EP1272520A2 - Gpcr-proteins and nucleic acids encoding same - Google Patents
Gpcr-proteins and nucleic acids encoding sameInfo
- Publication number
- EP1272520A2 EP1272520A2 EP01930484A EP01930484A EP1272520A2 EP 1272520 A2 EP1272520 A2 EP 1272520A2 EP 01930484 A EP01930484 A EP 01930484A EP 01930484 A EP01930484 A EP 01930484A EP 1272520 A2 EP1272520 A2 EP 1272520A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- nucleic acid
- polypeptide
- amino acid
- novx
- iii
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 150000007523 nucleic acids Chemical class 0.000 title claims abstract description 338
- 102000039446 nucleic acids Human genes 0.000 title claims abstract description 288
- 108020004707 nucleic acids Proteins 0.000 title claims abstract description 288
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 231
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 219
- 229920001184 polypeptide Polymers 0.000 claims abstract description 208
- 238000000034 method Methods 0.000 claims abstract description 172
- 241000282414 Homo sapiens Species 0.000 claims abstract description 100
- 239000012634 fragment Substances 0.000 claims abstract description 75
- 238000011282 treatment Methods 0.000 claims abstract description 24
- 102000040430 polynucleotide Human genes 0.000 claims abstract description 9
- 108091033319 polynucleotide Proteins 0.000 claims abstract description 9
- 239000002157 polynucleotide Substances 0.000 claims abstract description 9
- 230000002265 prevention Effects 0.000 claims abstract description 6
- 125000003729 nucleotide group Chemical group 0.000 claims description 129
- 239000002773 nucleotide Substances 0.000 claims description 125
- 230000014509 gene expression Effects 0.000 claims description 111
- 150000001875 compounds Chemical class 0.000 claims description 98
- 239000000523 sample Substances 0.000 claims description 96
- 230000000694 effects Effects 0.000 claims description 82
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 69
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 66
- 239000003795 chemical substances by application Substances 0.000 claims description 62
- 239000013598 vector Substances 0.000 claims description 55
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 53
- 125000000539 amino acid group Chemical group 0.000 claims description 45
- 230000000295 complement effect Effects 0.000 claims description 36
- 108091026890 Coding region Proteins 0.000 claims description 19
- 102000005962 receptors Human genes 0.000 claims description 18
- 206010028980 Neoplasm Diseases 0.000 claims description 17
- 239000008194 pharmaceutical composition Substances 0.000 claims description 17
- 108020003175 receptors Proteins 0.000 claims description 17
- 230000004075 alteration Effects 0.000 claims description 16
- 201000010099 disease Diseases 0.000 claims description 16
- 239000003550 marker Substances 0.000 claims description 15
- 238000006467 substitution reaction Methods 0.000 claims description 15
- 241000124008 Mammalia Species 0.000 claims description 14
- 239000013068 control sample Substances 0.000 claims description 12
- 230000001413 cellular effect Effects 0.000 claims description 11
- 201000011510 cancer Diseases 0.000 claims description 10
- 239000003937 drug carrier Substances 0.000 claims description 10
- 238000012545 processing Methods 0.000 claims description 6
- 238000013519 translation Methods 0.000 claims description 6
- 201000001320 Atherosclerosis Diseases 0.000 claims description 5
- 239000012636 effector Substances 0.000 claims description 3
- 206010012601 diabetes mellitus Diseases 0.000 claims description 2
- 230000001575 pathological effect Effects 0.000 claims 4
- 230000037353 metabolic pathway Effects 0.000 claims 3
- 208000031229 Cardiomyopathies Diseases 0.000 claims 2
- 101800004866 G protein-coupled receptor ligand Proteins 0.000 claims 2
- 102000004169 proteins and genes Human genes 0.000 abstract description 371
- 230000001225 therapeutic effect Effects 0.000 abstract description 28
- 108091005461 Nucleic proteins Proteins 0.000 abstract description 5
- 238000011160 research Methods 0.000 abstract description 5
- 238000003745 diagnosis Methods 0.000 abstract 1
- 108090000623 proteins and genes Proteins 0.000 description 495
- 235000018102 proteins Nutrition 0.000 description 357
- 210000004027 cell Anatomy 0.000 description 176
- 108020004414 DNA Proteins 0.000 description 101
- 108050002069 Olfactory receptors Proteins 0.000 description 61
- 108020004999 messenger RNA Proteins 0.000 description 55
- 241001465754 Metazoa Species 0.000 description 54
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 description 53
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 description 53
- 235000001014 amino acid Nutrition 0.000 description 46
- 238000012360 testing method Methods 0.000 description 46
- 102000012547 Olfactory receptors Human genes 0.000 description 44
- 238000003556 assay Methods 0.000 description 44
- 238000004458 analytical method Methods 0.000 description 42
- 108700026244 Open Reading Frames Proteins 0.000 description 41
- 230000000692 anti-sense effect Effects 0.000 description 41
- 208000035475 disorder Diseases 0.000 description 41
- 239000013604 expression vector Substances 0.000 description 41
- 150000001413 amino acids Chemical class 0.000 description 39
- 210000001519 tissue Anatomy 0.000 description 39
- 229940024606 amino acid Drugs 0.000 description 38
- 230000035772 mutation Effects 0.000 description 38
- 230000027455 binding Effects 0.000 description 36
- 238000009396 hybridization Methods 0.000 description 36
- 239000000203 mixture Substances 0.000 description 35
- 108091007433 antigens Proteins 0.000 description 31
- 102000036639 antigens Human genes 0.000 description 31
- 102000037865 fusion proteins Human genes 0.000 description 31
- 108020001507 fusion proteins Proteins 0.000 description 31
- 108091034117 Oligonucleotide Proteins 0.000 description 28
- 108020004705 Codon Proteins 0.000 description 27
- 239000000427 antigen Substances 0.000 description 26
- 108091081024 Start codon Proteins 0.000 description 24
- 239000000126 substance Substances 0.000 description 24
- 108060003951 Immunoglobulin Proteins 0.000 description 23
- 239000012472 biological sample Substances 0.000 description 23
- 239000003814 drug Substances 0.000 description 23
- 102000018358 immunoglobulin Human genes 0.000 description 23
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 22
- 230000001105 regulatory effect Effects 0.000 description 21
- -1 OLF2 Proteins 0.000 description 19
- 238000003776 cleavage reaction Methods 0.000 description 19
- 239000013615 primer Substances 0.000 description 19
- 238000001514 detection method Methods 0.000 description 18
- 229940079593 drug Drugs 0.000 description 18
- 230000007017 scission Effects 0.000 description 18
- 102100033062 G-protein coupled receptor 61 Human genes 0.000 description 17
- 229940124812 GPR61 ligand Drugs 0.000 description 17
- 102100033839 Glucose-dependent insulinotropic receptor Human genes 0.000 description 17
- 101100122785 Homo sapiens GPR61 gene Proteins 0.000 description 17
- 101000996752 Homo sapiens Glucose-dependent insulinotropic receptor Proteins 0.000 description 17
- 101100122769 Mus musculus Gpr3 gene Proteins 0.000 description 17
- 239000000463 material Substances 0.000 description 17
- 230000009261 transgenic effect Effects 0.000 description 17
- 102000004190 Enzymes Human genes 0.000 description 16
- 108090000790 Enzymes Proteins 0.000 description 16
- 229940088598 enzyme Drugs 0.000 description 16
- 210000003917 human chromosome Anatomy 0.000 description 16
- 238000003752 polymerase chain reaction Methods 0.000 description 16
- 239000000047 product Substances 0.000 description 16
- 238000007423 screening assay Methods 0.000 description 16
- 102000018697 Membrane Proteins Human genes 0.000 description 15
- 108010052285 Membrane Proteins Proteins 0.000 description 15
- 241000699666 Mus <mouse, genus> Species 0.000 description 15
- 230000001594 aberrant effect Effects 0.000 description 15
- 230000004927 fusion Effects 0.000 description 15
- 210000004408 hybridoma Anatomy 0.000 description 15
- 238000003199 nucleic acid amplification method Methods 0.000 description 15
- 238000011144 upstream manufacturing Methods 0.000 description 15
- 101100490659 Arabidopsis thaliana AGP17 gene Proteins 0.000 description 14
- 241000282412 Homo Species 0.000 description 14
- 101100049938 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) exr-1 gene Proteins 0.000 description 14
- 108010076504 Protein Sorting Signals Proteins 0.000 description 14
- 230000003321 amplification Effects 0.000 description 14
- 210000000170 cell membrane Anatomy 0.000 description 14
- 239000002299 complementary DNA Substances 0.000 description 14
- 239000003446 ligand Substances 0.000 description 14
- 238000004519 manufacturing process Methods 0.000 description 14
- 238000002360 preparation method Methods 0.000 description 14
- 101150101384 rat1 gene Proteins 0.000 description 14
- 210000000349 chromosome Anatomy 0.000 description 13
- 230000006870 function Effects 0.000 description 13
- 238000000338 in vitro Methods 0.000 description 13
- 210000004379 membrane Anatomy 0.000 description 13
- 239000012528 membrane Substances 0.000 description 13
- 102100038385 Coiled-coil domain-containing protein R3HCC1L Human genes 0.000 description 12
- 101000743767 Homo sapiens Coiled-coil domain-containing protein R3HCC1L Proteins 0.000 description 12
- 108020005038 Terminator Codon Proteins 0.000 description 12
- 108091023045 Untranslated Region Proteins 0.000 description 12
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 12
- 239000002502 liposome Substances 0.000 description 12
- 238000003259 recombinant expression Methods 0.000 description 12
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 11
- 230000000890 antigenic effect Effects 0.000 description 11
- 230000004071 biological effect Effects 0.000 description 11
- 238000005516 engineering process Methods 0.000 description 11
- 230000002163 immunogen Effects 0.000 description 11
- 230000002974 pharmacogenomic effect Effects 0.000 description 11
- 108090000994 Catalytic RNA Proteins 0.000 description 10
- 102000053642 Catalytic RNA Human genes 0.000 description 10
- 102000053602 DNA Human genes 0.000 description 10
- 229940127089 cytotoxic agent Drugs 0.000 description 10
- 230000003993 interaction Effects 0.000 description 10
- 230000001404 mediated effect Effects 0.000 description 10
- 108091092562 ribozyme Proteins 0.000 description 10
- 150000003384 small molecules Chemical class 0.000 description 10
- 239000000243 solution Substances 0.000 description 10
- 241000894007 species Species 0.000 description 10
- 241000282465 Canis Species 0.000 description 9
- 241000282472 Canis lupus familiaris Species 0.000 description 9
- 241000588724 Escherichia coli Species 0.000 description 9
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 9
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 9
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 9
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 9
- 230000001580 bacterial effect Effects 0.000 description 9
- 239000012707 chemical precursor Substances 0.000 description 9
- 238000002744 homologous recombination Methods 0.000 description 9
- 230000006801 homologous recombination Effects 0.000 description 9
- 238000012216 screening Methods 0.000 description 9
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 8
- NCYCYZXNIZJOKI-IOUUIBBYSA-N 11-cis-retinal Chemical compound O=C/C=C(\C)/C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C NCYCYZXNIZJOKI-IOUUIBBYSA-N 0.000 description 8
- 101001122433 Homo sapiens Olfactory receptor 4C12 Proteins 0.000 description 8
- 102000004330 Rhodopsin Human genes 0.000 description 8
- 108090000820 Rhodopsin Proteins 0.000 description 8
- 239000002253 acid Substances 0.000 description 8
- 239000005557 antagonist Substances 0.000 description 8
- 208000006673 asthma Diseases 0.000 description 8
- 230000015572 biosynthetic process Effects 0.000 description 8
- 230000004663 cell proliferation Effects 0.000 description 8
- 238000006243 chemical reaction Methods 0.000 description 8
- 230000002068 genetic effect Effects 0.000 description 8
- 239000001963 growth medium Substances 0.000 description 8
- 230000002401 inhibitory effect Effects 0.000 description 8
- 238000000746 purification Methods 0.000 description 8
- 101000909637 Homo sapiens Transcription factor COE1 Proteins 0.000 description 7
- 101150112539 OR gene Proteins 0.000 description 7
- 102100027148 Olfactory receptor 4C12 Human genes 0.000 description 7
- 102100025386 Oxidized low-density lipoprotein receptor 1 Human genes 0.000 description 7
- 108020004511 Recombinant DNA Proteins 0.000 description 7
- 230000004913 activation Effects 0.000 description 7
- 238000001994 activation Methods 0.000 description 7
- 239000000556 agonist Substances 0.000 description 7
- 230000002255 enzymatic effect Effects 0.000 description 7
- 238000001415 gene therapy Methods 0.000 description 7
- 238000001727 in vivo Methods 0.000 description 7
- 230000004048 modification Effects 0.000 description 7
- 238000012986 modification Methods 0.000 description 7
- 230000004044 response Effects 0.000 description 7
- 108091005418 scavenger receptor class E Proteins 0.000 description 7
- 238000003786 synthesis reaction Methods 0.000 description 7
- 108700028369 Alleles Proteins 0.000 description 6
- 241000287828 Gallus gallus Species 0.000 description 6
- 101001128138 Homo sapiens NACHT, LRR and PYD domains-containing protein 2 Proteins 0.000 description 6
- 102100031897 NACHT, LRR and PYD domains-containing protein 2 Human genes 0.000 description 6
- 208000012902 Nervous system disease Diseases 0.000 description 6
- 208000025966 Neurological disease Diseases 0.000 description 6
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 108091023040 Transcription factor Proteins 0.000 description 6
- 102000040945 Transcription factor Human genes 0.000 description 6
- 239000002671 adjuvant Substances 0.000 description 6
- 239000002246 antineoplastic agent Substances 0.000 description 6
- 238000013459 approach Methods 0.000 description 6
- 210000003651 basophil Anatomy 0.000 description 6
- 239000002254 cytotoxic agent Substances 0.000 description 6
- 231100000599 cytotoxic agent Toxicity 0.000 description 6
- 238000012217 deletion Methods 0.000 description 6
- 230000037430 deletion Effects 0.000 description 6
- 230000001419 dependent effect Effects 0.000 description 6
- 239000003085 diluting agent Substances 0.000 description 6
- 210000001671 embryonic stem cell Anatomy 0.000 description 6
- 239000003205 fragrance Substances 0.000 description 6
- 230000003902 lesion Effects 0.000 description 6
- 230000000670 limiting effect Effects 0.000 description 6
- 210000004962 mammalian cell Anatomy 0.000 description 6
- 230000007246 mechanism Effects 0.000 description 6
- 238000002703 mutagenesis Methods 0.000 description 6
- 231100000350 mutagenesis Toxicity 0.000 description 6
- 210000002569 neuron Anatomy 0.000 description 6
- 239000013612 plasmid Substances 0.000 description 6
- 102000054765 polymorphisms of proteins Human genes 0.000 description 6
- 239000002987 primer (paints) Substances 0.000 description 6
- 239000002904 solvent Substances 0.000 description 6
- 230000008685 targeting Effects 0.000 description 6
- 238000013518 transcription Methods 0.000 description 6
- 230000035897 transcription Effects 0.000 description 6
- 108091033380 Coding strand Proteins 0.000 description 5
- 102000005720 Glutathione transferase Human genes 0.000 description 5
- 108010070675 Glutathione transferase Proteins 0.000 description 5
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 5
- 101000586111 Homo sapiens Olfactory receptor 5I1 Proteins 0.000 description 5
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 5
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 5
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 5
- 241000699660 Mus musculus Species 0.000 description 5
- 206010035226 Plasma cell myeloma Diseases 0.000 description 5
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 5
- 241000700159 Rattus Species 0.000 description 5
- 241000700157 Rattus norvegicus Species 0.000 description 5
- 108010091086 Recombinases Proteins 0.000 description 5
- 102000018120 Recombinases Human genes 0.000 description 5
- 241000283984 Rodentia Species 0.000 description 5
- 208000002495 Uterine Neoplasms Diseases 0.000 description 5
- 150000007513 acids Chemical class 0.000 description 5
- 230000009471 action Effects 0.000 description 5
- 238000007792 addition Methods 0.000 description 5
- 239000011324 bead Substances 0.000 description 5
- 230000024245 cell differentiation Effects 0.000 description 5
- 239000003184 complementary RNA Substances 0.000 description 5
- 210000003527 eukaryotic cell Anatomy 0.000 description 5
- 239000012530 fluid Substances 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 230000002538 fungal effect Effects 0.000 description 5
- 239000000499 gel Substances 0.000 description 5
- 230000016784 immunoglobulin production Effects 0.000 description 5
- 229940072221 immunoglobulins Drugs 0.000 description 5
- 239000002609 medium Substances 0.000 description 5
- 238000012544 monitoring process Methods 0.000 description 5
- 201000006417 multiple sclerosis Diseases 0.000 description 5
- 201000000050 myeloid neoplasm Diseases 0.000 description 5
- 210000000287 oocyte Anatomy 0.000 description 5
- 239000002243 precursor Substances 0.000 description 5
- 230000000069 prophylactic effect Effects 0.000 description 5
- 230000010076 replication Effects 0.000 description 5
- 108091008146 restriction endonucleases Proteins 0.000 description 5
- 230000011664 signaling Effects 0.000 description 5
- 238000010561 standard procedure Methods 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- 208000024827 Alzheimer disease Diseases 0.000 description 4
- 108020005544 Antisense RNA Proteins 0.000 description 4
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 4
- 241000894006 Bacteria Species 0.000 description 4
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 4
- 108020004635 Complementary DNA Proteins 0.000 description 4
- 108010001237 Cytochrome P-450 CYP2D6 Proteins 0.000 description 4
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 4
- 108091006027 G proteins Proteins 0.000 description 4
- 102000030782 GTP binding Human genes 0.000 description 4
- 108091000058 GTP-Binding Proteins 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 241000238631 Hexapoda Species 0.000 description 4
- 101000857733 Homo sapiens G-protein coupled bile acid receptor 1 Proteins 0.000 description 4
- 101000609563 Homo sapiens Oxoeicosanoid receptor 1 Proteins 0.000 description 4
- 206010020751 Hypersensitivity Diseases 0.000 description 4
- 108010091358 Hypoxanthine Phosphoribosyltransferase Proteins 0.000 description 4
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 4
- 241001529936 Murinae Species 0.000 description 4
- 101710163270 Nuclease Proteins 0.000 description 4
- 208000008589 Obesity Diseases 0.000 description 4
- 102100030084 Olfactory receptor 5I1 Human genes 0.000 description 4
- 206010061535 Ovarian neoplasm Diseases 0.000 description 4
- 208000018737 Parkinson disease Diseases 0.000 description 4
- 206010060862 Prostate cancer Diseases 0.000 description 4
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 4
- 238000002105 Southern blotting Methods 0.000 description 4
- 108010090804 Streptavidin Proteins 0.000 description 4
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 4
- 238000001042 affinity chromatography Methods 0.000 description 4
- 239000003242 anti bacterial agent Substances 0.000 description 4
- 238000003491 array Methods 0.000 description 4
- 210000003719 b-lymphocyte Anatomy 0.000 description 4
- 229960002685 biotin Drugs 0.000 description 4
- 235000020958 biotin Nutrition 0.000 description 4
- 239000011616 biotin Substances 0.000 description 4
- 239000000969 carrier Substances 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 230000008878 coupling Effects 0.000 description 4
- 238000010168 coupling process Methods 0.000 description 4
- 238000005859 coupling reaction Methods 0.000 description 4
- 230000007547 defect Effects 0.000 description 4
- 238000002405 diagnostic procedure Methods 0.000 description 4
- 239000006185 dispersion Substances 0.000 description 4
- 230000001747 exhibiting effect Effects 0.000 description 4
- 230000005714 functional activity Effects 0.000 description 4
- 238000001476 gene delivery Methods 0.000 description 4
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- 210000003630 histaminocyte Anatomy 0.000 description 4
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 4
- 239000004615 ingredient Substances 0.000 description 4
- 239000003112 inhibitor Substances 0.000 description 4
- 230000003834 intracellular effect Effects 0.000 description 4
- 238000002372 labelling Methods 0.000 description 4
- 210000000265 leukocyte Anatomy 0.000 description 4
- 201000005202 lung cancer Diseases 0.000 description 4
- 208000020816 lung neoplasm Diseases 0.000 description 4
- 210000004698 lymphocyte Anatomy 0.000 description 4
- 210000001161 mammalian embryo Anatomy 0.000 description 4
- 239000011159 matrix material Substances 0.000 description 4
- 239000003094 microcapsule Substances 0.000 description 4
- 235000020824 obesity Nutrition 0.000 description 4
- 210000001517 olfactory receptor neuron Anatomy 0.000 description 4
- 239000000816 peptidomimetic Substances 0.000 description 4
- 210000001236 prokaryotic cell Anatomy 0.000 description 4
- 238000007894 restriction fragment length polymorphism technique Methods 0.000 description 4
- 238000012163 sequencing technique Methods 0.000 description 4
- 230000019491 signal transduction Effects 0.000 description 4
- 206010046766 uterine cancer Diseases 0.000 description 4
- 230000003612 virological effect Effects 0.000 description 4
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 3
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 3
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 3
- 241000972773 Aulopiformes Species 0.000 description 3
- 108090001008 Avidin Proteins 0.000 description 3
- 208000035143 Bacterial infection Diseases 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 241000283690 Bos taurus Species 0.000 description 3
- 208000032841 Bulimia Diseases 0.000 description 3
- 206010006550 Bulimia nervosa Diseases 0.000 description 3
- 102000014914 Carrier Proteins Human genes 0.000 description 3
- 102100021704 Cytochrome P450 2D6 Human genes 0.000 description 3
- 230000004568 DNA-binding Effects 0.000 description 3
- 206010012689 Diabetic retinopathy Diseases 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 3
- 206010017533 Fungal infection Diseases 0.000 description 3
- 101001121109 Homo sapiens Olfactory receptor 2F1 Proteins 0.000 description 3
- 101000888425 Homo sapiens Putative uncharacterized protein C11orf40 Proteins 0.000 description 3
- 102100029098 Hypoxanthine-guanine phosphoribosyltransferase Human genes 0.000 description 3
- 102000013463 Immunoglobulin Light Chains Human genes 0.000 description 3
- 108010065825 Immunoglobulin Light Chains Proteins 0.000 description 3
- 206010061218 Inflammation Diseases 0.000 description 3
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- 108060001084 Luciferase Proteins 0.000 description 3
- 239000005089 Luciferase Substances 0.000 description 3
- 208000031888 Mycoses Diseases 0.000 description 3
- 108091092724 Noncoding DNA Proteins 0.000 description 3
- 102100026616 Olfactory receptor 2F1 Human genes 0.000 description 3
- 206010033128 Ovarian cancer Diseases 0.000 description 3
- 208000002193 Pain Diseases 0.000 description 3
- 208000016222 Pancreatic disease Diseases 0.000 description 3
- 206010033645 Pancreatitis Diseases 0.000 description 3
- 206010033647 Pancreatitis acute Diseases 0.000 description 3
- 208000004843 Pendred Syndrome Diseases 0.000 description 3
- 102100024952 Protein CBFA2T1 Human genes 0.000 description 3
- 108010029485 Protein Isoforms Proteins 0.000 description 3
- 102000001708 Protein Isoforms Human genes 0.000 description 3
- 206010037075 Protozoal infections Diseases 0.000 description 3
- 102100039548 Putative uncharacterized protein C11orf40 Human genes 0.000 description 3
- 108700008625 Reporter Genes Proteins 0.000 description 3
- 108010083644 Ribonucleases Proteins 0.000 description 3
- 102000006382 Ribonucleases Human genes 0.000 description 3
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 3
- 208000006011 Stroke Diseases 0.000 description 3
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 3
- 239000004473 Threonine Substances 0.000 description 3
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 3
- 208000036142 Viral infection Diseases 0.000 description 3
- 238000010521 absorption reaction Methods 0.000 description 3
- 201000003229 acute pancreatitis Diseases 0.000 description 3
- 230000007815 allergy Effects 0.000 description 3
- 230000033115 angiogenesis Effects 0.000 description 3
- 208000022531 anorexia Diseases 0.000 description 3
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 3
- 239000000074 antisense oligonucleotide Substances 0.000 description 3
- 238000012230 antisense oligonucleotides Methods 0.000 description 3
- 208000022362 bacterial infectious disease Diseases 0.000 description 3
- 108091008324 binding proteins Proteins 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 3
- 230000003197 catalytic effect Effects 0.000 description 3
- 230000012292 cell migration Effects 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 239000002738 chelating agent Substances 0.000 description 3
- 238000004587 chromatography analysis Methods 0.000 description 3
- 230000009918 complex formation Effects 0.000 description 3
- 230000021615 conjugation Effects 0.000 description 3
- 229920001577 copolymer Polymers 0.000 description 3
- 230000001086 cytosolic effect Effects 0.000 description 3
- 206010061428 decreased appetite Diseases 0.000 description 3
- 239000002612 dispersion medium Substances 0.000 description 3
- 239000003623 enhancer Substances 0.000 description 3
- 239000005038 ethylene vinyl acetate Substances 0.000 description 3
- 210000004602 germ cell Anatomy 0.000 description 3
- 208000006454 hepatitis Diseases 0.000 description 3
- 231100000283 hepatitis Toxicity 0.000 description 3
- 210000004754 hybrid cell Anatomy 0.000 description 3
- 229940124452 immunizing agent Drugs 0.000 description 3
- 229940127121 immunoconjugate Drugs 0.000 description 3
- 238000001114 immunoprecipitation Methods 0.000 description 3
- 230000001965 increasing effect Effects 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 208000015181 infectious disease Diseases 0.000 description 3
- 230000004054 inflammatory process Effects 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 230000000302 ischemic effect Effects 0.000 description 3
- 210000002510 keratinocyte Anatomy 0.000 description 3
- 150000002632 lipids Chemical class 0.000 description 3
- 208000019423 liver disease Diseases 0.000 description 3
- 229930182817 methionine Natural products 0.000 description 3
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 3
- 238000013508 migration Methods 0.000 description 3
- 210000001706 olfactory mucosa Anatomy 0.000 description 3
- 230000007170 pathology Effects 0.000 description 3
- 210000005259 peripheral blood Anatomy 0.000 description 3
- 239000011886 peripheral blood Substances 0.000 description 3
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 230000004952 protein activity Effects 0.000 description 3
- 230000006337 proteolytic cleavage Effects 0.000 description 3
- 230000001185 psoriatic effect Effects 0.000 description 3
- 230000008707 rearrangement Effects 0.000 description 3
- 230000002441 reversible effect Effects 0.000 description 3
- 235000019515 salmon Nutrition 0.000 description 3
- 150000003839 salts Chemical class 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 210000003491 skin Anatomy 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 210000001082 somatic cell Anatomy 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 235000000346 sugar Nutrition 0.000 description 3
- 230000004083 survival effect Effects 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- 210000001550 testis Anatomy 0.000 description 3
- 239000003053 toxin Substances 0.000 description 3
- 231100000765 toxin Toxicity 0.000 description 3
- 108700012359 toxins Proteins 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- 230000009466 transformation Effects 0.000 description 3
- 230000001131 transforming effect Effects 0.000 description 3
- 230000001960 triggered effect Effects 0.000 description 3
- 210000004881 tumor cell Anatomy 0.000 description 3
- 230000004614 tumor growth Effects 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- 241000701447 unidentified baculovirus Species 0.000 description 3
- 230000009385 viral infection Effects 0.000 description 3
- 210000005253 yeast cell Anatomy 0.000 description 3
- RFLVMTUMFYRZCB-UHFFFAOYSA-N 1-methylguanine Chemical compound O=C1N(C)C(N)=NC2=C1N=CN2 RFLVMTUMFYRZCB-UHFFFAOYSA-N 0.000 description 2
- YSAJFXWTVFGPAX-UHFFFAOYSA-N 2-[(2,4-dioxo-1h-pyrimidin-5-yl)oxy]acetic acid Chemical compound OC(=O)COC1=CNC(=O)NC1=O YSAJFXWTVFGPAX-UHFFFAOYSA-N 0.000 description 2
- FZWGECJQACGGTI-UHFFFAOYSA-N 2-amino-7-methyl-1,7-dihydro-6H-purin-6-one Chemical compound NC1=NC(O)=C2N(C)C=NC2=N1 FZWGECJQACGGTI-UHFFFAOYSA-N 0.000 description 2
- VPFUWHKTPYPNGT-UHFFFAOYSA-N 3-(3,4-dihydroxyphenyl)-1-(5-hydroxy-2,2-dimethylchromen-6-yl)propan-1-one Chemical compound OC1=C2C=CC(C)(C)OC2=CC=C1C(=O)CCC1=CC=C(O)C(O)=C1 VPFUWHKTPYPNGT-UHFFFAOYSA-N 0.000 description 2
- OVONXEQGWXGFJD-UHFFFAOYSA-N 4-sulfanylidene-1h-pyrimidin-2-one Chemical compound SC=1C=CNC(=O)N=1 OVONXEQGWXGFJD-UHFFFAOYSA-N 0.000 description 2
- OIVLITBTBDPEFK-UHFFFAOYSA-N 5,6-dihydrouracil Chemical compound O=C1CCNC(=O)N1 OIVLITBTBDPEFK-UHFFFAOYSA-N 0.000 description 2
- GANZODCWZFAEGN-UHFFFAOYSA-N 5-mercapto-2-nitro-benzoic acid Chemical compound OC(=O)C1=CC(S)=CC=C1[N+]([O-])=O GANZODCWZFAEGN-UHFFFAOYSA-N 0.000 description 2
- ZLAQATDNGLKIEV-UHFFFAOYSA-N 5-methyl-2-sulfanylidene-1h-pyrimidin-4-one Chemical compound CC1=CNC(=S)NC1=O ZLAQATDNGLKIEV-UHFFFAOYSA-N 0.000 description 2
- 102100031126 6-phosphogluconolactonase Human genes 0.000 description 2
- 108010029731 6-phosphogluconolactonase Proteins 0.000 description 2
- LRFVTYWOQMYALW-UHFFFAOYSA-N 9H-xanthine Chemical compound O=C1NC(=O)NC2=C1NC=N2 LRFVTYWOQMYALW-UHFFFAOYSA-N 0.000 description 2
- 108010088751 Albumins Proteins 0.000 description 2
- 102000009027 Albumins Human genes 0.000 description 2
- 206010002383 Angina Pectoris Diseases 0.000 description 2
- 208000019901 Anxiety disease Diseases 0.000 description 2
- 206010003445 Ascites Diseases 0.000 description 2
- 206010004446 Benign prostatic hyperplasia Diseases 0.000 description 2
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 2
- 208000020925 Bipolar disease Diseases 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- 206010007556 Cardiac failure acute Diseases 0.000 description 2
- 108010001857 Cell Surface Receptors Proteins 0.000 description 2
- 206010009944 Colon cancer Diseases 0.000 description 2
- 108020004394 Complementary RNA Proteins 0.000 description 2
- 241000699800 Cricetinae Species 0.000 description 2
- 208000011231 Crohn disease Diseases 0.000 description 2
- 108010026925 Cytochrome P-450 CYP2C19 Proteins 0.000 description 2
- 102100029363 Cytochrome P450 2C19 Human genes 0.000 description 2
- 102000004127 Cytokines Human genes 0.000 description 2
- 108090000695 Cytokines Proteins 0.000 description 2
- 239000003155 DNA primer Substances 0.000 description 2
- 239000003298 DNA probe Substances 0.000 description 2
- 206010012218 Delirium Diseases 0.000 description 2
- 206010012289 Dementia Diseases 0.000 description 2
- 208000012661 Dyskinesia Diseases 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 108091029865 Exogenous DNA Proteins 0.000 description 2
- 229920001917 Ficoll Polymers 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 206010071602 Genetic polymorphism Diseases 0.000 description 2
- 201000004311 Gilles de la Tourette syndrome Diseases 0.000 description 2
- 108010018962 Glucosephosphate Dehydrogenase Proteins 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- 108010024636 Glutathione Proteins 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 241000282575 Gorilla Species 0.000 description 2
- 208000031886 HIV Infections Diseases 0.000 description 2
- 108091027305 Heteroduplex Proteins 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- 208000023105 Huntington disease Diseases 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- 206010020772 Hypertension Diseases 0.000 description 2
- 208000001953 Hypotension Diseases 0.000 description 2
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 2
- 102000012745 Immunoglobulin Subunits Human genes 0.000 description 2
- 108010079585 Immunoglobulin Subunits Proteins 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 206010025323 Lymphomas Diseases 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- HYVABZIGRDEKCD-UHFFFAOYSA-N N(6)-dimethylallyladenine Chemical compound CC(C)=CCNC1=NC=NC2=C1N=CN2 HYVABZIGRDEKCD-UHFFFAOYSA-N 0.000 description 2
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 208000001132 Osteoporosis Diseases 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- 102000007079 Peptide Fragments Human genes 0.000 description 2
- 108010033276 Peptide Fragments Proteins 0.000 description 2
- 108091093037 Peptide nucleic acid Proteins 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 208000004403 Prostatic Hyperplasia Diseases 0.000 description 2
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 2
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 2
- 108091008109 Pseudogenes Proteins 0.000 description 2
- 102000057361 Pseudogenes Human genes 0.000 description 2
- 208000028017 Psychotic disease Diseases 0.000 description 2
- 206010039085 Rhinitis allergic Diseases 0.000 description 2
- 108010039491 Ricin Proteins 0.000 description 2
- 229920002684 Sepharose Polymers 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- 208000036623 Severe mental retardation Diseases 0.000 description 2
- FKNQFGJONOIPTF-UHFFFAOYSA-N Sodium cation Chemical compound [Na+] FKNQFGJONOIPTF-UHFFFAOYSA-N 0.000 description 2
- 108091081400 Subtelomere Proteins 0.000 description 2
- 108091008874 T cell receptors Proteins 0.000 description 2
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 2
- 210000001744 T-lymphocyte Anatomy 0.000 description 2
- 108010000499 Thromboplastin Proteins 0.000 description 2
- 102100030859 Tissue factor Human genes 0.000 description 2
- 208000000323 Tourette Syndrome Diseases 0.000 description 2
- 208000016620 Tourette disease Diseases 0.000 description 2
- 108700019146 Transgenes Proteins 0.000 description 2
- 208000025865 Ulcer Diseases 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- 206010046555 Urinary retention Diseases 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 230000001154 acute effect Effects 0.000 description 2
- 208000009956 adenocarcinoma Diseases 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 208000026935 allergic disease Diseases 0.000 description 2
- 230000009285 allergic inflammation Effects 0.000 description 2
- 201000010105 allergic rhinitis Diseases 0.000 description 2
- 230000000844 anti-bacterial effect Effects 0.000 description 2
- 230000003466 anti-cipated effect Effects 0.000 description 2
- 229940121375 antifungal agent Drugs 0.000 description 2
- 239000003429 antifungal agent Substances 0.000 description 2
- 229940041181 antineoplastic drug Drugs 0.000 description 2
- 230000036506 anxiety Effects 0.000 description 2
- 235000010323 ascorbic acid Nutrition 0.000 description 2
- 229960005070 ascorbic acid Drugs 0.000 description 2
- 239000011668 ascorbic acid Substances 0.000 description 2
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 2
- 230000001588 bifunctional effect Effects 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 238000004166 bioassay Methods 0.000 description 2
- 239000013060 biological fluid Substances 0.000 description 2
- 208000028683 bipolar I disease Diseases 0.000 description 2
- 210000004556 brain Anatomy 0.000 description 2
- 208000035269 cancer or benign tumor Diseases 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 238000000423 cell based assay Methods 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 210000003710 cerebral cortex Anatomy 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 230000002759 chromosomal effect Effects 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- OROGSEYTTFOCAN-DNJOTXNNSA-N codeine Chemical compound C([C@H]1[C@H](N(CC[C@@]112)C)C3)=C[C@H](O)[C@@H]1OC1=C2C3=CC=C1OC OROGSEYTTFOCAN-DNJOTXNNSA-N 0.000 description 2
- 208000029742 colonic neoplasm Diseases 0.000 description 2
- 238000002742 combinatorial mutagenesis Methods 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 239000003431 cross linking reagent Substances 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- 231100000433 cytotoxic Toxicity 0.000 description 2
- 230000001472 cytotoxic effect Effects 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 239000003405 delayed action preparation Substances 0.000 description 2
- 238000003935 denaturing gradient gel electrophoresis Methods 0.000 description 2
- 210000004443 dendritic cell Anatomy 0.000 description 2
- 239000003599 detergent Substances 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 150000004662 dithiols Chemical class 0.000 description 2
- 238000012377 drug delivery Methods 0.000 description 2
- 238000009510 drug design Methods 0.000 description 2
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 2
- 238000001502 gel electrophoresis Methods 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 229960002989 glutamic acid Drugs 0.000 description 2
- 229960003180 glutathione Drugs 0.000 description 2
- 235000011187 glycerol Nutrition 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 239000000017 hydrogel Substances 0.000 description 2
- 230000036543 hypotension Effects 0.000 description 2
- 238000003384 imaging method Methods 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 230000002637 immunotoxin Effects 0.000 description 2
- 239000002596 immunotoxin Substances 0.000 description 2
- 229940051026 immunotoxin Drugs 0.000 description 2
- 231100000608 immunotoxin Toxicity 0.000 description 2
- 238000007901 in situ hybridization Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 239000000543 intermediate Substances 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- 239000007951 isotonicity adjuster Substances 0.000 description 2
- 238000005304 joining Methods 0.000 description 2
- RGLRXNKKBLIBQS-XNHQSDQCSA-N leuprolide acetate Chemical compound CC(O)=O.CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 RGLRXNKKBLIBQS-XNHQSDQCSA-N 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 230000014759 maintenance of location Effects 0.000 description 2
- 210000003794 male germ cell Anatomy 0.000 description 2
- 238000013507 mapping Methods 0.000 description 2
- 238000002844 melting Methods 0.000 description 2
- 230000004060 metabolic process Effects 0.000 description 2
- 239000002207 metabolite Substances 0.000 description 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 2
- OSWPMRLSEDHDFF-UHFFFAOYSA-N methyl salicylate Chemical compound COC(=O)C1=CC=CC=C1O OSWPMRLSEDHDFF-UHFFFAOYSA-N 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 238000000520 microinjection Methods 0.000 description 2
- 239000004005 microsphere Substances 0.000 description 2
- 230000033607 mismatch repair Effects 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- BQJCRHHNABKAKU-KBQPJGBKSA-N morphine Chemical compound O([C@H]1[C@H](C=C[C@H]23)O)C4=C5[C@@]12CCN(C)[C@@H]3CC5=CC=C4O BQJCRHHNABKAKU-KBQPJGBKSA-N 0.000 description 2
- 208000010125 myocardial infarction Diseases 0.000 description 2
- 230000001537 neural effect Effects 0.000 description 2
- 239000000346 nonvolatile oil Substances 0.000 description 2
- 239000002853 nucleic acid probe Substances 0.000 description 2
- 239000002674 ointment Substances 0.000 description 2
- 238000011275 oncology therapy Methods 0.000 description 2
- 230000002611 ovarian Effects 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 238000002823 phage display Methods 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 239000000825 pharmaceutical preparation Substances 0.000 description 2
- 239000012071 phase Substances 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 150000003013 phosphoric acid derivatives Chemical group 0.000 description 2
- 230000035790 physiological processes and functions Effects 0.000 description 2
- 229920000747 poly(lactic acid) Polymers 0.000 description 2
- 229920002401 polyacrylamide Polymers 0.000 description 2
- 230000008488 polyadenylation Effects 0.000 description 2
- 229920005862 polyol Polymers 0.000 description 2
- 150000003077 polyols Chemical class 0.000 description 2
- 230000004481 post-translational protein modification Effects 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 230000002285 radioactive effect Effects 0.000 description 2
- 239000012857 radioactive material Substances 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000004043 responsiveness Effects 0.000 description 2
- 201000000980 schizophrenia Diseases 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 210000002027 skeletal muscle Anatomy 0.000 description 2
- 229910001415 sodium ion Inorganic materials 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 230000002459 sustained effect Effects 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 238000007910 systemic administration Methods 0.000 description 2
- 108091035539 telomere Proteins 0.000 description 2
- 102000055501 telomere Human genes 0.000 description 2
- 210000003411 telomere Anatomy 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 229940104230 thymidine Drugs 0.000 description 2
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 2
- 231100000397 ulcer Toxicity 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- YMXHPSHLTSZXKH-RVBZMBCESA-N (2,5-dioxopyrrolidin-1-yl) 5-[(3as,4s,6ar)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]pentanoate Chemical compound C([C@H]1[C@H]2NC(=O)N[C@H]2CS1)CCCC(=O)ON1C(=O)CCC1=O YMXHPSHLTSZXKH-RVBZMBCESA-N 0.000 description 1
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- NLEBIOOXCVAHBD-YHBSTRCHSA-N (2r,3r,4s,5s,6r)-2-[(2r,3s,4r,5r,6s)-6-dodecoxy-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound O[C@@H]1[C@@H](O)[C@@H](OCCCCCCCCCCCC)O[C@H](CO)[C@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 NLEBIOOXCVAHBD-YHBSTRCHSA-N 0.000 description 1
- XMQUEQJCYRFIQS-YFKPBYRVSA-N (2s)-2-amino-5-ethoxy-5-oxopentanoic acid Chemical compound CCOC(=O)CC[C@H](N)C(O)=O XMQUEQJCYRFIQS-YFKPBYRVSA-N 0.000 description 1
- ASWBNKHCZGQVJV-UHFFFAOYSA-N (3-hexadecanoyloxy-2-hydroxypropyl) 2-(trimethylazaniumyl)ethyl phosphate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(O)COP([O-])(=O)OCC[N+](C)(C)C ASWBNKHCZGQVJV-UHFFFAOYSA-N 0.000 description 1
- IEUUDEWWMRQUDS-UHFFFAOYSA-N (6-azaniumylidene-1,6-dimethoxyhexylidene)azanium;dichloride Chemical compound Cl.Cl.COC(=N)CCCCC(=N)OC IEUUDEWWMRQUDS-UHFFFAOYSA-N 0.000 description 1
- WJNGQIYEQLPJMN-IOSLPCCCSA-N 1-methylinosine Chemical compound C1=NC=2C(=O)N(C)C=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O WJNGQIYEQLPJMN-IOSLPCCCSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- YBBNVCVOACOHIG-UHFFFAOYSA-N 2,2-diamino-1,4-bis(4-azidophenyl)-3-butylbutane-1,4-dione Chemical compound C=1C=C(N=[N+]=[N-])C=CC=1C(=O)C(N)(N)C(CCCC)C(=O)C1=CC=C(N=[N+]=[N-])C=C1 YBBNVCVOACOHIG-UHFFFAOYSA-N 0.000 description 1
- UFBJCMHMOXMLKC-UHFFFAOYSA-N 2,4-dinitrophenol Chemical compound OC1=CC=C([N+]([O-])=O)C=C1[N+]([O-])=O UFBJCMHMOXMLKC-UHFFFAOYSA-N 0.000 description 1
- HLYBTPMYFWWNJN-UHFFFAOYSA-N 2-(2,4-dioxo-1h-pyrimidin-5-yl)-2-hydroxyacetic acid Chemical compound OC(=O)C(O)C1=CNC(=O)NC1=O HLYBTPMYFWWNJN-UHFFFAOYSA-N 0.000 description 1
- SGAKLDIYNFXTCK-UHFFFAOYSA-N 2-[(2,4-dioxo-1h-pyrimidin-5-yl)methylamino]acetic acid Chemical compound OC(=O)CNCC1=CNC(=O)NC1=O SGAKLDIYNFXTCK-UHFFFAOYSA-N 0.000 description 1
- FZDFGHZZPBUTGP-UHFFFAOYSA-N 2-[[2-[bis(carboxymethyl)amino]-3-(4-isothiocyanatophenyl)propyl]-[2-[bis(carboxymethyl)amino]propyl]amino]acetic acid Chemical compound OC(=O)CN(CC(O)=O)C(C)CN(CC(O)=O)CC(N(CC(O)=O)CC(O)=O)CC1=CC=C(N=C=S)C=C1 FZDFGHZZPBUTGP-UHFFFAOYSA-N 0.000 description 1
- FBUTXZSKZCQABC-UHFFFAOYSA-N 2-amino-1-methyl-7h-purine-6-thione Chemical compound S=C1N(C)C(N)=NC2=C1NC=N2 FBUTXZSKZCQABC-UHFFFAOYSA-N 0.000 description 1
- XMSMHKMPBNTBOD-UHFFFAOYSA-N 2-dimethylamino-6-hydroxypurine Chemical compound N1C(N(C)C)=NC(=O)C2=C1N=CN2 XMSMHKMPBNTBOD-UHFFFAOYSA-N 0.000 description 1
- XBBVURRQGJPTHH-UHFFFAOYSA-N 2-hydroxyacetic acid;2-hydroxypropanoic acid Chemical compound OCC(O)=O.CC(O)C(O)=O XBBVURRQGJPTHH-UHFFFAOYSA-N 0.000 description 1
- SMADWRYCYBUIKH-UHFFFAOYSA-N 2-methyl-7h-purin-6-amine Chemical compound CC1=NC(N)=C2NC=NC2=N1 SMADWRYCYBUIKH-UHFFFAOYSA-N 0.000 description 1
- FUBFWTUFPGFHOJ-UHFFFAOYSA-N 2-nitrofuran Chemical class [O-][N+](=O)C1=CC=CO1 FUBFWTUFPGFHOJ-UHFFFAOYSA-N 0.000 description 1
- UMCMPZBLKLEWAF-BCTGSCMUSA-N 3-[(3-cholamidopropyl)dimethylammonio]propane-1-sulfonate Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCC[N+](C)(C)CCCS([O-])(=O)=O)C)[C@@]2(C)[C@@H](O)C1 UMCMPZBLKLEWAF-BCTGSCMUSA-N 0.000 description 1
- GUQQBLRVXOUDTN-XOHPMCGNSA-N 3-[dimethyl-[3-[[(4r)-4-[(3r,5s,7r,8r,9s,10s,12s,13r,14s,17r)-3,7,12-trihydroxy-10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthren-17-yl]pentanoyl]amino]propyl]azaniumyl]-2-hydroxypropane-1-sulfonate Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCC[N+](C)(C)CC(O)CS([O-])(=O)=O)C)[C@@]2(C)[C@@H](O)C1 GUQQBLRVXOUDTN-XOHPMCGNSA-N 0.000 description 1
- KOLPWZCZXAMXKS-UHFFFAOYSA-N 3-methylcytosine Chemical compound CN1C(N)=CC=NC1=O KOLPWZCZXAMXKS-UHFFFAOYSA-N 0.000 description 1
- PQYGLZAKNWQTCV-HNNXBMFYSA-N 4-[N'-(2-hydroxyethyl)thioureido]-L-benzyl EDTA Chemical compound OCCNC(=S)NC1=CC=C(C[C@@H](CN(CC(O)=O)CC(O)=O)N(CC(O)=O)CC(O)=O)C=C1 PQYGLZAKNWQTCV-HNNXBMFYSA-N 0.000 description 1
- GJAKJCICANKRFD-UHFFFAOYSA-N 4-acetyl-4-amino-1,3-dihydropyrimidin-2-one Chemical compound CC(=O)C1(N)NC(=O)NC=C1 GJAKJCICANKRFD-UHFFFAOYSA-N 0.000 description 1
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 1
- MQJSSLBGAQJNER-UHFFFAOYSA-N 5-(methylaminomethyl)-1h-pyrimidine-2,4-dione Chemical compound CNCC1=CNC(=O)NC1=O MQJSSLBGAQJNER-UHFFFAOYSA-N 0.000 description 1
- WPYRHVXCOQLYLY-UHFFFAOYSA-N 5-[(methoxyamino)methyl]-2-sulfanylidene-1h-pyrimidin-4-one Chemical compound CONCC1=CNC(=S)NC1=O WPYRHVXCOQLYLY-UHFFFAOYSA-N 0.000 description 1
- LQLQRFGHAALLLE-UHFFFAOYSA-N 5-bromouracil Chemical compound BrC1=CNC(=O)NC1=O LQLQRFGHAALLLE-UHFFFAOYSA-N 0.000 description 1
- VKLFQTYNHLDMDP-PNHWDRBUSA-N 5-carboxymethylaminomethyl-2-thiouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=S)NC(=O)C(CNCC(O)=O)=C1 VKLFQTYNHLDMDP-PNHWDRBUSA-N 0.000 description 1
- ZFTBZKVVGZNMJR-UHFFFAOYSA-N 5-chlorouracil Chemical compound ClC1=CNC(=O)NC1=O ZFTBZKVVGZNMJR-UHFFFAOYSA-N 0.000 description 1
- KSNXJLQDQOIRIP-UHFFFAOYSA-N 5-iodouracil Chemical compound IC1=CNC(=O)NC1=O KSNXJLQDQOIRIP-UHFFFAOYSA-N 0.000 description 1
- KELXHQACBIUYSE-UHFFFAOYSA-N 5-methoxy-1h-pyrimidine-2,4-dione Chemical compound COC1=CNC(=O)NC1=O KELXHQACBIUYSE-UHFFFAOYSA-N 0.000 description 1
- LRSASMSXMSNRBT-UHFFFAOYSA-N 5-methylcytosine Chemical compound CC1=CNC(=O)N=C1N LRSASMSXMSNRBT-UHFFFAOYSA-N 0.000 description 1
- DCPSTSVLRXOYGS-UHFFFAOYSA-N 6-amino-1h-pyrimidine-2-thione Chemical compound NC1=CC=NC(S)=N1 DCPSTSVLRXOYGS-UHFFFAOYSA-N 0.000 description 1
- CJIJXIFQYOPWTF-UHFFFAOYSA-N 7-hydroxycoumarin Natural products O1C(=O)C=CC2=CC(O)=CC=C21 CJIJXIFQYOPWTF-UHFFFAOYSA-N 0.000 description 1
- MSSXOMSJDRHRMC-UHFFFAOYSA-N 9H-purine-2,6-diamine Chemical compound NC1=NC(N)=C2NC=NC2=N1 MSSXOMSJDRHRMC-UHFFFAOYSA-N 0.000 description 1
- 108010066676 Abrin Proteins 0.000 description 1
- 102100033639 Acetylcholinesterase Human genes 0.000 description 1
- 108010022752 Acetylcholinesterase Proteins 0.000 description 1
- 206010067484 Adverse reaction Diseases 0.000 description 1
- 108010000239 Aequorin Proteins 0.000 description 1
- 206010002198 Anaphylactic reaction Diseases 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 108020005224 Arylamine N-acetyltransferase Proteins 0.000 description 1
- 102100038110 Arylamine N-acetyltransferase 2 Human genes 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 101000669426 Aspergillus restrictus Ribonuclease mitogillin Proteins 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 101150010738 CYP2D6 gene Proteins 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 240000001432 Calendula officinalis Species 0.000 description 1
- 235000005881 Calendula officinalis Nutrition 0.000 description 1
- 244000025254 Cannabis sativa Species 0.000 description 1
- 101710158575 Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase Proteins 0.000 description 1
- OKTJSMMVPCPJKN-NJFSPNSNSA-N Carbon-14 Chemical compound [14C] OKTJSMMVPCPJKN-NJFSPNSNSA-N 0.000 description 1
- 208000005623 Carcinogenesis Diseases 0.000 description 1
- 108010013659 Catecholamine Receptors Proteins 0.000 description 1
- 102000017063 Catecholamine Receptors Human genes 0.000 description 1
- 108091005462 Cation channels Proteins 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108091092236 Chimeric RNA Proteins 0.000 description 1
- 208000032544 Cicatrix Diseases 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 229920000742 Cotton Polymers 0.000 description 1
- 108010051219 Cre recombinase Proteins 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 239000004971 Cross linker Substances 0.000 description 1
- 108700032819 Croton tiglium crotin II Proteins 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 108020001738 DNA Glycosylase Proteins 0.000 description 1
- 108020003215 DNA Probes Proteins 0.000 description 1
- 230000004544 DNA amplification Effects 0.000 description 1
- 102000028381 DNA glycosylase Human genes 0.000 description 1
- 101710177611 DNA polymerase II large subunit Proteins 0.000 description 1
- 101710184669 DNA polymerase II small subunit Proteins 0.000 description 1
- 230000006820 DNA synthesis Effects 0.000 description 1
- XPDXVDYUQZHFPV-UHFFFAOYSA-N Dansyl Chloride Chemical compound C1=CC=C2C(N(C)C)=CC=CC2=C1S(Cl)(=O)=O XPDXVDYUQZHFPV-UHFFFAOYSA-N 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 206010012438 Dermatitis atopic Diseases 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 238000009007 Diagnostic Kit Methods 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 102000016607 Diphtheria Toxin Human genes 0.000 description 1
- 108010053187 Diphtheria Toxin Proteins 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 206010014561 Emphysema Diseases 0.000 description 1
- 241000792859 Enema Species 0.000 description 1
- 108010013369 Enteropeptidase Proteins 0.000 description 1
- 102100029727 Enteropeptidase Human genes 0.000 description 1
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 1
- 101710082714 Exotoxin A Proteins 0.000 description 1
- 108010046276 FLP recombinase Proteins 0.000 description 1
- 108010074860 Factor Xa Proteins 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 230000035519 G0 Phase Effects 0.000 description 1
- 108010001515 Galectin 4 Proteins 0.000 description 1
- 102100039556 Galectin-4 Human genes 0.000 description 1
- 108700004714 Gelonium multiflorum GEL Proteins 0.000 description 1
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- 208000037357 HIV infectious disease Diseases 0.000 description 1
- 206010018910 Haemolysis Diseases 0.000 description 1
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 1
- 101000884399 Homo sapiens Arylamine N-acetyltransferase 2 Proteins 0.000 description 1
- 101000887490 Homo sapiens Guanine nucleotide-binding protein G(z) subunit alpha Proteins 0.000 description 1
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 1
- 101000917826 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-a Proteins 0.000 description 1
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 description 1
- 101000611343 Homo sapiens Olfactory receptor 1D2 Proteins 0.000 description 1
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 241000725303 Human immunodeficiency virus Species 0.000 description 1
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 1
- 241000713340 Human immunodeficiency virus 2 Species 0.000 description 1
- AVXURJPOCDRRFD-UHFFFAOYSA-N Hydroxylamine Chemical compound ON AVXURJPOCDRRFD-UHFFFAOYSA-N 0.000 description 1
- 102000009438 IgE Receptors Human genes 0.000 description 1
- 108010073816 IgE Receptors Proteins 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 238000012695 Interfacial polymerization Methods 0.000 description 1
- 208000002260 Keloid Diseases 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 1
- 108010000817 Leuprolide Proteins 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 1
- 239000004907 Macro-emulsion Substances 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 244000246386 Mentha pulegium Species 0.000 description 1
- 235000016257 Mentha pulegium Nutrition 0.000 description 1
- 235000004357 Mentha x piperita Nutrition 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 244000302512 Momordica charantia Species 0.000 description 1
- 235000009811 Momordica charantia Nutrition 0.000 description 1
- 108700005084 Multigene Family Proteins 0.000 description 1
- 108010021466 Mutant Proteins Proteins 0.000 description 1
- 102000008300 Mutant Proteins Human genes 0.000 description 1
- SGSSKEDGVONRGC-UHFFFAOYSA-N N(2)-methylguanine Chemical compound O=C1NC(NC)=NC2=C1N=CN2 SGSSKEDGVONRGC-UHFFFAOYSA-N 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- WTBIAPVQQBCLFP-UHFFFAOYSA-N N.N.N.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O Chemical compound N.N.N.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O WTBIAPVQQBCLFP-UHFFFAOYSA-N 0.000 description 1
- 206010028741 Nasal inflammation Diseases 0.000 description 1
- 102000008763 Neurofilament Proteins Human genes 0.000 description 1
- 108010088373 Neurofilament Proteins Proteins 0.000 description 1
- 108090000590 Neurotransmitter Receptors Proteins 0.000 description 1
- 208000032234 No therapeutic response Diseases 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 102100040776 Olfactory receptor 1D2 Human genes 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 102000010175 Opsin Human genes 0.000 description 1
- 108050001704 Opsin Proteins 0.000 description 1
- 102000016978 Orphan receptors Human genes 0.000 description 1
- 108070000031 Orphan receptors Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 241000282577 Pan troglodytes Species 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 108010067902 Peptide Library Proteins 0.000 description 1
- 108010004729 Phycoerythrin Proteins 0.000 description 1
- 101100413173 Phytolacca americana PAP2 gene Proteins 0.000 description 1
- 206010035664 Pneumonia Diseases 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-M Propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 1
- 108010066717 Q beta Replicase Proteins 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 1
- 101710100968 Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 206010038997 Retroviral infections Diseases 0.000 description 1
- 108091081021 Sense strand Proteins 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- DWAQJAXMDSEUJJ-UHFFFAOYSA-M Sodium bisulfite Chemical compound [Na+].OS([O-])=O DWAQJAXMDSEUJJ-UHFFFAOYSA-M 0.000 description 1
- 241000251131 Sphyrna Species 0.000 description 1
- 241000269319 Squalius cephalus Species 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 1
- 201000008754 Tenosynovial giant cell tumor Diseases 0.000 description 1
- 241000223892 Tetrahymena Species 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical group OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 108010034949 Thyroglobulin Proteins 0.000 description 1
- 102000009843 Thyroglobulin Human genes 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- 101710162629 Trypsin inhibitor Proteins 0.000 description 1
- 229940122618 Trypsin inhibitor Drugs 0.000 description 1
- 208000024780 Urticaria Diseases 0.000 description 1
- 240000001866 Vernicia fordii Species 0.000 description 1
- ZVNYJIZDIRKMBF-UHFFFAOYSA-N Vesnarinone Chemical compound C1=C(OC)C(OC)=CC=C1C(=O)N1CCN(C=2C=C3CCC(=O)NC3=CC=2)CC1 ZVNYJIZDIRKMBF-UHFFFAOYSA-N 0.000 description 1
- 240000006677 Vicia faba Species 0.000 description 1
- 235000010749 Vicia faba Nutrition 0.000 description 1
- 235000002098 Vicia faba var. major Nutrition 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 239000005862 Whey Substances 0.000 description 1
- 102000007544 Whey Proteins Human genes 0.000 description 1
- 108010046377 Whey Proteins Proteins 0.000 description 1
- RJZZTNAWUTTWMJ-WYIOVZGUSA-N [(2r,3s,5s)-5-amino-2-[2-(4-methoxyphenyl)-2,2-diphenylethyl]-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-3-yl]oxyphosphonamidous acid Chemical compound C1=CC(OC)=CC=C1C(C=1C=CC=CC=1)(C=1C=CC=CC=1)C[C@@H]1[C@@H](OP(N)O)C[C@](N)(N2C(NC(=O)C(C)=C2)=O)O1 RJZZTNAWUTTWMJ-WYIOVZGUSA-N 0.000 description 1
- 238000002679 ablation Methods 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 150000001242 acetic acid derivatives Chemical class 0.000 description 1
- 229940022698 acetylcholinesterase Drugs 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 125000000641 acridinyl group Chemical group C1(=CC=CC2=NC3=CC=CC=C3C=C12)* 0.000 description 1
- 230000036982 action potential Effects 0.000 description 1
- 208000038016 acute inflammation Diseases 0.000 description 1
- 230000006022 acute inflammation Effects 0.000 description 1
- 229960000643 adenine Drugs 0.000 description 1
- 210000000577 adipose tissue Anatomy 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000006838 adverse reaction Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 150000001299 aldehydes Chemical class 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- 102000013529 alpha-Fetoproteins Human genes 0.000 description 1
- 108010026331 alpha-Fetoproteins Proteins 0.000 description 1
- 108010001818 alpha-sarcin Proteins 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- 230000000202 analgesic effect Effects 0.000 description 1
- 229940035676 analgesics Drugs 0.000 description 1
- 230000036783 anaphylactic response Effects 0.000 description 1
- 208000003455 anaphylaxis Diseases 0.000 description 1
- 239000000730 antalgic agent Substances 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000000078 anti-malarial effect Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 229940124691 antibody therapeutics Drugs 0.000 description 1
- 210000000628 antibody-producing cell Anatomy 0.000 description 1
- 230000030741 antigen processing and presentation Effects 0.000 description 1
- 239000003430 antimalarial agent Substances 0.000 description 1
- 229940033495 antimalarials Drugs 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 238000010420 art technique Methods 0.000 description 1
- 210000001106 artificial yeast chromosome Anatomy 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 201000008937 atopic dermatitis Diseases 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 210000003050 axon Anatomy 0.000 description 1
- 230000003376 axonal effect Effects 0.000 description 1
- 230000003385 bacteriostatic effect Effects 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 210000000270 basal cell Anatomy 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- DZBUGLKDJFMEHC-UHFFFAOYSA-N benzoquinolinylidene Chemical group C1=CC=CC2=CC3=CC=CC=C3N=C21 DZBUGLKDJFMEHC-UHFFFAOYSA-N 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 239000003833 bile salt Substances 0.000 description 1
- 229940093761 bile salts Drugs 0.000 description 1
- 229920000249 biocompatible polymer Polymers 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 230000006287 biotinylation Effects 0.000 description 1
- 238000007413 biotinylation Methods 0.000 description 1
- 210000002459 blastocyst Anatomy 0.000 description 1
- 210000001109 blastomere Anatomy 0.000 description 1
- 230000008499 blood brain barrier function Effects 0.000 description 1
- 210000001218 blood-brain barrier Anatomy 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 230000011496 cAMP-mediated signaling Effects 0.000 description 1
- 238000010804 cDNA synthesis Methods 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 230000036952 cancer formation Effects 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 229910002092 carbon dioxide Inorganic materials 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 230000022534 cell killing Effects 0.000 description 1
- 230000002032 cellular defenses Effects 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 230000004700 cellular uptake Effects 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 238000012412 chemical coupling Methods 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 230000008711 chromosomal rearrangement Effects 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 208000037976 chronic inflammation Diseases 0.000 description 1
- 208000037893 chronic inflammatory disorder Diseases 0.000 description 1
- 150000001860 citric acid derivatives Chemical class 0.000 description 1
- 238000012411 cloning technique Methods 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 238000000975 co-precipitation Methods 0.000 description 1
- 238000005354 coacervation Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 229960004126 codeine Drugs 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 229940075614 colloidal silicon dioxide Drugs 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 230000001447 compensatory effect Effects 0.000 description 1
- 239000008139 complexing agent Substances 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 238000013270 controlled release Methods 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 239000007822 coupling agent Substances 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 238000009402 cross-breeding Methods 0.000 description 1
- UFULAYFCSOUIOV-UHFFFAOYSA-N cysteamine Chemical compound NCCS UFULAYFCSOUIOV-UHFFFAOYSA-N 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 230000016396 cytokine production Effects 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 239000003398 denaturant Substances 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 230000000368 destabilizing effect Effects 0.000 description 1
- 229960002086 dextran Drugs 0.000 description 1
- 229960000633 dextran sulfate Drugs 0.000 description 1
- 150000001982 diacylglycerols Chemical class 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 229930191339 dianthin Natural products 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 208000035647 diffuse type tenosynovial giant cell tumor Diseases 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- 125000005442 diisocyanate group Chemical group 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 206010013023 diphtheria Diseases 0.000 description 1
- ZWIBGKZDAWNIFC-UHFFFAOYSA-N disuccinimidyl suberate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCCC(=O)ON1C(=O)CCC1=O ZWIBGKZDAWNIFC-UHFFFAOYSA-N 0.000 description 1
- 125000002228 disulfide group Chemical group 0.000 description 1
- 230000007783 downstream signaling Effects 0.000 description 1
- 238000007876 drug discovery Methods 0.000 description 1
- 230000036267 drug metabolism Effects 0.000 description 1
- 239000003596 drug target Substances 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 230000008482 dysregulation Effects 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 210000002308 embryonic cell Anatomy 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 1
- 239000007920 enema Substances 0.000 description 1
- 229940079360 enema for constipation Drugs 0.000 description 1
- 230000037149 energy metabolism Effects 0.000 description 1
- 108010028531 enomycin Proteins 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- RTZKZFJDLAIYFH-UHFFFAOYSA-N ether Substances CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 150000002222 fluorine compounds Chemical class 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- IECPWNUMDGFDKC-MZJAQBGESA-N fusidic acid Chemical class O[C@@H]([C@@H]12)C[C@H]3\C(=C(/CCC=C(C)C)C(O)=O)[C@@H](OC(C)=O)C[C@]3(C)[C@@]2(C)CC[C@@H]2[C@]1(C)CC[C@@H](O)[C@H]2C IECPWNUMDGFDKC-MZJAQBGESA-N 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 230000004545 gene duplication Effects 0.000 description 1
- 238000012252 genetic analysis Methods 0.000 description 1
- 238000003205 genotyping method Methods 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 230000008588 hemolysis Effects 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 239000012145 high-salt buffer Substances 0.000 description 1
- 108091008039 hormone receptors Proteins 0.000 description 1
- 235000001050 hortel pimenta Nutrition 0.000 description 1
- 102000052301 human GNAZ Human genes 0.000 description 1
- 208000033519 human immunodeficiency virus infectious disease Diseases 0.000 description 1
- OROGSEYTTFOCAN-UHFFFAOYSA-N hydrocodone Natural products C1C(N(CCC234)C)C2C=CC(O)C3OC2=C4C1=CC=C2OC OROGSEYTTFOCAN-UHFFFAOYSA-N 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 229920001600 hydrophobic polymer Polymers 0.000 description 1
- 238000002169 hydrotherapy Methods 0.000 description 1
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 1
- 229920003063 hydroxymethyl cellulose Polymers 0.000 description 1
- 229940031574 hydroxymethyl cellulose Drugs 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- 230000002390 hyperplastic effect Effects 0.000 description 1
- 230000001969 hypertrophic effect Effects 0.000 description 1
- 150000002463 imidates Chemical class 0.000 description 1
- 230000003100 immobilizing effect Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 208000026278 immune system disease Diseases 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 238000010166 immunofluorescence Methods 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 230000000415 inactivating effect Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 208000021267 infertility disease Diseases 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 239000000138 intercalating agent Substances 0.000 description 1
- 230000003426 interchromosomal effect Effects 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 210000001117 keloid Anatomy 0.000 description 1
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- IZWSFJTYBVKZNK-UHFFFAOYSA-N lauryl sulfobetaine Chemical compound CCCCCCCCCCCC[N+](C)(C)CCCS([O-])(=O)=O IZWSFJTYBVKZNK-UHFFFAOYSA-N 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 229960004338 leuprorelin Drugs 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 230000033001 locomotion Effects 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- HWYHZTIRURJOHG-UHFFFAOYSA-N luminol Chemical compound O=C1NNC(=O)C2=C1C(N)=CC=C2 HWYHZTIRURJOHG-UHFFFAOYSA-N 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 208000037841 lung tumor Diseases 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 230000002101 lytic effect Effects 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 210000005075 mammary gland Anatomy 0.000 description 1
- 230000013011 mating Effects 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 229960003151 mercaptamine Drugs 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- IZAGSTRIDUNNOY-UHFFFAOYSA-N methyl 2-[(2,4-dioxo-1h-pyrimidin-5-yl)oxy]acetate Chemical compound COC(=O)COC1=CNC(=O)NC1=O IZAGSTRIDUNNOY-UHFFFAOYSA-N 0.000 description 1
- DFTAZNAEBRBBKP-UHFFFAOYSA-N methyl 4-sulfanylbutanimidate Chemical compound COC(=N)CCCS DFTAZNAEBRBBKP-UHFFFAOYSA-N 0.000 description 1
- STZCRXQWRGQSJD-GEEYTBSJSA-M methyl orange Chemical compound [Na+].C1=CC(N(C)C)=CC=C1\N=N\C1=CC=C(S([O-])(=O)=O)C=C1 STZCRXQWRGQSJD-GEEYTBSJSA-M 0.000 description 1
- 229940012189 methyl orange Drugs 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 229960001047 methyl salicylate Drugs 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 108010010621 modeccin Proteins 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 1
- 229960005181 morphine Drugs 0.000 description 1
- 210000000472 morula Anatomy 0.000 description 1
- 239000002324 mouth wash Substances 0.000 description 1
- 229940051866 mouthwash Drugs 0.000 description 1
- 101150029137 mutY gene Proteins 0.000 description 1
- 230000007498 myristoylation Effects 0.000 description 1
- ZTLGJPIZUOVDMT-UHFFFAOYSA-N n,n-dichlorotriazin-4-amine Chemical compound ClN(Cl)C1=CC=NN=N1 ZTLGJPIZUOVDMT-UHFFFAOYSA-N 0.000 description 1
- XJVXMWNLQRTRGH-UHFFFAOYSA-N n-(3-methylbut-3-enyl)-2-methylsulfanyl-7h-purin-6-amine Chemical compound CSC1=NC(NCCC(C)=C)=C2NC=NC2=N1 XJVXMWNLQRTRGH-UHFFFAOYSA-N 0.000 description 1
- UMWKZHPREXJQGR-XOSAIJSUSA-N n-methyl-n-[(2s,3r,4r,5r)-2,3,4,5,6-pentahydroxyhexyl]decanamide Chemical compound CCCCCCCCCC(=O)N(C)C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO UMWKZHPREXJQGR-XOSAIJSUSA-N 0.000 description 1
- SBWGZAXBCCNRTM-CTHBEMJXSA-N n-methyl-n-[(2s,3r,4r,5r)-2,3,4,5,6-pentahydroxyhexyl]octanamide Chemical compound CCCCCCCC(=O)N(C)C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO SBWGZAXBCCNRTM-CTHBEMJXSA-N 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 239000007922 nasal spray Substances 0.000 description 1
- 239000006218 nasal suppository Substances 0.000 description 1
- 239000006199 nebulizer Substances 0.000 description 1
- 210000005044 neurofilament Anatomy 0.000 description 1
- 239000002858 neurotransmitter agent Substances 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 239000002687 nonaqueous vehicle Substances 0.000 description 1
- 210000001331 nose Anatomy 0.000 description 1
- 238000007899 nucleic acid hybridization Methods 0.000 description 1
- 238000011330 nucleic acid test Methods 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 150000003833 nucleoside derivatives Chemical class 0.000 description 1
- HEGSGKPQLMEBJL-RKQHYHRCSA-N octyl beta-D-glucopyranoside Chemical compound CCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O HEGSGKPQLMEBJL-RKQHYHRCSA-N 0.000 description 1
- 235000019645 odor Nutrition 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 210000000956 olfactory bulb Anatomy 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 239000012285 osmium tetroxide Substances 0.000 description 1
- 229910000489 osmium tetroxide Inorganic materials 0.000 description 1
- 239000007800 oxidant agent Substances 0.000 description 1
- 230000001590 oxidative effect Effects 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 210000005105 peripheral blood lymphocyte Anatomy 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- 108010076042 phenomycin Proteins 0.000 description 1
- 235000021317 phosphate Nutrition 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 1
- 150000008300 phosphoramidites Chemical class 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 230000010399 physical interaction Effects 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 230000006461 physiological response Effects 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229920003229 poly(methyl methacrylate) Polymers 0.000 description 1
- 229920000447 polyanionic polymer Polymers 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 239000008389 polyethoxylated castor oil Substances 0.000 description 1
- 239000004633 polyglycolic acid Substances 0.000 description 1
- 229920002338 polyhydroxyethylmethacrylate Polymers 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 239000004926 polymethyl methacrylate Substances 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 239000003380 propellant Substances 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 229940076376 protein agonist Drugs 0.000 description 1
- 229940076372 protein antagonist Drugs 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 235000004252 protein component Nutrition 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 235000021251 pulses Nutrition 0.000 description 1
- 239000000376 reactant Substances 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000014493 regulation of gene expression Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 1
- 229940081974 saccharin Drugs 0.000 description 1
- 235000019204 saccharin Nutrition 0.000 description 1
- 239000000901 saccharin and its Na,K and Ca salt Substances 0.000 description 1
- 231100000241 scar Toxicity 0.000 description 1
- 230000037387 scars Effects 0.000 description 1
- 238000013391 scatchard analysis Methods 0.000 description 1
- 238000003345 scintillation counting Methods 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 210000001044 sensory neuron Anatomy 0.000 description 1
- 231100000004 severe toxicity Toxicity 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 229940126586 small molecule drug Drugs 0.000 description 1
- PTLRDCMBXHILCL-UHFFFAOYSA-M sodium arsenite Chemical compound [Na+].[O-][As]=O PTLRDCMBXHILCL-UHFFFAOYSA-M 0.000 description 1
- 235000010267 sodium hydrogen sulphite Nutrition 0.000 description 1
- 239000006104 solid solution Substances 0.000 description 1
- 230000000392 somatic effect Effects 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 238000003153 stable transfection Methods 0.000 description 1
- 238000012409 standard PCR amplification Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 238000011146 sterile filtration Methods 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 239000003270 steroid hormone Substances 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 150000005846 sugar alcohols Polymers 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 229940124530 sulfonamide Drugs 0.000 description 1
- 150000003456 sulfonamides Chemical class 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000002511 suppository base Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 230000000946 synaptic effect Effects 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 208000001608 teratocarcinoma Diseases 0.000 description 1
- 230000002381 testicular Effects 0.000 description 1
- 208000002918 testicular germ cell tumor Diseases 0.000 description 1
- 238000012956 testing procedure Methods 0.000 description 1
- 238000011285 therapeutic regimen Methods 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- CNHYKKNIIGEXAY-UHFFFAOYSA-N thiolan-2-imine Chemical compound N=C1CCCS1 CNHYKKNIIGEXAY-UHFFFAOYSA-N 0.000 description 1
- 238000003161 three-hybrid assay Methods 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 229960002175 thyroglobulin Drugs 0.000 description 1
- 230000017423 tissue regeneration Effects 0.000 description 1
- 210000002105 tongue Anatomy 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 102000027257 transmembrane receptors Human genes 0.000 description 1
- 108091008578 transmembrane receptors Proteins 0.000 description 1
- 230000008733 trauma Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 239000002753 trypsin inhibitor Substances 0.000 description 1
- 238000003160 two-hybrid assay Methods 0.000 description 1
- 238000010396 two-hybrid screening Methods 0.000 description 1
- ORHBXUUXSCNDEV-UHFFFAOYSA-N umbelliferone Chemical compound C1=CC(=O)OC2=CC(O)=CC=C21 ORHBXUUXSCNDEV-UHFFFAOYSA-N 0.000 description 1
- HFTAFOQKODTIJY-UHFFFAOYSA-N umbelliferone Natural products Cc1cc2C=CC(=O)Oc2cc1OCC=CC(C)(C)O HFTAFOQKODTIJY-UHFFFAOYSA-N 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 238000009777 vacuum freeze-drying Methods 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000008215 water for injection Substances 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 230000029663 wound healing Effects 0.000 description 1
- WCNMEQDMUYVWMJ-JPZHCBQBSA-N wybutoxosine Chemical compound C1=NC=2C(=O)N3C(CC([C@H](NC(=O)OC)C(=O)OC)OO)=C(C)N=C3N(C)C=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O WCNMEQDMUYVWMJ-JPZHCBQBSA-N 0.000 description 1
- 229940075420 xanthine Drugs 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/48—Drugs for disorders of the endocrine system of the pancreatic hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the present invention generally relates to novel proteins encoded by genomic DNA sequences and proteins similar to them, namely, new proteins bearing sequence similarity to G-protein coupled receptors (GPCRs), nucleic acids that encode these proteins or fragments thereof, and antibodies that bind immunospecifically to a protein of the invention.
- GPCRs G-protein coupled receptors
- Olfactory receptors have been identified as an extremely large subfamily of GPCRs in a number of species. These receptors share a seven transmembrane domain structure with many neurotransmitter and hormone receptors, and are likely to underlie the recognition of G-protein-mediated transduction of odorant signals.
- ORs Olfactory receptors
- the invention is based, in part, upon the discovery of novel polynucleotide sequences encoding novel polypeptides.
- the invention provides an isolated nucleic acid molecule that includes the sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23 or a fragment, homolog, analog or derivative thereof.
- the nucleic acid can include, e.g., a nucleic acid sequence encoding a polypeptide at least 85% identical to a polypeptide that includes the amino acid sequences of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24.
- the nucleic acid can be, e.g., a genomic DNA fragment, or a cDNA molecule.
- Also included in the invention is a vector containing one or more of the nucleic acids described herein, and a cell containing the vectors or nucleic acids described herein.
- the invention is also directed to host cells transformed with a vector comprising any of the nucleic acid molecules described above.
- the invention includes a pharmaceutical composition that includes a NOVX nucleic acid and a pharmaceutically acceptable carrier or diluent.
- the invention includes a substantially purified NOVX polypeptide, e.g., any of the NOVX polypeptides encoded by a NOVX nucleic acid, and fragments, homologs, analogs, and derivatives thereof.
- the invention also includes a pharmaceutical composition that includes a NOVX polypeptide and a pharmaceutically acceptable carrier or diluent.
- the invention provides an antibody that binds specifically to a NOVX polypeptide.
- the antibody can be, e.g., a monoclonal or polyclonal antibody, and fragments, homologs, analogs, and derivatives thereof.
- the invention also includes a pharmaceutical composition including NOVX antibody and a pharmaceutically acceptable carrier or diluent.
- the invention is also directed to isolated antibodies that bind to an epitope on a polypeptide encoded by any of the nucleic acid molecules described above.
- the invention also includes kits comprising any of the pharmaceutical compositions described above.
- the invention further provides a method for producing a NOVX polypeptide by providing a cell containing a NOVX nucleic acid, e.g., a vector that includes a NOVX nucleic acid, and culturing the cell under conditions sufficient to express the NOVX polypeptide encoded by the nucleic acid.
- the expressed NOVX polypeptide is then recovered from the cell.
- the cell produces little or no endogenous NOVX polypeptide.
- the cell can be, e.g., aprokaryotic cell or eukaryotic cell.
- the invention is also directed to methods of identifying a NOVX polypeptide or nucleic acid in a sample by contacting the sample with a compound that specifically binds to the polypeptide or nucleic acid, and detecting complex formation, if present.
- the invention further provides methods of identifying a compound that modulates the activity of a NOVX polypeptide by contacting a NOVX polypeptide with a compound and determining whether the NOVX polypeptide activity is modified.
- the invention is also directed to compounds that modulate NOVX polypeptide activity identified by contacting a NOVX polypeptide with the compound and determining whether the compound modifies activity of the NOVX polypeptide, binds to the NOVX polypeptide, or binds to a nucleic acid molecule encoding a NOVX polypeptide.
- the invention provides a method of determining the presence of or predisposition of a NOVX-associated disorder in a subject. The method includes providing a sample from the subject and measuring the amount of NOVX polypeptide in the subject sample. The amount of NOVX polypeptide in the subject sample is then compared to the amount of NOVX polypeptide in a control sample.
- An alteration in the amount of NOVX polypeptide in the subject protein sample relative to the amount of NOVX polypeptide in the control protein sample indicates the subject has a tissue proliferation-associated condition.
- a control sample is preferably taken from a matched individual, i.e., an individual of similar age, sex, or other general condition, but who is not suspected of having a tissue proliferation- associated condition.
- the control sample may be taken from the subject at a time when the subject is not suspected of having a tissue proliferation-associated disorder.
- the NOVX is detected using a NOVX antibody.
- the method includes providing a nucleic acid sample, e.g., RNA or DNA, or both, from the subject and measuring the amount of the NOVX nucleic acid in the subject nucleic acid sample.
- the amount of NOVX nucleic acid sample in the subject nucleic acid is then compared to the amount of a NOVX nucleic acid in a control sample.
- An alteration in the amount of NOVX nucleic acid in the sample relative to the amount of NOVX in the control sample indicates the subject has a NOVX- associated disorder.
- the invention provides a method of treating or preventing or delaying a NOVX-associated disorder.
- the method includes administering to a subject in which such treatment or prevention or delay is desired a NOVX nucleic acid, a NOVX polypeptide, or a NOVX antibody in an amount sufficient to treat, prevent, or delay a NOVX- associated disorder in the subject.
- NOV1-12 are homologous to members of the odorant receptor (OR) family of the human G-protein coupled receptor (GPCR) superfamily of proteins, as shown in Table 56.
- OR odorant receptor
- GPCR human G-protein coupled receptor
- Olfactory receptors are the largest family of G-protein-coupled receptors
- GPCRs GPCRs and belong to the first family (Class A) of GPCRs, along with catecholamine receptors and opsins.
- the OR family contains over 1,000 members that traverse the phylogenetic spectrum from C. elegans to mammals. ORs most likely emerged from prototypic GPCRs several times independently, extending the structural diversity necessary both within and between species in order to differentiate the multitude of ligands. Individual olfactory sensory neurons are predicted to express a single, or at most a few, ORs. All ORs are believed to contain seven ⁇ -helices separated by three extracellular and three cytoplasmic loops, with an extracellular amino-terminus and a cytoplasmic carboxy-terminus.
- the pocket of OR ligand binding is expected to be between the second and sixth transmembrane domains of the proteins.
- Overall amino acid sequence identity within the mammalian OR family ranges from 45% to >80%, and genes greater than 80% identical to one another at the amino acid level are considered to belong to the same subfamily. Since the first ORs were cloned in 1991, outstanding progress has been made into their mechanisms of action and potential dysregulation during disease and disorder. It is understood that some human diseases result from rare mutations within GPCRs. Drug discovery avenues could be used to produce highly specific compounds on the basis of minute structural differences of OR subtypes, which are now being appreciated with in vivo manipulation of OR levels in transgenic and knock-out animals.
- OR proteins bind odorant ligands and transmit a G-protein-mediated intracellular signal, resulting in generation of an action potential.
- the accumulation of DNA sequences of hundreds of OR genes provides an opportunity to predict features related to their structure, function and evolutionary diversification. See Pilpel Y, et.al., Essays Biochem 1998;33:93- 104.
- the OR repertoire has evolved a variable ligand-binding site that ascertains recognition of multiple odorants, coupled to constant regions that mediate the cAMP-mediated signal transduction.
- the cellular second messenger underlies the responses to diverse odorants through the direct gating of olfactory-specific cation channels. This situation necessitates a mechanism of cellular exclusion, whereby each sensory neuron expresses only one receptor type, which in turn influences axonal projections.
- a 'synaptic image' of the OR repertoire thus encodes the detected odorant in the central nervous system.
- ORs odorant receptors
- ORs are expressed by nasal olfactory sensory neurons, and each neuron expresses only 1 allele of a single OR gene.
- different sets of ORs are expressed in distinct spatial zones. Neurons that express the same OR gene are located in the same zone; however, in that zone they are randomly interspersed with neurons expressing other ORs.
- the cell chooses an OR gene for expression, it may be restricted to a specific zonal gene set, but it may select from that set by a stochastic mechanism.
- Proposed models of OR gene choice fall into 2 classes: locus-dependent and locus-independent.
- Locus-dependent models posit that OR genes are clustered in the genome, perhaps with members of different zonal gene sets clustered at distinct loci. In contrast, locus-independent models do not require that OR genes be clustered.
- OR genes have been mapped to 11 different regions on 7 chromosomes. These loci lie within paralogous chromosomal regions that appear to have arisen by duplications of large chromosomal domains followed by extensive gene duplication and divergence. Studies have shown that OR genes expressed in the same zone map to numerous loci; moreover, a single locus can contain genes expressed in different zones.
- Issel-Tarver and Rine characterized 4 members of the canine olfactory receptor gene family.
- the 4 subfamilies comprised genes expressed exclusively in olfactory epithelium. Analysis of large DNA fragments using Southern blots of pulsed field gels indicated that subfamily members were clustered together, and that two of the subfamilies were closely linked in the dog genome. Analysis of the four olfactory receptor gene subfamilies in 26 breeds of dog provided evidence that the number of genes per subfamily was stable in spite of differential selection on the basis of olfactory acuity in scent hounds, sight hounds, and toy breeds.
- Issel-Tarver and Rine performed a comparative study of four subfamilies of olfactory receptor genes first identified in the dog to assess changes in the gene family during mammalian evolution, and to begin linking the dog genetic map to that of humans.
- These four families were designated by them OLF1, OLF2, OLF3, and OLF4 in the canine genome.
- the subfamilies represented by these four genes range in size from 2 to 20 genes. They are all expressed in canine olfactory epithelium but were not detectably expressed in canine lung, liver, ovary, spleen, testis, or tongue.
- the OLF1 and OLF2 subfamilies are tightly linked in the dog genome and also in the human genome.
- the smallest family is represented by the canine OLF1 gene.
- dog gene probes individually to hybridize to Southern blots of genomic DNA from 24 somatic cell hybrid lines. They showed that the human homologous OLF1 subfamily maps to human chromosome 11. The human gene with the strongest similarity to the canine OLF2 gene also mapped to chromosome 11. Both members of the human subfamily that hybridized to canine OLF3 were located on chromosome 7. It was difficult to determine to which chromosome or chromosomes the human genes that hybridized to the canine OLF4 probe mapped. This subfamily is large in mouse and hamster as well as human, so the rodent background largely obscured the human cross-hybridizing bands.
- Issel-Tarver and Rine demonstrated that in the human OLF1 and OLF2 homologs are likewise closely linked. By studying YACs, Issel-Tarver and Rine (1997) found that the human OLF3 homolog maps to 7q35.
- a chromosome 19-specific cosmid library was screened by hybridization with the canine OLF4 gene probe, and clones that hybridized strongly to the probe even at high stringency were localized to 19pl3.1 and 19pl3.2. These clones accounted, however, for a small fraction of the homologous human bands. Rouquier et al. (1998) demonstrated that members of the olfactory receptor gene family are distributed on all but a few human chromosomes.
- OR sequences reside at more than 25 locations in the human genome. Their distribution was biased for terminal bands of chromosome arms. Flow-sorted chromosomes were used to isolate 87 OR sequences derived from 16 chromosomes. Their sequence relationships indicated the inter- and intrachromosomal duplications responsible for OR family expansion. Rouquier et al. (1998) determined that the human genome has accumulated a striking number of dysfunctional copies: 72% of these sequences were found to be pseudogenes. ORF-containing sequences predominate on chromosomes 7, 16, and 17.
- telomere a subtelomeric DNA duplication that provided insight into the variability, complexity, and evolutionary history of that unusual region of the human genome, the telomere.
- OR olfactory receptor
- ORs odorant receptor
- Buck and Axel (1991) discovered this large family of genes encoding putative odorant receptor genes. Zhao et al. (1998) provided functional proof that one OR gene encodes a receptor for odorants.
- the isolation of OR genes from the rat by Buck and Axel (1991) was based on three assumptions. First, ORs are likely G protein-coupled receptors, which characteristically are 7-transmembrane proteins. Second, ORs are likely members of a multigene family of considerable size, because an immense number of chemicals with vastly different structures can be detected and discriminated by the vertebrate olfactory system. Third, ORs are likely expressed selectively in olfactory sensory neurons. Ben-Arie et al.
- the human OR genes differ markedly from their counterparts in other species by their high frequency of pseudogenes, except the testicular OR genes. Research showed that individual olfactory sensory neurons express a small subset of the OR repertoire. In rat and mouse, axons of neurons expressing the same OR converge onto defined glomeruli in the olfactory bulb.
- the present invention generally relates to novel proteins encoded by genomic DNA sequences and proteins similar to them, namely, new proteins bearing sequence similarity to GPCRs, nucleic acids that encode these proteins or fragments thereof, and antibodies that bind immunospecifically to a protein of the invention. Included in the invention are the novel nucleic acid sequences and their polypeptides.
- NOVX nucleic acids or “NOVX polynucleotides” and the corresponding encoded polypeptides are referred to as “NOVX polypeptides” or “NOVX proteins.” Unless indicated otherwise, “NOVX” is meant to refer to any of the novel sequences disclosed herein.
- Table 1 provides a summary of the NOVX nucleic acids and their encoded polypeptides. Example 1 provides a description of how the novel nucleic acids were identified.
- NOVX nucleic acids and their encoded polypeptides are useful in a variety of applications and contexts.
- the various NOVX nucleic acids and polypeptides according to the invention are useful as novel members of the protein families according to the presence of domains and sequence relatedness to previously described proteins. Additionally, NOVX nucleic acids and polypeptides can also be used to identify proteins that are members of the family to which the NOVX polypeptides belong.
- NOV1 through NOV12 are homologous to members of the GPCR family of proteins that are important in maintaining G-protein mediated signal transduction.
- the NOV1 nucleic acids, polypeptides, antibodies and related compounds according to the invention will be useful in therapeutic and diagnostic applications in disorders characterized by G-protein signaling, e.g., bacterial, fungal, protozoal and viral infections, pain, cancer, anorexia, bulimia, asthma, and Parkinson's disease.
- the NOVX nucleic acids and polypeptides can also be used as immunogens to produce antibodies specific to the invention, and to screen for molecules, which inhibit or enhance NOVX activity or function.
- a NOVl sequence according to the invention includes a nucleic acid sequence encoding a polypeptide related to the GPCR family of proteins.
- a NOVl nucleic acid is found on human chromosome 11.
- a NOVl nucleic acid and its encoded polypeptide includes the sequences shown in Table 2A.
- the disclosed nucleic acid (SEQ ID NO.: 1) is 978 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 21-23 and ends with a TAA stop codon at nucleotides 954-956.
- a putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 2A, and the start and stop codons are in bold letters.
- the representative ORF encodes a 311 amino acid polypeptide (SEQ ID NO. : 2) with a predicted molecular weight of 34796.5 daltons (Da).
- PSORT analysis of a NOVl polypeptide predicts a plasma membrane protein with a certainty of 0.6400 and an endoplasmic reticulum membrane protein with a certainty of 0.6850.
- SIGNALP analysis suggests the presence of a signal peptide with the most likely cleavage site occuring between positions 55 and 56 in SEQ ID NO.: 2.
- a NOVl nucleic acid has homology (67% identity) to a Mus musculus GPCR mRNA 15 (MUSI; GENBANK-ID: AF121979), as is shown in Table 2B.
- a NOVl polypeptide also has homology (63% identity, 80% similarity) with the 318 amino acid residue protein from Mus musculus (MUS2; SPTREMBL-ACC: Q9WU93), as is shown in Table 2C.
- NOVl expression was analyzed by TaqMan analysis. Results shown in Example 4, Table 14C demonstate that NOVl expression is higher in lung cancer (small cell), colon cancer, ovarian cancer, prostate cancer and uterine cancer as compared to normal tissue.
- a NOV2 sequence according to the invention includes a nucleic acid sequence encoding a polypeptide related to the GPCR family of proteins.
- a NOV2 nucleic acid is found on human chromosome 11.
- a NOV2 nucleic acid and its encoded polypeptide include the sequences shown in Table 3 A.
- the disclosed nucleic acid (SEQ ID NO.: 3) is 983 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 21-23 and ends with a TAA stop codon at nucleotides 960-962.
- a putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 3A, and the start and stop codons are in bold letters.
- the representative ORF encodes a 313 amino acid polypeptide (SEQ ID NO.: 4) with a predicted molecular weight of 35077.8 Da.
- PSORT analysis of a NOV2 polypeptide predicts a plasma membrane protein with a certainty of 0.600. Using SIGNALP analysis, it is predicted that a NOV2 polypeptide has no signal peptide.
- a NOV2 polypeptide has homology (51% identity, 70% similarity) with a 319 amino acid residue olfactory receptor-like protein from Gallus gallus (GALl ; SPTREMBL-ACC: Q9YH55), as shown in Table 3C.
- a NOV2 polypeptide also has homology (46% identity, 67% similarity) to a HOR 5'BETA3 polypeptide from Homo sapiens (HORl; SPTREMBL-ACC: Q9Y5P1), as is shown in Table 3D.
- NOV2 201 TCACCACCTTCTTCTTGGTTGGGATGCCAGGGCTAGAATATGCACACATCTGGATCTCTA 260
- NOV2 261 TCCCCATCTGCAGCATGTATCTTATTGCTATTCTAGGAAATGGCACCATTCTTTTTATCA 320
- NOV2 321 TCAAGACAG-AGC-CCTCCTTGCATGGGCCCATGTACTATTTTCTTTCCATGTTGGCTAT 378
- GALl 29158 TGA-GAGTGCATCGCCAGCTC-CACCAGCCCATGTACTATTTCCTTTTGATGCTGGCCAC 29215
- GALl ' 29216 CACAGACCTGGGCCTGACTCTGTCCACCCTGCCCACCGTTCTGCGCGTCTTCTGGTTGGG 29275
- GALl 29276 TGCCATGGAAATCAGCTTCCCC-GCCTGCCTCATCCAGATGTTCTGCATCCATGTCTTTT 29334
- NOV2 498 CAGTACTGGAGTCCTCAGTCCTCCTGATCATGTCATTTGATAGATTCCTAGCCATCCACA 557
- GALl 29335 CCTTCATGGAGTCCTCAGTGCTCCTGGCCATGGCCTTTGATCGCTATGTGGCCATCTGCT 29394
- NOV2 558 ATCCTCTGAGATACACCTCAATCCTGACAACTGTCAGAGTTGCCCAAATAGGGATAGTAT 617
- GALl 29395 GCCCGCTGAGGTACTCCTCCATCCTCACTGGTGCCAGGGTTGCACAGATTGGACTGGGGA 29454
- GALl 29455 TCATCTGCC-GATGCACACTGTCACTTCTCCCATTAATCTGCCTCCTGACGTGGCT-GCC 29512
- NOV2 676 ATATTGCAAGAAAAACCAATTATCCCATTCCTACTGTCTCCACCAGGATGTCATGAAGT- 734
- GALl 29631 -ATCCTGGACTTTGTTCTCATTGCGTTGTCCTACATCATGATCTTTAGGACTGTGCTAGG 29689
- N0V2 853 AATTGCATCCAAAAAGGAGGAGCTTAAGGCTCTCAATACTTGTGTTTCACACATCTGTGC 912
- GALl 29690 CATCACCTCCAAAGAGGAGCAGACCAAAGCCCTAAACACTTGTGTCTCTCACTTCTGTGC 29749
- NOV2 913 AGTGATCATCTTCTACCTGCCCATCATCAAC-CTGGCCGTTGTCCACCGCTTTGCCGGGC 971 II IN I
- GALl 29750 CGTCCTCATCTTCTACAT-CCCTTTGGCTGGGCTGTCCATTATACACCGGTATGGAAGGA 29808
- GALl 29809 ATGCCCCACCTATTAGCCATGCTGTCATGGCCAATGT-CTACCTCTTTGTCCCACCTATA 29867 NOV2: 1031 ATGAAACCAATTGTTTATTGTGTAAAAACTAA 1062 (SEQ ID NO.: 31)
- OLR1 252 IPLAGLSIIHRYGRNAPPISHAVMANVYLFVPPILNPVLYSMKSKAICKGLLRLLCQ 308 NOV2 (SEQ ID NO. : 33) OLR1 (SEQ ID NO. : 34)
- NOV2 74 GLSLSSLPTVLSIFLFNAPETSSSACFAQEFFIHGFSVLESSVLLIMSFDRFLAIHNPLR 133
- HORl 70 MVTLTTMPTVMGIL VNHREISSVGCFLQAYFIHSLSVVESGSLLAMAYDRFIAIRNPLR 129 NOV2: 134 YTSILTTVRVAQIGIVFSFKSMLLVLPFPFTLRSLRYCKKNQLSHSYCLHQDVMKLACSD 193 I I I I I + 1 + + + + 1 1 I I I I + ++ ++ M M ++ I + M l + l
- HORl 190 ITFNRLYPVILISLTIFLDSLIILFSYILILNTVIGIASGEERAKALNTCISHISCVLIF 249 NOV2 254 YLPIINLAVVHRFAGHVSPLINVLMANVLLLVPPLMKPIVYCVKTKQIRVRVVAKL 309
- SNP single nucleotide polymorphic
- TTA 241 GCTGCTCCTTTTTGGATGCAATTCCCGGTACAGTCTTGAGGATCAGGGTGTA ⁇ GACACAGCAATGAGA ⁇ TAAAGTC
- NOV2 expression was analyzed by TaqMan analysis. Results shown in Example 4, Table 15B demonstate that NOV2 expression is higher in lung cancer (small cell) as compared to normal tissue.
- a NOV3 sequence according to the invention includes a nucleic acid sequence encoding a polypeptide related to the GPCR family of proteins.
- a NOV3 nucleic acid is found on human chromosome 11.
- a NOV3 nucleic acid and its encoded polypeptide includes the sequences shown in Table 4A.
- the disclosed nucleic acid (SEQ LD NO.: 5) is 980 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 25-27 and ends with a TAA stop codon at nucleotides 964-966.
- a putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 4A, and the start and stop codons are in bold letters.
- the representative ORF encodes a 313 amino acid polypeptide (SEQ ID NO.: 6) with a predicted molecular weight of 35255.9 Da.
- PSORT analysis of aNOV3 polypeptide predicts aplasma membrane protein with a certainty of 0.6000. Using SIGNALP analysis, it is predicted that a NOV3 polypeptide has no signal peptide.
- a NOV3 nucleic acid has homology (61% identity) to a Homo sapiens GPCR mRNA (GPCR; patn: T59274), as is shown in Table 4B.
- a NOV3 polypeptide has homology (53% identity, 72%> similarity) with a 319 amino acid residue olfactory receptor-like protein from Gallus gallus (GALl; SPTREMBL-ACC: Q9YH55), as is shown in Table 4C. Additional homology (46% identity, 69% similarity) to a HOR 5'BETA3 polypeptide from Homo sapiens (HORl; SPTREMBL-ACC: Q9Y5P1) was also identified, as is shown in Table 4D.
- NOV3 expression was analyzed by TaqMan analysis. The sequence is moderately expressed in many tissues; it is slightly higher in brain regions, especially cerebral cortex, indicating a utility as a marker to identify neuronal derived tissues and cells, as shown in Example 4 at Table 16B.
- a NOV4 sequence according to the invention includes a nucleic acid sequence encoding a polypeptide related to the GPCR family of proteins.
- a NOV4 nucleic acid is found on human chromosome 11.
- a NOV4 nucleic acid and its encoded polypeptide include the sequences shown in Table 5 A.
- the disclosed nucleic acid (SEQ ID NO.: 7) is 952 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 6-8 and ends with a TAA stop codon at nucleotides 945-947.
- a putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 5 A, and the start and stop codons are in bold letters.
- the representative ORF encodes a 313 amino acid polypeptide (SEQ ID NO.: 8) with a predicted molecular weight of 35077.8 Da.
- PSORT analysis of a NOV4 polypeptide predicts a plasma membrane protein with a certainty of 0.6000. Using SIGNALP analysis, it is predicted that a NOV4 polypeptide has no signal peptide.
- a NOV4 nucleic acid was cloned according to the method in Example 2.
- a NOV4 nucleic acid has homology (64% identity) to a Homo sapiens olfactory receptor mRNA (OLR2; GENBANK-ID: HPFH6OR/acc: X81445), as is shown in Table 5B.
- a NOV4 polypeptide has homology (51% identity, 71% similarity) with an olfactory receptor- like protein from Gallus gallus (GALl ; SPTREMBL-ACC: Q9YH55), as is shown in Table 5C.
- the global sequence homology (as defined by FASTA alignment with the full length sequence of this protein) is 49.518 % amino acid identity and 60.450 % amino acid similarity.
- this protein contains the following protein domains: 7 transmembrane receptor (rhodopsin family) (IPR000276) from amino acid residues 3 to 222 (as defined by Interpro).
- OLR2 1433 TCACCATGACGTTT-TCAA-ACGTTCCATAACATTCACACCTACAACATTCA-CTCTCGT 1489
- OLR2 1490 TGGCATCCCGGGACTGGAGGCAGAACATTATGTGGATATCCATCCCCTTCTGCCTGATAT 1549
- OLR2 1550 ACACCATCATCT-TTCCGGGAAATGGCATCATTCTTCACATCATCCGAATTGACTCTTCC 1608
- OLR2 1609 TTGCACCAACCCATGTACTATTTTCTGGCCATGCCGGCCTTTGTTGAACTTGG-TGTCTC 1667 NOV4: 233 TTTATCATCTCTGCCCACTGTGTTAAGCATCTTCCTGTTCAATGCTCCTGAAACTTCATC 292
- OLR2 1668 TGCTTCCACCATGCCCACTGTGTTAAGCATATTCCTCTTTGGCATTAACGATGTCAGTTT 1727
- NOV4 293 CAATGCCTGCTTTGC-CCAGGAATTCTTC-ATTCATGGATTCTCAGTACTGGAGTCCTCA 350
- OLR2 1728 TGGTGGTTGCCT-GCTCCAGATGTT-TTCTATGCACTCTTTCACTCTTATGGAGTCAGGT 1785
- OLR2 1786 GTCCTTCTGGCAATGTCAGTGGACCGCTTTGTGGCCATCTACAGCCCACTGCGCTACACA 1845
- NOV4 411 TCAATCCTGACAACTGTCAGAGTTGCCCAAATAGGGATAGT-ATTCTCCTTTAAGAGCAT 469
- OLR2 1846 ACCATTCTGACAATTGCCTGCATTTCTGGGATGGGTGCCGCCATTG-CCTTGCGCAGTGT 1904
- NOV4 470 GCTCCTGGTTCTTCC-CTTCCCTTTCACTTTAAGAAGCTTGAGATAT-TG-CAAGAAAAA 526
- OLR2 1905 AATGCTTATGCTCCCACTGCTCTTTCTCCTGAGGCGTCTGCCTTTCTGTGGCCACAATAC 1964
- NOV4 527 CCAATTATCCCATTCCTACTGTCTCCAC-CAGGATGTCATGAAGTTGGCCTGTTCTGACA 585
- NOV4 586 ACA-GAATTGATGTTATCTATGGCTTT-TTTGG-AGCACTCTGC-CTTATGG—TAGACT 639
- OLR2 2021 -CACGCCCCAATAGCATCC-TGGCTCTATTTGTCATTAC-CTTCACATTTGGACTGGACT 2077
- NOV4 640 TTATTCT-CATTGCTGTGTCTTACACCCTGATCCTCAAGACTGTACCGGGAATTGCATCC 698
- OLR2 2078 T-ATTGTTCATTGTGGTTTCTTATGTGCTGATTCTTCATACAGTACTGGAAATAGCTTCT 2136
- NOV4 699 AAAA-AGGAGCAGCTTAAGGCTCTCAATACTTGTGTTTCACACATCTGTGCAGTGATCAT 757
- OLR2 2137 GGAGCAGG-GC-GTGGCAGGCACTCAACACATGTGTGTCGCACATATGTGCTGTGCTTGT 2194
- NOV4 758 CTTCTACCTGCCCATCATCAACCTGGCCGTTGTCCACCGCTTTGCCCGGCATGTCTCTCC 817
- OLR2 2195 GTACTATGTGCCCATGATCAGCCTCTCC-TGATGCACCGCTTTGGACGGCATTTACCTCC 2253
- NOV4 818 CCTCATTAATGTTCTCATGGCAAATGTTCTCCTACTTGTA-CCTCCGCTGATGAAACCAA 876
- OLR2 2254 ACTTTTCCAGACTGTCACGGCCAATGCTTACCT-CTTCTTTCCTCCTGTGGTCAACCCCA 2312
- OLR2 2313 TTGTCTATAGTATCAAAATCAAAGAAATTCGCAACAGCGTTGT 2355 (SEQ ID NO. 47)
- GALl 12 FLLAGLPGMAQFHH VFLPFGLMYLVAVLGNGTILLVVRVHRQLHQPMYYFLLMLATTDL 71 N0V4 225 GLSLSSLPTVLSIFLFNAPETSSNACFAQEFFIHGFSVLESSVLLIMSFDRFLAIHNPLR 404
- the possible novel SNP variants of NOV4 are shown in Table 5D.
- the PHRED score indicates the SNP base pair quality, where a minimum score of 23 is acceptable.
- the method of identifying and confirming novel SNPs is described in Example 3.
- NOV4 expression was analyzed by TaqMan analysis. Results are shown in Example 4,
- Table 14C demonstate that NOVl expression is higher in lung cancer (small cell), colon cancer, ovarian cancer, prostate cancer and uterine cancer as compared to normal tissue.
- PCR probe/primer sets generated against GPCRs amplify the corresponding genomic region because GPCRs are single exon genes, as shown in Example 4 at Table 16B.
- the sequence is moderately expressed in many tissues; it is slightly higher in brain regions, especially cerebral cortex, indicating a utility as a marker to identify neuronal derived tissues and cells.
- a NOV5 sequence according to the invention includes a nucleic acid sequence encoding a polypeptide related to the GPCR family of proteins.
- a NOV5 nucleic acid is found on human chromosome 11.
- a NOV5 nucleic acid and its encoded polypeptide include the sequences shown in Table 6A.
- the disclosed nucleic acid (SEQ ID NO.: 9) is 885 nucleotides in length and contains an open reading frame (ORF) that begins with a GGG codon at nucleotides 2-4, which codes for the amino acid Glycine, and ends with a TAA stop codon at nucleotides 881-883.
- a putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 6A, and the start and stop codons are in bold letters.
- the representative ORF encodes a 293 amino acid polypeptide (SEQ ID NO.: 10).
- PSORT analysis of a NOV5 polypeptide predicts a plasma membrane protein with a certainty of 0.6400.
- SIGNALP analysis suggests the presence of a signal peptide with the most likely cleavage site occuring between positions 33 and 34 in SEQ LD NO.: 10.
- the reverse complement (SEQ ID NO. 47) of a NOV5 nucleic acid sequence (SEQ LD NO. 9) has high homology (98% identity) with a nucleic acid encoding a human olfactory receptor-like polypeptide (HUMl ; : SeqCalling Accession No. : 150205708), as is shown in Table 6B.
- HUMl human olfactory receptor-like polypeptide
- a NOV5 polypeptide was found to have homology (52% identity, 72% similarity) to a Gallus gallus olfactory receptor-like protein COR3 ⁇ ETA (GALl; SPTREMBL-ACC: Q9YH55), as is shown in Table 6C.
- NOV5 765 ACATTAATGAGGGGAGAGACATGCCGGGCAAAGCGGTGGACAACGGCCAGGTTGATGATG 706
- HUMl 304 ATGAGAATAAAGTCTACCATAAGGCAGAGTGCTCCAA ⁇ A ⁇ A ⁇ GCCATAGATAACATCAAT 363
- HUMl 424 TTGGTTTTTCTTGCAATATCTCAAGTTTCTTAAAGTGAA ⁇ GGGAAGGGAAGAACCAGGAG 483
- HUMl 604 TGAGGACTCCAGTACTGAGAATCCATGAATGAAGAATTCCTGGGCAAAGCAGGCATTGGA 663
- HUMl 724 CAAACCCAAGTCTGACATAGCCAACATGGAA ⁇ GAAAATAGTACATGGGCTCATGCAAGGA 783
- HUMl 844 GCTGCAGATGGGGATAGAGATCCAGATGTGTGCATATTCTAGCCC 888 (SEQ ID NO. 51)
- GALl (SEQ ID NO. 52)
- a NOV6 sequence according to the invention includes a nucleic acid sequence encoding a polypeptide related to the GPCR family of proteins.
- a NOV6 nucleic acid is found on human chromosome 11.
- a NOV6 nucleic acid and its encoded polypeptide include the sequences shown in Table 7A.
- the disclosed nucleic acid (SEQ D NO.: 11) is 798 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 24-26 and ends with a TGA stop codon at nucleotides 780-782.
- a putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 7A, and the start and stop codons are in bold letters.
- the representative ORF encodes a 252 amino acid polypeptide (SEQ ID NO.: 12) with a predicted molecular weight of 28399.4 Da.
- PSORT analysis of a NOV6 polypeptide predicts a plasma membrane protein with a certainty of 0.6400.
- SIGNALP analysis suggests the presence of a signal peptide with the most likely cleavage site occuring between positions 61 and 62 in SEQ ID NO.: 12.
- a NOV6 nucleic acid has homology (67% identity) with a Mus musculus GPCR mRNA (MUS3; GENBANK-LD: AF102539), as is shown in Table 7B.
- a NOV6 polypeptide has homology (59% identity, 74% similarity) with a 223 amino acid residue olfactory receptor protein bom Mus musculus (OLR3; SPTREMBL-ACC: Q9Z1T8), as is shown in Table 7C.
- this protein contains a seven transmembrane receptor domain (rhodopsin family) (LPR000276) from amino acid residues 1 to 232 (as defined by Interpro).
- a NOV7 sequence according to the invention includes a nucleic acid sequence encoding a polypeptide related to the GPCR family of proteins.
- a NOV7 nucleic acid is found on human chromosome 11.
- a NOV7 nucleic acid and its encoded polypeptide include the sequences shown in Table 8 A.
- the disclosed nucleic acid (SEQ ID NO.: 13) is 995 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 21-23 and ends with a TAA stop codon at nucleotides 966-968.
- a putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 8A, and the start and stop codons are in bold letters.
- the representative ORF encodes a 315 amino acid polypeptide (SEQ ID NO.: 14) with a predicted molecular weight of 34934.2 Da.
- PSORT analysis of a NOV7 polypeptide predicts a plasma membrane protein with a certainty of 0.6000.
- SIGNALP analysis suggests the presence of a signal peptide with the most likely cleavage site occuring between positions 46 and 47 in SEQ ID NO.: 14.
- a NOV7 nucleic acid has homology (38% identity) with a Pan tro lodytes GPCR mRNA (PAN1; GENBANK-ID: AF101730), as is shown in Table 8B.
- ANOV7 polypeptide has homology (49% identity, 64% similarity) with an olfactory-like receptor protein from Homo sapiens (OLR3; SPTREMBL-ACC: CAB65799), as is shown in Table 8C.
- this protein contains a seven transmembrane receptor domain (rhodopsin family) (LPR000276) from amino acid residues 40 to 149 (as defined by Interpro).
- OLR3 361 GACCGCTATGTGGCCATCTGCTTCCCCCTGCACTACACCGCCATCATGAGCCCCATGCTC 420 NOV7 435 TGTGTC-CAGTTGATGGCTCTGTCCTGGCTCAACAGAGGGGCCTTGGGACTCTTGT-ACA 492
- NOV7 expression was analyzed by TaqMan analysis. Results are shown in Example 4, Table 17B, 17C and 17E. Tissue expression of NOV7 (AC026038_B) is overall at a low level in many tissues, as shown in Example 4 at Table 17B. The highest expression is seen in testis. Thus, NOV7 (AC026038_B) may be used as a marker for male germ cells and may have therapeutic applications in fertility disorders as a potential target. NOV7 (AC026038_B) is overexpressed in tumors derived from tissues responsive to steroid hormones- ovarian, uterine and prostate cancers as shown in Example 4 at Table 17C (Panel 2D). It is therefore a marker for cells, especially tumor cells responsive to steroid hormones.
- the protein can be used to screen candidate therapeutics for molecules able to modulate tumor growth, preferably small molecule therapeutic and human monoclonal antibodies.
- Tables 17C and 17E Panel 4D shows that Agl201 may have a potential role in inflammation, since NOV7 is expressed in activated basophils. Basophils are one of the key cell mediators of inflammation during asthma and allergy (lfnmunopharmacolo y 2000 Jul 25;48(3):269-81.
- Immunologically mediated signaling in basophils and mast cells finding therapeutic targets for allergic diseases in the human Fcvar epsilonRl signaling pathway. Oliver JM, Kepley CL, Ortega E, Wilson BS.). This molecule may be important in allowing these cells to extravasate into the site of inflammation and/or in the activation of these cells.
- Antibody therapeutics to Agl201 may inhibit nasal and lung inflammation due to basophil activation and effectively reduce or eliminate symptoms of asthma, emphysema, and allergic rhinitis.
- the high affinity IgE receptor, Fcvar epsilon RI plays key roles in an array of acute and chronic human allergic reactions including asthma, allergic rhinitis, atopic dermatitis, urticaria and anaphylaxis. In humans and rodents, this receptor is found at high levels on basophils and mast cells where its activation by IgE and multivalent antigen produces mediators and cytokines responsible for Fcvar epsilon Rl-dependent acute inflammation. Mast cells can additionally contribute to sustained inflammatory responses by internalizing antigen bound to IgE-Fcvar epsilon RI complexes for processing to peptides and presentation to T cells.
- the Fcvar epsilon RI is also expressed, at lower density, on monocytes, macrophages and dendritic cells (DC), where its likely functions again include both signaling to mediator and cytokine production and antigen presentation.
- DC dendritic cells
- Antigen-stimulated Fcvar epsilon RI signaling may be limited by: (1) sequestering the Fcvar epsilon Rl-associated protein-tyrosine kinase, Lyn, that initiates FcvarepsilonRIsignaling; (2) eliminating; or (3) inactivating the protein-tyrosine kinase, Syk, that propagates FcvarepsilonRI signaling; and (4) establishing inhibitory crosstalk between Fcvar epsilon RI and a co-expressed receptor, FcgammaRII, that again limits Fc varepsilonRI- mediated Syk activation. These strategies may form the basis for new therapies for allergic inflammation.
- a NOV8 sequence according to the invention includes a nucleic acid sequence encoding a polypeptide related to the GPCR family of proteins.
- a NOV8 nucleic acid is found on human chromosome 11.
- a NOV8 nucleic acid and its encoded polypeptide include the sequences shown in Table 9A.
- the disclosed nucleic acid (SEQ ID NO.: 15) is 969 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 27-29 and ends with a TAA stop codon at nucleotides 951-953.
- a putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 9A, and the start and stop codons are in bold letters.
- the representative ORF encodes a 308 amino acid polypeptide (SEQ LD NO.: 16) with a predicted molecular weight of 33960.9 Da.
- PSORT analysis of a NOV8 polypeptide predicts a plasma membrane protein with a certainty of 0.6400.
- SIGNALP analysis suggests the presence of a signal peptide with the most likely cleavage site occuring between positions 41 and 42 in SEQ LD NO.: 16.
- a NOV8 nucleic acid has homology (71% identity) to a Rattus norvegicus GPCR mRNA (RAT1; GENBANK-ID: M64378) as is shown in Table 9B, and aNOV8 nucleic acid reverse complementary sequence has a high degree of homology (97% identity) to a nucleic acid encoding a human olfactory receptor-like polypeptide (HUM2; SeqCalling Accession No.:87740262) as is shown in Table 9C.
- RAT1 Rattus norvegicus GPCR mRNA
- HUM2 human olfactory receptor-like polypeptide
- a NOV8 polypeptide has homology (68% identity, 79%o similarity) to an olfactory-like receptor protein from Rattus norvegicus (OLR4; SPTREMBL-ACC: O95007), as is shown in Table 9D.
- the global sequence homology (as defined by GAP alignment with the full length sequence of this protein) is 67 % amino acid identity and 73 % amino acid similarity.
- this protein contains a seven transmembrane receptor domain (rhodopsin family) (LPR000276) from amino acid residue 41 to 290 (as defined by Interpro).
- I III I II I III II III II I III I II I I 11 II 1 1 I RAT1 420 TCCTGGGCTGGCGATGCGGTTGGCCCTGGGATCCTGGCTGTGTGGGTTTTCTG-CAATCA 478 NOV8 496 CAGTGCCCACAGCCCTCATCAGTGGCCTGTCCTTCTGTGGCCCCCGTGCCATCAACCACT 555
- RATl 896 ATGTCAAGGAAG-CTCTGC-GCAGGACGGTGAAGGGGAAGTGA 936 (SEQ ID NO. 62)
- NOV8 expression was analyzed by TaqMan analysis.
- a NOV8 nucleic acid is expressed in several tumor cell lines, including ovarian carcinoma OVCAR-8, and lung cancer (non-small cell) HOP-62, indicating a utility as a marker to identify tumor cells, preferably from ovarian and lung tumors, as shown in Example 4 at Table 18B.
- the protein can be used to screen for molecules able to modulate tumor growth, preferably small molecule therapeutics and human monoclonal antibodies.
- the expression in the adipose is tainted by genomic contamination.
- the expression in the testis indicates a utility to specifically identify male germ cells.
- a NOV9 sequence according to the invention includes a nucleic acid sequence encoding a polypeptide related to the GPCR family of proteins.
- a NOV9 nucleic acid is found on human chromosome 11.
- a NOV9 nucleic acid and its encoded polypeptide include the sequences shown in Table 10A.
- the disclosed nucleic acid (SEQ ID NO.: 17) is 936 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 5-7 and ends with a TAA stop codon at nucleotides 929-931.
- a putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 10A, and the start and stop codons are in bold letters.
- the representative ORF encodes a 308 amino acid polypeptide (SEQ ID NO.: 18).
- PSORT analysis of a NOV9 polypeptide predicts a plasma membrane protein with a certainty of 0.6400.
- SIGNALP analysis suggests the presence of a signal peptide with the most likely cleavage site occuring between positions 41 and 42 in SEQ LD NO.: 18.
- a NOV9 nucleic acid has a high degree of homology (98% identity) to a Gorilla gorilla olfactory receptor mRNA (GORl ; GENBANK-ID: AF179756
- a NOV9 polypeptide has homology (68%> identity, 79% similarity) to an olfactory-like receptor protein from Rattus norvegicus (OLR5; SWISSPROT-ACC: P23267), as is shown in Table IOC.
- this protein contains a seven transmembrane receptor domain (rhodopsin family) (1PR000276) from amino acid residues 41 to 290 (as defined by Interpro).
- a NOV10 sequence according to the invention includes a nucleic acid sequence encoding a polypeptide related to the GPCR family of proteins.
- a NOV10 nucleic acid is found on human chromosome 11.
- a NOV10 nucleic acid and its encoded polypeptide include the sequences shown in Table 11 A.
- the disclosed nucleic acid (SEQ LD NO.: 19) is 971 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 17-19 and ends with a TGA stop codon at nucleotides 950-952.
- a putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 11 A, and the start and stop codons are in bold letters.
- the representative ORF encodes a 311 amino acid polypeptide (SEQ LD NO.: 20) with a predicted molecular weight of 35147.4 Da.
- PSORT analysis of a NOV10 polypeptide predicts a plasma membrane protein with a certainty of 0.6000.
- SIGNALP analysis suggests the presence of a signal peptide with the most likely cleavage site occuring between positions 59 and 60 in SEQ ID NO.: 20.
- a NOV10 nucleic acid has homology (63% identity) to a Homo sapiens GPCR mRNA (GPCR2; GENBANK-LD: AL096770), as is shown in Table 1 IB.
- a NOV10 polypeptide has homology (51% identity, 68% similarity) to an olfactory receptor-like protein from Homo sapiens (OLR3; SPTREMBL-ACC: CAB65799), as is shown in Table 1 lC.
- the global sequence homology is 50.49% amino acid identity and 57.37% amino acid similarity.
- this protein contains a seven transmembrane receptor domain (rhodopsin family) (LPR000276) from amino acid residues 47 to 296 (as defined by Interpro).
- NOV10 779 AGAGTGTTACAACCACAAGATGTGGAATGCAGGTAGAAAATGTTTTTGATCTA-CCCTCC 721
- GPCR2 81387 AGAAGGTGGCTACAAATAGGTGTGGTAGGCAGGTGGAGAA-GACCTTGGTCCGGCCCTCA 81445
- NOV10 720 TTAGAAGGAATCCTCATGA-TGACAGAAAAAATGTACATGTAGGAGAGAGTAATT-ACAA 663
- NOV10 662 CAAAGGAGATTA-T-CACAAGAC-TTGTACCAAAAACCATGACTCCAATCTCAATGGT-A 607 n i i I I I I I I m i m i i n i i i m u m i i i
- GPCR2 81505 CAAAC-AGATAAATGCTGCAGACGTTGTGAATGCAGCCA-G—TGCAATCTCATTAATGA 81560
- NOV10 606 ATTACTTTGGGGTCTAAGAGGCTTAGGAGCTGTGGAATATTACAGAAAAATTGACGTATT 547
- NOV10 546 -CTATTGCGCCCACAGAATGGTAATGAGAATGTTGCTATCA-CATGCATGAATCCACAGA 489 n i ni m 11 mi mu m i 11 m mi 11 m m
- GPCR2 81620 ACTCTCTT-CCCACAGAGAGGTATGGAGAA-GTTAATGGCAGCATGCATGAGCCCAGAGA 81677 NOV10: 488 TCACCCCACTGAGCCACGACATGGCCATCA-TCC-T-CAGACAGACACCTTGGTTTATGA 432 i mi i in i ni i i mi i i i mi ni i i n i
- GPCR2 81678 GGCCCCCAGCAATCCAC-ACA-G-CTATCACTGCATGCCTACAGGCACGGGGATCCATAA 81734 NOV10: 431 TGACCTCATAATGTAAAGGCCGGCAGATGGCCATATAGCGGTCATAGGACATCACTGTAA 372
- GPCR2 81735 TAGTCTCATAATGAAGTGGTTGACAGATTGCTGCGTACCTGTCATAAGACATCACTGTGA 81794
- NOV10 371 GGATGGCTACCTCCGTAGTTGCCA-AGTCCATGAAAAAGAAGGCTTGCAGAGCACACCCA 313
- NOV10 312 AAGAAAGAAATGGAAGTATCATGAGTCAAG-GAACTAACAATAGATTTTGGAATTGTGAC 254
- NOV10 253 AGAGATGTAACAAAAATCTAAGAA-AGACAAGTTTCTCAAAAAGAAATACATTGGGGTTT 195 n i i i i i i i i m n n i i 1 1 i m i n i n m i i i n i
- GPCR2 81913 AGAGATGAAGCAGAGGTCCA-GAAGAGAGAGGTGCTTTAAAAAGTAATACATGGGGGAAT 81971 NOV10: 194 GGAGGTGAACATCCAGAGTGGTAAGTATGATGATTAGGAGATTTCCTATGACAGCTGCCA 135 GPCR2 81972 GGACGACGGTCCACGGTAATGATGGTGATAATGAGGAGGTTGCCTGTCAAGGCCAGCA 82031 NOV10 134 GGTAAACTAGGAAGAATAGAGCAGCATGTACAATCTGAATATCCCAGGAATTCGAAAATC 75 i m i i m m i in in m n i i II i mi i GPCR2 82032 GGTATGTCACCAGAAATACCAATGCATGTAAAATCTGAAGCTTACGCTCATCAGAAAACC 82091 NOV10 74 CCATGAGGAAAAATTCAGCAACTTCAGT 47 (SEQ ID NO. 71) III I 11 I III
- OLR3 3 NLTSMSGFLLMGFSDERKLQILHALVFLVTYLLALTGNLLIITIITVDRRLHSPMYYFLK 62
- OLR3 63 HLSLLDLCFISVTVPQSIANSLMGNGYISLVQCILQVFFFIALASSEVAILTVMSYDRYA 122
- OLR3 123 AICQPLHYETIMDPRACRHAVIAV IAGGLSGLMHAAINFSIPLCGKRVIHQFFCDVPQM 182
- OLR3 183 LKLACSYEFINEIALAAFTTSAAFICLISIVLSYIRIFSTVLRIPSAEGRTKVFSTCLPH 242
- NOV10 249 LVVVTLFMISGSIAYVKPISNSPPVLDVFLSAFYTWPPTLNPVIYSLRNRDMKAALRR 307
- OLR3 243 LFVATFFLSAAGFEFLRLPSDSSSTVDLVFSVFYTVIPPTLNPVIYSLRNDSMKAALRK 301
- NOV10 expression was analyzed by TaqMan analysis, as is shown in Table 19B.
- a NOVl 1 sequence according to the invention includes a nucleic acid sequence encoding a polypeptide related to the GPCR family of proteins.
- a NOVl 1 nucleic acid is found on human chromosome 11.
- a NOVl 1 nucleic acid and its encoded polypeptide include the sequences shown in Table 12A.
- the disclosed nucleic acid (SEQ ID NO.: 21) is 1010 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 37-39 and ends with a TAA stop codon at nucleotides 982-984.
- a putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 12A, and the start and stop codons are in bold letters.
- the representative ORF encodes a 315 amino acid polypeptide (SEQ ID NO.: 22) with a predicted molecular weight of 35620.1 Da.
- PSORT analysis of a NOVl 1 polypeptide predicts a plasma membrane protein with a certainty of 0.6000.
- SIGNALP analysis suggests the presence of a signal peptide with the two possible cleavage sites: one occuring between positions 49 and 50, and one between positions 59 and 60 in SEQ LD NO.: 22.
- a NOVl 1 nucleic acid has homology (88% identity) to a Homo sapiens GPCR mRNA (GPCR3; GENBANK-ID: AF065869), as is shown in Table 12B.
- a NOVl 1 polypeptide has homology (69%> identity, 81% similarity) to an odorant receptor protein Rattus norvegicus (ODOR1; SPTREMBL-ACC: G264618), as is shown in Table 12C.
- the global sequence homology (as defined by GAP alignment with the full length sequence of this protein) is 48% amino acid identity and 57% amino acid similarity.
- this protein contains a seven transmembrane receptor domain (rhodopsin family) (LPR000276) from amino acid residues 39 to 285 (as defined by Interpro). TABLE 12B.
- GPCR3 1 ATGAGACAGAATAATAATATTACAGAATTTGTCCTCCTGGGCTTCTCTCAGGATCTGGAT 60
- GPCR3 61 GTGCAAAAAGCATTATTTGTCATATTTTTACTCACATACTTGGTGACAGTGGTGGGGAAC 120
- GPCR3 121 CTGCTCATTGTGGTGACTATTATTACCAG-CCCTTCCTTGGGCTCCCCAATGTACTTCTT 179
- NOVll 216 CCTTGCCTGCCTGTCATTTATAGATGCTGTGTATTCCACCACCATTTCTCCTGTATTGAT 275
- GPCR3 180 CCTTGCCTGCCTGTCATTTATAGATGCTGCATATTCCACTACAATTTCTCCCAAATTGAT 239
- GPCR3 240 TGTAGACTTACTCTGTGATAAAAAGACTATTTCTTTCCCAGCTTGCATGGGCCAGTTATT 299
- NOVll 336 TATAGAGCACTTGTTTGGTGATACTGACGTCTTCCTTCTGGTGGTGATGGCCTATGATCG 395
- GPCR3 300 TATATACCACTTGTTTGGTGGTTCTGAGGTCTTCCTTCTTGTGGTGATGGCCTGTGATCA 359
- GPCR3 360 CTATGTGGCCATCTGTAAGCCACTGCACTATTTGACCATCATGAATCGACAGGTTTGAAT 419
- GPCR3 420 CCTTCTGTTGGTGGTGGTCGTGACTGGAGGTTTTCTGCATTCTGTTTCAAATTGTTGT 479
- GPCR3 480 TGTATACAGTCTCGCTTTCTGTGGCCCCAATGTCATTGACTACTTTGTCTGTGACATGTA 539
- NOVll 576 CCCTTTATTGGACCTGGAATGCACTGACACCTACTTCGTAGGCCTCGCTGTGGTTTTCAA 635
- GPCR3 540 CCCATTATTGGAACTGGTATGCACTGACACCTACTTTATTGGCCTTACTGTTTTTGTCAA 599
- GPCR3 600 TGGTGGAACAATCTGTATAGTCGTCTTCACCCTTCTACTAATCTCCTATGGAGTCATCCT 659
- GPCR3 660 AAACTCCCTTAAAACTTACAGTCAAGAAGGGAGGCATAAAG-TCCTGTTTACCTGCAGCT 718
- GPCR3 719 CCCACATTATCGTCTTTGCCCTCTTTTTTGTTCCCTGTATTTTCATGTATGTTAGACCTG 778
- NOVll 815 TTTCAAACTTTCCTATTGATAAATTCCTGACTGTGTTTTATTCAGTTATCACACCCAAGT 874
- GPCR3 838 TGAATCCTTTAATATACACATTGAGAAATTCAGAGATGAGAAATTCTGTAGAAACACTCT 897
- NOVll 1 MRQNNNITEFVLLGFSQYPDVQNALFVMFLLIYIVTMVGNLLIVVSIIASPFLGSPVYFF 60
- ODOR1 1 MGENNNITEFILLGLTQDPDGRKALFVIFFLIYIVTMMGNLLIVVTVIASPSLGSPMYFF 60
- ODOR1 61 LASLSLLDALFSTAISPKLIADLLYDQKTISFRACMSQLFIEHLFGGVDIVILVAMAYDR 120
- NOVll 121 YVATCKPLRYLTIMNRQVCILLLWAVTGGFLHSVFQILVVYSLPFCGPNVIYHFFCNIY 180
- ODOR1 121 YVAICKPLHYLAIMNRRVCITLLIFAWTGGFTHSLIQIVFVYNLPFCGPNVIDHFICDMS 180
- ODOR1 181 PLLVLACTDTYFIGLTVIANGGVNCIVIFTLLLGSYGIILRSLKTQSQEGRRKALSTCSS 240
- ODOR1 241 HILVVILFFVPCIFMYARPVYNFPIDKCITVFYTIITPMLNPLIYTLRNSEIKSCMKKL 299
- ODOR1 (SEQ ID NO. 78)
- a NOVl 2 sequence according to the invention includes a nucleic acid sequence encoding a polypeptide related to the GPCR family of proteins.
- a NOV12 nucleic acid is found on human chromosome 11.
- a NOV12 nucleic acid and its encoded polypeptide include the sequences shown in Table 13A.
- the disclosed nucleic acid (SEQ LD NO.: 23) is 988 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 23-25 and ends with a TAA stop codon at nucleotides 959-961.
- a putative untranslated region upstream from the initiation codon and downstream from the termination codon is underlined in Table 13 A, and the start and stop codons are in bold letters.
- the representative ORF encodes a 312 amino acid polypeptide (SEQ ID NO.: 24) with a predicted molecular weight of 35354.0 Da.
- PSORT analysis of a NOV12 polypeptide predicts a plasma membrane protein with a certainty of 0.6000.
- SIGNALP analysis suggests the presence of a signal peptide with the most likely cleavage site occuring between positions 38 and 39 in SEQ ID NO.: 24. TABLE 13A.
- the reverse complement (SEQ LD NO. 75) of aNOV12 nucleic acid sequence (SEQ ID NO. 23) has homology (73% identity) to a Homo sapiens GPCR mRNA (GPCR4;
- a NOV12 polypeptide has homology (48%o identity, 60% similarity) with a Mus musculus odorant receptor protein (ODOR2; SPTREMBL-ACC: BAA86125), as is shown in Table 13C.
- the global sequence homology (as defined by GAP alignment with the full length sequence of this protein) is 48 % amino acid identity and 57 % amino acid similarity.
- this protein contains a seven transmembrane receptor domain (rhodopsin family) (LPR000276) from amino acid residues 41 to 287 (as defined by Interpro).
- NOVl 2 966 TAT-ATTTAAAAGATTTTACTGTAATTCACAAACTGAGAGCATCGTCTTCTCATTGCCAC 908
- GPCR4 8393 TATCATTTATGAGATCTTCTTGTAAATCACTAGCTGTTTGCATACTCTCTTTATTGCTGC 8452
- NOVl 2 907 CATCATCTCTTTATTTCTAAAAGTATAGATGACTGGATTCAAAACGGGAGTGATAACTGC 848
- GPCR4 8453 CTTCATCTCCTTATTCCTGAATGTATAGACAACTGGATTCAGAAAAGGAGTGAGAACTGC 8512
- NOVl 2 847 ATCA ⁇ AGATGGCAAGGAATTTATCAAGATGTGATGTGGGAAATGGAAAAATATAGAAA ⁇ 788
- GPCR4 8513 ATCA ⁇ AAATAGCCAGAAACTTGTCCATCTGTGAATTAGGGTGTGGCCATGTATACACAAA 8572
- NOV12 87 GATTAATGGCCCA ⁇ AGACCAAAACCACCACAATGACATGAGCTGACAGCATAGAGAAAGC 728
- GPCR4 8573 CATGGGTGGACCAA ⁇ GA ⁇ CAAAAGGACCGCTGTGCTGTGAGCTGAAAGAGTGGA ⁇ AGGGC 8632
- GPCR4 J633 CTTGGATGAACCACCTGAGGAATGTTTCCAAACAGTAAACAGGATGAAGATGTAGGAGAT 8692
- NOVl 2 667 TATGAGAATTAAAAAAGAAGCCAGAGAAATAAATCCACTATTGGCAGTAACCATGAATCC 608
- GPCR4 8693 TAGAAGTATGAAGAAAGTACCCACACAGATAAACCCACTGTTAACAGTGACCATGAACTG 8752
- NOVl 2 607 CAATGTGTAGGTCTCTATGCAAGCCAGTTTGATAAATCGAGGAAGATCACAAAAGAAACT 548
- GPCR4 8753 CAATCTGTAGGTGTCGGTACAGGCTAGTCTGAGAAGCTGAGGAAGGTCACAGTAGAAGCT 8812
- NOVl 2 547 ATCTAATTCATTAGGGCCACAGAACAGCAGGTCTACAACAAAAGCCAACTGAATCACTGA 488
- NOVl2 427 GATGGTCAGGTAGTGGAGAGGCTTACATATGGCCACATATCGGTCAAAAGCCATGGCTAT 368
- GPCR4 8933 AATGGTCAGATAGTGGAGGGGCTTA-ATAGGGCCACATAACTGTCAAAGGCCATGGCTAT 8991
- NOVl2 367 GAGCAGCACCATCTCAGTTCCCCCAACTG-CATGGATAAAGAAGATCTGAACTACACAGC 309
- GPCR4 8992 GAGCAGCACCATCTCCACACCACCAA-TGACGTGGATGAAGAAGATTTGAGCGATGCAGC 9050
- NOVl2 308 CCCCAAAAGAGATGGTCTTGTGCTTCCTGAAAAGGTCATAAATCATCTTGGGAGCTGTGG 249
- GPCR4 9051 CTCCAAAGGAGATGACTTTGCGCTTTCTGAACAGGTCATAAATCATCTTGGGAGAAGTGA 9110
- NOVl2 248 AGGAACAAAATACCAAATTGATGATGGAAAGGTTGGCCAGCAGGAAGTACATGGGGGACT 189
- GPCR4 9111 CAGAGCAGGCTCCTAAGTCAATGAAGGAGAGACTGGCCAGTAGAAAGTACATGGGGGAGT 9170
- NOVl2 188 GTAAACGAGGGTCAGAGGTCACAGTTAGCACAATGAGGAGATTTCCCATCAGGCTTGATA 129
- GPCR4 9171 GTAAGTGAGGGTCAGTGGTCACAGAAAACACAATGAGGATGTTTCCAGTAATGCTTGCCA 9230
- NOVl 2 128 CATAGAACACTGAGAAAAAGAGGAAGAGGAGGAGCTGGATCTTCCGCGAGTCAGAGAGTC 69 llllll III III I 11 I I I I II I I III II I I Ml I 1 II II I 11 II I I I
- GPCR4 9231 CATAGAGCACAGAGGAAAACACTAGGAGGAGGAGCTGGATCTCCCATGAATGAGTGAGTC 9290
- GPCR4 9291 CCAGAAACAAAAACTCAGATACCACTGAGTGATTCTCTCCATCCATTGGTCCAGCCAACT 9350
- GPCR4 9351 GGG 9353 (SEQ ID NO. 80)
- NOV12 1 MDEANHSVVSEFVFLGLSDSRKIQLLLFLFFSVFYVSSLMGNLLIVLTVTSDPRLQSPMY 60 I I + I+II+IIII+I+ +++I I+ I+I I+ +I+II III+I+ III +111
- ODOR2 1 MGALNQTRVTEFIFLGLTDN VLEILFFVPFTVTYMLTLLGNFLIVVTIVFTPRLHNPMY 60
- NOVl2 61 FLLANLSIINLVFCSSTAPKMIYDLFRKHKTISFGGCVVQIFFIHAVGGTEMVLLIAMAF 120
- ODOR2 61 FFLSNLSFIDICHSSVTVPKMLEGLLLERKTISFDNCIAQLFFLHLFACSEIFLLTIMAY 120
- NOVl2 121 DRYVAICKPLHYLTIMNPQRCILFLVISWIIGIIHSVIQLAFVVDLLFCGPNELDSFFCD 180 l llll l l lll l +11 + 1+ + I+ I IM++I + I +1111 +11 + 111
- ODOR2 121 DRYVAICIPLHYSNVMNMKVCVQLVFAL LGGTIHSLVQTFLTIRLPYCGPNIIDSYFCD 180 NOVl2: 181 LPRFIKLACIETYTLGFMVTANSGFISLASFLILIISYIFILVTVQKKSSGGIFKAFSML 240
- ODOR2 181 VPPVIKLACTDTYLTGILIVSNSGTISLVCFLALVTSYTVILFSLRKKSAEGRRKALSTC 240
- NOVl2 241 SAHVIVWLVFGPLIFFYIFPFPTSHLDKFLAIFDAVITPVLNPVIYTFRNKEMMVAM— 298
- ODOR2 241 SAHFMVVTLFFGPCIFLYTRPDSSFSIDKVVSVFYTVVTPLLNPLIYTLRNEEVKTAMKH 300
- Novel SNP variants of NOV12 and their corresponding polypeptides are shown in Table 13D.
- the method of identifying and confirming novel SNPs is described in Example 3.
- GAG 561 GCTTACATATGGCCACATATCGGTCAAAAGCCATGGCTATGAGCAGCACCATCTCAGTTCCCCCAACTGCATGGATA AAG 641
- NOVl 2 expression was analyzed by TaqMan analysis.
- the expression of NOV12 in indicates highest levels in skeletal muscle and lower levels in the adipose tissue, as shown in Example 4 at Table 20B (Panel 1.2).
- the expression in skeletal muscle could indicate that this GPCR may be involved in energy metabolism and regulation of either carbohydrate or lipid as energy sources. It therefore could be a potential small molecule target in the treatment of diabetes and/or obesity.
- Polypeptides encoded by NOV1-NOV12 nucleic acids were analyzed by CLUSTALW analysis, as is shown in Table 21. TABLE 21.
- NOV12 AFS LSAHVIWVLVFGPLIFFYIFP—FP—TSHLDKFLAIFDAVITPVLNPV1YTFRN
- rOR indicates an olfactory-like receptor protein from Rattus norvegicus (SWISSPROT-ACC: P23267).
- NOVl through NOV12 represent new members of the GPCR family.
- NOVl through NOV12 can be used as markers for human chromosome 11.
- NOVl through NOV12 are useful in determining changes in expression of genes contained within the GPCR protein family.
- NOVl through NOV12 satisfy a need in the art by providing new diagnostic or therapeutic compositions useful in the treatment of disorders associated with alterations in the expression of members of the GPCR-associated protein families. Therefore, NOVl through NOV12, nucleic acids and proteins, and other compositions of the present invention identified here may be useful in potential therapeutic applications implicated in (but not limited to) various pathologies and disorders as indicated below.
- the potential therapeutic applications for this invention include, but are not limited to: protein therapeutic, small molecule drug target, antibody target (therapeutic, diagnostic, drug targeting/cytotoxic antibody), diagnostic and/or prognostic marker, gene therapy (gene delivery/gene ablation), research tools, tissue regeneration in vivo and in vitro of all tissues and cell types composing (but not limited to) those defined here.
- the nucleic acids and proteins of the invention are useful in potential therapeutic applications, including the treatment of infections such as bacterial, fungal, protozoal and viral infections (particularly infections caused by HIV-1 or HLV-2), pain, cancer (including but not limited to neoplasm, adenocarcinoma, lymphoma, prostate cancer, and uterine cancer), anorexia, bulimia, asthma, Parkinson's disease, acute heart failure, hypotension, hypertension, urinary retention, osteoporosis, Crohn's disease, multiple sclerosis, Albright hereditary ostoeodystrophy, angina pectoris, myocardial infarction, ulcers, asthma, allergies, benign prostatic hypertrophy, and psychotic and neurological disorders, including anxiety, schizophrenia, manic depression, delirium, dementia, severe mental retardation and dyskinesias, such as Huntington's disease or Gilles de la Tourette syndrome, and/or other pathologies and disorders.
- infections such as bacterial, fungal, protozoal and viral
- the polypeptides can be used as immunogens to produce antibodies specific for the invention, and as vaccines. They can also be used to screen for potential agonist and antagonist compounds.
- a cDNA encoding the GPCR-like protein may be useful in gene therapy, and the GPCR-like protein may be useful when administered to a subject in need thereof.
- compositions of the present invention will have efficacy for treatment of patients suffering from bacterial, fungal, protozoal and viral infections (particularly infections caused by HLV-1 or HIV-2), pain, cancer (including but not limited to neoplasm, adenocarcinoma, lymphoma, prostate cancer, and uterine cancer), anorexia, bulimia, asthma, Parkinson's disease, acute heart failure, hypotension, hypertension, urinary retention, osteoporosis, Crohn's disease, multiple sclerosis, Albright hereditary ostoeodystrophy, angina pectoris, myocardial infarction, ulcers, asthma, allergies, benign prostatic hypertrophy, and psychotic and neurological disorders, including anxiety, schizophrenia, manic depression, delirium, dementia, severe mental retardation and dyskinesias, such as Huntington's disease or Gilles de la Tourette syndrome, and/or other pathologies and disorders.
- cancer including but not limited to neoplasm, adenocarcinoma, lymph
- novel nucleic acid encoding GPCR-like protein, and the GPCR-like protein of the invention, or fragments thereof, may further be useful in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed. These materials are further useful in the generation of antibodies that bind immunospecifically to the novel substances of the invention for use in therapeutic or diagnostic methods.
- nucleic acids of the invention include those that encode a NOVX polypeptide or protein.
- polypeptide and “protein” are interchangeable.
- a NOVX nucleic acid encodes a mature NOVX polypeptide.
- a "mature" form of a polypeptide or protein relates to the product of a naturally occurring polypeptide or precursor form or proprotein.
- the naturally occurring polypeptide, precursor or proprotein includes, by way of nonlimiting example, the full-length gene product, encoded by the corresponding gene. Alternatively, it may be defined as the polypeptide, precursor or proprotein encoded by an open reading frame described herein.
- the product "mature" form arises, again by way of nonlimiting example, as a result of one or more naturally occurring processing steps that may take place within the cell in which the gene product arises.
- Examples of such processing steps leading to a "mature" form of a polypeptide or protein include the cleavage of the N-te ⁇ ninal methionine residue encoded by the initiation codon of an open reading frame, or the proteolytic cleavage of a signal peptide or leader sequence.
- a mature form arising from a precursor polypeptide or protein that has residues 1 to N, where residue 1 is the N-terminal methionine would have residues 2 through N remaining after removal of the N-terminal methionine.
- a mature form arising from a precursor polypeptide or protein having residues 1 to N, in which an N-terminal signal sequence from residue 1 to residue M is cleaved, would have the residues from residue M+l to residue N remaining.
- a "mature" form of a polypeptide or protein may arise from a step of post-translational modification other than a proteolytic cleavage event. Such additional processes include, by way of non-limiting example, glycosylation, myristoylation or phosphorylation.
- a mature polypeptide or protein may result from the operation of only one of these processes, or a combination of any of them.
- NOVX nucleic acids is the nucleic acid whose sequence is provided in
- SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23, or a fragment thereof includes mutant or variant nucleic acids of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23, or a fragment thereof, any of whose bases may be changed from the corresponding bases shown in SEQ LD NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23, while still encoding a protein that maintains at least one of its NOVX-like activities and physiological functions.
- the invention further includes the complement of the nucleic acid sequence of SEQ LD NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23, including fragments, derivatives, analogs and homologs thereof.
- the invention additionally includes nucleic acids or nucleic acid fragments, or complements thereto, whose structures include chemical modifications.
- nucleic acid molecules that encode NOVX proteins or biologically active portions thereof. Also included are nucleic acid fragments sufficient for use as hybridization probes to identify NOVX-encoding nucleic acids (e.g., NOVX mRNA) and fragments for use as polymerase chain reaction (PCR) primers for the amplification or mutation of NOVX nucleic acid molecules.
- nucleic acid molecule is intended to include DNA molecules (e.g., cDNA or genomic DNA), RNA molecules (e.g., mRNA), analogs of the DNA or RNA generated using nucleotide analogs, and derivatives, fragments and homologs thereof.
- the nucleic acid molecule can be single-stranded or double-stranded, but preferably is double-stranded DNA.
- Probes refer to nucleic acid sequences of variable length, preferably between at least about 10 nucleotides (nt), 100 nt, or as many as about, e.g., 6,000 nt, depending on use. Probes are used in the detection of identical, similar, or complementary nucleic acid sequences. Longer length probes are usually obtained from a natural or recombinant source, are highly specific and much slower to hybridize than oligomers. Probes may be single- or double-stranded and designed to have specificity in PCR, membrane-based hybridization technologies, or ELISA-like technologies.
- an "isolated" nucleic acid molecule is one that is separated from other nucleic acid molecules that are present in the natural source of the nucleic acid.
- isolated nucleic acid molecules include, but are not limited to, recombinant DNA molecules contained in a vector, recombinant DNA molecules maintained in a heterologous host cell, partially or substantially purified nucleic acid molecules, and synthetic DNA or RNA molecules.
- an "isolated" nucleic acid is free of sequences which naturally flank the nucleic acid (i.e., sequences located at the 5' and 3' ends of the nucleic acid) in the genomic DNA of the organism from which the nucleic acid is derived.
- the isolated NOVX nucleic acid molecule can contain less than about 50 kb, 25 kb, 5 kb, 4 kb, 3 kb, 2 kb, 1 kb, 0.5 kb or 0.1 kb of nucleotide sequences which naturally flank the nucleic acid molecule in genomic DNA of the cell from which the nucleic acid is derived.
- an "isolated" nucleic acid molecule such as a cDNA molecule, can be substantially free of other cellular material or culture medium when produced by recombinant techniques, or of chemical precursors or other chemicals when chemically synthesized.
- a nucleic acid molecule of the present invention e.g., a nucleic acid molecule having the nucleotide sequence of SEQ LD NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23, or a complement of any of this nucleotide sequence, can be isolated using standard molecular biology techniques and the sequence information provided herein.
- NOVX nucleic acid sequences can be isolated using standard hybridization and cloning techniques (e.g., as described in Sambrook et ⁇ l, eds., MOLECULAR CLONING: A LABORATORY MANUAL 2 nd Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989; and Ausubel, et ⁇ l, eds., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, New York, NY, 1993.)
- a nucleic acid of the invention can be amplified using cDNA, mRNA or alternatively, genomic DNA, as a template and appropriate oligonucleotide primers according to standard PCR amplification techniques.
- the nucleic acid so amplified can be cloned into an appropriate vector and characterized by DNA sequence analysis.
- oligonucleotides corresponding to NOVX nucleotide sequences can be prepared by standard synthetic techniques, e.g., using an automated DNA synthesizer.
- oligonucleotide refers to a series of linked nucleotide residues, which oligonucleotide has a sufficient number of nucleotide bases to be used in a PCR reaction.
- a short oligonucleotide sequence may be based on, or designed from, a genomic or cDNA sequence and is used to amplify, confirm, or reveal the presence of an identical, similar or complementary DNA or RNA in a particular cell or tissue.
- Oligonucleotides comprise portions of a nucleic acid sequence having about 10 nt, 50 nt, or 100 nt in length, preferably about 15 nt to 30 nt in length.
- an oligonucleotide comprising a nucleic acid molecule less than 100 nt in length would further comprise at lease 6 contiguous nucleotides of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23, or a complement thereof. Oligonucleotides may be chemically synthesized and may be used as probes.
- an isolated nucleic acid molecule of the invention comprises a nucleic acid molecule that is a complement of the nucleotide sequence shown in SEQ LD NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23, or a portion of this nucleotide sequence.
- a nucleic acid molecule that is complementary to the nucleotide sequence shown in SEQ LD NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23 is one that is sufficiently complementary to the nucleotide sequence shown in SEQ LD NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23 that it can hydrogen bond with little or no mismatches to the nucleotide sequence shown in SEQ LD NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23, thereby forming a stable duplex.
- binding means the physical or chemical interaction between two polypeptides or compounds or associated polypeptides or compounds or combinations thereof. Binding includes ionic, non-ionic, Von der Waals, hydrophobic interactions, etc.
- a physical interaction can be either direct or indirect. Indirect interactions may be through or due to the effects of another polypeptide or compound. Direct binding refers to interactions that do not take place through, or due to, the effect of another polypeptide or compound, but instead are without other substantial chemical intermediates.
- nucleic acid molecule of the invention can comprise only a portion of the nucleic acid sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23, e.g., a fragment that can be used as a probe or primer, or a fragment encoding a biologically active portion of NOVX. Fragments provided herein are defined as sequences of at least 6
- (contiguous) nucleic acids or at least 4 (contiguous) amino acids a length sufficient to allow for specific hybridization in the case of nucleic acids or for specific recognition of an epitope in the case of amino acids, respectively, and are at most some portion less than a full length sequence.
- Fragments may be derived from any contiguous portion of a nucleic acid or amino acid sequence of choice.
- Derivatives are nucleic acid sequences or amino acid sequences formed from the native compounds either directly or by modification or partial substitution.
- Analogs are nucleic acid sequences or amino acid sequences that have a structure similar to, but not identical to, the native compound but differs from it in respect to certain components or side chains. Analogs may be synthetic or from a different evolutionary origin and may have a similar or opposite metabolic activity compared to wild type.
- Derivatives and analogs may be full length or other than full length, if the derivative or analog contains a modified nucleic acid or amino acid, as described below.
- Derivatives or analogs of the nucleic acids or proteins of the invention include, but are not limited to, molecules comprising regions that are substantially homologous to the nucleic acids or proteins of the invention, in various embodiments, by at least about 70%, 80%, 85%, 90%, 95%o, 98%, or even 99% identity (with a preferred identity of 80-99%) over a nucleic acid or amino acid sequence of identical size or when compared to an aligned sequence in which the alignment is done by a computer homology program known in the art, or whose encoding nucleic acid is capable of hybridizing to the complement of a sequence encoding the aforementioned proteins under stringent, moderately stringent, or low stringent conditions.
- a “homologous nucleic acid sequence” or “homologous amino acid sequence,” or variations thereof, refer to sequences characterized by a homology at the nucleotide level or amino acid level as discussed above.
- Homologous nucleotide sequences encode those sequences coding for isoforms of a NOVX polypeptide. Isoforms can be expressed in different tissues of the same organism as a result of, for example, alternative splicing of RNA. Alternatively, isoforms can be encoded by different genes.
- homologous nucleotide sequences include nucleotide sequences encoding for a NOVX polypeptide of species other than humans, including, but not limited to, mammals, and thus can include, e.g., mouse, rat, rabbit, dog, cat cow, horse, and other organisms.
- homologous nucleotide sequences also include, but are not limited to, naturally occurring allelic variations and mutations of the nucleotide sequences set forth herein.
- a homologous nucleotide sequence does not, however, include the nucleotide sequence encoding huma NOVX protein.
- Homologous nucleic acid sequences include those nucleic acid sequences that encode conservative amino acid substitutions (see below) SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24, as well as a polypeptide having NOVX activity. Biological activities of the NOVX proteins are described below. A homologous amino acid sequence does not encode the amino acid sequence of a huma NOVX polypeptide.
- the nucleotide sequence determined from the cloning of the huma NOVX gene allows for the generation of probes and primers designed for use in identifying and/or cloning NOVX homologues in other cell types, e.g., from other tissues, as well as NOVX homologues from other mammals.
- the probe/primer typically comprises a substantially purified oligonucleotide.
- the oligonucleotide typically comprises a region of nucleotide sequence that hybridizes under stringent conditions to at least about 12, 25, 50, 100, 150, 200, 250, 300, 350 or 400 or more consecutive sense strand nucleotide sequence of SEQ ED NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23; or an anti-sense strand nucleotide sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23; or of anaturally occurring mutant of SEQ LD NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23.
- Probes based on the human NOVX nucleotide sequence can be used to detect transcripts or genomic sequences encoding the same or homologous proteins.
- the probe further comprises a label group attached thereto, e.g., the label group can be a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor.
- Such probes can be used as a part of a diagnostic test kit for identifying cells or tissue which misexpress a NOVX protein, such as by measuring a level of a NOVX-encoding nucleic acid in a sample of cells from a subject e.g., detecting NOVX mRNA levels or determining whether a genomic NOVX gene has been mutated or deleted.
- polypeptide having a biologically active portion of NOVX refers to polypeptides exhibiting activity similar, but not necessarily identical to, an activity of a polypeptide of the present invention, including mature forms, as measured in a particular biological assay, with or without dose dependency.
- a nucleic acid fragment encoding a "biologically active portion of NOVX” can be prepared by isolating a portion of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23 that encodes a polypeptide having a NOVX biological activity (biological activities of the NOVX proteins are described below), expressing the encoded portion of NOVX protein (e.g., by recombinant expression in vitro) and assessing the activity of the encoded portion of NOVX.
- a nucleic acid fragment encoding a biologically active portion of NOVX can optionally include an ATP -binding domain.
- a nucleic acid fragment encoding a biologically active portion of NOVX includes one or more regions.
- the invention further encompasses nucleic acid molecules that differ from the nucleotide sequences shown in SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23 due to the degeneracy of the genetic code.
- These nucleic acids thus encode the same NOVX protein as that encoded by the nucleotide sequence shown in SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23 e.g., the polypeptide of SEQ D NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24.
- an isolated nucleic acid molecule of the invention has a nucleotide sequence encoding a protein having an amino acid sequence shown SEQ ED NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24.
- DNA sequence polymorphisms that lead to changes in the amino acid sequences of NOVX may exist within a population (e.g., the human population). Such genetic polymorphism in the NOVX gene may exist among individuals within a population due to natural allelic variation.
- the terms "gene” and “recombinant gene” refer to nucleic acid molecules comprising an open reading frame encoding a NOVX protein, preferably a mammalia NOVX protein.
- Such natural allelic variations can typically result in 1-5% variance in the nucleotide sequence of the NOVX gene. Any and all such nucleotide variations and resulting amino acid polymorphisms in NOVX that are the result of natural allelic variation and that do not alter the functional activity of NOVX are intended to be within the scope of the invention. Moreover, nucleic acid molecules encoding NOVX proteins from other species, and thus that have a nucleotide sequence that differs from the human sequence of SEQ LD NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23 are intended to be within the scope of the invention.
- Nucleic acid molecules corresponding to natural allelic variants and homologues of the NOVX cDNAs of the invention can be isolated based on their homology to the huma NOVX nucleic acids disclosed herein using the human cDNAs, or a portion thereof, as a hybridization probe according to standard hybridization techniques under stringent hybridization conditions.
- a soluble huma NOVX cDNA can be isolated based on its homology to human membrane-bound NOVX.
- a membrane-bound huma NOVX cDNA can be isolated based on its homology to soluble huma NOVX.
- an isolated nucleic acid molecule of the invention is at least 6 nucleotides in length and hybridizes under stringent conditions to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23.
- the nucleic acid is at least 10, 25, 50, 100, 250, 500 or 750 nucleotides in length.
- an isolated nucleic acid molecule of the invention hybridizes to the coding region.
- hybridizes under stringent conditions is intended to describe conditions for hybridization and washing under which nucleotide sequences at least 60% homologous to each other typically remain hybridized to each other.
- Homologs i.e., nucleic acids encoding NOVX proteins derived from species other than human
- other related sequences e.g., paralogs
- stringent hybridization conditions refers to conditions under which a probe, primer or oligonucleotide will hybridize to its target sequence, but to no other sequences. Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures than shorter sequences.
- stringent conditions are selected to be about 5°C lower than the thermal melting point (T- for the specific sequence at a defined ionic strength and pH.
- Tm is the temperature (under defined ionic strength, pH and nucleic acid concentration) at which 50% of the probes complementary to the target sequence hybridize to the target sequence at equilibrium. Since the target sequences are generally present at excess, at Tm, 50% of the probes are occupied at equilibrium.
- stringent conditions will be those in which the salt concentration is less than about 1.0 M sodium ion, typically about 0.01 to 1.0 M sodium ion (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes, primers or oligonucleotides (e.g., 10 nt to 50 nt) and at least about 60°C for longer probes, primers and oligonucleotides.
- Stringent conditions may also be achieved with the addition of destabilizing agents, such as formamide.
- Stringent conditions are known to those skilled in the art and can be found in CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, NN. (1989), 6.3.1-6.3.6.
- the conditions are such that sequences at least about 65%, 70%, 75%, 85%, 90%), 95%, 98%, or 99% homologous to each other typically remain hybridized to each other.
- a non-limiting example of stringent hybridization conditions is hybridization in a high salt buffer comprising 6X SSC, 50 mM Tris-HCl (pH 7.5), 1 mM EDTA, 0.02% PVP, 0.02% Ficoll, 0.02% BSA, and 500 mg/ml denatured salmon sperm D ⁇ A at 65°C. This hybridization is followed by one or more washes in 0.2X SSC, 0.01% BSA at 50°C.
- An isolated nucleic acid molecule of the invention that hybridizes under stringent conditions to the sequence of SEQ LD NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23 corresponds to a naturally occurring nucleic acid molecule.
- a "naturally-occurring" nucleic acid molecule refers to an RNA or DNA molecule having a nucleotide sequence that occurs in nature (e.g., encodes a natural protein).
- a nucleic acid sequence that is hybridizable to the nucleic acid molecule comprising the nucleotide sequence of SEQ LD NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23, or fragments, analogs or derivatives thereof, under conditions of moderate stringency is provided.
- moderate stringency hybridization conditions are hybridization in 6X SSC, 5X Denhardt's solution, 0.5% SDS and 100 mg/ml denatured salmon sperm DNA at 55°C, followed by one or more washes in IX SSC, 0.1 % SDS at 37°C.
- Other conditions of moderate stringency that may be used are well known in the art. See, e.g., Ausubel et al.
- nucleic acid that is hybridizable to the nucleic acid molecule comprising the nucleotide sequence of SEQ LD NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23, or fragments, analogs or derivatives thereof, under conditions of low stringency, is provided.
- low stringency hybridization conditions are hybridization in 35% formamide, 5X SSC, 50 mM Tris-HCl (pH 7.5), 5 mM EDTA, 0.02% PVP, 0.02% Ficoll, 0.2% BSA, 100 mg/ml denatured salmon sperm DNA, 10% (wt/vol) dextran sulfate at 40°C, followed by one or more washes in 2X SSC, 25 mM Tris-HCl (pH 7.4), 5 mM EDTA, and 0.1% SDS at 50°C.
- Other conditions of low stringency that may be used are well known in the art (e.g., as employed for cross-species hybridizations).
- allelic variants of the NOVX sequence that may exist in the population, the skilled artisan will further appreciate that changes can be introduced by mutation into the nucleotide sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23, thereby leading to changes in the amino acid sequence of the encoded NOVX protein, without altering the functional ability of the NOVX protein.
- nucleotide substitutions leading to amino acid substitutions at "non-essential" amino acid residues can be made in the sequence of SEQ ED NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23.
- a "non-essential" amino acid residue is a residue that can be altered from the wild-type sequence of NOVX without altering the biological activity, whereas an "essential" amino acid residue is required for biological activity.
- amino acid residues that are conserved among the NOVX proteins of the present invention are predicted to be particularly unamenable to alteration.
- Another aspect of the invention pertains to nucleic acid molecules encoding NOVX proteins that contain changes in amino acid residues that are not essential for activity. Such NOVX proteins differ in amino acid sequence from SEQ LD NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24, yet retain biological activity.
- the isolated nucleic acid molecule comprises a nucleotide sequence encoding a protein, wherein the protein comprises an amino acid sequence at least about 75% homologous to the amino acid sequence of SEQ LD NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24 .
- the protein encoded by the nucleic acid is at least about 80% homologous to SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24, more preferably at least about 90%, 95%, 98%, and most preferably at least about 99% homologous to SEQ LD NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24.
- An isolated nucleic acid molecule encoding a NOVX protein homologous to the protein of can be created by introducing one or more nucleotide substitutions, additions or deletions into the nucleotide sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23, such that one or more amino acid substitutions, additions or deletions are introduced into the encoded protein.
- Mutations can be introduced into the nucleotide sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23 by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis.
- conservative amino acid substitutions are made at one or more predicted non-essential amino acid residues.
- a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
- amino acids with basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid, glutamic acid
- uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine
- nonpolar side chains e.g., alanine, valine, leucine, isoleucine, praline, phenylalanine, methionine, tryptophan
- beta-branched side chains e.g., threonine, valine, isoleucine
- aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
- a predicted nonessential amino acid residue in NOVX is replaced with another amino acid residue from the same side chain family.
- mutations can be introduced randomly along all or part of a NOVX coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for NOVX biological activity to identify mutants that retain activity.
- the encoded protein can be expressed by any recombinant technology known in the art and the activity of the protein can be determined.
- a mutant NOVX protein can be assayed for (1) the ability to form proteimprotein interactions with other NOVX proteins, other cell-surface proteins, or biologically active portions thereof, (2) complex formation between a mutant NOVX protein and a NOVX receptor; (3) the ability of a mutant NOVX protein to bind to an intracellular target protein or biologically active portion thereof; (e.g., avidin proteins); (4) the ability to bind NOVX protein; or (5) the ability to specifically bind an anti-NOVX protein antibody.
- Another aspect of the invention pertains to isolated antisense nucleic acid molecules that are hybridizable to or complementary to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23, or fragments, analogs or derivatives thereof.
- An "antisense" nucleic acid comprises a nucleotide sequence that is complementary to a "sense" nucleic acid encoding a protein, e.g., complementary to the coding strand of a double-stranded cDNA molecule or complementary to an mRNA sequence.
- antisense nucleic acid molecules comprise a sequence complementary to at least about 10, 25, 50, 100, 250 or 500 nucleotides or an entire NOVX coding strand, or to only a portion thereof.
- Nucleic acid molecules encoding fragments, homologs, derivatives and analogs of a NOVX protein of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24 or antisense nucleic acids complementary to a NOVX nucleic acid sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23 are additionally provided.
- an antisense nucleic acid molecule is antisense to a "coding region" of the coding strand of a nucleotide sequence encoding NOVX.
- coding region refers to the region of the nucleotide sequence comprising codons which are translated into amino acid residues (e.g., the protein coding region of huma NOVX corresponds to SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24).
- the antisense nucleic acid molecule is antisense to a "noncoding region" of the coding strand of a nucleotide sequence encoding NOVX.
- noncoding region refers to 5' and 3' sequences which flank the coding region that are not translated into amino acids (i.e., also referred to as 5' and 3' untranslated regions).
- antisense nucleic acids of the invention can be designed according to the rules of Watson and Crick or Hoogsteen base pairing.
- the antisense nucleic acid molecule can be complementary to the entire coding region of NOVX mRNA, but more preferably is an oligonucleotide that is antisense to only a portion of the coding or noncoding region of NOVX mRNA.
- the antisense oligonucleotide can be complementary to the region surrounding the translation start site of NOVX mRNA.
- An antisense oligonucleotide can be, for example, about 5, 10, 15, 20, 25, 30, 35, 40, 45 or 50 nucleotides in length.
- An antisense nucleic acid of the invention can be constructed using chemical synthesis or enzymatic ligation reactions using procedures known in the art.
- an antisense nucleic acid e.g., an antisense oligonucleotide
- an antisense nucleic acid e.g., an antisense oligonucleotide
- modified nucleotides that can be used to generate the antisense nucleic acid include: 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl) uracil, 5-carboxymethylaminomethyl- 2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D-mannosylqueosine, 5'-methoxy
- the antisense nucleic acid can be produced biologically using an expression vector into which a nucleic acid has been subcloned in an antisense orientation (i.e., RNA transcribed from the inserted nucleic acid will be of an antisense orientation to a target nucleic acid of interest, described further in the following subsection).
- the antisense nucleic acid molecules of the invention are typically administered to a subject or generated in situ such that they hybridize with or bind to cellular mRNA and/or genomic DNA encoding a NOVX protein to thereby inhibit expression of the protein, e.g., by inhibiting transcription and/or translation.
- the hybridization can be by conventional nucleotide complementarity to form a stable duplex, or, for example, in the case of an antisense nucleic acid molecule that binds to DNA duplexes, through specific interactions in the major groove of the double helix.
- An example of a route of administration of antisense nucleic acid molecules of the invention includes direct injection at a tissue site.
- antisense nucleic acid molecules can be modified to target selected cells and then administered systemically.
- antisense molecules can be modified such that they specifically bind to receptors or antigens expressed on a selected cell surface, e.g., by linking the antisense nucleic acid molecules to peptides or antibodies that bind to cell surface receptors or antigens.
- the antisense nucleic acid molecules can also be delivered to cells using the vectors described herein. To achieve sufficient intracellular concentrations of antisense molecules, vector constructs in which the antisense nucleic acid molecule is placed under the control of a strong pol II or pol III promoter are preferred.
- the antisense nucleic acid molecule of the invention is an ⁇ -anomeric nucleic acid molecule.
- An ⁇ -anomeric nucleic acid molecule forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual ⁇ -units, the strands run parallel to each other (Gaultier et al. (1987) Nucleic Acids Res 15: 6625-6641).
- the antisense nucleic acid molecule can also comprise a 2'-o-methylribonucleotide (Inoue et al (1987) Nucleic Acids Res 15: 6131-6148) or a chimeric RNA -DNA analogue (Inoue et al (1987) FEBSLett 215: 327-330).
- modifications include, by way of nonlimiting example, modified bases, and nucleic acids whose sugar phosphate backbones are modified or derivatized. These modifications are carried out at least in part to enhance the chemical stability of the modified nucleic acid, such that they may be used, for example, as antisense binding nucleic acids in therapeutic applications in a subject.
- an antisense nucleic acid of the invention is a ribozyme.
- Ribozymes are catalytic RNA molecules with ribonuclease activity that are capable of cleaving a single-stranded nucleic acid, such as a mRNA, to which they have a complementary region.
- ribozymes e.g., hammerhead ribozymes (described in Haselhoff and Gerlach (1988) Nature 334:585-591)
- a ribozyme having specificity for a NOVX-encoding nucleic acid can be designed based upon the nucleotide sequence of a NOVX DNA disclosed herein (i.e., SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 or 23).
- a derivative of a Tetrahymena L-19 IVS RNA can be constructed in which the nucleotide sequence of the active site is complementary to the nucleotide sequence to be cleaved in a NOVX-encoding mRNA. See, e.g., Cech et al. U.S. Pat. No. 4,987,071; and Cech et al. U.S. Pat. No. 5,116,742.
- NOVX mRNA can be used to select a catalytic RNA having a specific ribonuclease activity from a pool of RNA molecules. See, e.g., Bartel et al, (1993) -Science 261:1411-1418.
- NOVX gene expression can be inhibited by targeting nucleotide sequences complementary to the regulatory region of the NOVX (e.g. , the NOVX promoter and/or enhancers) to form triple helical structures that prevent transcription of the NOVX gene in target cells.
- nucleotide sequences complementary to the regulatory region of the NOVX e.g. , the NOVX promoter and/or enhancers
- the nucleic acids of NOVX can be modified at the base moiety, sugar moiety or phosphate backbone to improve, e.g. , the stability, hybridization, or solubility of the molecule.
- the deoxyribose phosphate backbone of the nucleic acids can be modified to generate peptide nucleic acids (see Hyrup et al. (1996) BioorgMed Chem 4: 5-23).
- the terms "peptide nucleic acids” or "PNAs” refer to nucleic acid mimics, e.g., DNA mimics, in which the deoxyribose phosphate backbone is replaced by a pseudopeptide backbone and only the four natural nucleobases are retained.
- PNAs The neutral backbone of PNAs has been shown to allow for specific hybridization to DNA and RNA under conditions of low ionic strength.
- the synthesis of PNA oligomers can be performed using standard solid phase peptide synthesis protocols as described in Hyrup et al. (1996) above; Perry-O'Keefe et ⁇ /. (1996) EN S 93: 14670-675.
- P ⁇ As of ⁇ OVX can be used in therapeutic and diagnostic applications. For example,
- P ⁇ As can be used as antisense or antigene agents for sequence-specific modulation of gene expression by, e.g., inducing transcription or translation arrest or inhibiting replication.
- P ⁇ As of ⁇ OVX can also be used, e.g., in the analysis of single base pair mutations in a gene by, e.g., P ⁇ A directed PCR clamping; as artificial restriction enzymes when used in combination with other enzymes, e.g., SI nucleases (Hyrup B. (1996) above); or as probes or primers for D ⁇ A sequence and hybridization (Hyrup et al. (1996), above; Perry-O'Keefe (1996), above).
- P ⁇ As of ⁇ OVX can be modified, e.g., to enhance their stability or cellular uptake, by attaching lipophilic or other helper groups to P ⁇ A, by the formation of P ⁇ A-D ⁇ A chimeras, or by the use of liposomes or other techniques of drug delivery known in the art.
- P ⁇ A-D ⁇ A chimeras of ⁇ OVX can be generated that may combine the advantageous properties of P ⁇ A and D ⁇ A.
- Such chimeras allow D ⁇ A recognition enzymes, e.g., R ⁇ ase H and D ⁇ A polymerases, to interact with the D ⁇ A portion while the P ⁇ A portion would provide high binding affinity and specificity.
- P ⁇ A-D ⁇ A chimeras can be linked using linkers of appropriate lengths selected in terms of base stacking, number of bonds between the nucleobases, and orientation (Hyrup (1996) above).
- the synthesis of PNA-DNA chimeras can be performed as described in Hyrup (1996) above and Finn et al. (1996) Nucl Acids Res 24: 3357-63.
- a DNA chain can be synthesized on a solid support using standard phosphoramidite coupling chemistry, and modified nucleoside analogs, e.g., 5'-(4-methoxytrityl) amino-5'-deoxy-thymidine phosphoramidite, can be used between the PNA and the 5' end of DNA (Mag et al. (1989) Nucl Acid Res 17: 5973-88). PNA monomers are then coupled in a stepwise manner to produce a chimeric molecule with a 5' PNA segment and a 3' DNA segment (Finn et al. (1996) above). Alternatively, chimeric molecules can be synthesized with a 5' DNA segment and a 3' PNA segment. See, Petersen et al. (1975) Bioorg Med Chem Lett 5: 1119-11124.
- the oligonucleotide may include other appended groups such as peptides (e.g., for targeting host cell receptors in vivo), or agents facilitating transport across the cell membrane (see, e.g., Letsinger et al, 1989, Proc. Natl. Acad. Sci. U.S.A. 86:6553-6556; Lemaifre et al, 1987, Proc. Natl. Acad. Sci. 84:648-652; PCT Publication No. W088/09810) or the blood-brain barrier (see, e.g., PCT Publication No. W089/10134).
- peptides e.g., for targeting host cell receptors in vivo
- agents facilitating transport across the cell membrane see, e.g., Letsinger et al, 1989, Proc. Natl. Acad. Sci. U.S.A. 86:6553-6556; Lemaifre et al, 1987
- oligonucleotides can be modified with hybridization triggered cleavage agents (See, e.g., Krol et al, 1988, BioTechniques 6:958-976) or intercalating agents. (See, e.g., Zon, 1988, Pharm. Res. 5: 539-549).
- the oligonucleotide may be conjugated to another molecule, e.g., a peptide, a hybridization triggered cross-linking agent, a transport agent, a hybridization-triggered cleavage agent, etc.
- a NOVX polypeptide of the invention includes the NOVX-like protein whose sequence is provided SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24.
- the invention also includes a mutant or variant protein any of whose residues may be changed from the corresponding residue shown SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24 while still encoding a protein that maintains its NOVX-like activities and physiological functions, or a functional fragment thereof. In some embodiments, up to 20% or more of the residues may be so changed in the mutant or variant protein, hi some embodiments, the NOVX polypeptide according to the invention is a mature polypeptide.
- a NOVX -like variant that preserves NOVX-like function includes any variant in which residues at a particular position in the sequence have been substituted by other amino acids, and further include the possibility of inserting an additional residue or residues between two residues of the parent protein as well as the possibility of deleting one or more residues from the parent sequence.
- Any amino acid substitution, insertion, or deletion is encompassed by the invention. In favorable circumstances, the substitution is a conservative substitution as defined above.
- One aspect of the invention pertains to isolated NOVX proteins, and biologically active portions thereof, or derivatives, fragments, analogs or homologs thereof. Also provided are polypeptide fragments suitable for use as immunogens to raise anti-NOVX antibodies.
- native NOVX proteins can be isolated from cells or tissue sources by an appropriate purification scheme using standard protein purification techniques.
- NOVX proteins are produced by recombinant DNA techniques.
- a NOVX protein or polypeptide can be synthesized chemically using standard peptide synthesis techniques.
- an “isolated” or “purified” protein or biologically active portion thereof is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the NOVX protein is derived, or substantially free from chemical precursors or other chemicals when chemically synthesized.
- the language “substantially free of cellular material” includes preparations of NOVX protein in which the protein is separated from cellular components of the cells from which it is isolated or recombinantly produced.
- the language "substantially free of cellular material” includes preparations of NOVX protein having less than about 30% (by dry weight) of non-NOVX protein (also referred to herein as a "contaminating protein"), more preferably less than about 20% of non-NOVX protein, still more preferably less than about 10% of non-NOVX protein, and most preferably less than about 5% non-NOVX protein.
- non-NOVX protein also referred to herein as a "contaminating protein”
- NOVX protein or biologically active portion thereof is recombinantly produced, it is also preferably substantially free of culture medium, i.e., culture medium represents less than about 20%, more preferably less than about 10%, and most preferably less than about 5% of the volume of the protein preparation.
- the language “substantially free of chemical precursors or other chemicals” includes preparations of NOVX protein in which the protein is separated from chemical precursors or other chemicals that are involved in the synthesis of the protein.
- the language “substantially free of chemical precursors or other chemicals” includes preparations of NOVX protein having less than about 30% (by dry weight) of chemical precursors or non-NOVX chemicals, more preferably less than about 20%o chemical precursors or non-NOVX chemicals, still more preferably less than about 10% chemical precursors or non-NOVX chemicals, and most preferably less than about 5%> chemical precursors or non-NOVX chemicals.
- Biologically active portions of a NOVX protein include peptides comprising amino acid sequences sufficiently homologous to or derived from the amino acid sequence of the NOVX protein, e.g., the amino acid sequence shown SEQ LD NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 or 24 that include fewer amino acids than the full length NOVX proteins, and exhibit at least one activity of a NOVX protein.
- biologically active portions comprise a domain or motif with at least one activity of the NOVX protein.
- a biologically active portion of a NOVX protein can be a polypeptide which is, for example, 10, 25, 50, 100 or more amino acids in length.
- a biologically active portion of a NOVX protein of the present invention may contain at least one of the above-identified domains conserved between the NOVX proteins, e.g. TSR modules.
- other biologically active portions, in which other regions of the protein are deleted can be prepared by recombinant techniques and evaluated for one or more of the functional activities of a native NOVX protein.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Toxicology (AREA)
- Endocrinology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Diabetes (AREA)
- Pharmacology & Pharmacy (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Animal Behavior & Ethology (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Cell Biology (AREA)
- Immunology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
Description
Claims
Applications Claiming Priority (29)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US19599400P | 2000-04-11 | 2000-04-11 | |
| US19653800P | 2000-04-11 | 2000-04-11 | |
| US195994P | 2000-04-11 | ||
| US196538P | 2000-04-11 | ||
| US19990200P | 2000-04-26 | 2000-04-26 | |
| US199902P | 2000-04-26 | ||
| US199964P | 2000-04-26 | ||
| US19994800P | 2000-04-27 | 2000-04-27 | |
| US19995600P | 2000-04-27 | 2000-04-27 | |
| US19996400P | 2000-04-27 | 2000-04-27 | |
| US19995500P | 2000-04-27 | 2000-04-27 | |
| US20017600P | 2000-04-27 | 2000-04-27 | |
| US199955P | 2000-04-27 | ||
| US199956P | 2000-04-27 | ||
| US200176P | 2000-04-27 | ||
| US199948P | 2000-04-27 | ||
| US21899500P | 2000-07-17 | 2000-07-17 | |
| US218995P | 2000-07-17 | ||
| US22064400P | 2000-07-25 | 2000-07-25 | |
| US220644P | 2000-07-25 | ||
| US25964101P | 2001-01-04 | 2001-01-04 | |
| US259641P | 2001-01-04 | ||
| US26485101P | 2001-01-29 | 2001-01-29 | |
| US264851P | 2001-01-29 | ||
| US26856701P | 2001-02-14 | 2001-02-14 | |
| US268567P | 2001-02-14 | ||
| US09/826,734 US20030017457A1 (en) | 2000-04-06 | 2001-04-05 | Novel polynucleotides and polypeptides encoded thereby |
| US826734P | 2001-04-05 | ||
| PCT/US2001/011901 WO2001077177A2 (en) | 2000-04-11 | 2001-04-11 | Gpcr-proteins and nucleic acids encoding same |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP1272520A2 true EP1272520A2 (en) | 2003-01-08 |
Family
ID=27585087
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP01930484A Withdrawn EP1272520A2 (en) | 2000-04-11 | 2001-04-11 | Gpcr-proteins and nucleic acids encoding same |
Country Status (3)
| Country | Link |
|---|---|
| EP (1) | EP1272520A2 (en) |
| CA (1) | CA2406370A1 (en) |
| WO (1) | WO2001077177A2 (en) |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5874243A (en) * | 1997-03-28 | 1999-02-23 | Smithkline Beecham Corporation | OLRCC15 receptor |
| WO2001027158A2 (en) * | 1999-10-08 | 2001-04-19 | Digiscents | Olfactory receptor sequences |
-
2001
- 2001-04-11 EP EP01930484A patent/EP1272520A2/en not_active Withdrawn
- 2001-04-11 CA CA002406370A patent/CA2406370A1/en not_active Abandoned
- 2001-04-11 WO PCT/US2001/011901 patent/WO2001077177A2/en not_active Ceased
Non-Patent Citations (1)
| Title |
|---|
| See references of WO0177177A2 * |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2001077177A2 (en) | 2001-10-18 |
| WO2001077177A3 (en) | 2002-08-15 |
| CA2406370A1 (en) | 2001-10-18 |
| WO2001077177A8 (en) | 2002-04-18 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20050287564A1 (en) | Therapeutic polypeptides, nucleic acids encoding same, and methods of use | |
| WO2001049729A2 (en) | Novex polypeptides, nucleic acids encoding same and their diagnostic and therapeutic use | |
| US20030204052A1 (en) | Novel proteins and nucleic acids encoding same and antibodies directed against these proteins | |
| WO2002046229A2 (en) | Novel proteins and nucleic acids encoding same | |
| CA2448540A1 (en) | Therapeutic polypeptides, nucleic acids encoding same, and methods of use | |
| US20030212255A1 (en) | Novel proteins and nucleic acids encoding same | |
| US20030216545A1 (en) | Novel proteins and nucleic acids encoding same | |
| US20030087815A1 (en) | Novel polypeptides and nucleic acids encoding same | |
| US20030100491A1 (en) | Novel proteins and nucleic acids encoding same | |
| WO2002040539A2 (en) | Gpcr-like protein and nucleic acids encoding same | |
| WO2001090187A2 (en) | G-protein coupled olfactory receptors | |
| US20030068618A1 (en) | Novel proteins and nucleic acids encoding same | |
| US20060211031A1 (en) | Novel proteins and nucleic acids encoding same | |
| US20030091563A1 (en) | Novel GPCR-proteins and nucleic acids encoding same | |
| US20020146807A1 (en) | Novel polypeptides and nucleic acids encoding same | |
| WO2001077177A2 (en) | Gpcr-proteins and nucleic acids encoding same | |
| WO2001051632A9 (en) | Odorant receptor polypeptides and nucleic acids encoding same | |
| AU2001257016A1 (en) | Novel gpcr-proteins and nucleic acids encoding same | |
| US20030165858A1 (en) | Novel GPCR-like proteins and nucleic acids encoding same | |
| US20030077794A1 (en) | Novel polypeptides and nucleic acids encoding same | |
| US20020065405A1 (en) | Novel polypeptides and nucleic acids encoding same | |
| US20030059830A1 (en) | Novel single nucleotide polymorphisms for olfactory receptor-like polypeptides and nucleic acids encoding the same | |
| US20030175705A1 (en) | Methods of use for novel single nucleotide polymorphisms of olfactory receptor-like polypeptides and nucleic acids encoding the same | |
| US20060210559A1 (en) | Novel antibodies that bind to antigenic polypeptides, nucleic acids encoding the antigens, and methods of use | |
| US20030166845A1 (en) | Novel proteins and nucleic acids encoding same |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20021018 |
|
| AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE TR |
|
| AX | Request for extension of the european patent |
Free format text: AL;LT;LV;MK;RO;SI |
|
| RIN1 | Information on inventor provided before grant (corrected) |
Inventor name: WOLENC, ADAM R. Inventor name: TCHERNEV, VELIZAR, T. Inventor name: SZEKERES, EDWARD, S. Inventor name: GANGOLLI, ESHA, A., Inventor name: RASTELLI, LUCA Inventor name: GORSSE, WILLIAM Inventor name: SMITHSON, GLENNDA Inventor name: BURGESS, CATHERINE, E. Inventor name: CASMAN, STACIE, J. Inventor name: VERNET, CORINE, A., M. Inventor name: PADIGARU, MURALIDHARA Inventor name: ALSOBROOK, JOHN, P. Inventor name: SHENOY, SURESH |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION HAS BEEN WITHDRAWN |
|
| 18W | Application withdrawn |
Effective date: 20040505 |
|
| RIN1 | Information on inventor provided before grant (corrected) |
Inventor name: RASTELLI, LUCA Inventor name: ALSOBROOK, JOHN, P. Inventor name: GORSSE, WILLIAM Inventor name: CASMAN, STACIE, J. Inventor name: VERNET, CORINE, A., M. Inventor name: GANGOLLI, ESHA, A., Inventor name: SMITHSON, GLENNDA Inventor name: SHENOY, SURESH Inventor name: TCHERNEV, VELIZAR, T. Inventor name: WOLENC, ADAM R. Inventor name: SZEKERES, EDWARD, S. Inventor name: BURGESS, CATHERINE, E. Inventor name: PADIGARU, MURALIDHARA |