EP1250126A2 - Transepithelial delivery of glp-1 derivatives - Google Patents

Transepithelial delivery of glp-1 derivatives

Info

Publication number
EP1250126A2
EP1250126A2 EP01900109A EP01900109A EP1250126A2 EP 1250126 A2 EP1250126 A2 EP 1250126A2 EP 01900109 A EP01900109 A EP 01900109A EP 01900109 A EP01900109 A EP 01900109A EP 1250126 A2 EP1250126 A2 EP 1250126A2
Authority
EP
European Patent Office
Prior art keywords
glp
lys
arg
xaa
spacer
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP01900109A
Other languages
German (de)
French (fr)
Inventor
Keith Anderson
Henrik Agerso
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novo Nordisk AS
Original Assignee
Novo Nordisk AS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Novo Nordisk AS filed Critical Novo Nordisk AS
Publication of EP1250126A2 publication Critical patent/EP1250126A2/en
Withdrawn legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/007Pulmonary tract; Aromatherapy
    • A61K9/0073Sprays or powders for inhalation; Aerolised or nebulised preparations generated by other means than thermal energy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/26Glucagons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/542Carboxylic acids, e.g. a fatty acid or an amino acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00

Definitions

  • GLP-1 and analogues have been well- characterised over recent years. There is little doubt that the development of a pharmaceutically useful form of GLP-1 , or an analogue thereof, would result in a valuable addition to the available chemotherapeutic products for the treatment of diabetes and other metabolic disorders. It has been made clear that certain fatty-acyl derivatives of GLP-1 are prone to non- covalent self-association, which can lead to clinical failure (cf. Clodfelter DK et al. Effects of non-covalent self-association on the subcutaneous absorption of a therapeutic peptide. Pharm Res 15(2) (1998) 254-262).
  • the present invention relates to a new formulation comprising a stabilized GLP-1 compound, such as an analog, fragment or derivative thereof for delivery across pulmonary tissue in vivo.
  • a family of fatty-acylated GLP-1 compounds can be solubi- lized to a very high degree in water without formation of insoluble physical aggregates (> 5 mg/mL), are stable in solution without the requirement of additional stabilizing excipients in the formulation (eg. surfactants, cyclodextrins, etc.), are physically stable in solution in the presence of external stresses such as during exposure to high shear encountered during jet or ultrasonic nebulisation and are physically stable without forming insoluble aggregates or fibrillated products over time, and are metabolicly stable. Further, the solution structure of these candidates allow for simple formulation design changes to control pulmonary absorp- tion rates, thus having features which allow optimisation of drug delivery.
  • a pulmonary dosage form of a GLP-1 compound whereto is attached a lipo- philic substituent optionally via a spacer represents a non-invasive means of protein drug de- livery without the inconvenience and health/environmental risks associated with traditional injectable, needle-based medications.
  • permeability enhancers or absorption promoters are viewed as potentially toxic agents and will require much documentation to prove that they represent no potential harm to human subjects, especially when concerning such sensitive tissues as in the lung.
  • One class of potentially approvable enhancers are the protease inhibitors, however they are often required in excessive amounts to improve the delivery efficiency (cf. Patton JS, Bukar J, Nagarajan S. Inhaled insulin. Adv Drug Del Rev 35 (1999) 235-247).
  • Gly 8 -GLP-1 (7-37) designates a peptide which relates to GLP-1 (1-37) by the deletion of the amino acid residues at positions 1 to 6 and the substitution of the naturally occurring amino acid residue in position 8 (Ala) with Gly.
  • Lys 34 (N ⁇ -tetradecanoyl)-GLP-1(7-37) designates GLP-1 (7-37) wherein the ⁇ -amino group of the Lys residue in position 34 has been tetradecanoylated.
  • the present invention relates to a new formulation for use in a pulmonary device, comprising a soluble and, solution stabilized, metabolic stabilized, and/or stress stabilized GLP-1 compound for delivery across pulmonary tissue in vivo.
  • the present invention relates to a method for preparing a formulation for use in a pulmonary device, said formulation comprising a soluble and, solution stabilized, metabolic stabilized, and/or stress stabilized GLP-1 compound for delivery across pulmonary tissue in vivo.
  • Typical, soluble GLP-1 compounds are compounds that, within the pH range of 4-9, within a temperature range of 0-50°C, in isotonic buffered solutions, at concentrations in solution representing no less than a 1 :1 potency:bioavailable dose ratio when compared to na- tive GLP-1 , demonstrate no formation of insoluble aggregates (or insoluble material), according to techniques acceptable in the art.
  • Typical, solution stabilized GLP-1 compounds are compounds, which, in the presence of no stabilizing excipients (e.g. surfactants, cyclodextrins, etc.), within the pH range of 4-9, within a temperature range of 0-50°C, in isotonic buffered solutions, after storage of at least 3 months, demonstrate the presence of:
  • no stabilizing excipients e.g. surfactants, cyclodextrins, etc.
  • Typical, metabolic stabilized GLP-1 compounds are compounds, which demonstrate, after introduction into mammals within the therapeutic window, terminal plasma half-lives of greater than 1 hour, as measured by techniques acceptable in the art.
  • Typical, stress stabilized GLP-1 compounds are compounds which maintain > 75% of initial bioactivity after exposure to conditions associated with manufacturing processes, de- livery processes, handling or storage conditions, as measured by techniques acceptable in the art.
  • the therapeutic window is a range of drug concentrations within which the probability of the desired clinical response is relatively high and the probability of unacceptable toxicity is relatively low. Evans, WE ed., Applied Pharmacokinetics : Principles of Therapeutic Drug Monitoring, 3 rd ed, Ch 1-3, 1992.
  • a way of preparing a soluble and, solution stabilized, metabolic stabilized, and/or stress stabilized GLP-1 compound ideal for delivery across pulmonary tissue in vivo is by modifying the structure of a GLP-1 analogue by introducing a lipophilic substituent optionally via a spacer.
  • a spacer is present.
  • the present invention relates to a pulmonary liquid or dry formulation comprising a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer.
  • the present invention relates to a method for preparing a pulmonary liquid or dry formulation for use in a pulmonary device, said formulation comprising a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer.
  • the present invention relates to a pulmonary delivery device comprising a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer.
  • the present invention relates to a method for preparing a pulmonary delivery device, said device comprising a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer.
  • the present invention relates to a method of reducing blood glu- cose levels, treating diabetes type I, diabetes type II or obesity, or inhibiting gastric acid secretion, or inhibiting apoptosis of ⁇ -cells, comprising administering to a patient in need thereof an effective amount of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer, by inhalation so as to deposit said GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer in the lungs of the patient.
  • the present invention relates to a method of treating gastric ulcers comprising administering to a patient in need thereof an effective amount of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer, by inhalation so as to deposit said GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer in the lungs of the patient.
  • the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary liquid or dry formulation for reducing blood glucose levels.
  • the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary liquid or dry formulation for treating diabetes type I.
  • the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary liquid or dry formulation for treating diabetes type II.
  • the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary liquid or dry formulation for treating obesity.
  • the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary liquid or dry formulation for treating gastric ulcers.
  • the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary liquid or dry formulation for inhibition of apoptosis of ⁇ -cells.
  • the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary delivery device for reducing blood glucose levels.
  • the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary delivery device for treating diabetes type I.
  • the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary delivery device for treating diabetes type II.
  • the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary delivery device for treating obesity. In a further aspect the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary delivery device for treating gastric ulcers.
  • the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary delivery device for inhibition of apoptosis of ⁇ -cells.
  • the lipophilic substituent may be attached to an amino group of the GLP-1 compound by means of a carboxyl group of the lipophilic substituent which forms an amide bond with an amino group of the amino acid residue to which it is attached.
  • the lipophilic substituent may be attached to said amino acid residue in such a way that an amino group of the lipophilic substituent forms an amide bond with a carboxyl group of the amino acid residue.
  • the lipophilic substituent may be linked to the GLP-1 compound via an ester bond.
  • the ester can be formed either by reaction between a carboxyl group of the GLP-1 compound and a hydroxyl group of the substituent-to-be or by reaction between a hydroxyl group of the GLP-1 compound and a carboxyl group of the substituent- to-be.
  • the lipophilic substituent can be an alkyl group which is introduced into a primary amino group of the GLP-1 compound.
  • the lipophilic substituent may be attached to the GLP-1 compound by means of a spacer in such a way that a carboxyl group of the spacer forms an amide bond with an amino group of the GLP-1 compound.
  • a spacer must contain at least two functional groups, one to attach to a functional group of the lipophilic substituent and the other to a functional group of the parent GLP-1 peptide. Examples of suitable spacers are succinic acid, lysyl, glutamyl, asparagyl, glycyl, beta-alanyl and gamma-aminobutanoyl, or a dipeptide such as Gly-Lys, each of which constitutes an individual embodiment.
  • one carboxyl group thereof may form an amide bond with an amino group of the amino acid residue, and the other carboxyl group thereof may form an amide bond with an amino group of the lipophilic substituent.
  • the spacer is lysyl, glutamyl, asparagyl, glycyl, beta-alanyl or gamma-aminobutanoyl
  • the carboxyl group thereof may form an amide bond with an amino group of the amino acid residue
  • the amino group thereof may form an amide bond with a carboxyl group of the lipophilic substituent.
  • a further spacer may in some instances be inserted between the ⁇ -amino group of Lys and the lipophilic substituent.
  • a further spacer is succinic acid which forms an amide bond with the ⁇ -amino group of Lys and with an amino group present in the lipophilic substituent.
  • such a further spacer is Glu or Asp which forms an amide bond with the ⁇ -amino group of Lys and another amide bond with a carboxyl group present in the lipophilic substituent, that is, the lipophilic substituent is a N ⁇ -acylated lysine residue.
  • the spacer is an amino acid residue except Cys or Met, or a dipeptide such as Gly-Lys.
  • a dipeptide such as Gly-Lys means any combination of two amino acids except Cys or Met, preferably a dipeptide wherein the C-terminal amino acid residue is Lys, His or Trp, preferably Lys, and the N-terminal amino acid residue is Ala, Arg, Asp, Asn, Gly, Glu, Gin, lie, Leu, Val, Phe, Pro, Ser, Tyr, Thr, Lys, His and Trp.
  • an amino group of the GLP-1 compound forms an amide bond with a carboxylic group of the amino acid residue or dipeptide spacer
  • an amino group of the amino acid residue or dipeptide spacer forms an amide bond with a carboxyl group of the lipophilic substituent.
  • Examples of such GLP-1 compounds whereto is attached one or more lipophilic substituents optionally via a spacer have been disclosed in e.g EP 0708179, WO 98/08871 , WO 99/43705, WO 99/43706, WO 99/43707, WO 99/43708, WO 99/43341 , which are incorporated herein by reference.
  • the GLP-1 compounds whereto is attached one or more lipophilic substituents optionally via a spacer are useful in treatment of diabetes mellitus (types I or II) and prevention of hyperglycaemia, as well as in treatment of obesity, or gastric ulcers, or in inhibition of apoptosis of ⁇ -cells, upon administering to a patient in need thereof an effective amount of a pulmonary formulation comprising a stabilized GLP-1 compound by inhalation so as to deposit said stabilized GLP-1 compound in the lungs of the patient.
  • exendin-3 and -4 and fragments are useful in treatment of diabetes mellitus (types I or II) and prevention of hyperglycaemia. They normalise hyperglycaemia through glucose-dependent, insulin-independent and insulin- dependent mechanisms.
  • Exendin-4 is specific for exendin receptors, i.e. it does not interact with vasoactive intestinal peptide receptors.
  • WO 9746584 describes truncated versions of exendin peptide(s) for treating diabetes. The disclosed peptides increase secretion and biosynthesis of insulin, but reduce those of glucagon. The truncated peptides can be made more economically than full length versions.
  • the GLP-1 compound is GLP-1 (7-37) or GLP-1 (7- 36) amide.
  • the GLP-1 compound is exendin or an ana- log thereof.
  • the GLP-1 compound whereto is attached a lipophilic substituent via a spacer is Arg 34 Lys 26 (N ⁇ -( ⁇ -glutamyl(N ⁇ -hexadecanoyl)))-GLP-1(7- 37)-OH.
  • the GLP-1 compound whereto is attached a lipophilic substituent via a spacer is Arg 18 , Leu 20 , Gin 34 , Lys 33 (N ⁇ -( ⁇ -aminobutyroyl(N ⁇ - hexadecanoyl))) Exendin-4-(7-45)-NH 2 .
  • the GLP-1 compound whereto is attached a lipophilic substituent via a spacer is Arg 33 , Leu 20 , Gin 34 , Lys 18 (N ⁇ -( ⁇ -aminobutyroyl(N ⁇ - hexadecanoyl))) Exendin-4-(7-45)-NH 2 .
  • the GLP-1 compound is a GLP-1 analogue.
  • the GLP-1 analogue is selected from the Thr 8 , Met 8 , Gly 8 and Val 8 analogues of GLP-1 (7-37) and GLP-1 (7-36) amide, more preferred the Gly 8 and Val 8 analogues of GLP-1 (7-37) and GLP-1 (7-36) amide, most preferred the Val 8 analogues of GLP-1 (7-37) and GLP-1 (7-36) amide.
  • the GLP-1 analogue has the formula II:
  • Xaa at posit on 8 is Ala, Gly, Ser, Thr, Leu, lie, Val, Glu, Asp, Met, or Lys
  • Xaa at posit on 9 is Glu, Asp, or Lys
  • Xaa at posit on 11 is Thr, Ala, Gly, Ser, Leu, lie, Val, Glu, Asp, or Lys
  • Xaa at positi on 18 Ser, Ala, Gly, Thr, Leu, lie,
  • the amino acids at positions 37-45 are absent.
  • the amino acids at positions 38-45 are absent. In another embodiment of the GLP-1 analogue of formula II, the amino acids at posi- tions 39-45 are absent.
  • Xaa at position 8 is Ala, Gly, Ser, Thr, Met, or Val.
  • Xaa at position 8 is Gly, Thr, Met, or Val.
  • Xaa at position 8 is Val.
  • Xaa at position 9 is Glu.
  • Xaa at position 11 is Thr.
  • Xaa at position 14 is Ser.
  • Xaa at position 16 is Val.
  • Xaa at position 17 is Ser.
  • Xaa at position 18 is Ser, Lys, Glu, or Asp.
  • Xaa at position 19 is Tyr, Lys, Glu, or Asp.
  • Xaa at position 20 is Leu, Lys, Glu, or Asp.
  • Xaa at position 21 is Glu, Lys, or Asp.
  • Xaa at position 22 is Gly,
  • Xaa at position 23 is Gin, Glu, Asp, or Lys.
  • Xaa at position 24 is Ala, Glu, Asp, or Lys.
  • Xaa at position 25 is Ala, Glu, Asp, or Lys.
  • Xaa at position 26 is Lys, Glu, Asp, or Arg.
  • Xaa at position 27 is Glu
  • Xaa at position 30 is Ala, Glu, Asp, or Lys.
  • Xaa at position 31 is Trp, Glu, Asp, or Lys.
  • GLP-1 analogue of formula Xaa at position 32 is Leu, Glu, Asp, or Lys.
  • Xaa at position 33 is Val, Glu, Asp, or Lys.
  • Xaa at position 34 is Lys,
  • Xaa at position 35 is Gly, Glu, Asp, or Lys.
  • Xaa at position 36 is Arg, Lys, Glu, or Asp.
  • Xaa at position 37 is Gly, Glu, Asp, or Lys.
  • Xaa at position 38 is Arg, or Lys, or is deleted. In another embodiment of the GLP-1 analogue of formula I, Xaa at position 39 is de- leted.
  • Xaa at position 40 is de- leted.
  • Xaa at position 42 is de- leted.
  • Xaa at position 43 is de- leted.
  • Xaa at position 44 is deleted.
  • Xaa at position 45 is deleted.
  • Xaa at position 26 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-36).
  • Xaa at position 26 is Arg
  • each of Xaa at positions 38-45 is deleted
  • each of the other Xaa is the amino acid in native GLP-1 (7-37).
  • Xaa at position 26 is Arg
  • each of Xaa at positions 39-45 is deleted
  • each of the other Xaa is the amino acid in native GLP-1 (7-38).
  • Xaa at position 34 is Arg
  • each of Xaa at positions 37-45 is deleted
  • each of the other Xaa is the amino acid in native GLP-1 (7-36).
  • Xaa at position 34 is Arg, each of Xaa at positions 38-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-37).
  • Xaa at position 34 is Arg, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-38).
  • Xaa at positions 26 and 34 is Arg
  • Xaa at position 36 is Lys
  • each of Xaa at positions 37-45 is deleted
  • each of the other Xaa is the amino acid in native GLP-1 (7-36).
  • Xaa at positions 26 and 34 is Arg
  • Xaa at position 36 is Lys
  • each of Xaa at positions 38-45 is deleted
  • each of the other Xaa is the amino acid in native GLP-1 (7-37).
  • Xaa at positions 26 and 34 is Arg
  • Xaa at position 36 is Lys
  • each of Xaa at positions 39-45 is deleted
  • each of the other Xaa is the amino acid in native GLP-1 (7-38).
  • Xaa at positions 26 and 34 is Arg
  • Xaa at position 38 is Lys
  • each of Xaa at positions 39-45 is deleted
  • each of the other Xaa is the amino acid in native GLP-1 (7-38).
  • Xaa at position 8 is Thr, Ser, Gly, or Val
  • Xaa at position 37 is Glu
  • Xaa at position 36 is Lys
  • each of Xaa at positions 38- 45 is deleted
  • each of the other Xaa is the amino acid in native GLP-1 (7-37).
  • Xaa at position 8 is Thr, Ser, Gly, or Val
  • Xaa at position 37 is Glu
  • Xaa at position 36 is Lys
  • each of Xaa at positions 39- 45 is deleted
  • each of the other Xaa is the amino acid in native GLP-1 (7-38).
  • Xaa at position 8 is Thr, Ser, Gly or Val
  • Xaa at position 37 is Glu
  • Xaa at position 38 is Lys
  • each of Xaa at positions 39- 45 is deleted
  • each of the other Xaa is the amino acid in native GLP-1 (7-38).
  • Xaa at position 18, 23 or 27 is Lys
  • Xaa at positions 26 and 34 is Arg
  • each of Xaa at positions 38-45 is deleted
  • each of the other Xaa is the amino acid in native GLP-1 (7-37).
  • Xaa at position 18, 23 or 27 is Lys
  • Xaa at positions 26 and 34 is Arg
  • each of Xaa at positions 39-45 is deleted
  • each of the other Xaa is the amino acid, in native GLP-1 (7-38).
  • Xaa at position 8 is Thr, Ser, Gly, or Val
  • Xaa at position 18, 23 or 27 is Lys
  • Xaa at position 26 and 34 is Arg
  • each of Xaa at positions 37-45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1(7-36).
  • Xaa at position 8 is Thr, Ser, Gly, or Val
  • Xaa at position 18, 23 or 27 is Lys
  • Xaa at position 26 and 34 is Arg
  • each of Xaa at positions 38-45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1(7-37).
  • Xaa at position 8 is Thr, Ser, Gly, or Val
  • Xaa at position 18, 23 or 27 is Lys
  • Xaa at position 26 and 34 is Arg
  • each of Xaa at positions 39-45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1(7-38).
  • Such GLP-1 analogues of formula II includes, but is not limited to, Arg 26 -GLP- 1(7-37); Arg 34 -GLP-1(7-37); Lys 36 -GLP-1(7-37); Arg 2634 Lys 36 -GLP-1 (7-37); Arg 2634 Lys 38 GLP-1(7-38); Arg 263 Lys 39 -GLP-1 (7-39); Arg 2634 Lys 40 -GLP-1(7-40); Arg 26 Lys 36 -GLP-1 (7-37); Arg ⁇ Lys ⁇ -GLP- 1(7-37); Arg 26 Lys 39 -GLP-1(7-39); Arg 34 Lys 40 -GLP-1(7-40); Arg 263 Lys 36 ' 39 -GLP-1(7-39); Arg ⁇ Lys ⁇ -GLP-l (7-40); Gly 8 Arg26-GLP-1 (7-37); Gly' ⁇ rg ⁇ -GLP-l (7-37); Val 8 -
  • R 1 , R 2 and R 3 are independently H, lower alkyl having 1 to 6 carbon atoms, optionally substituted phenyl, NH 2 , NH-CO-(lower alkyl), -OH, lower alkoxy having 1 to 6 carbon atoms, halogen, SO 2 -(lower alkyl) or CF 3 , said phenyl is optionally substituted with at least one group selected from NH 2 , -OH, lower alkyl or lower alkoxy having 1-6 carbon atoms, halogen, SO 2 - (lower alkyl), NH-CO-(lower alkyl) or CF 3 , or R and R 2 may together form a bond;
  • Y is a five or six membered ring system selected from the group consisting of:
  • Z is N, O or S
  • said ring system is optionally substituted with one or more functional groups selected from the group consisting of NH 2 , NO 2 , OH, C 1-6 alkyl, C 1-6 alkoxy, halogen (Cl,
  • B is an integer in the range of 35-45;
  • X is -OH, -NH 2 , or a C 1-6 alkyl amide or C 1-6 dialkyl amide group; or an analogue thereof.
  • GLP-1 analogues of formula III includes, but is not limited to
  • Each one of these specific GLP-1 analogues constitutes an alternative embodiment of the invention.
  • the GLP-1 analogue has the formula IV
  • A is a peptide comprising the amino acid residues of GLP-1 (8-18) or a fragment thereof;
  • B is an integer in the range of 35-45;
  • X is -OH, -NH 2 , or a C 1-6 alkyl amide or C ⁇ dialkyl amide group; or an analogue thereof.
  • A is a peptide selected from the group consisting of GLP-1 (8-18), GLP-1 (9-18), GLP-1 (10-18), GLP-1 (11-18), GLP-1 (12-18),
  • A is GLP-1 (8-18), GLP-1 (9-18), GLP-1 (10-18), GLP-1 (11 -18) or GLP-1 (12-18), and
  • B is 36, 37 or 38. Most preferably, A is GLP-1 (8-18). In a further embodiment of the GLP-1 analogue of formula IV, B is 35, 36, 37, 38, 39,
  • B is 36. In another more preferred embodiment. B is 37. In another more preferred embodiment, B is 38.
  • Such GLP-1 analogues of formula IV includes, but is not limited to
  • the lipophilic substituent comprises 4-40 carbon atoms. In a further embodiment of the present invention the lipophilic substituent comprises 8-30 carbon atoms. In a further embodiment of the present invention the lipophilic substituent comprises 8-25 carbon atoms. In a further embodiment of the present invention the lipophilic substituent comprises 12-25 carbon atoms. In a further embodiment of the present invention the lipophilic substituent comprises 14-18 carbon atoms.
  • the lipophilic substituent(s) contain a functional group which can be attached to one of the following functional groups of an amino acid of the parent GLP-1 compound:
  • a lipophilic substituent is attached to the carboxy group of the R group of any Asp and Glu residue. In another embodiment, a lipophilic substituent is attached to the carboxy group attached to the alpha-carbon of the C-terminal amino acid.
  • a lipophilic substituent is attached to the epsilon- amino group of any Lys residue.
  • Each lipophilic substituent contains a functional group which may be attached to a functional group of an amino acid of the parent GLP-1 compound.
  • a lipophilic substituent may contain a carboxyl group which can be attached to an amino group of the parent GLP-1 peptide by means of an amide bond.
  • the lipophilic substituent comprises a partially or completely hydrogenated cyclopentanophenathrene skeleton. In another embodiment, the lipophilic substituent is a straight-chain or branched alkyl group.
  • the lipophilic substituent is an acyl group of a straight-chain or branched fatty acid. In a further embodiment the lipophilic substituent is an acyl group having the formula
  • the lipophilic substituent is selected from the following individual embodiments CH 3 (CH 2 ) ⁇ 2 CO-, CH 3 (CH 2 ) 14 CO-, CH 3 (CH 2 ) ⁇ 6 CO-, CH 3 (CH 2 ) 18 CO-, CH 3 (CH 2 ) 2 oCO- and CH 3 (CH ) 22 CO-.
  • the lipophilic substituent is tetradecanoyl.
  • the lipophilic substituent is hexadecanoyl.
  • the lipophilic substituent has a group which is negatively charged such as a carboxylic acid group.
  • the lipophilic substituent may be an acyl group of a straight-chain or branched alkane ⁇ , ⁇ -dicarboxylic acid of the formula HOOC(CH 2 ) m CO-, wherein m is an integer from 4 to 38, preferably an integer from 12 to 38, and most preferably is HOOC(CH 2 ) ⁇ 4 CO-, HOOC(CH 2 ) 16 CO-, HOOC(CH 2 ) ⁇ 8 CO-, HOOC(CH 2 ) 20 CO- or HOOC(CH 2 ) 22 CO-.
  • the lipophilic substituent is attached to the parent GLP-1 compound by means of a spacer.
  • a spacer must contain at least two functional groups, one to attach to a functional group of the lipophilic substituent and the other to a functional group of the parent GLP-1 compound.
  • the spacer is an amino acid residue except Cys or Met. In another embodiment, the spacer is a dipeptide such as Gly-Lys.
  • the spacer is selected from lysyl, glutamyl, asparagyl, glycyl, beta-alanyl and gamma-aminobutanoyl, each of which constitutes an individual embodiment. Most preferred spacers are glutamyl and beta-alanyl.
  • the spacer is an unbranched alkane ⁇ , ⁇ -dicarboxylic acid group having from 1 to 7 methylene groups, which spacer forms a bridge between an amino group of the parent peptide and an amino group of the lipophilic substituent.
  • the spacer is succinic acid.
  • the lipophilic substituent with the attached spacer is a group of the formula CH 3 (CH 2 )pNH-CO(CH 2 ) q CO-, wherein p is an integer from 8 to 33, such as from 12 to 28 and q is an integer from 1 to 6, such as 2.
  • the lipophilic substituent with the attached spacer is a group of the formula CH3(CH 2 ) r CO-NHCH(COOH)(CH 2 ) 2 CO-, wherein r is an integer from 4 to 24, such as from 10 to 24.
  • the lipophilic substituent with the attached spacer is a group of the formula CH 3 (CH 2 )sCO-NHCH((CH 2 ) 2 COOH)CO-, wherein s is an integer from 4 to 24, preferably from 10 to 24.
  • the lipophilic substituent is a group of the formula COOH(CH 2 ) t CO- wherein t is an integer from 6 to 24.
  • the lipophilic substituent with the attached spacer is a group of the formula -NHCH(COOH)(CH 2 ) 4 NH-CO(CH 2 ) u CH 3 , wherein u is an integer from 8 to 18.
  • the lipophilic substituent with the attached spacer is a group of the formula CH 3 (CH 2 ) v CO-NH-(CH 2 ) z -CO, wherein v is an integer from 4 to 24 and z is an integer from 1 to 6.
  • the lipophilic substituent with the attached spacer is a group of the formula -NHCH(COOH)(CH 2 ) 4 NH-COCH((CH 2 ) 2 COOH)NH-CO(CH 2 ) w CH 3 , wherein w is an integer from 10 to 16.
  • the lipophilic substituent with the attached spacer is a group of the formula -NHCH(COOH)(CH 2 ) 4 NH-CO(CH 2 ) 2 CH(COOH)NHCO(CH 2 ) ⁇ CH3, wherein x is zero or an integer from 1 to 22, such as from 10 to 16.
  • GLP-1 means GLP-1 (7-37) or GLP-1 (7-36) amide.
  • the amino acid sequence of GLP-1 is given La. by Schmidt et al. (Diabetologia 28 704-707 (1985).
  • treatment is defined as the management and care of a patient, e.g. a mammal, in particular a human, for the purpose of combating the disease, condition, or disorder and includes the administration of a GLP-1 compound to prevent the onset of the symptoms or complications, or alleviating the symptoms or complications, or eliminating the disease, condition, or disorder.
  • a GLP-1 compound is intended to indicate GLP-1 or an ana- logue or a derivative thereof, or exendin or an analogue or a derivative thereof, which binds to a GLP-1 receptor, preferably with an affinity constant, K D , below 1 ⁇ M, e.g. below 100 nM.
  • GLP-1 compounds are described in WO 93/19175 (Novo Nordisk A/S). Suitable GLP-1 compounds have been disclosed in e.g. WO 87/06941 , WO 90/11296, WO 93/25579, WO 91/11457, EP 0699686, WO 98/43658, EP 0619322, which are incorporated herein by reference.
  • a GLP-1 compound is also intended to comprise active metabolites and prodrugs thereof, such as active metabolites and prodrugs of GLP-1 or an analogue or a derivative thereof, or exendin or an analogue or a derivative thereof.
  • a “metabolite” is an active derivative of a GLP-1 compound produced when the GLP-1 compound is metabolized.
  • a “prodrug” is a compound which is either metabolized to a GLP-1 compound or is metabolized to the same metabolite(s) as a GLP-1 compound.
  • an analogue is used to designate a peptide wherein one or more amino acid residues of the parent peptide have been substituted by another amino acid residue and/or wherein one or more amino acid residues of the parent peptide have been deleted and/or wherein one or more amino acid residues have been added to the parent peptide.
  • Such addition can take place either in the peptide, at the N-terminal end or at the C- terminal end of the parent peptide, or any combination thereof.
  • derivative is used in the present text to designate a peptide in which one or more of the amino acid residues of the parent peptide have been chemically modified, e.g. by alkylation, acylation, ester formation or amide formation.
  • lipophilic substituent is characterised by comprising 4-40 carbon atoms and having a solubility in water at 20°C in the range from about 0.1 mg/100 ml water to about 250 mg/100 ml water, preferable in the range from about 0.3 mg/100 ml water to about 75 mg/100 ml water.
  • octanoic acid (C8) has a solubility in water at 20°C of 68 mg/100 ml
  • decanoic acid (C10) has a solubility in water at 20°C of 15 mg/100 ml
  • octa- decanoic acid (C18) has a solubility in water at 20°C of 0.3 mg/100 ml.
  • spacer is used in the present text to designate a bivalent moiety which contain at least two functional groups, one to attach to a functional group of the lipophilic substituent and the other to a functional group of the GLP-1 compound.
  • suitable spacers are succinic acid, lysyl, glutamyl, asparagyl, glycyl, beta-alanyl and gamma- aminobutanoyl, or a dipeptide such as Gly-Lys.
  • an effective amount is the effective dose to be determined by a qualified practitioner, who may titrate dosages to achieve the desired response.
  • Factors for considera- tion of dose will include potency, bioavailability, desired pharmacokinetic/pharmacodynamic profiles, condition of treatment (e.g. diabetes, obesity, gastric ulcers), patient-related factors (e.g. weight, health, age, etc.), presence of co-administered medications (e.g. insulin), time of administration, or other factors known to a medical practitioner.
  • an effective amount of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer will range from 0.01 - 1000.0 ⁇ g/kg, more preferably from 0.05 - 500 ⁇ g/kg, even more preferably from 0.1 - 100 ⁇ g/kg, such as from 0.5 - 50 ⁇ g/kg .
  • Ranges of required daily doses would typically include the equivalent of about 0.1- 4.0 inhalations/day.
  • the inhaled GLP-1 compound whereto is at- tached a lipophilic substituent optionally via a spacer is administered once daily and demonstrate bioequivalence to a sub-cutaneous dosage form.
  • the pulmonary formulation is a liquid formulation, such as a solution or a suspension.
  • the pulmonary formulation is a dry formulation.
  • the pulmonary delivery device is selected from nebulizers, such as jet or ultrasonic nebulizers, metered-dose inhalers, or dry powder inhalers. Each of said devices is considered an individual embodiment.
  • aerosol formulations for pulmonary delivery of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer could be designed which minimise the excipient requirements and maximise bioactive delivery of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer to the deep lung (i.e. alveolar tissue), where compounds are known to be predominantly absorbed (cf. Yu J, Chien YW. Pulmonary drug delivery: Physiologic and mechanistic aspects. Crit Rev Ther Drug Carr Sys 14(4) (1997) 395-453).
  • formulations should also be designed in accordance with common pharmaceutical development goals and have features such as, long-term stability and preservation from bacterial or fungal contamination during defined shelf-lives. Additionally, formulations should allow for controlled delivery profiles in order to optimise the pharmacokinetic/pharmacodynamic profile following in vivo pulmonary delivery of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer.
  • the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer may be produced by any recognised peptide / protein synthetic, semi-synthetic and/or recombinant DNA techniques.
  • the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer can be delivered in a vehicle, as a solution, suspension, or dry powder and can be administered by any of the known devices suitable for pulmonary drug delivery known in the art.
  • a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer can be administered by any of three general types of aerosol-generating systems for pulmonary drug delivery, and include jet or ultrasonic nebulizers, metered-dose inhalers, or dry powder inhalers (Cf. Yu J, Chien YW. Pulmonary drug delivery: Physiologic and mechanistic aspects. Crit Rev Ther Drug Carr Sys 14(4) (1997) 395-453).
  • MMAD mass median aerodynamic diameter
  • MMEAD mass median effective aerodynamic diameter
  • the aerodynamic diameter (d a ) of a particle is defined as the geometric equivalent diameter of a reference standard spherical particle of unit density (1 g/cm 3 ).
  • d a is related to a reference diameter (d) as a function of the square root of the density ratio as described by:
  • MMAD is normally measured by cascade impactors, which estimate the particle size based on the particle behavior in a high velocity airstream. It is commonly accepted that a MMAD window between 1-3 ⁇ m is optimal for deposition of particles in the deep lung.
  • stable liquid formulations of GLP-1 compounds whereto is attached a lipophilic substituent optionally via a spacer can be designed for nebulisation.
  • Such liquid formulations may contain preservative agents, isotonicty agents, buffering agents, antioxidants, flavorants, or delivery modifying agents so as to improve the shelf-life and performance of formulated products.
  • Preservatives may be required to develop a commercial product for multiple-use.
  • Preservatives may include, but are not limited to, phenolics, such as phenol or m-cresol, benzyl alcohol, chlorobutanol, parabens, quaternary ammonium compounds, thirmerosal, or phenylmercuric salts or combinations thereof. Phenol or m-cresol at concentrations between 2 - 5 mg/mL is preferred as a preservative agent.
  • Pharmaceutically acceptable isotonicity agents may include NaCI, dextrose, manni- tol, lactose, or glycerin.
  • Pharmaceutically acceptable buffering agents for controlling formulation pH may include, but are not limited to, phosphates, citrates, acetates, TRIS, amino acids, or amino acid based salts (e.g. glycylglycine).
  • Pharmaceutically acceptable antioxidants may be included to improve the chemical stability profile of the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer. Suitable antioxidants may include, but are not limited to, phenolic compounds (e.g.BHT, BHA, popyl gallate, ⁇ -tocopherol), reducing agents (e.g. methionine, ascorbic acid, sodium sulfite, thioglycerol, thioglycolic acid), or chelating agents (e.g. EDTA, citric acid, or thioglycolic acid).
  • phenolic compounds e.g.BHT, BHA, popyl gallate, ⁇ -tocopherol
  • reducing agents e.g.
  • delivery modifying agents in this context, can include substances which can be added to the formulation in order to improve delivery efficiency of the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer to the lower lung, or modify the permeation of the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer across the pulmonary epithelium.
  • the added ingredient may: 1) on exposure to an aerosol-generating device, facilitate nebulisation of liquids to achieve particle sizes within the optimum window of 1-3 ⁇ m MMAD, which has been defined as being optimal for deep lung deposition (cf. Edwards DA, Ben-Jebria A, Langer R.
  • Typical formulations for nebulisation would normally include between 0.1 - 100 mg of the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer per mL solution. More preferably between 1 - 50 mg protein per mL solution.
  • One liquid formulation for nebulization could include a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer at 5mg/mL, phenol at 5.0 mg/mL, mannitol at 38 mg/mL, and phosphate- buffer adjusted to about pH 7.4 in bacteriostatic water for injection.
  • the liquid formulation could be nebulised by any known nebulisation technology, such as jet or ultrasonic nebulisation, to achieve a MMAD of aerosol particles less than 10 ⁇ m, more preferably between 1-5 ⁇ m, and most preferably between 1-3 ⁇ m.
  • nebulisation technology such as jet or ultrasonic nebulisation
  • An example of a clinically useful nebuliser could be the Maxin® nebuliser developed by Clinova Medical AB (Malmo, Swe).
  • the particle distribution is substantially narrow so as to provide an optimal, reproducible delivery of the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer to the lung.
  • the preferred particle size range is based on the most effective size range for delivery of drug to the deep lung, where protein is optimally absorbed.
  • advanced nebulisation techniques such as those provided for by Aradigm Corp. (AERx® system) could be utilised (cf. US 5,934,272; US 5,855,564).
  • the GLP-1 compound whereto is attached a lipophilic sub- stituent optionally via a spacer could be formulated as a dry powder for inhalation.
  • Dry powders have the advantages of room-temperature stability, and high drug payload (e.g. dry powder aerosols contain between 50-95% pure drug) when compared to aqueous formulations for nebulisation, or metered dose inhalers (MDIs), an additional advantage is that DPIs (dry powder inhalers) do not require the co-ordination necessary to operate traditional MDIs (metered dose inhalers) since most are breath activated and are optimally designed to deliver consistent doses independent of inspiratory flow rates over a wide range.
  • MDIs dry powder inhalers
  • Dry powder formulations can be designed to be highly soluble in pulmonary fluid.
  • controlled pulmonary delivery may be achieved by modifying the solubility of the dry powder formulation, modifying the aggregation state of the solubilized GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer, or the dry powder particle size.
  • Additives may be included to facilitate controlled pulmonary delivery, processing and filling of powders, aersoli- sation efficiency of the powder, chemical stabilization, or to provide cosmetic appeal (e.g. flavorants).
  • Examples of processing, filling, and metering methods for developing dry powders for inhalation are provided for in e.g. US 5,874,064, US 5,855,913, WO9829096, WO9829098, WO9829140, WO9829141 , WO9816205, WO9741833, WO 97/41833, US 5,780,014, WO 99/16419, US 5,699,649, US 5,654,007, WO 97/47286, WO 98/13031 , US 5725841 , WO 98/34596, WO 99/36334, WO 98/35888, WO 98/30262.
  • excipients can include, but are not limited to, substances which can be added to the formulation in order to improve dry powder processing, metering, and filling, de- livery efficiency of the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer to the lower lung, or modify the permeation of the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer across the pulmonary epithelium.
  • the added ingredient may: 1) facilitate processing of dry powders to achieve particle sizes within the optimum window of 1-3 ⁇ m MMAD, which has been defined as being optimal for deep lung deposition (cf. Edwards DA, Ben-Jebria A, Langer R.
  • excipients include, but are not limited to, complexing agents (e.g. divalent metals, cyclodextrins, pro- teins/polypeptides (e.g. albumin, protamine)), phospholipids, glycolipids, glycerides, carbohydrates, surfactants, biocompatible polymers (polyethylene glycols, PLGA derivatives, plu- ronics, methylcellulose derivatives, etc.), salts, amino acids, or, alternatively, small organic molecules as described by Emisphere Technologies (cf. WO 98/25589).
  • Choice and amount of excipients in the formulation would depend primarily on the excipients safety record (i.e. toxicological profile). This safety record would be based on relative systemic and local pulmonary toxicity determinations.
  • no added excipient will adversely affect the airways of a patient.
  • antioxidants may be added to prevent chemical degradation of the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer.
  • Suitable antioxidants may include, but are not limited to, phenolic compounds (e.g.BHT, BHA, popyl gallate, ⁇ -tocopherol), reducing agents (e.g. methionine, ascorbic acid, sodium sulfite, thioglycerol, thioglycolic acid), or chelating agents (e.g. EDTA, citric acid, or thioglycolic acid).
  • phenolic compounds e.g.BHT, BHA, popyl gallate, ⁇ -tocopherol
  • reducing agents e.g. methionine, ascorbic acid, sodium sulfite, thioglycerol, thioglycolic acid
  • chelating agents e.g. EDTA, citric acid, or thioglycolic acid.
  • dry powders for inhalation would contain between 50 - 100 %, more preferably between 75-100%, and most preferably between 90 - 100% GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer on a w/w basis.
  • the dry powder formulation should be designed to contain a MMAD of aerosol particles less than 10 ⁇ m, more preferably between 1-5 ⁇ m, and most preferably between 1-3 ⁇ m.
  • the particle distribution is substantially narrow so as to provide an optimal, reproducible delivery of GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer to the lung.
  • the preferred particle size range is based on the most effective size range for delivery of drug to the deep lung, where protein is optimally absorbed.
  • the defined optimal particle size range of the protein powders may be obtained by any conventional method know to those skilled in the art, such as spray-drying, spray-coating, jet-milling, extrusion, micronization, lyophilisation, solution condensation, or the like
  • the above particles may be supplied to the aerosol-generating device as redisper- sable aggregates or agglomerates in order to improve the powder handling characteristics, for example during filling of unit dose blister packs.
  • Aggregates, agglomerates, or granules may be formed by techniques known in the art, for example formation of a wetted particle mass with a binding solvent, extrusion of wetted mass through fine mesh screens (ca. 40 - 650 ⁇ m), and subsequent drying, sieving, and optional spheronization steps. Examples of such processes used in protein formulations are provided for in e.g. WO 99/48476, US 5,780,014 and US 5,654,007, and are recognised in the art.
  • Formation of aggregates, agglomerates, granules or the like may include the use of non aqueous solvents such as, a flu- rocarbon (e.g. perfluorodecalin, perfluorooctylbromide), toluene, xylene, benzene, acetone, hexane, octane, chloroform and methylene chloride.
  • a flu- rocarbon e.g. perfluorodecalin, perfluorooctylbromide
  • toluene xylene
  • benzene benzene
  • acetone hexane
  • octane chloroform
  • methylene chloride e.g. perfluorodecalin, perfluorooctylbromide
  • Packaging of drug product is typically done in unit dose blisters or cartridges, and is completed by techniques know in the art.
  • Embodiments of devices suitable for dry powder pulmonary delivery of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer include, but are not limited to, devices provided for by 3M, Inhale Therapeutic Systems, Advanced Inhalation Technology Corp., Dura Pharmaceuticals (e.g. Spiros® device), Astra Pharmaceuticals (e.g Turbuhaler® device), Glaxo (e.g. rotahaler® or diskhaler® device), Fisons (e.g. spinhaler® device) or MicroDose Technologies, of which some examples are provided for in e.g. WO 96/32149, US 5,655,523, US 5,645,051 , US 5,622,166, US 5,577,497, US 5,492,112, US 5,327,883, US 5,277,195 and US 5,694,920.
  • 3M Inhale Therapeutic Systems, Advanced Inhalation Technology Corp.
  • Dura Pharmaceuticals e.g. Spiros® device
  • Astra Pharmaceuticals e
  • the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer may be formulated for use with conventional metered dose inhalers (MDIs).
  • MDIs can usually deliver higher concentrations of active over shorter periods of time when compared to nebulised solutions.
  • Formulations prepared for MDIs are typically finely dispersed powders, which are suspended in non-aqueous propellant solutions.
  • a solution aerosol can be made by including organic co-solvents, such as ethanol.
  • Propellents used can be chosen from common materials such as, chlorofluorcarbons, hydrochlorofluorocarbons, hydrofluro- carbons, or hydrocarbons.
  • the propellant is chosen to be more environmentally friendly, such as the hydrofluorocarbons.
  • additional excipients may be necessary to stabilise the dispersed powder suspension, to prevent chemical degradation, or to optimise the delivery of the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer in a finely dispersed form.
  • the particle size fractions delivered from the MDI device will ideally have an MMAD of ⁇ 10 ⁇ m, more preferably between 1-5 ⁇ m, and most preferably between 1-3 ⁇ m.
  • Examples of formulations and devices for MDIs are provided for in WO 97/47286, WO 98/13031 , US 5725841 , WO 98/34596, WO 99/36334, WO 98/35888, WO 98/30262.
  • Pigs Loaded x Yorkshire x Duroc, mean weight ca. 20kg
  • the nebulizer was attached in line on the inspiratory side of the ventilation circuit using a T-piece.
  • MMAD of aerosol particles were between 4.3 - 4.8 ⁇ m.
  • Plasma GLP-1 levels were assessed using a validated immunoassay. The results showed that the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer (e.g. Arg 34 Lys 26 (N ⁇ -( ⁇ -glutamyl(N ⁇ -hexadecanoyl)))-GLP-1 (7- 37)-OH, referred to as Acyl-GLP-1) was absorbed in vivo via pulmonary delivery.
  • a spacer e.g. Arg 34 Lys 26 (N ⁇ -( ⁇ -glutamyl(N ⁇ -hexadecanoyl))

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Public Health (AREA)
  • Medicinal Chemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Diabetes (AREA)
  • Epidemiology (AREA)
  • Endocrinology (AREA)
  • Hematology (AREA)
  • Obesity (AREA)
  • Immunology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Emergency Medicine (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Child & Adolescent Psychology (AREA)
  • Otolaryngology (AREA)
  • Pulmonology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)

Abstract

The present invention relates to a new formulation comprising a stabilized GLP-1 compound, such as an analog, fragment or derivative thereof for delivery across pulmonary tissue in vivo.

Description

Title
Transepithelial delivery of GLP-1 derivatives
Background
The physico-chemical characteristics, production and purification methods, in vitro and in vivo potencies and clinical advantages of GLP-1 and analogues have been well- characterised over recent years. There is little doubt that the development of a pharmaceutically useful form of GLP-1 , or an analogue thereof, would result in a valuable addition to the available chemotherapeutic products for the treatment of diabetes and other metabolic disorders. It has been made clear that certain fatty-acyl derivatives of GLP-1 are prone to non- covalent self-association, which can lead to clinical failure (cf. Clodfelter DK et al. Effects of non-covalent self-association on the subcutaneous absorption of a therapeutic peptide. Pharm Res 15(2) (1998) 254-262). Furthermore, recent disclosures suggest that such derivatives require co-addition of surfactants to ensure a stabilized, therapeutically useful dosage form (cf. WO 99/29336). Importantly, due to toxicity concerns, many of the surfactants provided for in (cf. WO 99/29336) will limit the use of formulations of such derivatives to the gastrointestinal, transdermal, or possibly nasal delivery routes.
Summary of Invention
The present invention relates to a new formulation comprising a stabilized GLP-1 compound, such as an analog, fragment or derivative thereof for delivery across pulmonary tissue in vivo.
We have discovered that a family of fatty-acylated GLP-1 compounds can be solubi- lized to a very high degree in water without formation of insoluble physical aggregates (> 5 mg/mL), are stable in solution without the requirement of additional stabilizing excipients in the formulation (eg. surfactants, cyclodextrins, etc.), are physically stable in solution in the presence of external stresses such as during exposure to high shear encountered during jet or ultrasonic nebulisation and are physically stable without forming insoluble aggregates or fibrillated products over time, and are metabolicly stable. Further, the solution structure of these candidates allow for simple formulation design changes to control pulmonary absorp- tion rates, thus having features which allow optimisation of drug delivery. Moreover, the development of a pulmonary dosage form of a GLP-1 compound whereto is attached a lipo- philic substituent optionally via a spacer represents a non-invasive means of protein drug de- livery without the inconvenience and health/environmental risks associated with traditional injectable, needle-based medications.
Currently there is a need to limit the use of surfactants for developing physically stable GLP-1 solutions, such as described in (WO 99/47160, WO 99/29336), when developing pulmonary delivery systems for such compounds. Unfortunately, surfactants, cyclodextrins and other potential excipients utilised for stabilising peptide solutions are associated with solubilisation of lipid components of cell membranes, and therefore, are associated with cell toxicity. In parallel, many efforts have been taken to enhance the permeability of insulin across pulmonary tissue by using formulation additives (cf. Patton JS, Bukar J, Nagarajan S. Inhaled insulin. Adv Drug Del Rev 35 (1999) 235-247), however it is very difficult to delineate the permeability enhancement effects from the toxic effects of excipients on pulmonary tissue. Thus far, permeability enhancers or absorption promoters are viewed as potentially toxic agents and will require much documentation to prove that they represent no potential harm to human subjects, especially when concerning such sensitive tissues as in the lung. One class of potentially approvable enhancers are the protease inhibitors, however they are often required in excessive amounts to improve the delivery efficiency (cf. Patton JS, Bukar J, Nagarajan S. Inhaled insulin. Adv Drug Del Rev 35 (1999) 235-247).
Description of invention
A simple system is used to describe the GLP-1 compounds of the present invention. For example, Gly8-GLP-1 (7-37) designates a peptide which relates to GLP-1 (1-37) by the deletion of the amino acid residues at positions 1 to 6 and the substitution of the naturally occurring amino acid residue in position 8 (Ala) with Gly. Similarly, Lys34(Nε-tetradecanoyl)-GLP-1(7-37) designates GLP-1 (7-37) wherein the ε-amino group of the Lys residue in position 34 has been tetradecanoylated. Accordingly the present invention relates to a new formulation for use in a pulmonary device, comprising a soluble and, solution stabilized, metabolic stabilized, and/or stress stabilized GLP-1 compound for delivery across pulmonary tissue in vivo.
Also, the present invention relates to a method for preparing a formulation for use in a pulmonary device, said formulation comprising a soluble and, solution stabilized, metabolic stabilized, and/or stress stabilized GLP-1 compound for delivery across pulmonary tissue in vivo.
Typical, soluble GLP-1 compounds are compounds that, within the pH range of 4-9, within a temperature range of 0-50°C, in isotonic buffered solutions, at concentrations in solution representing no less than a 1 :1 potency:bioavailable dose ratio when compared to na- tive GLP-1 , demonstrate no formation of insoluble aggregates (or insoluble material), according to techniques acceptable in the art.
Typical, solution stabilized GLP-1 compounds are compounds, which, in the presence of no stabilizing excipients (e.g. surfactants, cyclodextrins, etc.), within the pH range of 4-9, within a temperature range of 0-50°C, in isotonic buffered solutions, after storage of at least 3 months, demonstrate the presence of:
No less than 90% of original protein purity, and no formation of insoluble aggregates, as measured by techniques acceptable in the art. Typical, metabolic stabilized GLP-1 compounds are compounds, which demonstrate, after introduction into mammals within the therapeutic window, terminal plasma half-lives of greater than 1 hour, as measured by techniques acceptable in the art.
Typical, stress stabilized GLP-1 compounds are compounds which maintain > 75% of initial bioactivity after exposure to conditions associated with manufacturing processes, de- livery processes, handling or storage conditions, as measured by techniques acceptable in the art.
The therapeutic window is a range of drug concentrations within which the probability of the desired clinical response is relatively high and the probability of unacceptable toxicity is relatively low. Evans, WE ed., Applied Pharmacokinetics : Principles of Therapeutic Drug Monitoring, 3rd ed, Ch 1-3, 1992.
We have discovered that a way of preparing a soluble and, solution stabilized, metabolic stabilized, and/or stress stabilized GLP-1 compound ideal for delivery across pulmonary tissue in vivo is by modifying the structure of a GLP-1 analogue by introducing a lipophilic substituent optionally via a spacer. Preferably, a spacer is present. In one aspect the present invention relates to a pulmonary liquid or dry formulation comprising a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer.
In another aspect the present invention relates to a method for preparing a pulmonary liquid or dry formulation for use in a pulmonary device, said formulation comprising a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer.
In a further aspect the present invention relates to a pulmonary delivery device comprising a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer. In a further aspect the present invention relates to a method for preparing a pulmonary delivery device, said device comprising a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer.
In a further aspect the present invention relates to a method of reducing blood glu- cose levels, treating diabetes type I, diabetes type II or obesity, or inhibiting gastric acid secretion, or inhibiting apoptosis of β-cells, comprising administering to a patient in need thereof an effective amount of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer, by inhalation so as to deposit said GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer in the lungs of the patient. In a further aspect the present invention relates to a method of treating gastric ulcers comprising administering to a patient in need thereof an effective amount of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer, by inhalation so as to deposit said GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer in the lungs of the patient. In a further aspect the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary liquid or dry formulation for reducing blood glucose levels.
In a further aspect the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary liquid or dry formulation for treating diabetes type I.
In a further aspect the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary liquid or dry formulation for treating diabetes type II.
In a further aspect the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary liquid or dry formulation for treating obesity.
In a further aspect the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary liquid or dry formulation for treating gastric ulcers. In a further aspect the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary liquid or dry formulation for inhibition of apoptosis of β-cells.
In a further aspect the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary delivery device for reducing blood glucose levels. In a further aspect the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary delivery device for treating diabetes type I.
In a further aspect the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary delivery device for treating diabetes type II.
In a further aspect the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary delivery device for treating obesity. In a further aspect the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary delivery device for treating gastric ulcers.
In a further aspect the present invention relates to use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary delivery device for inhibition of apoptosis of β-cells.
The lipophilic substituent may be attached to an amino group of the GLP-1 compound by means of a carboxyl group of the lipophilic substituent which forms an amide bond with an amino group of the amino acid residue to which it is attached. Alternatively, the lipophilic substituent may be attached to said amino acid residue in such a way that an amino group of the lipophilic substituent forms an amide bond with a carboxyl group of the amino acid residue. As a further option, the lipophilic substituent may be linked to the GLP-1 compound via an ester bond. Formally, the ester can be formed either by reaction between a carboxyl group of the GLP-1 compound and a hydroxyl group of the substituent-to-be or by reaction between a hydroxyl group of the GLP-1 compound and a carboxyl group of the substituent- to-be. As a further alternative, the lipophilic substituent can be an alkyl group which is introduced into a primary amino group of the GLP-1 compound.
In a further alternative, the lipophilic substituent may be attached to the GLP-1 compound by means of a spacer in such a way that a carboxyl group of the spacer forms an amide bond with an amino group of the GLP-1 compound. A spacer must contain at least two functional groups, one to attach to a functional group of the lipophilic substituent and the other to a functional group of the parent GLP-1 peptide. Examples of suitable spacers are succinic acid, lysyl, glutamyl, asparagyl, glycyl, beta-alanyl and gamma-aminobutanoyl, or a dipeptide such as Gly-Lys, each of which constitutes an individual embodiment. When the spacer is succinic acid, one carboxyl group thereof may form an amide bond with an amino group of the amino acid residue, and the other carboxyl group thereof may form an amide bond with an amino group of the lipophilic substituent. When the spacer is lysyl, glutamyl, asparagyl, glycyl, beta-alanyl or gamma-aminobutanoyl, the carboxyl group thereof may form an amide bond with an amino group of the amino acid residue, and the amino group thereof may form an amide bond with a carboxyl group of the lipophilic substituent. When Lys is used as the spacer, a further spacer may in some instances be inserted between the ε-amino group of Lys and the lipophilic substituent. In one preferred embodiment, such a further spacer is succinic acid which forms an amide bond with the ε-amino group of Lys and with an amino group present in the lipophilic substituent. In another preferred embodiment such a further spacer is Glu or Asp which forms an amide bond with the ε-amino group of Lys and another amide bond with a carboxyl group present in the lipophilic substituent, that is, the lipophilic substituent is a Nε-acylated lysine residue. In an embodiment, the spacer is an amino acid residue except Cys or Met, or a dipeptide such as Gly-Lys. For purposes of the present invention, the phrase "a dipeptide such as Gly-Lys" means any combination of two amino acids except Cys or Met, preferably a dipeptide wherein the C-terminal amino acid residue is Lys, His or Trp, preferably Lys, and the N-terminal amino acid residue is Ala, Arg, Asp, Asn, Gly, Glu, Gin, lie, Leu, Val, Phe, Pro, Ser, Tyr, Thr, Lys, His and Trp. Preferably, an amino group of the GLP-1 compound forms an amide bond with a carboxylic group of the amino acid residue or dipeptide spacer, and an amino group of the amino acid residue or dipeptide spacer forms an amide bond with a carboxyl group of the lipophilic substituent. Examples of such GLP-1 compounds whereto is attached one or more lipophilic substituents optionally via a spacer have been disclosed in e.g EP 0708179, WO 98/08871 , WO 99/43705, WO 99/43706, WO 99/43707, WO 99/43708, WO 99/43341 , which are incorporated herein by reference. The GLP-1 compounds whereto is attached one or more lipophilic substituents optionally via a spacer are useful in treatment of diabetes mellitus (types I or II) and prevention of hyperglycaemia, as well as in treatment of obesity, or gastric ulcers, or in inhibition of apoptosis of β-cells, upon administering to a patient in need thereof an effective amount of a pulmonary formulation comprising a stabilized GLP-1 compound by inhalation so as to deposit said stabilized GLP-1 compound in the lungs of the patient.
Examples of exendin as well as analogs, derivatives, and fragments thereof to be in- eluded within the present invention are those disclosed in WO 9746584 and US 5424286. US 5424286 describes a method for stimulating insulin release with exendin polypeptide(s). The exendin polypeptides disclosed include HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGX; wherein X = P or Y, and HX1X2GTFITSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS; wherein X1X2 = SD (exendin-3) or GE (exendin-4)). The exendin-3 and -4 and fragments are useful in treatment of diabetes mellitus (types I or II) and prevention of hyperglycaemia. They normalise hyperglycaemia through glucose-dependent, insulin-independent and insulin- dependent mechanisms. Exendin-4 is specific for exendin receptors, i.e. it does not interact with vasoactive intestinal peptide receptors. WO 9746584 describes truncated versions of exendin peptide(s) for treating diabetes. The disclosed peptides increase secretion and biosynthesis of insulin, but reduce those of glucagon. The truncated peptides can be made more economically than full length versions.
In one embodiment of the invention the GLP-1 compound is GLP-1 (7-37) or GLP-1 (7- 36) amide.
In a further embodiment of the invention the GLP-1 compound is exendin or an ana- log thereof.
In a further embodiment of the invention the GLP-1 compound whereto is attached a lipophilic substituent via a spacer is Arg34Lys26(Nε-(γ-glutamyl(Nα-hexadecanoyl)))-GLP-1(7- 37)-OH.
In a further embodiment of the invention the GLP-1 compound whereto is attached a lipophilic substituent via a spacer is Arg18, Leu20, Gin34, Lys33 (Nε-(γ-aminobutyroyl(Nα- hexadecanoyl))) Exendin-4-(7-45)-NH2.
In a further embodiment of the invention the GLP-1 compound whereto is attached a lipophilic substituent via a spacer is Arg33, Leu20, Gin34, Lys18 (Nε-(γ-aminobutyroyl(Nα- hexadecanoyl))) Exendin-4-(7-45)-NH2. In a further embodiment of the invention the GLP-1 compound is a GLP-1 analogue.
In a further embodiment of the invention the GLP-1 analogue is selected from the Thr8, Met8, Gly8 and Val8 analogues of GLP-1 (7-37) and GLP-1 (7-36) amide, more preferred the Gly8 and Val8 analogues of GLP-1 (7-37) and GLP-1 (7-36) amide, most preferred the Val8 analogues of GLP-1 (7-37) and GLP-1 (7-36) amide. In a further embodiment of the invention the GLP-1 analogue has the formula II:
7 8 9 10 11 12 13 14 15 16 17 His-Xaa-Xaa-Gly-Xaa-Phe-Thr-Xaa-Asp-Xaa-Xaa-
18 19 20 21 22 23 24 25 26 27 28 Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Phe-
29 30 31 32 33 34 35 36 37 38 lle-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa
39 40 41 42 43 44 45 Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa
(ll) wherein
Xaa at posit on 8 is Ala, Gly, Ser, Thr, Leu, lie, Val, Glu, Asp, Met, or Lys, Xaa at posit on 9 is Glu, Asp, or Lys, Xaa at posit on 11 is Thr, Ala, Gly, Ser, Leu, lie, Val, Glu, Asp, or Lys, Xaa at positi on 14 s Ser, Ala, Gly, Thr, Leu, lie, Val, Glu, Asp, or Lys, Xaa at posit on 16 s Val, Ala, Gly, Ser, Thr, Leu, He, Tyr, Glu, Asp, or Lys, Xaa at posit on 17 s Ser, Ala, Gly, Thr, Leu, lie, Val, Glu, Asp, or Lys, Xaa at positi on 18 s Ser, Ala, Gly, Thr, Leu, lie, Val, Glu, Asp, or Lys, Xaa at posit on 19 s Tyr, Phe, Trp, Glu, Asp, or Lys, Xaa at posit on 20 s Leu, Ala, Gly, Ser, Thr, Leu, lie, Val, Glu, Asp, or Lys, Xaa at posit on 21 s Glu, Asp, or Lys, Xaa at posit on 22 s Gly, Ala, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys, Xaa at posit on 23 s Gin, Asn, Arg, Glu, Asp, or Lys, Xaa at posit on 24 s Ala, Gly, Ser, Thr, Leu, lie, Val, Arg, Glu, Asp, or Lys, Xaa at posit on 25 s Ala, Gly, Ser, Thr, Leu, lie, Val, Glu, Asp, or Lys, Xaa at posit on 26 s Lys, Arg, Gin, Glu, Asp, or His, Xaa at posit on 27 s Glu, Asp, or Lys, Xaa at posit on 30 s Ala, Gly, Ser, Thr, Leu, lie, Val, Glu, Asp, or Lys, Xaa at posit on 31 s Trp, Phe, Tyr, Glu, Asp, or Lys, Xaa at posit on 32 s Leu, Gly, Ala, Ser, Thr, He, Val, Glu, Asp, or Lys, Xaa at posit on 33 s Val, Gly, Ala, Ser, Thr, Leu, He, Glu, Asp, or Lys, Xaa at posit on 34 s Lys, Arg, Glu, Asp, or His, Xaa at posit on 35 s Gly, Ala, Ser, Thr, Leu, lie, Val, Glu, Asp, or Lys, Xaa at posit on 36 s Arg, Lys, Glu, Asp, or His, Xaa at positi on 37 s Gly, Ala, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys, or is deleted, Xaa at posit on 38 s Arg, Lys, Glu, Asp, or His, or is deleted, Xaa at posit on 39 s Arg, Lys, Glu, Asp, or His, or is deleted, Xaa at posit on 40 s Asp, Glu, or Lys, or is deleted, Xaa at posit on 41 s Phe, Trp, Tyr, Glu, Asp, or Lys, or is deleted, Xaa at posit on 42 s Pro, Lys, Glu, or Asp, or is deleted, Xaa at posit on 43 s Glu, Asp, or Lys, or is deleted, Xaa at posit on 44 s Glu, Asp, or Lys, or is deleted, and Xaa at posit on 45 s Val, Glu, Asp, or Lys, or is deleted, or (a) a C-1-6-ester thereof, (b) amide, C-1-6-alkylamide, or C-1-6-dialkylamide thereof and/or (c) a pharmaceutically acceptable salt thereof, provided that
(i) when the amino acid at position 37, 38, 39, 40, 41 , 42, 43 or 44 is deleted, then each amino acid downstream of the amino acid is also deleted.
In a further embodiment of the GLP-1 analogue of formula II, the amino acids at positions 37-45 are absent.
In another embodiment of the GLP-1 analogue of formula II, the amino acids at positions 38-45 are absent. In another embodiment of the GLP-1 analogue of formula , the amino acids at posi- tions 39-45 are absent.
In another embodiment of the GLP-1 analogue of formula , Xaa at position 8 is Ala, Gly, Ser, Thr, Met, or Val.
In another embodiment of the GLP-1 analogue of formula , Xaa at position 8 is Gly, Thr, Met, or Val.
In another embodiment of the GLP-1 analogue of formula , Xaa at position 8 is Val. In another embodiment of the GLP-1 analogue of formula , Xaa at position 9 is Glu. In another embodiment of the GLP-1 analogue of formula , Xaa at position 11 is Thr. In another embodiment of the GLP-1 analogue of formula , Xaa at position 14 is Ser. In another embodiment of the GLP-1 analogue of formula , Xaa at position 16 is Val.
In another embodiment of the GLP-1 analogue of formula , Xaa at position 17 is Ser. In another embodiment of the GLP-1 analogue of formula , Xaa at position 18 is Ser, Lys, Glu, or Asp.
In another embodiment of the GLP-1 analogue of formula , Xaa at position 19 is Tyr, Lys, Glu, or Asp.
In another embodiment of the GLP-1 analogue of formula , Xaa at position 20 is Leu, Lys, Glu, or Asp.
In another embodiment of the GLP-1 analogue of formula , Xaa at position 21 is Glu, Lys, or Asp. In another embodiment of the GLP-1 analogue of formula , Xaa at position 22 is Gly,
Glu, Asp, or Lys.
In another embodiment of the GLP-1 analogue of formula , Xaa at position 23 is Gin, Glu, Asp, or Lys.
In another embodiment of the GLP-1 analogue of formula , Xaa at position 24 is Ala, Glu, Asp, or Lys. In another embodiment of the GLP-1 analogue of formula , Xaa at position 25 is Ala, Glu, Asp, or Lys.
In another embodiment of the GLP-1 analogue of formula I, Xaa at position 26 is Lys, Glu, Asp, or Arg. In another embodiment of the GLP-1 analogue of formula I, Xaa at position 27 is Glu,
Asp, or Lys.
In another embodiment of the GLP-1 analogue of formula , Xaa at position 30 is Ala, Glu, Asp, or Lys.
In another embodiment of the GLP-1 analogue of formula I, Xaa at position 31 is Trp, Glu, Asp, or Lys.
In another embodiment of the GLP-1 analogue of formula Xaa at position 32 is Leu, Glu, Asp, or Lys.
In another embodiment of the GLP-1 analogue of formula I, Xaa at position 33 is Val, Glu, Asp, or Lys. In another embodiment of the GLP-1 analogue of formula I, Xaa at position 34 is Lys,
Arg, Glu, or Asp.
In another embodiment of the GLP-1 analogue of formula I, Xaa at position 35 is Gly, Glu, Asp, or Lys.
In another embodiment of the GLP-1 analogue of formula I, Xaa at position 36 is Arg, Lys, Glu, or Asp.
In another embodiment of the GLP-1 analogue of formula I , Xaa at position 37 is Gly, Glu, Asp, or Lys.
In another embodiment of the GLP-1 analogue of formula I, Xaa at position 38 is Arg, or Lys, or is deleted. In another embodiment of the GLP-1 analogue of formula I, Xaa at position 39 is de- leted.
In another embodiment of the GLP-1 analogue of formula I, Xaa at position 40 is de- leted.
In another embodiment of the GLP-1 analogue of formula Xaa at position 41 is de- leted.
In another embodiment of the GLP-1 analogue of formula I, Xaa at position 42 is de- leted.
In another embodiment of the GLP-1 analogue of formula I, Xaa at position 43 is de- leted. In another embodiment of the GLP-1 analogue of formula II, Xaa at position 44 is deleted.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 45 is deleted. In another embodiment of the GLP-1 analogue of formula II, Xaa at position 26 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-36).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 26 is Arg, each of Xaa at positions 38-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-37).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 26 is Arg, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-38).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 34 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-36).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 34 is Arg, each of Xaa at positions 38-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-37). In another embodiment of the GLP-1 analogue of formula II, Xaa at position 34 is Arg, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-38).
In another embodiment of the GLP-1 analogue of formula II, Xaa at positions 26 and 34 is Arg, Xaa at position 36 is Lys, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-36).
In another embodiment of the GLP-1 analogue of formula II, Xaa at positions 26 and 34 is Arg, Xaa at position 36 is Lys, each of Xaa at positions 38-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-37).
In another embodiment of the GLP-1 analogue of formula II, Xaa at positions 26 and 34 is Arg, Xaa at position 36 is Lys, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-38).
In another embodiment of the GLP-1 analogue of formula II, Xaa at positions 26 and 34 is Arg, Xaa at position 38 is Lys, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-38). In another embodiment of the GLP-1 analogue of formula II, Xaa at position 8 is Thr, Ser, Gly, or Val, Xaa at position 37 is Glu, Xaa at position 36 is Lys, each of Xaa at positions 38- 45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-37).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 8 is Thr, Ser, Gly, or Val, Xaa at position 37 is Glu, Xaa at position 36 is Lys, each of Xaa at positions 39- 45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-38).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 8 is Thr, Ser, Gly or Val, Xaa at position 37 is Glu, Xaa at position 38 is Lys, each of Xaa at positions 39- 45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-38). In another embodiment of the GLP-1 analogue of formula II, Xaa at position 18, 23 or
27 is Lys, and Xaa at positions 26 and 34 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-36).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 18, 23 or 27 is Lys, and Xaa at positions 26 and 34 is Arg, each of Xaa at positions 38-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-37).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 18, 23 or 27 is Lys, and Xaa at positions 26 and 34 is Arg, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid, in native GLP-1 (7-38).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 8 is Thr, Ser, Gly, or Val, Xaa at position 18, 23 or 27 is Lys, and Xaa at position 26 and 34 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-36).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 8 is Thr, Ser, Gly, or Val, Xaa at position 18, 23 or 27 is Lys, and Xaa at position 26 and 34 is Arg, each of Xaa at positions 38-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-37).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 8 is Thr, Ser, Gly, or Val, Xaa at position 18, 23 or 27 is Lys, and Xaa at position 26 and 34 is Arg, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-38).
Such GLP-1 analogues of formula II includes, but is not limited to, Arg26-GLP- 1(7-37); Arg34-GLP-1(7-37); Lys36-GLP-1(7-37); Arg2634Lys36-GLP-1 (7-37); Arg2634Lys38GLP-1(7-38); Arg263 Lys39-GLP-1 (7-39); Arg2634Lys40-GLP-1(7-40); Arg26Lys36-GLP-1 (7-37); Arg^Lys∞-GLP- 1(7-37); Arg26Lys39-GLP-1(7-39); Arg34Lys40-GLP-1(7-40); Arg263 Lys36'39-GLP-1(7-39); Arg^Lys∞^-GLP-l (7-40); Gly8Arg26-GLP-1 (7-37); Gly'Αrg^-GLP-l (7-37); Val8-GLP-1 (7-37); Thr8-GLP-1(7-37); Gly8-GLP-1(7-37); Met8-GLP-1(7-37); Gly8Lys36-GLP-1(7-37); (7-37); (7-39); Gly8Arg2634Lys40-GLP-1 (7-40); Gly8Arg26Lys36-GLP-1 (7-37); GlyβArg34Lys-GLP-1 (7-37); Gly8Arg26Lys39-GLP-1 (7-39); Gly8Arg3 Lys40-GLP-1 (7-40); (7-39); Gly8Arg26'34Lys36'40-GLP-1 (7-40); Arg263 Lys38GLP-1 (7-38); Arg2634Lys39GLP-1 (7-39); Arg26 :j4Lys40GLP-1 (7-40); Arg2634Lys41GLP-1 (7-41); Arg2634Lys 2GLP-1 (7-42); Arg2634Lys43GLP-1(7-43); Arg^Lys^GLP- 1(7-44); Arg2634Lys45GLP-1(7-45); Arg^Lys^GLP-IO-Sδ); Arg26 :i4Lys39GLP-1(1-39); Arg^Lys^GLP-I C O); Arg2634Lys41GLP-1 (1-41); Arg2634Lys 2GLP-1(1-42); Arg2634Lys 3GLP- 1 (1-43); Arg2634Lys44GLP-1(1-44); Arg2634Lys45GLP-1(1-45); Arg2634Lys38GLP-1 (2-38); Arg2634Lys39GLP-1 (2-39); Arg26-34Lys 0GLP-1(2-40); Arg2634Lys41GLP-1 (2-41); Arg2634Lys42GLP-
1(2-42); Arg2634Lys43GLP-1(2-43); Arg26'3 Lys44GLP-1(2-44); Arg2634Lys45GLP-1(2-45); Arg263 Lys38GLP-1(3-38); Arg2634Lys39GLP-1(3-39); Arg2634Lys40GLP-1(3-40); Arg2634Lys 1GLP- 1 (3-41); Arg2634Lys42GLP-1(3-42); Arg2834Lys 3GLP-1(3-43); Arg2634Lys44GLP-1(3-44); Arg∞^Lys^GLP-l ^δ); Arg2634Lys38GLP-1 (4-38); Arg2634Lys39GLP-1(4-39); Arg∞^Lys^GLP- 1 (4-40); Arg263 Lys41GLP-1 (4-41 ); Arg2634Lys42GLP-1 (4-42); Arg2634Lys 3GLP-1 (4-43);
Arg2634Lys44GLP-1 (4-44); Arg26 :i Lys 5GLP-1(4-45); Arg263 Lys38GLP-1 (5-38); Arg2634Lys39GLP- 1(5-39); Arg^Lys^GLP-I^O); Arg26'34Lys 1GLP-1(5-41); Arg2634Lys 2GLP-1(5-42); Arg263 Lys43GLP-1 (5-43); Arg2634Lys44GLP-1(5-44); Arg2634Lys 5GLP-1(5-45); Arg2634Lys38GLP- 1(6-38); Arg^Lys^GLP-l^-SΘ); Arg26'34Lys 0GLP-1(6-40); Arg2634Lys41GLP-1(6-41); Arg2634Lys42GLP-1 (6-42); Arg2634Lys 3GLP-1 (6-43); Arg26'34Lys44GLP-1 (6-44); Arg2634Lys45GLP- 1(6-45); Arg26Lys38GLP-1(1-38); Arg34LysGLP-1(1-38); Arg26Lys38GLP-1 (7-38); Arg34Lys38GLP-1(7-38); Arg263 Lys3638GLP-1(7-38); Arg26 ;3 Lys38GLP- 1(7-38); Arg26Lys39GLP-1(1-39); Arg^Lys^GLP-^l-SΘ); Arg26 :i4Lys36'39GLP-1(1-39); Arg26Lys39GLP-1 (7-39); Arg3 Lys39GLP-1(7-39) and Arg2634Lys36'39GLP-1(7-39). Each one of these specific GLP-1 analogues constitutes an alternative embodiment of the invention. In a further embodiment of the invention the GLP-1 analogue has the formula III
A-HN-GLP-1(8-B)-X (III) wherein
wherein R1, R2 and R3 are independently H, lower alkyl having 1 to 6 carbon atoms, optionally substituted phenyl, NH2, NH-CO-(lower alkyl), -OH, lower alkoxy having 1 to 6 carbon atoms, halogen, SO2-(lower alkyl) or CF3, said phenyl is optionally substituted with at least one group selected from NH2, -OH, lower alkyl or lower alkoxy having 1-6 carbon atoms, halogen, SO2- (lower alkyl), NH-CO-(lower alkyl) or CF3, or R and R2 may together form a bond; Y is a five or six membered ring system selected from the group consisting of:
wherein Z is N, O or S, said ring system is optionally substituted with one or more functional groups selected from the group consisting of NH2, NO2, OH, C1-6 alkyl, C1-6 alkoxy, halogen (Cl,
Br, F, I), CF3 and aryl;
B is an integer in the range of 35-45; and
X is -OH, -NH2, or a C1-6 alkyl amide or C1-6 dialkyl amide group; or an analogue thereof. Such GLP-1 analogues of formula III includes, but is not limited to
Arg26-GLP-1(7-37); ArgM-GLP-1(7-37); Lys36-GLP- 1(7-37);
Arg263 Lys36-GLP-1 (7-37); Arg2634Lys38GLP-1 (7-38);
Arg2634Lys39-GLP-1 (7-39); Arg∞^Lys^-GLP-l (7-40);
Arg26Lys36-GLP-1 (7-37); Arg^Lys^-GLP-l (7-37); Arg26Lys39-GLP-1 (7-39); Arg34Lys40-GLP-1 (7-40); Arg2634Lys36'39-GLP-1 (7-39); Argaβl34Lys?β'40-GLP-1 (7-40); Gly8Arg26-GLP-1 (7-37); (7-37); Gly8Lys36-GLP-1 (7-37); (7-37); G|y8Arg26,34|_ys 39_GLp_1 (7.3g); Gl Arg^^Lys^-GLP-l (7-40); Gly8Arg26Lys36-GLP-1(7-37); Gly8Arg34Lys36-GLP-1(7-37);
Gly8Arg26Lys39-GLP-1 (7-39); GlyβArg34Lys 0-GLP-1 (7-40);
Gly8Arg2634Lys36'39-GLP-1 (7-39); or
Gly8Arg 6,34Lys36'40-GLP-1 (7-40). Each one of these specific GLP-1 analogues constitutes an alternative embodiment of the invention. In a further embodiment of the invention the GLP-1 analogue has the formula IV
A - GLP-1(19-B) - X (IV)
wherein A is a peptide comprising the amino acid residues of GLP-1 (8-18) or a fragment thereof;
B is an integer in the range of 35-45; and
X is -OH, -NH2, or a C1-6 alkyl amide or C^ dialkyl amide group; or an analogue thereof. In an embodiment of the GLP-1 analogue of formula IV, A is a peptide selected from the group consisting of GLP-1 (8-18), GLP-1 (9-18), GLP-1 (10-18), GLP-1 (11-18), GLP-1 (12-18),
GLP-1(13-18), GLP-1(14-18), GLP-1 (15-18), GLP-1(16-18), GLP-1(17-18) and GLP-1 (18).
Preferably, A is GLP-1 (8-18), GLP-1 (9-18), GLP-1 (10-18), GLP-1 (11 -18) or GLP-1 (12-18), and
B is 36, 37 or 38. Most preferably, A is GLP-1 (8-18). In a further embodiment of the GLP-1 analogue of formula IV, B is 35, 36, 37, 38, 39,
40, 41, 42, 43 or 44. In a more preferred embodiment, B is 36. In another more preferred embodiment. B is 37. In another more preferred embodiment, B is 38.
Such GLP-1 analogues of formula IV includes, but is not limited to
Arg26-GLP-1(8-37); Arg34-GLP-1 (8-37); Lys36-GLP- 1(8-37); Arg^Lys∞-GLP-l (8-37); Arg2634Lys38GLP-1 (8-38);
Arg26 :i4Lys39-GLP-1 (8-39); Arg26'3 Lys40-GLP-1 (8-40);
Arg26Lys36-GLP-1 (8-37); Arg34Lys-GLP-1 (8-37);
Arg26Lys39-GLP-1 (8-39); Arg34Lys40-GLP-1 (8-40);
Arg2634Lys36'39-GLP-1 (8-39); Arg26|34Lys3640-GLP-1 (8-40); Gly8Arg26-GLP-1(8-37); Gly8Arg3 -GLP-1(8-37); Gly8Lys36-GLP-1 (8-37); Gly8Arg2634Lys36-GLP-1 (8-37); Gly8Arg26,34|_ys 39.GLp_1 (8.39). Gly8Arg26 34Lys40-GLP-1 (8-40);
Gly8Arg26Lys36-GLP-1 (8-37); Gly'Αrg^Lys -GLP-l (8-37);
Gly8Arg26Lys39-GLP-1 (8-39); Gly'Arg^Lys^-GLP-l (8-40); Gly'Αrg^Lys^-GLP-l -SΘ); or
Gly^rg^^Lys^^-GLP-I^O). Each one of these specific GLP-1 analogues constitutes an alternative embodiment of the invention.
In one embodiment of the present invention the lipophilic substituent comprises 4-40 carbon atoms. In a further embodiment of the present invention the lipophilic substituent comprises 8-30 carbon atoms. In a further embodiment of the present invention the lipophilic substituent comprises 8-25 carbon atoms. In a further embodiment of the present invention the lipophilic substituent comprises 12-25 carbon atoms. In a further embodiment of the present invention the lipophilic substituent comprises 14-18 carbon atoms.
The lipophilic substituent(s) contain a functional group which can be attached to one of the following functional groups of an amino acid of the parent GLP-1 compound:
(a) the amino group attached to the alpha-carbon of the N-terminal amino acid,
(b) the carboxy group attached to the alpha-carbon of the C-terminal amino acid,
(c) the epsilon-amino group of any Lys residue,
(d) the carboxy group of the R group of any Asp and Glu residue, (e) the hydroxy group of the R group of any Tyr, Ser and Thr residue,
(f) the amino group of the R group of any Trp, Asn, Gin, Arg, and His residue, or
(g) the thiol group of the R group of any Cys residue.
In an embodiment, a lipophilic substituent is attached to the carboxy group of the R group of any Asp and Glu residue. In another embodiment, a lipophilic substituent is attached to the carboxy group attached to the alpha-carbon of the C-terminal amino acid.
In a most preferred embodiment, a lipophilic substituent is attached to the epsilon- amino group of any Lys residue.
Each lipophilic substituent contains a functional group which may be attached to a functional group of an amino acid of the parent GLP-1 compound. For example, a lipophilic substituent may contain a carboxyl group which can be attached to an amino group of the parent GLP-1 peptide by means of an amide bond.
In a further embodiment, the lipophilic substituent comprises a partially or completely hydrogenated cyclopentanophenathrene skeleton. In another embodiment, the lipophilic substituent is a straight-chain or branched alkyl group.
In another embodiment, the lipophilic substituent is an acyl group of a straight-chain or branched fatty acid. In a further embodiment the lipophilic substituent is an acyl group having the formula
CH3(CH2)nCO-, wherein n is an integer from 4 to 38. In a further embodiment n is an integer from 12 to 38. In further embodiments the lipophilic substituent is selected from the following individual embodiments CH3(CH22CO-, CH3(CH2)14CO-, CH3(CH26CO-, CH3(CH2)18CO-, CH3(CH2)2oCO- and CH3(CH )22CO-. In a specific embodiment, the lipophilic substituent is tetradecanoyl. In another specific embodiment, the lipophilic substituent is hexadecanoyl.
In another embodiment of the present invention, the lipophilic substituent has a group which is negatively charged such as a carboxylic acid group. For example, the lipophilic substituent may be an acyl group of a straight-chain or branched alkane α,ω-dicarboxylic acid of the formula HOOC(CH2)mCO-, wherein m is an integer from 4 to 38, preferably an integer from 12 to 38, and most preferably is HOOC(CH24CO-, HOOC(CH2)16CO-, HOOC(CH28CO-, HOOC(CH2)20CO- or HOOC(CH2)22CO-.
In a further embodiment of the invention, the lipophilic substituent is attached to the parent GLP-1 compound by means of a spacer. A spacer must contain at least two functional groups, one to attach to a functional group of the lipophilic substituent and the other to a functional group of the parent GLP-1 compound.
In an embodiment, the spacer is an amino acid residue except Cys or Met. In another embodiment, the spacer is a dipeptide such as Gly-Lys.
In a further embodiment the spacer is selected from lysyl, glutamyl, asparagyl, glycyl, beta-alanyl and gamma-aminobutanoyl, each of which constitutes an individual embodiment. Most preferred spacers are glutamyl and beta-alanyl.
In another embodiment, the spacer is an unbranched alkane α,ω-dicarboxylic acid group having from 1 to 7 methylene groups, which spacer forms a bridge between an amino group of the parent peptide and an amino group of the lipophilic substituent. Preferably, the spacer is succinic acid. In a further embodiment, the lipophilic substituent with the attached spacer is a group of the formula CH3(CH2)pNH-CO(CH2)qCO-, wherein p is an integer from 8 to 33, such as from 12 to 28 and q is an integer from 1 to 6, such as 2.
In a further embodiment, the lipophilic substituent with the attached spacer is a group of the formula CH3(CH2)rCO-NHCH(COOH)(CH2)2CO-, wherein r is an integer from 4 to 24, such as from 10 to 24. In a further embodiment, the lipophilic substituent with the attached spacer is a group of the formula CH3(CH2)sCO-NHCH((CH2)2COOH)CO-, wherein s is an integer from 4 to 24, preferably from 10 to 24.
In a further embodiment, the lipophilic substituent is a group of the formula COOH(CH2)tCO- wherein t is an integer from 6 to 24.
In a further embodiment, the lipophilic substituent with the attached spacer is a group of the formula -NHCH(COOH)(CH2)4NH-CO(CH2)uCH3, wherein u is an integer from 8 to 18.
In a further embodiment, the lipophilic substituent with the attached spacer is a group of the formula CH3(CH2)vCO-NH-(CH2)z-CO, wherein v is an integer from 4 to 24 and z is an integer from 1 to 6.
In a further embodiment, the lipophilic substituent with the attached spacer is a group of the formula -NHCH(COOH)(CH2)4NH-COCH((CH2)2COOH)NH-CO(CH2)wCH3, wherein w is an integer from 10 to 16.
In a further embodiment, the lipophilic substituent with the attached spacer is a group of the formula -NHCH(COOH)(CH2)4NH-CO(CH2)2CH(COOH)NHCO(CH2)χCH3, wherein x is zero or an integer from 1 to 22, such as from 10 to 16.
The term "GLP-1" means GLP-1 (7-37) or GLP-1 (7-36) amide. The amino acid sequence of GLP-1 is given La. by Schmidt et al. (Diabetologia 28 704-707 (1985).
The term "treatment" is defined as the management and care of a patient, e.g. a mammal, in particular a human, for the purpose of combating the disease, condition, or disorder and includes the administration of a GLP-1 compound to prevent the onset of the symptoms or complications, or alleviating the symptoms or complications, or eliminating the disease, condition, or disorder.
In the present context "a GLP-1 compound" is intended to indicate GLP-1 or an ana- logue or a derivative thereof, or exendin or an analogue or a derivative thereof, which binds to a GLP-1 receptor, preferably with an affinity constant, KD, below 1 μM, e.g. below 100 nM.
Methods for identifying GLP-1 compounds are described in WO 93/19175 (Novo Nordisk A/S). Suitable GLP-1 compounds have been disclosed in e.g. WO 87/06941 , WO 90/11296, WO 93/25579, WO 91/11457, EP 0699686, WO 98/43658, EP 0619322, which are incorporated herein by reference.
In the present context "a GLP-1 compound" is also intended to comprise active metabolites and prodrugs thereof, such as active metabolites and prodrugs of GLP-1 or an analogue or a derivative thereof, or exendin or an analogue or a derivative thereof. A "metabolite" is an active derivative of a GLP-1 compound produced when the GLP-1 compound is metabolized. A "prodrug" is a compound which is either metabolized to a GLP-1 compound or is metabolized to the same metabolite(s) as a GLP-1 compound.
In the present text, the designation "an analogue" is used to designate a peptide wherein one or more amino acid residues of the parent peptide have been substituted by another amino acid residue and/or wherein one or more amino acid residues of the parent peptide have been deleted and/or wherein one or more amino acid residues have been added to the parent peptide. Such addition can take place either in the peptide, at the N-terminal end or at the C- terminal end of the parent peptide, or any combination thereof.
The term "derivative" is used in the present text to designate a peptide in which one or more of the amino acid residues of the parent peptide have been chemically modified, e.g. by alkylation, acylation, ester formation or amide formation.
The term "lipophilic substituent" is characterised by comprising 4-40 carbon atoms and having a solubility in water at 20°C in the range from about 0.1 mg/100 ml water to about 250 mg/100 ml water, preferable in the range from about 0.3 mg/100 ml water to about 75 mg/100 ml water. For instance, octanoic acid (C8) has a solubility in water at 20°C of 68 mg/100 ml, decanoic acid (C10) has a solubility in water at 20°C of 15 mg/100 ml, and octa- decanoic acid (C18) has a solubility in water at 20°C of 0.3 mg/100 ml.
The term "spacer" is used in the present text to designate a bivalent moiety which contain at least two functional groups, one to attach to a functional group of the lipophilic substituent and the other to a functional group of the GLP-1 compound. Examples of suitable spacers are succinic acid, lysyl, glutamyl, asparagyl, glycyl, beta-alanyl and gamma- aminobutanoyl, or a dipeptide such as Gly-Lys.
The term "an effective amount" is the effective dose to be determined by a qualified practitioner, who may titrate dosages to achieve the desired response. Factors for considera- tion of dose will include potency, bioavailability, desired pharmacokinetic/pharmacodynamic profiles, condition of treatment (e.g. diabetes, obesity, gastric ulcers), patient-related factors (e.g. weight, health, age, etc.), presence of co-administered medications (e.g. insulin), time of administration, or other factors known to a medical practitioner.
In one embodiment, an effective amount of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer will range from 0.01 - 1000.0 μg/kg, more preferably from 0.05 - 500 μg/kg, even more preferably from 0.1 - 100 μg/kg, such as from 0.5 - 50 μg/kg .
Ranges of required daily doses would typically include the equivalent of about 0.1- 4.0 inhalations/day. In a preferred embodiment, the inhaled GLP-1 compound whereto is at- tached a lipophilic substituent optionally via a spacer is administered once daily and demonstrate bioequivalence to a sub-cutaneous dosage form.
Any possible combination of two or more of the embodiments described herein, is comprised within the scope of the present invention. In an embodiment the pulmonary formulation is a liquid formulation, such as a solution or a suspension.
In another embodiment the pulmonary formulation is a dry formulation. In an embodiment the pulmonary delivery device is selected from nebulizers, such as jet or ultrasonic nebulizers, metered-dose inhalers, or dry powder inhalers. Each of said devices is considered an individual embodiment.
Ideally, aerosol formulations for pulmonary delivery of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer could be designed which minimise the excipient requirements and maximise bioactive delivery of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer to the deep lung (i.e. alveolar tissue), where compounds are known to be predominantly absorbed (cf. Yu J, Chien YW. Pulmonary drug delivery: Physiologic and mechanistic aspects. Crit Rev Ther Drug Carr Sys 14(4) (1997) 395-453). Aside from the basic demands of safety and efficacy, said formulations should also be designed in accordance with common pharmaceutical development goals and have features such as, long-term stability and preservation from bacterial or fungal contamination during defined shelf-lives. Additionally, formulations should allow for controlled delivery profiles in order to optimise the pharmacokinetic/pharmacodynamic profile following in vivo pulmonary delivery of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer.
The GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer may be produced by any recognised peptide / protein synthetic, semi-synthetic and/or recombinant DNA techniques.
The GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer can be delivered in a vehicle, as a solution, suspension, or dry powder and can be administered by any of the known devices suitable for pulmonary drug delivery known in the art. Ideally, a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer can be administered by any of three general types of aerosol-generating systems for pulmonary drug delivery, and include jet or ultrasonic nebulizers, metered-dose inhalers, or dry powder inhalers (Cf. Yu J, Chien YW. Pulmonary drug delivery: Physiologic and mechanistic aspects. Crit Rev Ther Drug Carr Sys 14(4) (1997) 395-453).
The terms "MMAD" and "MMEAD" are well-described and known to the art (cf. Ed- wards DA, Ben-Jebria A, Langer R. Recent advances in pulmonary drug delivery using large, porous inhaled particles. J Appl Physiol 84(2) (1998) 379-385). Mass median aerodynamic diameter (MMAD) and mass median effective aerodynamic diameter (MMEAD) are used in- ter-changeably, are statistical parameters, and empirically describe the size of aerosol particles in relation to their potential to deposit in the lungs, independent of actual shape, size, or density (cf. Edwards DA, Ben-Jebria A, Langer R. Recent advances in pulmonary drug delivery using large, porous inhaled particles. J Appl Physiol 84(2) (1998) 379-385).
Based on standardised testing methodology, the aerodynamic diameter (da) of a particle is defined as the geometric equivalent diameter of a reference standard spherical particle of unit density (1 g/cm3). In the simplest case, for spherical particles, da is related to a reference diameter (d) as a function of the square root of the density ratio as described by:
Modifications to this relationship occur for non-spherical particles (cf. Edwards DA, Ben- Jebria A, Langer R. Recent advances in pulmonary drug delivery using large, porous inhaled particles. J Appl Physiol 84(2) (1998) 379-385). MMAD is normally measured by cascade impactors, which estimate the particle size based on the particle behavior in a high velocity airstream. It is commonly accepted that a MMAD window between 1-3 μm is optimal for deposition of particles in the deep lung. In a further embodiment stable liquid formulations of GLP-1 compounds whereto is attached a lipophilic substituent optionally via a spacer can be designed for nebulisation. Such liquid formulations may contain preservative agents, isotonicty agents, buffering agents, antioxidants, flavorants, or delivery modifying agents so as to improve the shelf-life and performance of formulated products. Preservatives may be required to develop a commercial product for multiple-use.
Preservatives may include, but are not limited to, phenolics, such as phenol or m-cresol, benzyl alcohol, chlorobutanol, parabens, quaternary ammonium compounds, thirmerosal, or phenylmercuric salts or combinations thereof. Phenol or m-cresol at concentrations between 2 - 5 mg/mL is preferred as a preservative agent. Pharmaceutically acceptable isotonicity agents may include NaCI, dextrose, manni- tol, lactose, or glycerin.
Pharmaceutically acceptable buffering agents for controlling formulation pH may include, but are not limited to, phosphates, citrates, acetates, TRIS, amino acids, or amino acid based salts (e.g. glycylglycine). Pharmaceutically acceptable antioxidants may be included to improve the chemical stability profile of the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer. Suitable antioxidants may include, but are not limited to, phenolic compounds (e.g.BHT, BHA, popyl gallate, α-tocopherol), reducing agents (e.g. methionine, ascorbic acid, sodium sulfite, thioglycerol, thioglycolic acid), or chelating agents (e.g. EDTA, citric acid, or thioglycolic acid).
In a further embodiment delivery modifying agents, in this context, can include substances which can be added to the formulation in order to improve delivery efficiency of the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer to the lower lung, or modify the permeation of the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer across the pulmonary epithelium. In this context, the added ingredient may: 1) on exposure to an aerosol-generating device, facilitate nebulisation of liquids to achieve particle sizes within the optimum window of 1-3 μm MMAD, which has been defined as being optimal for deep lung deposition (cf. Edwards DA, Ben-Jebria A, Langer R. Recent advances in pulmonary drug delivery using large, porous inhaled particles. J Appl Physiol 84(2) (1998) 379-385), 2) maximise aerosolisation and delivery of protein out of the aerosol-generating device, by, for example, preventing losses associated with protein adsorption to device surfaces, 3) modify the aggregation state of the solution stable peptide which can modulate the permeability characteristics of the peptide across pulmonary epithe- lia. Examples of delivery modifying agents include, but are not limited to, complexing agents (e.g. divalent metals, cyclodextrins, proteins (e.g. albumin, protamine)), phospholipids, gly- colipids, glycerides, carbohydrates, surfactants, viscosity modifying agents (e.g. glycerol, glycols, hydrophilic biocompatible polymers (e.g. polyethylene glycols, pluronics, methylcellu- lose derivatives, carbopols, chitosans, etc.)), semi-polar co-solvents (e.g. ethanol), salts, or, alternatively, small organic molecules as described by Emisphere Technologies (cf. WO 98/25589 Active agent transport systems). Choice and amount of excipients in the formulation would depend primarily on the excipients safety record (i.e. toxicological profile). This safety record would include both systemic and local pulmonary toxicity determinations. Advantageously, no added excipient will adversely affect the airways of the patient. Typical formulations for nebulisation would normally include between 0.1 - 100 mg of the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer per mL solution. More preferably between 1 - 50 mg protein per mL solution.
One liquid formulation for nebulization could include a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer at 5mg/mL, phenol at 5.0 mg/mL, mannitol at 38 mg/mL, and phosphate- buffer adjusted to about pH 7.4 in bacteriostatic water for injection.
In a further embodiment, the liquid formulation could be nebulised by any known nebulisation technology, such as jet or ultrasonic nebulisation, to achieve a MMAD of aerosol particles less than 10μm, more preferably between 1-5 μm, and most preferably between 1-3 μm. An example of a clinically useful nebuliser could be the Maxin® nebuliser developed by Clinova Medical AB (Malmo, Swe). Ideally, the particle distribution is substantially narrow so as to provide an optimal, reproducible delivery of the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer to the lung. The preferred particle size range is based on the most effective size range for delivery of drug to the deep lung, where protein is optimally absorbed. In one embodiment, advanced nebulisation techniques such as those provided for by Aradigm Corp. (AERx® system) could be utilised (cf. US 5,934,272; US 5,855,564).
In an alternative embodiment, the GLP-1 compound whereto is attached a lipophilic sub- stituent optionally via a spacer could be formulated as a dry powder for inhalation. Dry powders have the advantages of room-temperature stability, and high drug payload (e.g. dry powder aerosols contain between 50-95% pure drug) when compared to aqueous formulations for nebulisation, or metered dose inhalers (MDIs), an additional advantage is that DPIs (dry powder inhalers) do not require the co-ordination necessary to operate traditional MDIs (metered dose inhalers) since most are breath activated and are optimally designed to deliver consistent doses independent of inspiratory flow rates over a wide range. This translates to the ability to delivery a much larger amount of drug per patient breath (5-100 fold) when compared MDIs and nebulised solutions. As well, the risk of microbial or fungal contamination is reduced due to formulations being in the dry state. Dry powder formulations can be designed to be highly soluble in pulmonary fluid. Alternatively, controlled pulmonary delivery may be achieved by modifying the solubility of the dry powder formulation, modifying the aggregation state of the solubilized GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer, or the dry powder particle size. Additives may be included to facilitate controlled pulmonary delivery, processing and filling of powders, aersoli- sation efficiency of the powder, chemical stabilization, or to provide cosmetic appeal (e.g. flavorants).
Examples of processing, filling, and metering methods for developing dry powders for inhalation are provided for in e.g. US 5,874,064, US 5,855,913, WO9829096, WO9829098, WO9829140, WO9829141 , WO9816205, WO9741833, WO 97/41833, US 5,780,014, WO 99/16419, US 5,699,649, US 5,654,007, WO 97/47286, WO 98/13031 , US 5725841 , WO 98/34596, WO 99/36334, WO 98/35888, WO 98/30262.
Examples of excipients can include, but are not limited to, substances which can be added to the formulation in order to improve dry powder processing, metering, and filling, de- livery efficiency of the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer to the lower lung, or modify the permeation of the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer across the pulmonary epithelium. In this context, the added ingredient may: 1) facilitate processing of dry powders to achieve particle sizes within the optimum window of 1-3 μm MMAD, which has been defined as being optimal for deep lung deposition (cf. Edwards DA, Ben-Jebria A, Langer R. Recent advances in pulmonary drug delivery using large, porous inhaled particles. J Appl Physiol 84(2) (1998) 379-385), 2) on exposure to an aerosol-generating device, facilitate the formation of substantially dispersed aerosol particles from a powder cake within the optimum window of 1-3 μm MMAD, 3) maximise aerosolisation and delivery of protein out of the aerosol-generating de- vice, by, for example, preventing losses associated with powder aggregation, 4) improve powder flow characteristics to optimise filling procedures (e.g. bulking agents), 5) modify the aggregation state of the solution stable peptide which can modulate the permeability characteristics of the peptide across pulmonary epithelia, 6) control the release of the GLP-1 compound whereto is attached a lipophilic substituent. Examples of such excipients include, but are not limited to, complexing agents (e.g. divalent metals, cyclodextrins, pro- teins/polypeptides (e.g. albumin, protamine)), phospholipids, glycolipids, glycerides, carbohydrates, surfactants, biocompatible polymers (polyethylene glycols, PLGA derivatives, plu- ronics, methylcellulose derivatives, etc.), salts, amino acids, or, alternatively, small organic molecules as described by Emisphere Technologies (cf. WO 98/25589). Choice and amount of excipients in the formulation would depend primarily on the excipients safety record (i.e. toxicological profile). This safety record would be based on relative systemic and local pulmonary toxicity determinations. Advantageously, no added excipient will adversely affect the airways of a patient.
Additionally, antioxidants may be added to prevent chemical degradation of the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer. Suitable antioxidants may include, but are not limited to, phenolic compounds (e.g.BHT, BHA, popyl gallate, α-tocopherol), reducing agents (e.g. methionine, ascorbic acid, sodium sulfite, thioglycerol, thioglycolic acid), or chelating agents (e.g. EDTA, citric acid, or thioglycolic acid). Ideally, dry powders for inhalation would contain between 50 - 100 %, more preferably between 75-100%, and most preferably between 90 - 100% GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer on a w/w basis. Furthermore, the dry powder formulation should be designed to contain a MMAD of aerosol particles less than 10μm, more preferably between 1-5 μm, and most preferably between 1-3 μm. Ideally, the particle distribution is substantially narrow so as to provide an optimal, reproducible delivery of GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer to the lung. The preferred particle size range is based on the most effective size range for delivery of drug to the deep lung, where protein is optimally absorbed. The defined optimal particle size range of the protein powders may be obtained by any conventional method know to those skilled in the art, such as spray-drying, spray-coating, jet-milling, extrusion, micronization, lyophilisation, solution condensation, or the like.
The above particles may be supplied to the aerosol-generating device as redisper- sable aggregates or agglomerates in order to improve the powder handling characteristics, for example during filling of unit dose blister packs. Aggregates, agglomerates, or granules may be formed by techniques known in the art, for example formation of a wetted particle mass with a binding solvent, extrusion of wetted mass through fine mesh screens (ca. 40 - 650 μm), and subsequent drying, sieving, and optional spheronization steps. Examples of such processes used in protein formulations are provided for in e.g. WO 99/48476, US 5,780,014 and US 5,654,007, and are recognised in the art. Formation of aggregates, agglomerates, granules or the like may include the use of non aqueous solvents such as, a flu- rocarbon (e.g. perfluorodecalin, perfluorooctylbromide), toluene, xylene, benzene, acetone, hexane, octane, chloroform and methylene chloride.
Packaging of drug product is typically done in unit dose blisters or cartridges, and is completed by techniques know in the art.
Embodiments of devices suitable for dry powder pulmonary delivery of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer include, but are not limited to, devices provided for by 3M, Inhale Therapeutic Systems, Advanced Inhalation Technology Corp., Dura Pharmaceuticals (e.g. Spiros® device), Astra Pharmaceuticals (e.g Turbuhaler® device), Glaxo (e.g. rotahaler® or diskhaler® device), Fisons (e.g. spinhaler® device) or MicroDose Technologies, of which some examples are provided for in e.g. WO 96/32149, US 5,655,523, US 5,645,051 , US 5,622,166, US 5,577,497, US 5,492,112, US 5,327,883, US 5,277,195 and US 5,694,920.
In an alternative embodiment, the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer may be formulated for use with conventional metered dose inhalers (MDIs). MDIs can usually deliver higher concentrations of active over shorter periods of time when compared to nebulised solutions.
Formulations prepared for MDIs are typically finely dispersed powders, which are suspended in non-aqueous propellant solutions. Alternatively, a solution aerosol can be made by including organic co-solvents, such as ethanol. Propellents used can be chosen from common materials such as, chlorofluorcarbons, hydrochlorofluorocarbons, hydrofluro- carbons, or hydrocarbons. Preferably the propellant is chosen to be more environmentally friendly, such as the hydrofluorocarbons. The use of additional excipients may be necessary to stabilise the dispersed powder suspension, to prevent chemical degradation, or to optimise the delivery of the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer in a finely dispersed form. The particle size fractions delivered from the MDI device will ideally have an MMAD of <10 μm, more preferably between 1-5 μm, and most preferably between 1-3 μm. Examples of formulations and devices for MDIs are provided for in WO 97/47286, WO 98/13031 , US 5725841 , WO 98/34596, WO 99/36334, WO 98/35888, WO 98/30262.
Experimental
The following formulations have been tested in pigs:
• approx. 125 μg/Kg was administered via nebulization using a Maxin® MA3 jet nebulizer (Clinova Medical AB, Malmό, Se) adjusted for an air flow pressure of 5bar.
• Pigs (Landrace x Yorkshire x Duroc, mean weight ca. 20kg) were anesthetized, intubated, and ventilated. The nebulizer was attached in line on the inspiratory side of the ventilation circuit using a T-piece.
• MMAD of aerosol particles were between 4.3 - 4.8 μm.
• Plasma GLP-1 levels were assessed using a validated immunoassay. The results showed that the GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer (e.g. Arg34Lys26(Nε-(γ-glutamyl(Nα-hexadecanoyl)))-GLP-1 (7- 37)-OH, referred to as Acyl-GLP-1) was absorbed in vivo via pulmonary delivery.

Claims

1. A pulmonary liquid or dry formulation comprising a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer.
2. The pulmonary formulation of claim 1 wherein said GLP-1 compound is exendin or an analog thereof or a GLP-1 analogue.
3. The pulmonary formulation of claim 2 wherein said GLP-1 compound is exendin-3, ex- endin-4 or Arg34-GLP-1 (7-37)-OH.
4. The pulmonary formulation of any one of claims 1-3 wherein said lipophilic substituent comprises 4-40 carbon atoms.
5. The pulmonary formulation of any one of claims 1-4 wherein said lipophilic substituent is hexadecanoyl.
6. The pulmonary formulation of any one of claims 1-5 wherein a spacer is present.
7. The pulmonary formulation of claim 6 wherein said spacer is γ-Glu or β-Ala.
8. The pulmonary formulation of claim 1 wherein said GLP-1 compound whereto is attached a lipophilic substituent via a spacer is Arg34Lys26(Nε-(γ-glutamyl(Nα-hexadecanoyl)))-GLP-1 (7- 37)-OH, Arg18, Leu20, Gin34, Lys33 (Nε-(γ-aminobutyroyl(Nα-hexadecanoyl))) Exendin-4-(7-45)- NH2 or Arg33, Leu20, Gin34, Lys18 (Nε-(γ-aminobutyroyl(Nα-hexadecanoyl))) Exendin-4-(7-45)- NH2.
9. A pulmonary delivery device comprising a formulation according to any one of claims 1-8.
10. A pulmonary delivery device comprising a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer.
11. A method for preparing a pulmonary liquid or dry formulation for use in a pulmonary device, said formulation comprising a GLP-1 compound whereto is attached a lipophilic sub- stituent optionally via a spacer.
12. A method for preparing a pulmonary delivery device, said device comprising a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer.
13. A method of reducing blood glucose levels, treating diabetes type I, diabetes type II, or obesity, or inhibiting gastric acid secretion, or inhibiting apoptosis of β-cells, comprising administering to a patient in need thereof an effective amount of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer by inhalation so as to deposit said GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer in the lungs of the patient.
14. Use of a GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer for the preparation of a pulmonary delivery device for reducing blood glucose levels, treating diabetes type I, diabetes type II, obesity, gastric ulcers, or for inhibition of apoptosis of β-cells.
15. The use according to claim 14, wherein said GLP-1 compound whereto is attached a lipophilic substituent optionally via a spacer is Arg34Lys26(Nε-(γ-glutamyl(Nα-hexadecanoyl)))- GLP-1 (7-37)-OH.
EP01900109A 2000-01-11 2001-01-11 Transepithelial delivery of glp-1 derivatives Withdrawn EP1250126A2 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
DKPA200000030 2000-01-11
DK200000030 2000-01-11
PCT/DK2001/000015 WO2001051071A2 (en) 2000-01-11 2001-01-11 Transepithelial delivery of glp-1 derivatives

Publications (1)

Publication Number Publication Date
EP1250126A2 true EP1250126A2 (en) 2002-10-23

Family

ID=8158907

Family Applications (1)

Application Number Title Priority Date Filing Date
EP01900109A Withdrawn EP1250126A2 (en) 2000-01-11 2001-01-11 Transepithelial delivery of glp-1 derivatives

Country Status (4)

Country Link
EP (1) EP1250126A2 (en)
JP (1) JP2003519664A (en)
AU (1) AU2353701A (en)
WO (1) WO2001051071A2 (en)

Families Citing this family (69)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9006175B2 (en) 1999-06-29 2015-04-14 Mannkind Corporation Potentiation of glucose elimination
US20030119734A1 (en) 2001-06-28 2003-06-26 Flink James M. Stable formulation of modified GLP-1
EP1494732B1 (en) 2002-03-20 2008-01-30 MannKind Corporation Inhalation apparatus
WO2004105790A1 (en) 2003-06-03 2004-12-09 Novo Nordisk A/S Stabilized pharmaceutical peptide compositions
US8921311B2 (en) 2003-08-01 2014-12-30 Mannkind Corporation Method for treating hyperglycemia
TW200522976A (en) 2003-09-19 2005-07-16 Novo Nordisk As Novel plasma protein affinity tags
KR101241862B1 (en) * 2003-09-19 2013-03-13 노보 노르디스크 에이/에스 Novel glp-1 derivatives
RU2401276C2 (en) * 2003-09-19 2010-10-10 Ново Нордиск А/С Glucagon-like peptide-1 (glp-1) derivatives
US20060287221A1 (en) 2003-11-13 2006-12-21 Novo Nordisk A/S Soluble pharmaceutical compositions for parenteral administration comprising a GLP-1 peptide and an insulin peptide of short time action for treatment of diabetes and bulimia
ES2373660T3 (en) * 2003-11-13 2012-02-07 Novo Nordisk A/S PHARMACEUTICAL COMPOSITION THAT INCLUDES AN INSULINOTROPIC GLP-1 ANALOG (7-37), ASP INSULIN (B28) AND A TENSIOACTIVE.
PT1687019T (en) 2003-11-20 2018-02-26 Novo Nordisk As FORMULATIONS OF PEPTIDES CONTAINING POLYETHYLENE GLYCOL THAT ARE GREAT FOR PRODUCTION AND USE IN INJECTION DEVICES
JP2007537141A (en) 2003-12-18 2007-12-20 ノボ ノルディスク アクティーゼルスカブ Novel GLP-1 compound
DK1786784T3 (en) 2004-08-20 2011-02-14 Mannkind Corp Catalysis of diketopiperazine synthesis
CN104436170B (en) 2004-08-23 2018-02-23 曼金德公司 Diketopiperazine salt for drug delivery
US7442682B2 (en) * 2004-10-19 2008-10-28 Nitto Denko Corporation Transepithelial delivery of peptides with incretin hormone activities
EP2494983B1 (en) 2004-11-12 2019-04-24 Novo Nordisk A/S Stable formulations of glp-1
AU2006215566A1 (en) * 2005-02-16 2006-08-24 Novo Nordisk A/S Insulinotropic agents conjugated with structurally well defined branched polymers
JP5755398B2 (en) 2005-03-18 2015-07-29 ノヴォ ノルディスク アー/エス Elongated GLP-1 compound
TWI372629B (en) 2005-03-18 2012-09-21 Novo Nordisk As Acylated glp-1 compounds
CA2606902A1 (en) * 2005-05-27 2006-11-30 Asubio Pharma Co., Ltd. Insulin resistance improver
AU2006290227B2 (en) 2005-09-14 2012-08-02 Mannkind Corporation Method of drug formulation based on increasing the affinity of crystalline microparticle surfaces for active agents
KR20080096809A (en) 2006-02-22 2008-11-03 맨카인드 코포레이션 Method for Improving Pharmaceutical Properties of Microparticles Containing Diketopiperazine and Active Agents
KR101736502B1 (en) * 2007-10-24 2017-05-16 맨카인드 코포레이션 Method of preventing adverse effects by glp-1
US8485180B2 (en) 2008-06-13 2013-07-16 Mannkind Corporation Dry powder drug delivery system
SG10201507036TA (en) 2008-06-13 2015-10-29 Mannkind Corp A dry powder inhaler and system for drug delivery
EP2609954B1 (en) 2008-06-20 2021-12-29 MannKind Corporation An interactive apparatus for real-time profiling of inhalation efforts
AU2009279090A1 (en) 2008-08-06 2010-02-11 Novo Nordisk Health Care Ag Conjugated proteins with prolonged in vivo efficacy
TWI614024B (en) 2008-08-11 2018-02-11 曼凱公司 Ultra-fast use of insulin
PT3228320T (en) 2008-10-17 2020-03-26 Sanofi Aventis Deutschland Combination of an insulin and a glp-1 agonist
US8314106B2 (en) 2008-12-29 2012-11-20 Mannkind Corporation Substituted diketopiperazine analogs for use as drug delivery agents
MX2011007371A (en) 2009-01-08 2011-09-06 Mannkind Corp Method for treating hyperglycemia with glp-1.
CA2747825A1 (en) 2009-01-22 2010-07-29 Novo Nordisk Health Care Ag Stable growth hormone compounds
MX2011009512A (en) 2009-03-11 2011-11-29 Mannkind Corp Apparatus, system and method for measuring resistance of an inhaler.
MY157166A (en) 2009-06-12 2016-05-13 Mankind Corp Diketopiperazine microparticles with defined specific surface areas
KR101853606B1 (en) 2009-07-06 2018-05-03 사노피-아벤티스 도이칠란트 게엠베하 Aqueous insulin preparations containing methionine
EP2461831B1 (en) 2009-08-06 2018-11-21 Novo Nordisk Health Care AG Growth hormones with prolonged in-vivo efficacy
CA2778698A1 (en) 2009-11-03 2011-05-12 Mannkind Corporation An apparatus and method for simulating inhalation efforts
DK2498802T3 (en) 2009-11-13 2015-04-13 Sanofi Aventis Deutschland Pharmaceutical composition comprising a GLP-1 agonist, insulin and a methionine
KR101337322B1 (en) 2009-11-13 2013-12-06 사노피-아벤티스 도이칠란트 게엠베하 Pharmaceutical composition comprising a glp-1 agonist and methionine
RU2012134974A (en) 2010-01-22 2014-02-27 Ново Нордиск Хелс Кеа Аг STABILIZED GROWTH HORMONE COMPOUND
RU2605627C2 (en) 2010-01-22 2016-12-27 Ново Нордиск Хелс Кеа Аг Growth hormones with prolonged efficacy in vivo
IL223742A (en) 2010-06-21 2016-06-30 Mannkind Corp Dry powder inhaler and composition therefor
ES2606554T3 (en) 2010-08-30 2017-03-24 Sanofi-Aventis Deutschland Gmbh Use of AVE0010 for the manufacture of a medication for the treatment of type 2 diabetes mellitus
EP2694402B1 (en) 2011-04-01 2017-03-22 MannKind Corporation Blister package for pharmaceutical cartridges
US9821032B2 (en) 2011-05-13 2017-11-21 Sanofi-Aventis Deutschland Gmbh Pharmaceutical combination for improving glycemic control as add-on therapy to basal insulin
WO2012174472A1 (en) 2011-06-17 2012-12-20 Mannkind Corporation High capacity diketopiperazine microparticles
PL2750699T3 (en) 2011-08-29 2015-12-31 Sanofi Aventis Deutschland Pharmaceutical combination for use in glycemic control in diabetes type 2 patients
AR087744A1 (en) 2011-09-01 2014-04-16 Sanofi Aventis Deutschland PHARMACEUTICAL COMPOSITION FOR USE IN THE TREATMENT OF A NEURODEGENERATIVE DISEASE
HK1200318A1 (en) 2011-10-24 2015-08-07 曼金德公司 Methods and compositions for treating pain
CN104411322B (en) 2012-05-08 2017-05-24 诺和诺德股份有限公司 Diacylated GLP‑1 Derivatives
EP2872205B1 (en) 2012-07-12 2017-02-08 MannKind Corporation Dry powder drug delivery systems
US10159644B2 (en) 2012-10-26 2018-12-25 Mannkind Corporation Inhalable vaccine compositions and methods
TWI641381B (en) 2013-02-04 2018-11-21 法商賽諾菲公司 Stabilized pharmaceutical formulations of insulin analogs and/or insulin derivatives
WO2014144895A1 (en) 2013-03-15 2014-09-18 Mannkind Corporation Microcrystalline diketopiperazine compositions and methods
EP2981282B1 (en) 2013-04-05 2020-11-04 Novo Nordisk Health Care AG Growth hormone compound formulation
KR102465025B1 (en) 2013-07-18 2022-11-09 맨카인드 코포레이션 Heat-stable dry powder pharmaceutical compositions and methods
EP3030294B1 (en) 2013-08-05 2020-10-07 MannKind Corporation Insufflation apparatus
SG11201604706TA (en) 2014-01-09 2016-07-28 Sanofi Sa Stabilized pharmaceutical formulations of insulin aspart
CN112957455A (en) 2014-01-09 2021-06-15 赛诺菲 Stabilized pharmaceutical formulations of insulin analogues and/or insulin derivatives
EP3091965A1 (en) 2014-01-09 2016-11-16 Sanofi Stabilized glycerol free pharmaceutical formulations of insulin analogues and/or insulin derivatives
US10307464B2 (en) 2014-03-28 2019-06-04 Mannkind Corporation Use of ultrarapid acting insulin
US10561806B2 (en) 2014-10-02 2020-02-18 Mannkind Corporation Mouthpiece cover for an inhaler
AU2015359376B2 (en) 2014-12-12 2021-09-09 Sanofi-Aventis Deutschland Gmbh Insulin glargine/lixisenatide fixed ratio formulation
TWI748945B (en) 2015-03-13 2021-12-11 德商賽諾菲阿凡提斯德意志有限公司 Treatment type 2 diabetes mellitus patients
TW201705975A (en) 2015-03-18 2017-02-16 賽諾菲阿凡提斯德意志有限公司 Treatment of type 2 diabetes mellitus patients
HUE066356T2 (en) 2017-08-24 2024-07-28 Novo Nordisk As GLP-1 preparations and their applications
KR20220045206A (en) * 2019-08-12 2022-04-12 바이오마린 파머수티컬 인크. Hydrophobic Peptide Salts for Extended Release Compositions
CN114555058A (en) * 2019-08-16 2022-05-27 应用分子转运公司 Compositions and particles for payload delivery
PE20221575A1 (en) 2020-02-18 2022-10-06 Novo Nordisk As PHARMACEUTICAL FORMULATIONS

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1993018785A1 (en) * 1992-03-19 1993-09-30 Novo Nordisk A/S Novel medicament

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1999043708A1 (en) * 1998-02-27 1999-09-02 Novo Nordisk A/S Glp-1 derivatives of glp-1 and exendin with protracted profile of action
JP2002504518A (en) * 1998-02-27 2002-02-12 ノボ ノルディスク アクティーゼルスカブ GLP-1 derivatives with helix-content of more than 25% forming partially structured micellar-like aggregates
HUP0103369A3 (en) * 1998-08-28 2002-03-28 Lilly Co Eli Use of insulinotropic peptides

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1993018785A1 (en) * 1992-03-19 1993-09-30 Novo Nordisk A/S Novel medicament

Also Published As

Publication number Publication date
WO2001051071A2 (en) 2001-07-19
JP2003519664A (en) 2003-06-24
AU2353701A (en) 2001-07-24
WO2001051071A3 (en) 2002-01-24

Similar Documents

Publication Publication Date Title
WO2001051071A2 (en) Transepithelial delivery of glp-1 derivatives
US20010012829A1 (en) Transepithelial delivery GLP-1 derivatives
CN101674812B (en) Method of drying protein composition, dried protein composition and pharmaceutical composition comprising dried protein
EP2076242B1 (en) Aerosolizable formulation comprising insulin for pulmonary delivery
EP2060268A1 (en) Pharmaceutical compositions for pulmonary or nasal delivery of peptides
RU2148398C1 (en) Therapeutic preparation and method for making inhalations
EP0997151B1 (en) Method for administering insulinotropic peptides
US20010007853A1 (en) Method for administering monomeric insulin analogs
US20040120897A1 (en) Method for administering insulinotropic peptides
EP1173482A1 (en) Insulin crystals for pulmonary administration
EP1986674A2 (en) Methionine-containing protein or peptide compositions and methods of making and using
EP2036572A1 (en) Process for drying a protein, a protein particle and a pharmaceutical composition comprising the protein particle
KR20040093155A (en) Powdery medicinal compositions for inhalation and process for producing the same
US20040214747A1 (en) Method for administering monomeric insulin
WO2006076277A1 (en) Compositions and methods for increasing the bioavailability of pulmonarily administered insulin
Somasundaram et al. CARRIER PARTICLES INFLUENCE ON DRY POWDER INHALATION IN LUNG DISEASE
CZ20002418A3 (en) Method of administering monomeric analog of insulin
CZ20002417A3 (en) Drug for administration by inhalation
MXPA00006644A (en) Method for administering monomeric insulin analogs
EP1666054A1 (en) Method for administering insulinotropic peptides
MXPA01001905A (en) Method for administering insulinotropic peptides

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20020812

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE TR

AX Request for extension of the european patent

Free format text: LT;LV;MK;RO;SI

17Q First examination report despatched

Effective date: 20040930

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20080905