split in the same manner, ultimately yielding a fully branched dendrogram.
- In a further embodiment, self-organizing maps (SOM) may be used to generate clusters. In general, the gene expression patterns are plotted in n-dimensional space, using a metric such as the Euclidean metrics described above. A grid of centroids is then placed onto the n-dimensional space and the centroids are allowed to migrate towards clusters of points, representing clusters of gene expression. Finally the centroids represent a gene expression pattern that is a sort of average of a gene cluster. In certain embodiments, SOM may be used to generate centroids, and the genes clustered at each centroid may be further represented by a dendrogram. An exemplary method is described in Tamayo et al., 1999, PNAS 96:2907-12. Once centroids are formed, correlation must be evaluated by one of the methods described supra.
- In another aspect, the invention provides probe sets. Preferred probe sets are designed to detect expression of multiple genes and provide information about the status of a graft. Preferred probe sets of the invention comprise probes that are useful for the detection of at least two genes belonging to gene clusters A, B, C, D, E, F or G. Particularly preferred probe sets will comprise probes useful for the detection of at least three, at least four or at least five genes belonging to gene clusters A, B, C, D, E, F or G. Certain probe sets may additionally comprise probes that are useful for the detection of one or more genes of gene cluster H. Probe sets of the invention do not comprise probes useful for the detection of more than 10,000 gene transcripts, and preferred probe sets will comprise probes useful for the detection of fewer than 4000, fewer than 1000, fewer than 200, and most preferably fewer than 50 gene transcripts. Probe sets of the invention are particularly useful because they are smaller and cheaper than probe sets that are intended to detect as many genes as possible in a particular genome. The probe sets of the invention are targeted at the detection of gene transcripts that are informative about transplant status. Probe sets of the invention may comprise a large or small number of probes that detect gene transcripts that are not informative about transplant status. Such probes are useful as controls and for normalization. Probe sets may be a dry mixture or a mixture in solution. In preferred embodiments, probe sets of the invention are affixed to a solid substrate to form an array of probes. It is anticipated that probe sets may also be useful for multiplex PCR.
- The present invention provides wild-type and mutant CYP2D6 polypeptides which are isolated from, or otherwise substantially free of other cellular proteins. The term "substantially free of other cellular proteins" (also referred to herein as "contaminating proteins") or "substantially pure or purified preparations" are defined as encompassing preparations of CYP2D6 polypeptides having less than about 20% (by dry weight) contaminating protein, and preferably having less than about 5% contaminating protein. Functional forms of the subject polypeptides can be prepared, for the first time, as purified preparations by using a cloned gene as described herein.
- Preferred CYP2D6 proteins of the invention have an amino acid sequence which is at least about 60%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 85%, 90%, or 95% identical or homologous to an amino acid sequence of the CYP2D6 P450 polypeptide. Even more preferred CYP2D6 proteins comprise an amino acid sequence of at least 10, 20, 30, or 50 residues which is at least about 70, 80, 90, 95, 97, 98, or 99% homologous or identical to an amino acid sequence of CYP2D6. Such proteins can be recombinant proteins, and can be, e.g., produced in vitro from nucleic acids comprising a nucleotide sequence set forth in SEQ ID Nos. 1,2, 3, or 4 or another nucleic acid SEQ ID No. of the invention or homologs thereof. For example, recombinant polypeptides preferred by the present invention can be encoded by a nucleic acid, which is at least 85% homologous and more preferably 90% homologous and most preferably 95% homologous with a nucleotide sequence set forth in a SEQ ID Nos. of the invention. Polypeptides which are encoded by a nucleic acid that is at least about 98-99% homologous with the sequence of SEQ ID No. of the invention are also within the scope of the invention.
- In a preferred embodiment, a CYP2D6 protein of the present invention is a mammalia CYP2D6 protein. In a particularly preferred embodiment the CYP2D6 polypeptide includes a polypeptide segment of the carboxy-terminal segment of the wild type 2D6 P450 protein sequence RRACLGEPLARMELFLFFTSLL QHFSFSVPTGQPRPSHHGVFAFLVSPSPYELC-AVPR (SEQ ID NO. 32) or the CYP2D6 C5816TA mutant 2D6 P450 carboxy-terminal sequence RACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYEYLOCA PLEWGT (SEQ ID NO. 34). In particularly preferred embodiments, a CYP2D6 protein has a CYP2D6 bioactivity, such as a monoxygenase activity. It will be understood that certain post-translational modifications, e.g., phosphorylation and the like, can increase the apparent molecular weight of the CYP2D6 protein relative to the unmodified polypeptide chain.
- The invention also provides protein isoforms encoded by splice variants of the present invention. Such isoforms may have biological activities identical to or different from those possessed by the CYP2D6 proteins encoded by SEQ ID NOs. 1-4. Such isoforms may arise, for example, by alternative splicing of one or more CYP2D6 gene transcripts.
- CYP2D6 polypeptides preferably are capable of functioning as either an agonist or antagonist of at least one biological activity of a wild-type ("authentic") CYP2D6 protein of the appended sequence listing.Full length proteins or fragments corresponding to one or more particular motifs and/or domains or to arbitrary sizes, for example, at least 5, 10, 20, 25, 50, 75 and 100, amino acids in length are within the scope of the present invention.
- For example, isolated CYP2D6 polypeptides can be encoded by all or a portion of a nucleic acid sequence shown in any of SEQ ID NOs. 1, 2, 3 or 4. Isolated peptidyl portions of CYP2D6 proteins can be obtained by screening peptides recombinantly produced from the corresponding fragment of the nucleic acid encoding such peptides. In addition, fragments can be chemically synthesized using techniques known in the art such as conventional Merrifield solid phase f-Moc or t-Boc chemistry. For example, a CYP2D6 polypeptide of the present invention may be arbitrarily divided into fragments of desired length with no overlap of the fragments, or preferably divided into overlapping fragments of a desired length. The fragments can be produced (recombinantly or by chemical synthesis) and tested to identify those peptidyl fragments which can function as either agonists or antagonists of a wild-type (e.g., "authentic") CYP2D6 protein.
- A CYP2D6 polypeptide can be a membrane bound form or a soluble form. A preferred soluble CYP2D6 polypeptide is a polypeptide which does not contain a hydrophobic signal sequence domain. Such proteins can be created by genetic engineering by methods known in the art. The solubility of a recombinant polypeptide may be increased by deletion of hydrophobic domains, such as predicted transmembrane domains, of the wild type protein.
- In general, polypeptides referred to herein as having an activity (e.g., are "bioactive") of a CYP2D6 protein are defined as polypeptides which include an amino acid sequence encoded by all or a portion of the nucleic acid sequences shown in one of SEQ ID No. 1, 2, 3 or 4 and which mimic or antagonize all or a portion of the blological/biochemlcal activities of a naturally occurring CYP2D6 protein. Examples of such biological activity include a region of conserved structure such as the CYP2D6 carboxy-terminal conserved domain (see FIGURE 6A, CYP2D6 SEQ ID NO. 32).
- Other biological activities of the subject CYP2D6 proteins will be reasonably apparent to those skilled in the art based upon the present description. According to the present invention, a polypeptide has biological activity if it is a specific agonist or antagonist of a naturally-occurring form of a CYP2D6 protein.
- Other preferred proteins of the invention are those encoded by the nucleic acids set forth in the section pertaining to nucleic acids of the invention. In particular, the invention provides fusion proteins, e.g., CYP2D6 -immunoglobulin fusion proteins. Such fusion proteins can provide, e.g., enhanced stability and solubility of CYP2D6 proteins and may thus be useful in therapy. Fusion proteins can also be used to produce an immunogenic fragment of a CYP2D6 protein. For example, the VP6 capsid protein of rotavirus can be used as an immunologic carrier protein for portions of the CYP2D6 polypeptide, either in the monomeric form or in the form of a viral particle. The nucleic acid sequences corresponding to the portion of a subject CYP2D6 protein to which antibodies are to be raised can be incorporated into a fusion gene construct which includes coding sequences for a late vaccinia virus structural protein to produce a set of recombinant viruses expressing fusion proteins comprising CYP2D6 epitopes as part of the virion. It has been demonstrated with the use of immunogenic fusion proteins utilizing the Hepatitis B surface antigen fusion proteins that recombinant Hepatitis B virions can be utilized in this role as well. Similarly, chimeric constructs coding for fusion proteins containing a portion of a CYP2D6 protein and the poliovirus capsid protein can be created to enhance immunogenicity of the set of polypeptide antigens (see, for example, EP Publication No: 0259149; and Evans et al. (1989) Nature 339:385; Huang et al. (1988) J. Virol. 62:3855; and Schlienger et al. (1992) J. Virol. 66:2).
- The Multiple antigen peptide system for peptide-based immunization can also be utilized to generate an immunogen, wherein a desired portion of a CYP2D6 polypeptide is obtained directly from organo-chemical synthesis of the peptide onto an oligomeric branching lysine core (see, for example, Posnett et al. (1988) JBC 263:1719 and Nardelli et al. (1992) J. Immunol. 148:914). Antigenic determinants of CYP2D6 proteins can also be expressed and presented by bacterial cells.
- In addition to utilizing fusion proteins to enhance immunogenicity, it is widely appreciated that fusion proteins can also facilitate the expression of proteins, and accordingly, can be used in the expression of the CYP2D6 polypeptides of the present invention. For example, CYP2D6 polypeptides can be generated as glutathione-S-transferase (GST-fusion) proteins. Such GST-fusion proteins can enable easy purification of the CYP2D6 polypeptide, as for example by the use of glutathione-derivatized matrices (see, for example, Current Protocols in Molecular Biology, eds. Ausubel et al. (N.Y.: John Wiley & Sons, 1991)). Additionally, fusion of CYP2D6 polypeptides to small epitope tags, such as the FLAG or hemagluttinin tag sequences, can be used to simplify immunological purification of the resulting recombinant polypeptide or to facilitate immunological detection in a cell or tissue sample. Fusion to the green fluorescent protein, and recombinant versions thereof which are known in the art and available commercially, may further be used to localize CYP2D6 polypeptides within living cells and tissue.
- The present invention further pertains to methods of producing the subject CYP2D6 polypeptides. For example, a host cell transfected with a nucleic acid vector directing expression of a nucleotide sequence encoding the subject polypeptides can be cultured under appropriate conditions to allow expression of the peptide to occur. Suitable media for cell culture are well known in the art. The recombinant CYP2D6 polypeptide can be isolated from cell culture medium, host cells, or both using techniques known in the art for purifying proteins including ion-exchange chromatography, gel filtration chromatography, ultrafiltration, electrophoresis, and immunoaffinity purification with antibodies specific for such peptide. In a preferred embodiment, the recombinant CYP2D6 polypeptide is a fusion protein containing a domain which facilitates its purification, such as GST fusion protein.
- Moreover, it will be generally appreciated that, under certain circumstances, it may be advantageous to provide homologs of one of the subject CYP2D6 polypeptides which function in a limited capacity as one of either a CYP2D6 agonist (mimetic) or a CYP2D6 antagonist, in order to promote or inhibit only a subset of the biological activities of the naturally-occurring form of the protein. Thus, specific biological effects can be elicited by treatment with a homolog of limited function, and with fewer side effects relative to treatment with agonists or antagonists which are directed to all of the biological activities of naturally occurring forms of CYP2D6 proteins.
- Homologs of each of the subject CYP2D6 proteins can be generated by mutagenesis, such as by discrete point mutation(s), or by truncation. For instance, mutation can give rise to homologs which retain substantially the same, or merely a subset, of the biological activity of the CYP2D6 polypeptide from which it was derived. Alternatively, antagonistic forms of the protein can be generated which are able to inhibit the function of the naturally occurring form of the protein, such as by competitively binding to a CYP2D6 receptor.
- The recombinant CYP2D6 polypeptides of the present invention also include homologs of the wildtype CYP2D6 proteins, such as versions of those protein which are resistant to proteolytic cleavage, as for example, due to mutations which alter ubiquitination or other enzymatic targeting associated with the protein.
- CYP2D6 polypeptides may also be chemically modified to create CYP2D6 derivatives by forming covalent or aggregate conjugates with other chemical moieties, such as glycosyl groups, lipids, phosphate, acetyl groups and the like. Covalent derivatives of CYP2D6 proteins can be prepared by linking the chemical moieties to functional groups on amino acid sidechains of the protein or at the N-terminus or at the C-terminus of the polypeptide.
- Modification of the structure of the subject CYP2D6 polypeptides can be for such purposes as enhancing therapeutic or prophylactic efficacy, stability (e.g., ex vivo shelf life and resistance to proteolytic degradation), or post-translational modifications (e.g., to alter phosphorylation pattern of protein). Such modified peptides, when designed to retain at least one activity of the naturally-occurring form of the protein, or to produce specific antagonists thereof, are considered functional equivalents of the CYP2D6 polypeptides described in more detail herein. Such modified peptides can be produced, for instance, by amino acid substitution, deletion, or addition. The substitutional variant may be a substituted conserved amino acid or a substituted non-conserved amino acid.
- For example, it is reasonable to expect that an isolated replacement of a leucine with an isoleucine or valine, an aspartate with a glutamate, a threonine with a serine, or a similar replacement of an amino acid with a structurally related amino acid (i.e. isosteric and/or isoelectric mutations) will not have a major effect on the biological activity of the resulting molecule. Conservative replacements are those that take place within a family of amino acids that are related in their side chains. Genetically encoded amino acids can be divided into four families: (1) acidic = aspartate, glutamate; (2) basic = lysine, arginine, histidine; (3) nonpolar = alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan; and (4) uncharged polar = glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine. In similar fashion, the amino acid repertoire can be grouped as (1) acidic = aspartate, glutamate; (2) basic = lysine, arginine histidine, (3) aliphatic = glycine, alanine, valine, leucine, isoleucine, serine, threonine, with serine and threonine optionally be grouped separately as aliphatic-hydroxyl; (4) aromatic = phenylalanine, tyrosine, tryptophan; (5) amide = asparagine, glutamine; and (6) sulfur -containing = cysteine and methionine. (see, for example, Biochemistry, 2nd ed., Ed. by L. Stryer, WH Freeman and Co.: 1981). Whether a change in the amino acid sequence of a peptide results in a functional CYP2D6 homolog (e.g., functional in the sense that the resulting polypeptide mimics or antagonizes the wild-type form) can be readily determined by assessing the ability of the variant peptide to produce a response in cells in a fashion similar to the wild-type protein, or competitively inhibit such a response. Polypeptides in which more than one replacement has taken place can readily be tested in the same manner.
- This invention further contemplates a method for generating sets of combinatorial mutants of the subject CYP2D6 proteins as well as truncation mutants, and is especially useful for identifying potential variant sequences (e.g., homologs). The purpose of screening such combinatorial libraries is to generate, for example, novel CYP2D6 homologs which can act as, e.g., agonists or antagonist, or alternatively, possess novel activities all together. Thus, combinatorially-derived homologs can be generated to have an increased potency relative to a naturally occurring form of the protein.
- In one embodiment, the variegated CYP2D6 libary of CYP2D6 variants is generated by combinatorial mutagenesis at the nucleic acid level, and is encoded by a variegated gene CYP2D6 library. For instance, a mixture of synthetic oligonucleotides can be enzymatically ligated into gene sequences such that the degenerate set of potential CYP2D6 sequences are expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display) containing the set of CYP2D6 sequences therein.
- There are many ways by which such libraries of potential CYP2D6 homologs can be generated from a degenerate oligonucleotide sequence. Chemical synthesis of a degenerate gene sequence can be carried out in an automatic DNA synthesizer, and the synthetic genes then ligated into an appropriate expression vector. The purpose of a degenerate set of genes is to provide, in one mixture, all of the sequences encoding the desired set of potential CYP2D6 sequences. The synthesis of degenerate oligonucleotides is well known in the art (see for example, Narang, SA (1983) Tetrahedron 39:3; Itakura et al. (1981) Recombinant DNA,
Proc 3rd Cleveland Sympos. Macromolecules, ed. AG Walton, Amsterdam: Elsevier pp 273-289; Itakura et al. (1984) Annu. Rev. Biochem. 53:323; Itakura et al. (1984) Science 198:1056; Ike et al. (1983) Nucleic Acid Res. 11:477. Such techniques have been employed in the directed evolution of other proteins (see, for example, Scott et al. (1990) Science 249:386-390; Roberts et al. (1992) PNAS 89:2429-2433; Devlin et al. (1990) Science 249: 404-406; Cwirla et al. (1990) PNAS 87: 6378-6382; as well as U.S. Patents Nos. 5,223,409, 5,198,346, and 5,096,815). - Likewise, a library of coding sequence fragments can be provided for a CYP2D6 clone in order to generate a variegated population of CYP2D6 fragments for screening and subsequent selection of bioactive fragments. A variety of techniques are known in the art for generating such libraries, including chemical synthesis. In one embodiment, a library of coding sequence fragments can be generated by (i) treating a double stranded PCR fragment of a CYP2D6 coding sequence with a nuclease under conditions wherein nicking occurs only about once per molecule; (ii) denaturing the double stranded DNA; (iii) renaturing the DNA to form double stranded DNA which can include sense/antisense pairs from different nicked products; (iv) removing single stranded portions from reformed duplexes by treatment with S1 nuclease; and (v) ligating the resulting fragment library into an expression vector. By this exemplary method, an expression library can be derived which codes for N-terminal, C-terminal and internal fragments of various sizes.
- A wide range of techniques are known in the art for screening gene products of combinatorial libraries made by point mutations or truncation, and for screening cDNA libraries for gene products having a certain property. Such techniques will be generally adaptable for rapid screening of the gene libraries generated by the combinatorial mutagenesis of CYP2D6 homologs. The most widely used techniques for screening large gene libraries typically comprises cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting libraries of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates relatively easy isolation of the vector encoding the gene whose product was detected. Each of the illustrative assays described below are amenable to high through-put analysis as necessary to screen large numbers of degenerate CYP2D6 sequences created by combinatorial mutagenesis techniques. Combinatorial mutagenesis has a potential to generate very large libraries of mutant proteins, e.g., in the order of 1026 molecules. Combinatorial libraries of this size may be technically challenging to screen even with high throughput screening assays. To overcome this problem, a new technique has been developed recently, recrusive ensemble mutagenesis (REM), which allows one to avoid the very high proportion of non-functional proteins in a random library and simply enhances the frequency of functional proteins, thus decreasing the complexity required to achieve a useful sampling of sequence space. REM is an algorithm which enhances the frequency of functional mutants in a library when an appropriate selection or screening method is employed (Arkin and Yourvan, 1992, PNAS USA 89:7811-7815; Yourvan et al., 1992, Parallel Problem Solving from Nature, 2., In Maenner and Manderick, eds., Elsevir Publishing Co., Amsterdam, pp. 401-410; Delgrave et al., 1993, Protein Engineering 6(3):327-331).
- The invention also provides for reduction of the CYP2D6 proteins to generate mimetics, e.g., peptide or non-peptide agents, such as small molecules, which are able to disrupt binding of a CYP2D6 polypeptide of the present invention with a molecule, e.g. target peptide. Thus, such mutagenic techniques as described above are also useful to map the determinants of the CYP2D6 proteins which participate in protein-protein interactions involved in, for example, binding of the subject CYP2D6 polypeptide to a target peptide. To illustrate, the critical residues of a subject CYP2D6 polypeptide which are involved in molecular recognition of its receptor can be determined and used to generate CYP2D6 derived peptidomimetics or small molecules which competitively inhibit binding of the authentic CYP2D6 protein with that moiety. By employing, for example, scanning mutagenesis to map the amino acid residues of the subject CYP2D6 proteins which are involved in binding other proteins, peptidomimetic compounds can be generated which mimic those residues of the CYP2D6 protein which facilitate the interaction. Such mimetics may then be used to interfere with the normal function of a CYP2D6 protein. For instance, non-hydrolyzable peptide analogs of such residues can be generated using benzodiazepine (e.g., see Freidinger et al. in Peptides: Chemistry and Biology, G.R. Marshall ed., ESCOM Publisher: Leiden, Netherlands, 1988), azepine (e.g., see Huffman et al. in Peptides: Chemistry and Biology, G.R. Marshall ed., ESCOM Publisher: Leiden, Netherlands, 1988), substituted gamma lactam rings (Garvey et al. in Peptides: Chemistry and Biology, G.R. Marshall ed., ESCOM Publisher: Leiden, Netherlands, 1988), keto-methylene pseudopeptides (Ewenson et al. (1986) J Med Chem 29:295; and Ewenson et al. in Peptides: Structure and Function (Proceedings of the 9th American Peptide Symposium) Pierce Chemical Co. Rockland, IL, 1985), b-turn dipeptide cores (Nagai et al. (1985) Tetrahedron Lett 26:647; and Sato et al. (1986) J Chem Soc Perkin Trans 1:1231), and b-aminoalcohols (Gordon et al. (1985) Biochem Biophys Res Commun 126:419; and Dann et al. (1986) Biochem Biophys Res Commun 134:71).
- Another aspect of the invention pertains to an antibody specifically reactive with a mammalia CYP2D6 protein, e.g., a wild-type or mutated CYP2D6 protein, particularly to the wild-type (SEQ ID NO. 5) and mutant (SEQ ID NO. 6, 8, or 30) CYP2D6 P450 carboxy-terminal sequences shown in FIGURE 6. For example, by using immunogens derived from a CYP2D6 protein, e.g., based on the cDNA sequences, anti-protein/anti-peptide antisera or monoclonal antibodies can be made by standard protocols (See, for example, Antibodies: A Laboratory Manual ed. by Harlow and Lane (Cold Spring Harbor Press: 1988)). A mammal, such as a mouse, a hamster or rabbit can be immunized with an immunogenic form of the peptide (e.g., a mammalia CYP2D6 polypeptide or an antigenic fragment which is capable of eliciting an antibody response, or a fusion protein as described above). Techniques for conferring immunogenicity on a protein or peptide include conjugation to carriers or other techniques well known in the art. An immunogenic portion of a CYP2D6 protein can be administered in the presence of adjuvant. The progress of immunization can be monitored by detection of antibody titers in plasma or serum. Standard ELISA or other immunoassays can be used with the immunogen as antigen to assess the levels of antibodies. In a preferred embodiment, the subject antibodies are immunospecific for antigenic determinants of a CYP2D6 protein of a mammal, e.g., antigenic determinants of a protein set forth in SEQ ID No. 6 or 8 or closely related homologs (e.g., at least 90% homologous, and more preferably at least 94% homologous).
- Following immunization of an animal with an antigenic preparation of a CYP2D6 polypeptide, anti-CYP2D6 antisera can be obtained and, if desired, polyclonal anti-CYP2D6 antibodies isolated from the serum. To produce monoclonal antibodies, antibody-producing cells (lymphocytes) can be harvested from an immunized animal and fused by standard somatic cell fusion procedures with immortalizing cells such as myeloma cells to yield hybridoma cells. Such techniques are well known in the art, and include, for example, the hybridoma technique originally developed by Kohler and Milstein ((1975) Nature, 256: 495-497), the human B cell hybridoma technique (Kozbar et al., (1983) Immunology Today , 4: 72), and the EBV-hybridoma technique to produce human monoclonal antibodies (Cole et al., (1985) Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc. pp. 77-96). Hybridoma cells can be screened immunochemically for production of antibodies specifically reactive with a mammalia CYP2D6 polypeptide of the present invention and monoclonal antibodies isolated from a culture comprising such hybridoma cells. In one embodiment anti-human CYP2D6 antibodies specifically react with the protein encoded by a nucleic acid having SEQ ID NOs. 1, 2, 3 or 4.
- The term antibody as used herein is intended to include fragments thereof which are also specifically reactive with one of the subject mammalia CYP2D6 polypeptides. Antibodies can be fragmented using conventional techniques and the fragments screened for utility in the same manner as described above for whole antibodies. For example, F(ab)2 fragments can be generated by treating antibody with pepsin. The resulting F(ab)2 fragment can be treated to reduce disulfide bridges to produce Fab fragments. The antibody of the present invention is further intended to include bispecific, single-chain, and chimeric and humanized molecules having affinity for a CYP2D6 protein conferred by at least one CDR region of the antibody. In preferred embodiments, the antibody further comprises a label attached thereto and able to be detected, (e.g., the label can be a radioisotope, fluorescent compound, enzyme or enzyme co-factor).
- Anti-CYP2D6 antibodies can be used, e.g., to monitor CYP2D6 protein levels in an individual for determining, e.g., whether a subject has a disease or condition associated with an aberrant CYP2D6 protein level, or allowing determination of the efficacy of a given treatment regimen for an individual afflicted with such a disorder. The level of CYP2D6 polypeptides may be measured from cells in bodily fluid, such as in blood samples.
- Another application of anti-CYP2D6 antibodies of the present invention is in the immunological screening of cDNA libraries constructed in expression vectors such as λ gt11, λ gt18-23, λ ZAP, and λ ORF8. Messenger libraries of this type, having coding sequences inserted in the correct reading frame and orientation, can produce fusion proteins. For instance, λ gt11 will produce fusion proteins whose amino termini consist of β-galactosidase amino acid sequences and whose carboxy termini consist of a foreign polypeptide. Antigenic epitopes of a CYP2D6 protein, e.g., other orthologs of a particular CYP2D6 protein or other paralogs from the same species, can then be detected with antibodies, as, for example, reacting nitrocellulose filters lifted from infected plates with anti-CYP2D6 antibodies. Positive phage detected by this assay can then be isolated from the infected plate. Thus, the presence of CYP2D6 homologs can be detected and cloned from other animals, as can alternate isoforms (including splice variants) from humans.
- The invention further provides for transgenic animals. Transgenic animals of the invention include non-human animals containing an heterologous CYP2D6 P450 C(5816)TA variant or fragment thereof under the control of an CYP2D6 promoter or under the control of a heterologous promoter. Accordingly, the transgenic animals of the invention can be animals expressing a transgene encoding a polymorphic variant of the CYP2D6 gene. Such transgenic animals, preferably, carry at least one heterologous replacement of the wild-type CYP2D6 P450 locus with an heterologous CYP2D6 P450 C(5816)TA variant allele. Such animals can be used, e.g., to determine the effects of such variants on drug metabolism. Other non-human animals within the scope of the invention include those in which at least one copy of the endogenous CYP2D6 P450 gene has been mutated or "knocked out". For example, a CYP2D6 P450 C(5816)TA variant allele/ CYP2D6 P450 knock-out mutant animal having a poor metabolizer phenotype could be constructed and used to determine whether particular treatments, such as with a CYP2D6 P450 drug agonist compound or candidate, are capable of rescuing the poor metabolizer phenotype resulting from a CYP2D6 P450 C(5816)TA mutation. Furthermore, these knock-out animals can be crossed with other transgenic animals expressing, e.g., a mutated form of another P450 gene, thus resulting in an animal which express multiple mutated P450 protein resulting in a complex poor metabolizer phenotype. Methods for obtaining transgenic and knockout non-human animals are well known in the art.
- Knowledge of the particular alteration or alterations, resulting in defective or deficient CYP2D6 genes or proteins in an individual (the CYP2D6 genetic profile), alone or in conjunction with information on other genetic defects contributing to the same disease (the genetic profile of the particular disease) allows a customization of the therapy for a particular disease to the individual's genetic profile, the goal of "pharmacogenomics". The major route of phase I drug metabolism is oxidation by cytochrome P-450 (CYP). Most clinically used drugs are metabolized to some degree by P450s. These enzymes are also principally responsible for activation of procarcinogens and promutagens. Debrisoquine 4-hydroxylase (CYP2D6 ) is the most well characterized P450 polymorphism. About 25% of prescribed drugs are metabolized by CYP2D6. The CYP2D6 C5816TA polymorphism appears to have clinical consequences in the use of cardiovascular drugs and drugs used for treatment of psychiatric disorders. Genotype has been shown to closely correlate with phenotype in this and other CYP2D6 mutations which have been examined. Subjects having a specific allele of a CYP2D6 gene may or may not exhibit symptoms of a drug sensitivity or be predisposed of developing symptoms of a particular disease, such as cancer resulting from the inability to adequately metabolize environmental mutagens or carcinogens. Further, if those subjects are symptomatic, they may or may not respond to a certain drug, e.g., a specific CYP2D6 therapeutic, but may respond to another. Thus, generation of a CYP2D6 genetic profile, (e.g., categorization of alterations in CYP2D6 genes which are associated with the development of a particular disease), from a population of subjects, who are symptomatic for a disease or condition that is caused by or contributed to by a defective and/or deficient CYP2D6 gene and/or protein (a CYP2D6 genetic population profile) and comparison of an individual's CYP2D6 profile to the population profile, permits the selection or design of drugs that are expected to be efficacious for a particular patient or patient population (i.e., a group of patients having the same genetic alteration).
- For example, a CYP2D6 C5816TA population profile can be performed, by determining the CYP2D6 profile, e.g., the identity of a CYP2D6 C5816TA mutant gene in a patient population having a disease, which is caused by or contributed to by a defective or deficient CYP2D6 gene. Optionally, the CYP2D6 population profile can further include information relating to the response of the population to a CYP2D6 therapeutic, using any of a variety of methods, including, monitoring: 1) the severity of symptoms associated with the CYP2D6 related disease, 2) CYP2D6 gene expression level, 3) CYP2D6 mRNA level, and/or 4) CYP2D6 protein level. and (iii) dividing or categorizing the population based on the particular genetic alteration or alterations present in its CYP2D6 gene or a CYP2D6 pathway gene. The CYP2D6 genetic population profile can also, optionally, indicate those particular alterations in which the patient was either responsive or non-responsive to a particular therapeutic. This information or population profile, is then useful for predicting which individuals should respond to particular drugs, based on their individual CYP2D6 profile. In another embodiment, the CYP2D6 profile is a transcriptional or expression level profile and step (i) is comprised of determining the expression level of CYP2D6 proteins, alone or in conjunction with the expression level of other genes, known to contribute to the same disease. The CYP2D6 profile can be measured in many patients at various stages of the disease. Pharmacogenomic studies can also be performed using transgenic animals. For example, one can produce transgenic mice, e.g., as described herein, which contain a specific allelic variant of a CYP2D6 gene. These mice can be created, e.g, by replacing their wild-type CYP2D6 gene with an allele of the human CYP2D6 gene. The response of these mice to specific CYP2D6 therapeutics can then be determined.
- The present invention is illustrated by the following examples. The foregoing and following description of the present invention and the various embodiments are not intended to be limiting of the invention but rather are illustrative thereof. Hence, it will be understood that the invention is not limited to the specific details of these examples.
- We utilized primers and methods of the invention to detect a genetic deficiency in a subject for metabolizing drugs, i.e., a CYP2D6 poor metabolizer genotype, who had previously been shown to have a poor metabolizer phenotype. Genomic DNA from the subject identified as a poor metabolizer was isolated using Qiagen's QiaAMP Blood isolation kit according to manufacturer's protocol. Genomic DNA was extracted from 200 ul of whole blood. Amplification of the CYP2D6 locus was achieved in two steps. First, an initial amplification of the entire CYP2D6 gene to prevent amplification of CYP2D6 pseudogene in subsequent PCR.
- The primers and the associated methods used were based upon Johansson et al. (Johansson, Lundqvist, Dahl, and Ingelman-Sundberg (1996) "PCR-based genotyping for duplicated and deleted CYP2D6 genes", Pharmacogenetics 6, 351-355).
- The following PCR protocol was utilized:
- Initial Amplification
- PCR:
- Lower Mix: Per reaction
- 11.8 ul of water
- 12.0 ul of 3.3X XL Buffer II
- 10.0 ul of 2mM dNTPs
- 0.1 ul of 100 uM primer 35791-81 (CCAGAAGGCTTTGCAGGCTTCA)
- 0.1 ul of 100 uM primer 35791-82 (ACTGAGCCCTGGGAGGTAGGTA)
- 6.0 ul of 25 mM Mg(OAc)2
- 40 ul
-
- The PCR reaction mixture was subsequently sealed by adding one Ampliwax gem over this mixture in a PCR tube. The reaction mixture was heated to 80°C for 5 minutes, and then cooled to 25°C for 5 minutes. The following upper reaction mix was then added:
- Upper Mix: Per reaction
- 30 ul of water
- 18 ul of 3.3X XL buffer II
- 2 ul of rRth, XL
- 10 ul of genomic DNA (
sample 9070; study # 161-003) - 100 ul total volume
-
- The PCR reaction was performed using Perkin Elmer 9600 machine programmed as follows:
- 94°C for 1 minute
- 94°C for 15 seconds
- 62°C for 5 minutes (repeat
2 and 3 for 25 cycles)steps - 94°C for 15 seconds
- 62°C for 5 minutes + autoextend for 15 seconds (repeat steps 4 and 5 for 10 cycles)
- 72°C for 10 minutes
- 4°C hold
-
- This initial amplification product then serves as the template for subsequent amplification of each exon of the CYP2D6 gene. While each exon was amplified and sequenced, only the method and reagents for
Exon 9, the exon in which the mutation was detected, are described below: - Nested PCR methodology was used to amplify
CYP2D6 Exon 9 using M13-tagged primers as follows: - PCR:
- 10 ul 10 X PCR Buffer
- 10 ul 25mM MgCl2
- 2 ul each 10-mM dNTP
- 2
ul 10 uM 35791-11 forward primer (TGTAAAACGACGGCCAGT-AGCCAGGCTCACTGA) - 2ul 10 uM 35791-12 reverse primer (CAGGAAACAGCTATGACC-TGATCCCAACGAGGGCGTGAGCAG)
- 0.5 ul AmpliTaq Gold 5U/ul
- 62.5 ul sterile water
- 5.0 ul of 1:5 dilution of PCR product from initial PCR above
- 100 ul
-
- The PCR reaction was performed using Perkin Elmer 9600 machine programmed as follows:
- 95°C for 10 minutes
- 95°C for 30 seconds
- 63°C for 45 minutes
- 72°C for 1 minute (repeat
steps 2 to 4 for 25 cycles) - 4°C hold
-
- The amplified product was sequenced as follows:
- First, 100 ul of the resulting PCR product was purified using Qiagen's PCR purification kit and the DNA was eluted in 50 ul of water and diluted to 10 ng/ul. Second, sequence reactions were performed using dye-primer chemistry with M13 forward and M13-reverse primers. These and equivalent sequencing methods are known in the art. The CYP2D6 poor metabolizer genotype containing the C(5816)TA variant detected is shown in Figure 1.
-
- 35791-81: CCAGAAGGCTTTGCAGGCTTCA
- 35791-82: ACTGAGCCCTGGGAGGTAGGTA
-
-
- 35791-11 TGTAAAACGACGGCCAGT AGCCAGGCTCACTGA
- 35791-12 CAGGAAACAGCTATGACC TGATCCCAACGAGGGCGTGAGCAG
-
- The CYP2D6 mutations of the invention were cloned into a eukaryotic CMV-CYP2D6 expression vector to determine the biological activity associated with each mutation identified. Individual constructs included: the CYP2D6 with the G5799C mutation, CYP2D6 with the C to TA frameshift at position 5816, and a construct which included both mutations together. Following transfection of these constructs into mammalian cells, as well as the wild type construct, CYP2D6 protein was evident based on Western blot analysis of the cell extracts. In comparison to the wild type construct the CYP2D6 activity was evident, however the turnover time was extremely rapid with the double mutant suggesting that the stability of the protein was affected by this frameshift.
-
Claims (15)
- An isolated nucleic acid molecule comprising: (a) a sequence of at least 20 consecutive nucleotides of an allele of a CYP2D6 gene having SEQ ID NO: 1, which sequence comprises a polymorphic region selected from the group consisting of nucleotide 5816, and nucleotide 5799 of SEQ ID NO: 1, wherein said polymorphic region comprises a nucleotide sequence which differs from that in SEQ ID NO: 1; or (b) a complement of the sequence in (a).
- An isolated nucleic acid molecule comprising at least 20 contiguous nucleotides of SEQ ID NO: 3, including nucleotide 1474, wherein C is replaced by TA, or the complement thereof.
- An isolated nucleic acid molecule comprising at least 30 contiguous nucleotides of SEQ ID NO: 3, including: (a) nucleotide 1474 wherein C is replaced by TA; (b) nucleotide 1457 wherein G is replaced by C; (c) both (a) and (b); or (d) the complement of (a), (b), or (c).
- An isolated nucleic acid molecule encoding a polypeptide comprising an amino acid sequence selected from the group comprising SEQ ID NO.6, SEQ ID NO. 8 and SEQ ID No. 30.
- A single-stranded DNA probe that hybridizes under stringent conditions to a variant form of the CYP2D6 gene having SEQ ID NO. 1, wherein said variant is selected from the group consisting of: (a) SEQ ID No: 1 having TA at position 5816; (b) SEQ ID No: 1 having C at position 5799; (c) SEQ ID No: 1 having TA at position 5816 and C at position 5799; and (d) the complement of (a), (b), and (c).
- A primer capable of amplifying the C5816TA allelic variant comprising a sequence of at least 10 consecutive nucleotides of SEQ ID NO. 2 or SEQ ID NO. 4, or complement thereof, and further comprising a 3' terminal nucleotide of at least one of the nucleotides, or complements thereof, selected from the group consisting of: the T at position 5816 of SEQ ID NO. 2; the T at position 1474 of SEQ ID NO. 4; the A at position 5817 of SEQ ID NO. 2; and the A at position 1475 of SEQ ID NO.4.
- An allele specific oligonucleotide for the detection of the C5816TA allelic variant comprising a sequence of at least 10 consecutive nucleotides of SEQ ID NO. 2 or SEQ ID NO. 4, or complement thereof, and further comprising the nucleotide pair TA at position 5816-5817 of SEQ ID NO. 2 and nucleotide 1474 and 1475 of SEQ ID NO. 4, or complement thereof.
- An array of nucleic acid molecules attached to a support, said array comprising an oligonucleotide that will hybridize under stringent conditions to a nucleic acid sequence as set forth in SEQ ID NO. 2, under conditions wherein said oligonucleotide will not hybridize to the nucleic acid sequence of SEQ ID No. 1.
- An isolated polypeptide having residues 481-502 of the amino acid sequence set forth in SEQ ID NO. 8.
- A purified antibody that selectively binds to an epitope comprising residues 481-502 of the amino acid sequence as set forth in SEQ ID NO. 6.
- A purified antibody that selectively binds to a mutant CYP2D6 polypeptide having an amino acid sequence as set forth in SEQ ID NO. 8 but not to the wild-type CYP2D6 polypeptide having an amino acid sequence as set forth in SEQ ID NO. 5.
- A method for determining whether a subject has a genetic deficiency for metabolizing a drug comprising determining the identity of the amino acids at the C-terminal end of the CYP2D6 protein, wherein the presence of an amino acid sequence other than SEQ ID No: 28 identifies a subject having a genetic deficiency.
- A method for evaluating therapy with a drug metabolized by P450 CYP2D6 comprising: (a) obtaining a sample of DNA from an individual; (b) determining the identity of the nucleotide at position 5816 of the genomic sequence of CYP2D6; and (c) evaluating whether the individual should undergo therapy with a drug metabolized by P450 CYP2D6.
- A method for determining whether a subject has a genetic deficiency for metabolizing a drug comprising: providing a sample of DNA from the individual; amplifying a segment of the CYP2D6 gene with primers capable of amplifying the C5816TA allelic variant of CYP2D6 exon 9; and detecting the presence of amplified DNA that codes for the C5816TA allelic variant, wherein the presence of amplified DNA that codes for the C5816TA allelic variant indicates that the subject has a genetic deficiency for metabolizing drugs.
- A method for determining whether an individual is susceptible to being a PM of drugs comprising detecting the presence of a cytochrome P450 CYP2D6 gene C5816TA polymorphism by: providing a sample of cellular protein from the individual; and detecting the presence of a mutant CYP2D6 C5816TA polypeptide containing the carboxy-terminal sequence YLCCAPLEWGT in said sample with an antibody which recognizes an epitope of the YLCCAPLEWGT mutant carboxy-terminal sequence, wherein the presence of the mutant CYP2D6 C5816TA polypeptide containing the carboxy-terminal sequence YLCCAPLEWGT indicates that the individual is susceptible to being a PM of drugs.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US30911101P | 2001-07-31 | 2001-07-31 | |
| US309111P | 2001-07-31 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| EP1281755A2 true EP1281755A2 (en) | 2003-02-05 |
| EP1281755A3 EP1281755A3 (en) | 2003-06-18 |
Family
ID=23196740
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP02254972A Withdrawn EP1281755A3 (en) | 2001-07-31 | 2002-07-16 | Variants of the human cyp2d6 gene |
Country Status (4)
| Country | Link |
|---|---|
| US (1) | US20030083485A1 (en) |
| EP (1) | EP1281755A3 (en) |
| JP (1) | JP2003111597A (en) |
| CA (1) | CA2391621A1 (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2004069189A3 (en) * | 2003-02-04 | 2005-07-28 | Innovaceuticals Inc | Methods of assessment of drug metabolizing enzymes |
| WO2008076557A3 (en) * | 2006-11-14 | 2008-08-21 | Mayo Foundation | Detecting cyp2d6 alleles |
| WO2008076856A3 (en) * | 2006-12-14 | 2009-02-19 | Siemens Healthcare Diagnostics | Reagents and methods for detecting cyp2d6 polymorphisms |
Families Citing this family (35)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7195877B2 (en) * | 2001-07-20 | 2007-03-27 | Bioventures, Inc. | Cytochrome P450 genetic variations |
| US20040096874A1 (en) * | 2002-04-11 | 2004-05-20 | Third Wave Technologies, Inc. | Characterization of CYP 2D6 genotypes |
| US20100063093A1 (en) | 2007-03-28 | 2010-03-11 | Curt Wolfgang | Methods for the administration of iloperidone |
| WO2006039663A2 (en) | 2004-09-30 | 2006-04-13 | Vanda Pharmaceuticals, Inc | Methods for the administration of iloperidone |
| US7807465B2 (en) * | 2004-10-27 | 2010-10-05 | Duke University | Methods for identifying an individual at increased risk of developing coronary artery disease |
| US20070148661A1 (en) * | 2005-07-19 | 2007-06-28 | Duke University | LSAMP Gene Associated With Cardiovascular Disease |
| EP1948827B1 (en) * | 2005-10-21 | 2016-03-23 | The Regents of The University of California | C-kit oncogene mutations in melanoma |
| EA200971025A1 (en) | 2007-05-04 | 2010-04-30 | Кардиом Фарма Корп. | ORAL COMPOSITIONS WITH REGULATED RELEASE OF COMPOUNDS, MODULATING IONAL CHANNELS, AND RELATED METHODS OF ARRHTHMARIA |
| US20110023154A1 (en) * | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Silkworm genome editing with zinc finger nucleases |
| US20110016541A1 (en) * | 2008-12-04 | 2011-01-20 | Sigma-Aldrich Co. | Genome editing of sensory-related genes in animals |
| US20110016539A1 (en) * | 2008-12-04 | 2011-01-20 | Sigma-Aldrich Co. | Genome editing of neurotransmission-related genes in animals |
| US20110023141A1 (en) * | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Genomic editing of genes involved with parkinson's disease |
| US20110016543A1 (en) * | 2008-12-04 | 2011-01-20 | Sigma-Aldrich Co. | Genomic editing of genes involved in inflammation |
| US20110023153A1 (en) * | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Genomic editing of genes involved in alzheimer's disease |
| US20110016540A1 (en) * | 2008-12-04 | 2011-01-20 | Sigma-Aldrich Co. | Genome editing of genes associated with trinucleotide repeat expansion disorders in animals |
| US20110023149A1 (en) * | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Genomic editing of genes involved in tumor suppression in animals |
| US20110023146A1 (en) * | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Genomic editing of genes involved in secretase-associated disorders |
| US20110023144A1 (en) * | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Genomic editing of genes involved in amyotrophyic lateral sclerosis disease |
| US20110023143A1 (en) * | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Genomic editing of neurodevelopmental genes in animals |
| US20110023139A1 (en) * | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Genomic editing of genes involved in cardiovascular disease |
| US20110023156A1 (en) * | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Feline genome editing with zinc finger nucleases |
| US20110030072A1 (en) * | 2008-12-04 | 2011-02-03 | Sigma-Aldrich Co. | Genome editing of immunodeficiency genes in animals |
| US20110023152A1 (en) * | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Genome editing of cognition related genes in animals |
| US20110023158A1 (en) * | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Bovine genome editing with zinc finger nucleases |
| US20110023147A1 (en) * | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Genomic editing of prion disorder-related genes in animals |
| US20110023140A1 (en) * | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Rabbit genome editing with zinc finger nucleases |
| US20110023145A1 (en) * | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Genomic editing of genes involved in autism spectrum disorders |
| US20110023150A1 (en) * | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Genome editing of genes associated with schizophrenia in animals |
| US20110016546A1 (en) * | 2008-12-04 | 2011-01-20 | Sigma-Aldrich Co. | Porcine genome editing with zinc finger nucleases |
| US20110023151A1 (en) * | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Genome editing of abc transporters |
| US20110023148A1 (en) * | 2008-12-04 | 2011-01-27 | Sigma-Aldrich Co. | Genome editing of addiction-related genes in animals |
| CA3140959A1 (en) | 2009-11-27 | 2011-06-03 | Genzyme Corporation | An amorphous and a crystalline form of genz 112638 hemitartrate as inhibitor of glucosylceramide synthase |
| US20130316391A1 (en) | 2010-12-29 | 2013-11-28 | Sigmaaldrich Co., LLC | Cells having disrupted expression of proteins involved in adme and toxicology processes |
| US11062187B1 (en) * | 2019-09-15 | 2021-07-13 | Gideon Samid | Shapeless—a new language concept and related technology |
| BR112022025317A2 (en) * | 2020-06-15 | 2023-01-03 | Univ Basel | METHOD OF DOSAGE OF AN EMPATOGEN/ENTACTOGEN IN THE TREATMENT OF PATIENTS; METHOD FOR DETERMINING A DOSE OF AN EMPATHOGEN/ENTACTOGEN BASED ON BODY WEIGHT, GENDER AND CYP2D6 ACTIVITY; METHOD TO REFINE THE DOSAGE OF AN EMPATOGEN/ENTACTOGEN; METHOD FOR PREDICTING FUTURE DOSAGE WITH AN EMPATOGEN/ENTACTOGEN; METHOD TO EVALUATE THE FEASIBILITY OF PATIENTS TO RECEIVE AN EMPATOGEN/ENTACTOGEN AS TREATMENT; AND METHOD TO OPTIMIZE TREATMENT WITH EMPATOGEN/ENTACTOGEN IN A PATIENT |
-
2002
- 2002-07-16 EP EP02254972A patent/EP1281755A3/en not_active Withdrawn
- 2002-07-29 CA CA002391621A patent/CA2391621A1/en not_active Abandoned
- 2002-07-31 JP JP2002223211A patent/JP2003111597A/en not_active Abandoned
- 2002-07-31 US US10/209,737 patent/US20030083485A1/en not_active Abandoned
Non-Patent Citations (9)
| Title |
|---|
| DALY A K ET AL: "NOMENCLATURE FOR HUMAN CYP2D6 ALLELES" PHARMACOGENETICS, CHAPMAN & HALL, LONDON, GB, vol. 6, no. 3, June 1996 (1996-06), pages 193-201, XP001018203 ISSN: 0960-314X * |
| DATABASE EMBL [Online] EBI; 28 March 1991 (1991-03-28) "Human mRNA for cytochrome P-450IID (clone pMP33)" retrieved from EMBL Database accession no. X16866 XP002238323 * |
| DATABASE EMBL [Online] EBI; 3 July 1990 (1990-07-03) "Human debrisoquine 4-hydroxylase mutant allele (CYP2D6-MA1) gene" retrieved from EMBL Database accession no. M33189 XP002238324 * |
| JOHANSSON I ET AL: "GENETIC ANALYSIS OF THE CHINESE CYTOCHROME P4502D LOCUS: CHARACTERIZATION OF VARIANT CYP2D6 GENES PRESENT IN SUBJECTS WITH DIMINISHED CAPACITY FOR DEBRISOQUINE HYDROXYLATION" MOLECULAR PHARMACOLOGY, BALTIMORE, MD, US, vol. 46, 1994, pages 452-459, XP001059102 ISSN: 0026-895X * |
| KIMURA S ET AL: "THE HUMAN DEBRISOQUINE 4-HYDROXYLASE (CYP2D) LOCUS: SEQUENCE AND IDENTIFICATION OF THE POLYMORPHIC CYP2D6 GENE, A RELATED GENE, AND A PSEUDOGENE" AMERICAN JOURNAL OF HUMAN GENETICS, UNIVERSITY OF CHICAGO PRESS, CHICAGO,, US, vol. 45, no. 6, 1 December 1989 (1989-12-01), pages 889-904, XP000570035 ISSN: 0002-9297 -& DATABASE EMBL [Online] EBI; 3 July 1990 (1990-07-03) "Human debrisoquine 4-hydroxylase (CYP2D8P) and (CYP2D7) pseudogenes " retrieved from EMBL Database accession no. M33387 XP002238328 * |
| MAREZ, D. ET AL: "Polymorphism of the cytochrome P450 CYP2D6 gene in a European population: characterization of 48 mutations and 53 alleles, their frequencies and evolution" PHARMACOGENETICS (1997), 7(3), 193-202 , 1997, XP001064750 * |
| MEYER U A ET AL: "MOLECULAR MECHANISMS OF GENETIC POLYMORPHISMS OF DRUG METABOLISM" ANNUAL REVIEW OF PHARMACOLOGY AND TOXICOLOGY, ANNUAL REVIEW INC., PALO ALTO, CA, US, vol. 37, 1997, pages 269-296, XP001073468 ISSN: 0362-1642 * |
| ROBERTS R ET AK: "Rapid and Comprehensive Determination of Cytochrome P450 CYP2D6 poor Metabolizer Genotypes by Multiplex Polymerase Chain Reaction" HUMAN MUTATION, WILEY-LISS, NEW YORK, NY, US, vol. 16, 2000, pages 77-85, XP002176411 ISSN: 1059-7794 * |
| WOLF C R ET AL: "CHAPTER 18. CYTOCHROME P450 CYP2D6" METABOLIC POLYMORPHISMS AND SUSCEPTIBILITY TO CANCER, XX, XX, no. 148, 1999, pages 209-229, XP001064897 * |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2004069189A3 (en) * | 2003-02-04 | 2005-07-28 | Innovaceuticals Inc | Methods of assessment of drug metabolizing enzymes |
| WO2008076557A3 (en) * | 2006-11-14 | 2008-08-21 | Mayo Foundation | Detecting cyp2d6 alleles |
| WO2008076856A3 (en) * | 2006-12-14 | 2009-02-19 | Siemens Healthcare Diagnostics | Reagents and methods for detecting cyp2d6 polymorphisms |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2003111597A (en) | 2003-04-15 |
| EP1281755A3 (en) | 2003-06-18 |
| CA2391621A1 (en) | 2003-01-31 |
| US20030083485A1 (en) | 2003-05-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP1281755A2 (en) | Variants of the human cyp2d6 gene | |
| WO2002006529A2 (en) | Detection and treatment of polycystic kidney disease | |
| WO1993025713A9 (en) | Compositions and methods for detecting gene rearrangements and translocations | |
| AU6625900A (en) | Alterations in the long QT syndrome genes KVLQT1 and SCN5A and methods for detecting same | |
| US20040132021A1 (en) | Osteolevin gene polymorphisms | |
| CN106957907B (en) | Genetic test for liver copper accumulation in dogs | |
| US6306591B1 (en) | Screening for the molecular defect causing spider lamb syndrome in sheep | |
| US20040180358A1 (en) | Methods for predicting therapeutic response to agents acting on the growth hormone receptor | |
| US6617104B2 (en) | Predisposition to breast cancer by mutations at the ataxia-telangiectasia genetic locus | |
| CA2471198A1 (en) | Identification of novel polymorphic sites in the human mglur8 gene and uses thereof | |
| US7718787B2 (en) | Gene families associated with cancers | |
| US20030165854A1 (en) | Marker genes responding to treatment with toxins | |
| US7939257B2 (en) | Polymorphic GHSR nucleic acids and uses thereof | |
| US6544742B1 (en) | Detection of genes regulated by EGF in breast cancer | |
| US20030059793A1 (en) | Nucleic acids of the human ABCC11 gene, vectors containing such nucleic acids and uses thereof | |
| WO2000042196B1 (en) | Human methionine synthase reductase: cloning, and methods for evaluating risk of neural tube defects, cardiovascular disease, cancer, and down's syndrome | |
| US20040137440A1 (en) | Androgen regulated nucleic acid molecules and encoded proteins | |
| KR20070029245A (en) | Methods of predicting therapeutic response to drugs acting on growth hormone receptors | |
| US10301615B2 (en) | Genes expressed in mental illness and mood disorders | |
| JP3998934B2 (en) | Electron transfer flavin protein dehydrogenase gene and diagnostic method of glutaric aciduria type II using the same | |
| HK40069686A (en) | Use of a probe, primer or primer combination in the preparation of a kit for detecting a dog to determine the susceptibility of the dog to liver copper accumulation and a computer system | |
| US20030079236A1 (en) | Polymorphisms associated with internalizing disorders | |
| US20030144188A1 (en) | Androgen regulated nucleic acid molecules and encoded proteins | |
| EP1264841A1 (en) | DNA encoding a mutant peroxisome proliferator-activated receptor gamma coactivator-1 (PGC-1), detection methods and test kits therefor | |
| JP2005073626A (en) | Mutation of electron transfer flavin protein dehydrogenase gene and diagnosis of glutaric aciduria type II using it |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20020722 |
|
| AK | Designated contracting states |
Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR IE IT LI LU MC NL PT SE SK TR |
|
| AX | Request for extension of the european patent |
Extension state: AL LT LV MK RO SI |
|
| PUAL | Search report despatched |
Free format text: ORIGINAL CODE: 0009013 |
|
| AK | Designated contracting states |
Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR IE IT LI LU MC NL PT SE SK TR |
|
| AX | Request for extension of the european patent |
Extension state: AL LT LV MK RO SI |
|
| AKX | Designation fees paid |
Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR IE IT LI LU MC NL PT SE SK TR |
|
| 17Q | First examination report despatched |
Effective date: 20050412 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20050823 |






























