EP1239871A1 - Use of glp-1 agonists for the inhibition of beta cell degeneration - Google Patents

Use of glp-1 agonists for the inhibition of beta cell degeneration

Info

Publication number
EP1239871A1
EP1239871A1 EP00974350A EP00974350A EP1239871A1 EP 1239871 A1 EP1239871 A1 EP 1239871A1 EP 00974350 A EP00974350 A EP 00974350A EP 00974350 A EP00974350 A EP 00974350A EP 1239871 A1 EP1239871 A1 EP 1239871A1
Authority
EP
European Patent Office
Prior art keywords
glp
lys
arg
gly
xaa
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP00974350A
Other languages
German (de)
French (fr)
Inventor
Liselotte Bjerre Knudsen
Carsten Foged Godtfredsen
Jacob Sten Petersen
Richard David Carr
Soeren Bregenholt
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novo Nordisk AS
Original Assignee
Novo Nordisk AS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Novo Nordisk AS filed Critical Novo Nordisk AS
Publication of EP1239871A1 publication Critical patent/EP1239871A1/en
Withdrawn legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/26Glucagons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16Anti-Parkinson drugs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/48Drugs for disorders of the endocrine system of the pancreatic hormones
    • A61P5/50Drugs for disorders of the endocrine system of the pancreatic hormones for increasing or potentiating the activity of insulin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/08Vasodilators for multiple indications

Definitions

  • the present invention relates to a method for modulating, inhibiting or decreasing or preventing beta cell degeneration, loss of beta cell function, beta cell dysfunction, and/or death of beta cells, such as necrosis or apoptosis of beta cells in a subject comprising adminis- tering a GLP-1 agonist to said subject.
  • coagulative necrosis This is an abnormal morphological appearance, detected in tissue examined under the microscope.
  • the changes, which affect aggregates of adjacent cells or functionally related cohorts of cells, are seen in a variety of contexts produced by accident, injury, or disease.
  • oxygen deprivation oxygen deprivation
  • hyper- thermia hyper- thermia
  • immunological attack and exposure to various toxins that inhibit crucial intracellular metabolic processes.
  • Coagulative necrosis is the classical form of cell change seen when tis- sues autolyze (digest themselves) in vitro.
  • Apoptosis is an active process of cellular self-destruction that is regulated by extrinsic and intrinsic signals occurring during normal development. It is well documented that apoptosis plays a key role in regulation of pancreatic endocrine beta cells. There is increasing evidence that in adult mammalians the beta-cell mass is submitted to dynamic changes to adapt insulin production for maintaining euglycemia in particular conditions, such as pregnancy and obesity (J. Dev. Physiol. 5: 373, 1983 and Endocrinology 130: 1459, 1992). The control of beta cell mass depends on a subtle balance between cell proliferation, growth and cell death (apoptosis). A disruption of this balance may lead to impairment of glucose homeostasis.
  • glucose intolerance develops with aging when beta cell replica- tion rates are reduced (Diabetes 32: 14, 1983) and human autopsy studies repeatedly showed a 40-60% reduction of beta cell mass in patients with non- insulin-dependent-diabetes mellitus compared with nondiabetic subjects (Am. J. Med. 70: 105, 1981 and Diabetes Res. 9: 151, 1988). It is generally agreed that insulin resistance is an invariable accompaniment of obesity but that normoglycemia is maintained by compensatory hyperinsulinemia until the beta cells become unable to meet the increased demand for insulin, at which point Type 2 Diabetes begins. Apoptosis is also associated with diseases states such as cancer, immunological disorders, like multiple sclerosis, and AIDS, and neurodegenerative disorders (Science 267: 1449, 1995), like Alzheimers disease, stroke, and Parkinson's disease.
  • the present invention relates to use of a GLP-1 agonist for the preparation of a medicament for treatment of beta cell degeneration, such as necrosis or apoptosis of * ⁇ -cells.
  • the present invention relates to use of a GLP-1 agonist for the prepara- tion of a medicament for modulation of beta cell degeneration, such as necrosis or apoptosis of ⁇ -cells.
  • the present invention relates to use of a GLP-1 agonist for the preparation of a medicament for inhibition of beta cell degeneration, such as necrosis or apoptosis of ⁇ -cells. Furthermore, the present invention relates to use of a GLP-1 agonist for the preparation of a medicament for decreasing beta cell degeneration, such as necrosis or apoptosis of ⁇ - cells.
  • the present invention relates to use of a GLP-1 agonist for the preparation of a medicament for reduction of beta cell degeneration, such as necrosis or apoptosis of ⁇ -cells.
  • the present invention relates to use of a GLP-1 agonist for the preparation of a medicament for arresting beta cell degeneration, such as necrosis or apoptosis of ⁇ - cells.
  • the present invention relates to use of a GLP-1 agonist preventing beta cell degeneration for the preparation of a medicament for prevention of beta cell degeneration, such as necrosis or apoptosis of ⁇ -cells.
  • the invention relates to a method for treatment of beta cell degeneration, such as necrosis or apoptosis of ⁇ -cells, in a subject comprising administering a GLP-1 agonist to said subject. Furthermore, the invention relates to a method for modulation of beta cell degeneration, such as necrosis or apoptosis of ⁇ -cells, in a subject comprising administering a GLP-1 agonist to said subject. Furthermore, the invention relates to a method for inhibition of beta cell degeneration- such as necrosis or apoptosis of ⁇ -cells, in a subject comprising administering a GLP-1 agonist to said subject.
  • the invention relates to a method for decreasing beta cell degeneration, such as necrosis or apoptosis of ⁇ -cells, in a subject comprising administering a GLP-1 agonist to said subject.
  • the invention relates to a method for reduction of beta cell degeneration- such as necrosis or apoptosis of ⁇ -cells, in a subject comprising administering a GLP-1 agonist to said subject. Furthermore, the invention relates to a method for arresting beta cell degeneration, such as necrosis or apoptosis of ⁇ -cells, in a subject comprising administering a GLP-1 agonist to said subject.
  • the invention relates to a method for prevention of beta cell degeneration, such as necrosis or apoptosis of ⁇ -cells, in a subject comprising administering a GLP-1 agonist to said subject.
  • beta cell degeneration is necrosis of beta cells.
  • beta cell degeneration is apoptosis of beta cells.
  • said apoptosis is induced by a cytokine.
  • the cytokine may be any cytokine or mixtures thereof, such as interleukin 1 (IL-1), IL-2, IL-3, IL-5, IL-6, IL-7, IL- 8, IL-9, IL-12, IL-14, IL-17, interferon- ⁇ , tumor necrosis factor- ⁇ , TNF- ⁇ , granulocyte macrophage colony stimulating factor, monocyte chemoattractant protein- 1 , or mixtures thereof.
  • the subject is preferably a mammal, more preferably a human.
  • the use according any of the above uses in a regimen which additionally comprises treatment with human growth hormone, a growth hormone releasing agent or a growth factor such as prolactin or placental lactogen; the use of human growth hormone, a growth hormone releasing agent or a growth factor such as prolactin or placental lactogen for the preparation of a medicament for inhibiting the beta cell degeneration, such as necrosis or apoptosis of ⁇ -cells in a subject; the use of human growth hormone, a growth hormone releasing agent or a growth factor such as prolactin or placental lactogen for the preparation of a medicament for treatment of beta cell degeneration, such as necrosis or apoptosis of ⁇ -cells in a subject.
  • the GLP-1 agonist is GLP-l(7-37) or GLP-1(7- 36) amide.
  • the GLP-1 agonist is a GLP-1 analogue.
  • the GLP-1 analogue is selected from the Thr 8 , Met 8 , Gly 8 and Val 8 analogues of GLP-1 (7-37) and GLP-l(7-36) amide, more preferred the Gly 8 and Val 8 analogues of GLP- 1 (7-37) and GLP- 1 (7-36) amide, most preferred the Val 8 analogues of GLP- 1(7-37) and GLP-1 (7-36) amide.
  • the GLP-1 analogue has the formula II: 7 8 9 10 11 12 13 14 15 16 17 His-Xaa-Xaa-Gly-Xaa-Phe-Thr-Xaa-Asp-Xaa-Xaa-
  • Xaa at position 8 is Ala, Gly, Ser, Thr, Leu, He, Val, Glu, Asp, Met, or Lys,
  • Xaa at position 9 is Glu, Asp, or Lys
  • Xaa at position 11 is Thr, Ala, Gly, Ser, Leu, He, Val, Glu, Asp, or Lys
  • Xaa at position 14 is Ser, Ala, Gly, Thr, Leu, He, Val, Glu, Asp, or Lys
  • Xaa at position 16 is Val, Ala, Gly, Ser, Thr, Leu, He, Tyr, Glu, Asp, or Lys,
  • Xaa at position 17 is Ser, Ala, Gly, Thr, Leu, He, Val, Glu, Asp, or Lys,
  • Xaa at position 18 is Ser, Ala, Gly, Thr, Leu, He, Val, Glu, Asp, or Lys,
  • Xaa at position 19 is Tyr, Phe, Tip, Glu, Asp, or Lys
  • Xaa at position 20 is Leu, Ala, Gly, Ser, Thr, Leu, He. Val, Glu, Asp, or Lys
  • Xaa at position 21 is Glu, Asp, or Lys
  • Xaa at position 22 is Gly, Ala, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys
  • Xaa at position 23 is Gin, Asn, Arg, Glu, Asp, or Lys
  • Xaa at position 24 is Ala, Gly, Ser, Thr, Leu, He, Val, Arg, Glu, Asp, or Lys
  • Xaa at position 25 is Ala, Gly, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys
  • Xaa at position 26 is Lys, Arg, Gin, Glu, Asp, or His
  • Xaa at position 27 is Glu, Asp, or Lys
  • Xaa at position 30 is Ala, Gly, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys
  • Xaa at position 31 is Trp, Phe, Tyr, Glu, Asp, or Lys
  • Xaa at position 32 is Leu, Gly, Ala, Ser, Thr, He, Val, Glu, Asp, or Lys
  • Xaa at position 33 is Val, Gly, Ala, Ser, Thr, Leu, He, Glu, Asp, or Lys
  • Xaa at position 34 is Lys, Arg, Glu, Asp, or His
  • Xaa at position 35 is Gly, Ala, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys
  • Xaa at position 36 is Arg, Lys, Glu, Asp, or His
  • Xaa at position 37 is Gly, Ala, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys, or is deleted
  • Xaa at position 38 is Arg, Lys, Glu, Asp, or His, or is deleted
  • Xaa at position 39 is Arg, Lys, Glu, Asp, or His, or is deleted
  • Xaa at position 40 is Asp, Glu, or Lys, or is deleted
  • Xaa at position 41 is Phe, Trp, Tyr, Glu, Asp, or Lys, or is deleted
  • Xaa at position 42 is Pro, Lys, Glu, or Asp, or is deleted
  • Xaa at position 43 is Glu, Asp, or Lys, or is deleted
  • Xaa at position 44 is Glu, Asp, or Lys, or is deleted, and
  • Xaa at position 45 is Val, Glu, Asp, or Lys, or is deleted, or (a) a C-l-6-ester thereof, (b) amide, C-l-6-alkylamide, or C-l-6-dialkylamide thereof and/or (c) a pharmaceutically acceptable salt thereof, provided that (i) when the amino acid at position 37, 38, 39, 40, 41, 42, 43 or 44 is deleted, then each amino acid downstream of the amino acid is also deleted.
  • the amino acids at positions 37-45 are absent.
  • the amino acids at posi- tions 38-45 are absent.
  • the amino acids at positions 39-45 are absent.
  • Xaa at position 8 is Ala, Gly, Ser, Thr, Met, or Val.
  • Xaa at position 8 is Gly, Thr, Met, or Val. In another embodiment of the GLP-1 analogue of formula II, Xaa at position 8 is Val.
  • Xaa at position 9 is Glu. In another embodiment of the GLP-1 analogue of formula II, Xaa at position 11 is Thr. In another embodiment of the GLP-1 analogue of formula II, Xaa at position 14 is Ser. In another embodiment of the GLP-1 analogue of formula II, Xaa at position 16 is Val. In another embodiment of the GLP- 1 analogue of formula II, Xaa at position 17 is Ser.
  • Xaa at position 18 is Ser, Lys, Glu, or Asp.
  • Xaa at position 19 is Tyr, Lys, Glu, or Asp.
  • Xaa at position 20 is Leu,
  • Xaa at position 21 is Glu, Lys, or Asp.
  • Xaa at position 22 is Gly, Glu, Asp, or Lys.
  • Xaa at position 23 is Gin, Glu, Asp, or Lys.
  • Xaa at position 24 is Ala, Glu, Asp, or Lys.
  • Xaa at position 25 is Ala,
  • Xaa at position 26 is Lys, Glu, Asp, or Arg.
  • Xaa at position 27 is Glu, Asp, or Lys.
  • Xaa at position 30 is Ala, Glu, Asp, or Lys.
  • Xaa at position 31 is Trp, Glu, Asp, or Lys.
  • Xaa at position 32 is Leu, Glu, Asp, or Lys. In another embodiment of the GLP-1 analogue of formula II, Xaa at position 33 is Val,
  • Xaa at position 34 is Lys, Arg, Glu, or Asp.
  • Xaa at position 35 is Gly, Glu, Asp, or Lys.
  • Xaa at position 36 is Arg, Lys, Glu, or Asp.
  • Xaa at position 37 is Gly, Glu, Asp, or Lys.
  • Xaa at position 38 is Arg, or Lys, or is deleted.
  • Xaa at position 40 is de- leted.
  • Xaa at position 42 is deleted.
  • Xaa at position 43 is deleted.
  • Xaa at position 45 is de- leted.
  • Xaa at position 26 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-36).
  • Xaa at position 26 is Arg
  • each of Xaa at positions 38-45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1(7-37).
  • Xaa at position 26 is Arg
  • each of Xaa at positions 39-45 is deleted
  • each of the other Xaa is the amino acid in native GLP-l(7-38).
  • Xaa at position 34 is Arg
  • each of Xaa at positions 37-45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1(7-36).
  • Xaa at position 34 is Arg
  • each of Xaa at positions 38-45 is deleted
  • each of the other Xaa is the amino acid in native GLP-l(7-37).
  • Xaa at position 34 is Arg
  • each of Xaa at positions 39-45 is deleted
  • each of the other Xaa is the amino acid in native GLP-l(7-38).
  • Xaa at positions 26 and 34 is Arg
  • Xaa at position 36 is Lys
  • each of Xaa at positions 37-45 is deleted
  • each of the other Xaa is the amino acid in native GLP-1 (7-36).
  • Xaa at positions 26 and 34 is Arg
  • Xaa at position 36 is Lys
  • each of Xaa at positions 38-45 is deleted
  • each of the other Xaa is the amino acid in native GLP-1 (7-37).
  • Xaa at positions 26 and 34 is Arg
  • Xaa at position 36 is Lys
  • each of Xaa at positions 39-45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1(7-38).
  • Xaa at positions 26 and 34 is Arg
  • Xaa at position 38 is Lys
  • each of Xaa at positions 39-45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1(7-38).
  • Xaa at position 8 is Thr, Ser, Gly, or Val
  • Xaa at position 37 is Glu
  • Xaa at position 36 is Lys
  • each of Xaa at positions 38- 45 is deleted
  • each of the other Xaa is the amino acid in native GLP-1 (7-37).
  • Xaa at position 8 is Thr, Ser, Gly, or Val
  • Xaa at position 37 is Glu
  • Xaa at position 36 is Lys
  • each of Xaa at positions 39- 45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1(7-38).
  • Xaa at position 8 is Thr, Ser, Gly or Val
  • Xaa at position 37 is Glu
  • Xaa at position 38 is Lys
  • each of Xaa at positions 39- 45 is deleted
  • each of the other Xaa is the amino acid in native GLP-l(7-38).
  • Xaa at position 18, 23 or 27 is Lys
  • Xaa at positions 26 and 34 is Arg
  • each of Xaa at positions 38-45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1 (7-37).
  • Xaa at position 18, 23 or 27 is Lys
  • Xaa at positions 26 and 34 is Arg
  • each of Xaa at positions 39-45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1(7-38).
  • Xaa at position 8 is Thr, Ser, Gly, or Val
  • Xaa at position 18, 23 or 27 is Lys
  • Xaa at position 26 and 34 is Arg
  • each of Xaa at positions 37-45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1(7-36).
  • Xaa at position 8 is Thr, Ser, Gly, or Val
  • Xaa at position 18, 23 or 27 is Lys
  • Xaa at position 26 and 34 is Arg
  • each of Xaa at positions 38-45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1(7-37).
  • Xaa at position 8 is Thr, Ser, Gly, or Val
  • Xaa at position 18, 23 or 27 is Lys
  • Xaa at position 26 and 34 is Arg
  • each of Xaa at positions 39-45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1(7-38).
  • Such GLP-1 analogues includes, but is not limited to, Arg 26 -GLP- 1(7-37); Arg 34 -GLP- 1(7-37); Lys 36 -GLP- 1(7-37); Arg 26 ' 34 Lys 36 -GLP- 1(7-37); Arg 26 ' 34 Lys 38 GLP-l(7-38); Arg 26 4 Lys 39 -GLP- 1(7-39); Arg 26 4 Lys 40 -GLP- 1(7-40); Arg 26 Lys 36 -GLP-l(7-37); Arg 34 Lys 36 -
  • Arg 26 ' 34 Lys 40 GLP- 1 (2-40); Arg 26 ' 34 Lys 41 GLP- 1 (2-41 ); Arg 26 ' 34 Lys 42 GLP- 1 (2-42); Arg 26 ' 34 Lys 43 GLP- 1(2-43); Arg 26,34 Lys 44 GLP-l(2-44); Arg 26 ' 34 Lys 45 GLP-l(2-45);
  • Arg 26 ' 34 Lys 39 GLP-l(4-39); Arg 26 - 34 Lys 40 GLP-l(4-40); Arg 26 ' 34 Lys 1 GLP-l(4-41); Arg 26 ' 34 Lys 42 GLP- 1 (4-42); Arg 26 ' 34 Lys 43 GLP- 1 (4-43); Arg 26 ' 34 Lys 44 GLP- 1 (4-44);
  • Arg 26 - 34 Lys 38 GLP-l(6-38); Arg 26 ' 34 Lys 39 GLP-l(6-39); Arg 26 ' 34 Lys 40 GLP-l(6-4O); Arg 26 - 34 Lys 41 GLP-l(6-41); Arg 26 ' 34 Lys 42 GLP- 1(6-42); Arg 26 ' 34 Lys 43 GLP- 1(6-43);
  • the GLP-1 agonist is a GLP-1 derivative.
  • the GLP-1 derivative has one or more lipophilic substituents attached to the parent peptide. The lipophilic substituents make the profile of action of the parent GLP-1 peptide more protracted, make the parent GLP-1 peptide more me- tabolically and physically stable, and/or increase the water solubility of the parent GLP-1 pep- tide.
  • the lipophilic substituent is characterised by having a solubility in water at 20°C in the range from about 0.1 mg/100 ml water to about 250 mg/100 ml water, preferable in the range from about 0.3 mg/100 ml water to about 75 mg/100 ml water.
  • octanoic acid (C8) has a solubility in water at 20°C of 68 mg/100 ml
  • decanoic acid (CIO) has a solubility in water at 20°C of 15 mg/100 ml
  • octadecanoic acid (C 18) has a solubility in water at 20°C of 0.3 mg/100 ml.
  • the GLP-1 derivatives preferably have three lipophilic substituents, more preferably two lipophilic substituents, and most preferably one lipophilic substituent.
  • Each lipophilic substituent(s) preferably has 4-40 carbon atoms, more preferably 8-30 carbon atoms, even more preferably 8-25 carbon atoms, even more preferably 12-25 carbon atoms, and most preferably 14-18 carbon atoms.
  • the lipophilic substituent(s) contain a functional group which can be attached to one of the following functional groups of an amino acid of the parent GLP-1 peptide: (a) the amino group attached to the alpha-carbon of the N-terminal amino acid,
  • a lipophilic 'substituent is attached to the carboxy group of the R group of any Asp and Glu residue.
  • a lipophilic substituent is attached to the carboxy group attached to the alpha-carbon of the C-terminal amino acid.
  • a lipophilic substituent is attached to the epsilon- amino group of any Lys residue.
  • Each lipophilic substituent contains a functional group which may be attached to a functional group of an amino acid of the parent GLP-1 peptide.
  • a lipophilic substituent may contain a carboxy 1 group which can be attached to an amino group of the parent GLP-1 peptide by means of an amide bond.
  • the lipophilic substituent comprises a partially or completely hydrogenated cyclopentanophenathrene skeleton.
  • the lipophilic substituent is a straight-chain or branched alkyl group.
  • the lipophilic substituent is an acyl group of a straight-chain or branched fatty acid.
  • the lipophilic substituent is an acyl group having the formula CH 3 (CH 2 ) n CO-, wherein n is an integer from 4 to 38, preferably an integer from 12 to 38, and most preferably is CH 3 (CH 2 ) 12 CO-, CH 3 (CH 2 ) ⁇ 4 CO-, CH 3 (CH 2 ) ⁇ 6 CO-, CH 3 (CH 2 ) ⁇ 8 C0-, CH 3 (CH 2 ) 20 CO- and CH 3 (CH 2 ) 22 CO-.
  • the lipophilic substituent is tetradecanoyl.
  • the lipophilic substituent is hexadecanoyl.
  • the lipophilic substituent has a group which is negatively charged such as a carboxylic acid group.
  • the lipophilic substituent may be an acyl group of a straight-chain or branched alkane ⁇ , ⁇ -dicarboxylic acid of the formula HOOC(CH 2 ) m CO-, wherein m is an integer from 4 to 38, preferably an integer from 12 to 38, and most preferably is HOOC(CH 2 )* 4 CO-, HOOC(CH 2 ) ⁇ 6 CO-, HOOC(CH 2 )* 8 CO-, HOOC(CH 2 ) 20 CO- or HOOC(CH 2 ) 22 CO-.
  • the lipophilic substituent is attached to the parent GLP-1 peptide by means of a spacer.
  • a spacer must contain at least two functional groups, one to attach to a functional group of the lipophilic substituent and the other to a functional group of the parent GLP-1 peptide.
  • the spacer is an amino acid residue except Cys or Met, or a dipeptide such as Gly-Lys.
  • a dipeptide such as Gly- Lys means any combination of two amino acids except Cys or Met, preferably a dipeptide wherein the C-terminal amino acid residue is Lys, His or Trp, preferably Lys, and the N-terminal amino acid residue is Ala, Arg, Asp, Asn, Gly, Glu, Gin, He, Leu, Val, Phe, Pro, Ser, Tyr, Thr, Lys, His and Trp.
  • an amino group of the parent peptide forms an amide bond with a carboxylic group of the amino acid residue or dipeptide spacer
  • an amino group of the amino acid residue or dipeptide spacer forms an amide bond with a carboxyl group of the lipophilic substituent
  • Preferred spacers are lysyl, glutamyl, asparagyl, glycyl, beta-alanyl and gamma- aminobutanoyl, each of which constitutes an individual embodiment. Most preferred spacers are glutamyl and beta-alanyl.
  • the spacer is Lys, Glu or Asp
  • the carboxyl group thereof may form an amide bond with an amino group of the amino acid residue
  • the amino group thereof may form an amide bond with a carboxyl group of the lipophilic substituent.
  • a further spacer may in some instances be inserted between the ⁇ -amino group of Lys and the lipophilic substituent.
  • such a further spacer is succinic acid which forms an amide bond with the ⁇ -amino group of Lys and with an amino group present in the lipophilic substituent.
  • such a further spacer is Glu or Asp which forms an amide bond with the ⁇ -amino group of Lys and another amide bond with a carboxyl group present in the lipophilic substituent, that is, the lipophilic substituent is a N ⁇ -acylated lysine residue.
  • the spacer is an unbranched alkane , ⁇ -dicarboxylic acid group having from 1 to 7 methylene groups, which spacer forms a bridge between an amino group of the parent peptide and an amino group of the lipophilic substituent.
  • the spacer is succinic acid.
  • the lipophilic substituent with the attached spacer is a group of the formula CH 3 (CH 2 ) p NH-CO(CH 2 ) q CO-, wherein p is an integer from 8 to 33 , preferably from 12 to 28 and q is an integer from 1 to 6, preferably 2.
  • the lipophilic substituent with the attached spacer is a group of the formula CH 3 (CH 2 ) r CO-NHCH(COOH)(CH 2 ) 2 CO-, wherein r is an integer from 4 to 24, preferably from 10 to 24.
  • the lipophilic substituent with the attached spacer is a group of the formula CH 3 (CH 2 ) S CO-NHCH((CH 2 ) 2 COOH)CO-, wherein s is an integer from 4 to 24, preferably from 10 to 24.
  • the lipophilic substituent is a group of the formula COOH(CH 2 ) t CO- wherein t is an integer from 6 to 24.
  • the lipophilic substituent with the attached spacer is a group of the formula -NHCH(COOH)(CH 2 ) 4 NH-CO(CH 2 ) u CH 3 , wherein u is an integer from 8 to 18.
  • the lipophilic substituent with the attached spacer is a group of the formula CH 3 (CH 2 ) v CO-NH-(CH 2 ) z -CO, wherein v is an integer from 4 to 24 and z is an integer from 1 to 6.
  • the lipophilic substituent with the attached spacer is a group of the formula -NHCH(COOH)(CH 2 ) 4 NH-COCH((CH 2 ) 2 COOH)NH-CO(CH 2 ) w CH 3 , wherein w is an integer from 10 to 16.
  • the lipophilic substituent with the attached spacer is a group of the formula -NHCH(COOH)(CH 2 ) 4 NH-CO(CH 2 ) 2 CH(COOH)NHCO(CH 2 ) x CH 3 , wherein x is zero or an integer from 1 to 22, preferably 10 to 16.
  • the GLP- 1 derivative is derived from a GLP- 1 fragment selected from the group comprising GLP-l(7-35), GLP-1 (7-36), GLP-1 (7-36)amide, GLP-l(7-37), GLP- 1(7-38), GLP-l(7-39), GLP-1 (7-40) and GLP-1 (7-41) or an analogue thereof.
  • the designation analogue comprises derivatives wherein a total of up to fifteen, preferably up to ten amino acid residues have been exchanged with any -amino acid residue.
  • the designation analogue comprises derivatives wherein a total of up to fifteen, preferably up to ten amino acid residues have been exchanged with any ⁇ -amino acid residue which can be coded for by the genetic code.
  • the designation analogue comprises de- rivatives wherein a total of up to six amino acid residues have been exchanged with another ⁇ - arnino acid residue which can be coded for by the genetic code.
  • the GLP-1 derivative is a GLP-1 derivative of formula I:
  • Xaa at position 8 is Ala, Gly, Ser, Thr, Leu, He, Val, Glu, Asp, Met, or Lys
  • Xaa at position 9 is Glu, Asp, or Lys
  • Xaa at position 11 is Thr, Ala, Gly, Ser, Leu, He, Val, Glu, Asp, or Lys
  • Xaa at position 14 is Ser, Ala, Gly, Thr, Leu, He, Val, Glu, Asp, or Lys
  • Xaa at position 16 is Val, Ala, Gly, Ser, Thr, Leu, He, Tyr, Glu, Asp, or Lys
  • Xaa at position 17 is Ser, Ala, Gly, Thr, Leu, He, Val, Glu, Asp, or Lys
  • Xaa at position 18 is Ser, Ala, Gly, Thr, Leu, He, Val, Glu, Asp, or Lys
  • Xaa at position 19 is Tyr, Phe, Tip, Glu, Asp, or Lys
  • Xaa at position 20 i is Leu, Ala, Gly, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys
  • Xaa at position 21 is Glu, Asp, or Lys
  • Xaa at position 22 is Gly, Ala, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys
  • Xaa at position 23 is Gin, Asn, Arg, Glu, Asp, or Lys
  • Xaa at position 24 ⁇ is Ala, Gly, Ser, Thr, Leu, He, Val, Arg, Glu, Asp, or Lys
  • Xaa at position 25 > is Ala, Gly, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys
  • Xaa at position 26 i is Lys, Arg, Gin, Glu, Asp, or His
  • Xaa at position 27 ' is Glu, Asp, or Lys,
  • Xaa at position 31 is Trp, Phe, Tyr, Glu, Asp, or Lys
  • Xaa at position 32 is Leu, Gly, -Ala, Ser, Thr, He, Val, Glu, Asp, or Lys
  • Xaa at position 33 is Val, Gly, Ala, Ser, Thr, Leu, He, Glu, Asp, or Lys
  • Xaa at position 34 is Lys, Arg, Glu, Asp, or His
  • Xaa at position 35 is Gly, Ala, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys
  • Xaa at position 36 is Arg, Lys, Glu, Asp, or His
  • Xaa at position 37 is Gly, Ala, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys, or is deleted
  • Xaa at position 38 is Arg, Lys, Glu, Asp, or His, or is deleted
  • Xaa at position 39 is Arg, Lys, Glu, Asp, or His, or is deleted
  • Xaa at position 40 is Asp, Glu, or Lys, or is deleted
  • Xaa at position 41 is Phe, Trp, Tyr, Glu, Asp, or Lys, or is deleted
  • Xaa at position 42 is Pro, Lys, Glu, or Asp, or is deleted, Xaa at position 43 is Glu, Asp, or Lys, or is deleted, Xaa at position 44 is Glu, Asp, or Lys, or is deleted, and Xaa at position 45 is Val, Glu, Asp, or Lys, or is deleted, or (a) a C- 1 -6-ester thereof, (b) amide, C- 1 -6-alkylamide, or C- 1 -6-dialkylamide thereof and/or (c) a pharmaceutically acceptable salt thereof, provided that
  • the total number of different amino acids between the derivative of the GLP-1 analog and the corresponding native form of GLP-1 does not exceed six.
  • the amino acids at positions 37-45 are absent.
  • the amino acids at positions 38-45 are absent.
  • the amino acids at posi- tions 39-45 are absent.
  • Xaa at position 8 is Ala, Gly, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys
  • Xaa at position 8 is Ala, Gly, Ser, Thr, or Nal.
  • Xaa at position 9 is Glu. In another embodiment of the GLP-1 derivative of formula I, Xaa at position 11 is Thr. In another embodiment of the GLP-1 derivative of formula I, Xaa at position 14 is Ser.
  • Xaa at position 16 is Val. In another embodiment of the GLP-1 derivative of formula I, Xaa at position 17 is Ser. In another embodiment of the GLP-1 derivative of formula I, Xaa at position 18 is Ser, Lys, Glu, or Asp. In another embodiment of the GLP- 1 derivative of formula I, Xaa at position 19 is Tyr,
  • Xaa at position 20 is Leu, Lys, Glu, or Asp.
  • Xaa at position 21 is Glu, Lys, or Asp.
  • Xaa at position 22 is Gly, Glu, Asp, or Lys.
  • Xaa at position 23 is Gin, Glu, Asp, or Lys.
  • Xaa at position 24 is Ala
  • Xaa at position 25 is Ala, Glu, Asp, or Lys.
  • Xaa at position 26 is Lys, Glu, Asp, or Arg.
  • Xaa at position 27 is Glu, Asp, or Lys.
  • Xaa at position 30 is Ala, Glu, Asp, or Lys.
  • Xaa at position 31 is Trp ,
  • Xaa at position 32 is Leu, Glu, Asp, or Lys.
  • Xaa at position 33 is Val, Glu, Asp, or Lys. In another embodiment of the GLP-1 derivative of formula I, Xaa at position 34 is Lys,
  • Xaa at position 35 is Gly, Glu, Asp, or Lys.
  • Xaa at position 36 is Arg, Lys, Glu, or Asp.
  • Xaa at position 37 is Gly, Glu, Asp, or Lys.
  • Xaa at position 38 is Arg, or Lys, or is deleted. In another embodiment of the GLP-1 derivative of formula I, Xaa at position 39 is deleted.
  • Xaa at position 41 is de- leted.
  • Xaa at position 43 is deleted. In another embodiment of the GLP-1 derivative of formula I, Xaa at position 44 is deleted.
  • Xaa at position 26 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP-l(7-36).
  • Xaa at position 26 is Arg, each of Xaa at positions 38-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-37).
  • Xaa at position 26 is Arg
  • each of Xaa at positions 39-45 is deleted
  • each of the other Xaa is the amino acid in native GLP-l(7-38).
  • Xaa at position 34 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP-l(7-36).
  • Xaa at position 34 is Arg, each of Xaa at positions 38-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-37).
  • Xaa at position 34 is Arg
  • each of Xaa at positions 39-45 is deleted
  • each of the other Xaa is the amino acid in native GLP-1 (7-38).
  • Xaa at positions 26 and 34 is Arg
  • Xaa at position 36 is Lys
  • each of Xaa at positions 37-45 is deleted
  • each of the other Xaa is the amino acid in native GLP-l(7.-36).
  • Xaa at positions 26 and 34 is Arg
  • Xaa at position 36 is Lys
  • each of Xaa at positions 38-45 is deleted
  • each of the other Xaa is the amino acid in native GLP-1 (7-37).
  • Xaa at positions 26 and 34 is Arg
  • Xaa at position 36 is Lys
  • each of Xaa at positions 39-45 is deleted
  • each of the other Xaa is the amino acid in native GLP-l(7-38).
  • Xaa at positions 26 and 34 is Arg
  • Xaa at position 38 is Lys
  • each of Xaa at positions 39-45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1(7-38).
  • Xaa at position 8 is Thr, Ser, Gly or Val
  • Xaa at position 37 is Glu
  • Xaa at position 36 is Lys
  • each of Xaa at positions 38- 45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1(7-37).
  • Xaa at position 8 is Thr, Ser, Gly or Val
  • Xaa at position 37 is Glu
  • Xaa at position 36 is Lys
  • each of Xaa at positions 39- 45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1(7-38).
  • Xaa at position 8 is Thr, Ser, Gly or Val
  • Xaa at position 37 is Glu
  • Xaa at position 38 is Lys
  • each of Xaa at positions 39- 45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1(7-38).
  • Xaa at position 18, 23 or 27 is Lys, and Xaa at positions 26 and 34 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-36).
  • Xaa at position 18, 23 or 27 is Lys, and Xaa at positions 26 and 34 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-36).
  • Xaa at position 18, 23 or 27 is Lys, and Xaa at positions 26 and 34 is Arg, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP-l(7-38).
  • Xaa at position 8 is Thr, Ser, Gly, or Val, Xaa at position 18, 23 or 27 is Lys, and Xaa at position 26 and 34 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-36).
  • Xaa at position 8 is Thr, Ser, Gly, or Val, Xaa at position 18, 23 or 27 is Lys, and Xaa at position 26 and 34 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-36).
  • Xaa at position 8 is Thr, Ser, Gly, or Val, Xaa at position 18, 23 or 27 is Lys, and Xaa at position 26 and 34 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1
  • Xaa at position 18, 23 or 27 is Lys
  • Xaa at position 26 and 34 is Arg
  • each of Xaa at positions 38-45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1(7-37).
  • Xaa at position 8 is Thr, Ser, Gly, or Val
  • Xaa at position 18, 23 or 27 is Lys
  • Xaa at position 26 and 34 is Arg
  • each of Xaa at positions 39-45 is deleted
  • each of the other Xaa is the amino acid in native GLP- 1(7-38).
  • Such GLP-1 derivatives includes, but is not limited to, Lys 34 (N ⁇ -( ⁇ -glutamyl(N ⁇ -tetradecanoyl))) GLP-1 (7-37), Arg 26 ' 34 ,Lys 8 (N ⁇ -( ⁇ -glutamyl(N ⁇ -hexadecanoyl))) GLP-1 (7-37), Arg 34 ,Lys 2o (N ⁇ -( ⁇ -gh ⁇ tamyl(N ⁇ -dodecanoyl))) GLP-1 (7-37), Arg 34 ,Lys 26 (N ⁇ -( ⁇ -alanyl(N ⁇ -hexadecanoyl))) GLP-1 (7-37), Arg 34 ,Lys 26 (N ⁇ -( ⁇ -glutamyl(N ⁇ -hexadecanoyl))) GLP-1 (7-37), Arg 34 ,Lys 26 (N
  • Lys 26 - 34 bis(N ⁇ -( ⁇ -glutamyl(N ⁇ -tetradecanoyl)))-GLP- 1 (7-37)-OH,
  • Ly s 26 - 34 bis(N ⁇ -( ⁇ -glutamyl(N ⁇ -hexadecanoyl)))-GLP- 1(7-37)-OH,
  • Arg 26 ' 34 Lys 38 (N ⁇ -( ⁇ -glutamyl(N ⁇ -tetradecanoyl)))-GLP- 1 (7-38)-OH
  • Arg 26 ' 34 Lys 38 (N ⁇ -( ⁇ -glutamyl(N ⁇ -hexadecanoyl)))-GLP- 1 (7-38)-OH
  • Arg 2634 Lys 38 (N ⁇ -( ⁇ -glutamyl(N ⁇ -octadecanoyl)))-GLP- 1 (7-38)-OH.
  • Lys 26 ' 34 bis(N ⁇ -( ⁇ -glutamyl(N ⁇ -tetradecanoyl)))-GLP-l(7-37)-OH,
  • Lys 26 - 34 bis(N ⁇ -( ⁇ -glutamyl(N ⁇ -hexadecanoyl)))-GLP- 1 (7-37)-OH,
  • Arg 34 Lys 26 (N ⁇ -( ⁇ -glutamyl(N ⁇ -hexadecanoyl)))-GLP-l(7-37)-OH
  • Arg 26 ' 34 Lys 38 (N ⁇ -( ⁇ -glutamyl(N ⁇ -tetradecanoyl)))-GLP- 1 (7-38)-OH
  • Arg 26,34 Lys 38 (N ⁇ -( ⁇ -carboxytridecanoyl))-GLP-l(7-38)-OH
  • Arg 34 Lys 26 (N ⁇ -( ⁇ -glutamy l(N ⁇ -tetradecanoyl)))-GLP- 1(7-37)-OH
  • Arg 34 Lys 26 (N ⁇ -( ⁇ -alanyl(N ⁇ -tetradecanoyl)))-GLP-l(7-37)-OH
  • Arg 26 ' 34 Lys 38 (N ⁇ -( ⁇ -alanyl(N ⁇ -octadecanoyl)))-GLP- 1 (7-38)-OH.
  • Lys 38 (N ⁇ -( ⁇ -alanyl(N ⁇ -octadecanoyl)))-GLP- 1 (7-38)-OH, Lys 26 (N ⁇ -tetradecanoyl)-GLP-l(7-37);
  • Lys 34 (N ⁇ -tetradecanoyl)-GLP-l(7-37);
  • Gly 8 Lys 34 (N ⁇ -tetradecanoyl)-GLP- 1 (7-37);
  • Lys 34 (N ⁇ -tetradecanoyl)-GLP-l(7-37); Lys 26 (N ⁇ -tetradecanoyl)-GLP- 1 (7-38);
  • Lys 34 (N ⁇ -tetradecanoyl)-GLP-l(7-38);
  • Gly 8 Lys 3 (N ⁇ -tetradecanoyl)-GLP- 1 (7-38); Gly 8 Lys 26 ' 34 -bis(N ⁇ -tetradecanoyl)-GLP-l(7-38); Arg 26 Lys 34 (N ⁇ -tetradecanoyl)-GLP- 1 (7-38); Lys 26 (N ⁇ -tetradecanoyl)-GLP- 1 (7-39); Lys 34 (N ⁇ -tetradecanoyl)-GLP-l(7-39); Lys 26*34 -bis(N ⁇ -tetradecanoyl)-GLP-l(7-39); Gly 8 Lys 26 (N ⁇ -tetradecanoyl)-GLP-l(7-39); Gly 8 Lys 34 (N ⁇ -tetradecanoyl)-GLP-l(7-39); Gly 8 Lys 26 ' 34 -bis(N
  • Lys 26 (N ⁇ -tetradecanoyl)-GLP-l(7-36);
  • Lys 34 (N ⁇ -tetradecanoyl)-GLP- 1 (7-36);
  • Gly 8 Lys 26 (N ⁇ -tetradecanoyl)-GLP-l(7-36);
  • Gly 8 Lys 34 (N ⁇ -tetradecanoyl)-GLP-l(7-36);
  • Lys 26 (N ⁇ -tetradecanoyl)-GLP-l(7-35);
  • Lys 34 (N ⁇ -tetradecanoyl)-GLP-l(7-35); Lys 2634 -bis(N ⁇ -tetradecanoyl)-GLP-l(7-35);
  • Lys 34 (N ⁇ -tetradecanoyl)-GLP- 1 (7-35); Lys 26 (N ⁇ -tetradecanoyl)-GLP- 1 (7-36)amide; Lys 34 (N ⁇ -tetradecanoy 1)-GLP- 1(7-36)amide;
  • Gly 8 Lys 34 (N ⁇ -tetradecanoyl)-GLP-l(7-36)amide; Gly 8 Lys 26 - 34 -bis(N ⁇ -tetradecanoyl)-GLP- 1 (7-36)amide;
  • Lys 26 (N ⁇ -tetradecanoyl)Arg 34 -GLP-l(7-37);
  • Lys 26 (N ⁇ -tetradecanoyl)Arg 34 -GLP- 1 (7-38);
  • Lys 26 (N ⁇ -tetradecanoyl)Arg 34 -GLP-l(7-39); Gly 8 Lys 26 (N ⁇ -tetradecanoyl)Arg 34 -GLP- 1 (7-39);
  • Lys 26 (N ⁇ -tetradecanoyl)Arg 34 -GLP- 1 (7-40); Gly 8 Lys 26 (N ⁇ -tetradecanoyl)Arg 34 -GLP- 1 (7-40);
  • Lys 26 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP-l(7-37);
  • Lys 34 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP-l(7-37); Lys 26 ' 34 -bis(N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-37); Gly 8 Lys 26 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP-l(7-37);
  • Lys 26 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-38); Lys 34 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-38);
  • Lys 26 - 34 bis(N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP-l(7-38);
  • Lys j4 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP-l(7-39);
  • Lys 26 ' 34 bis(N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP-l(7-39);
  • Gly 8 Lys 34 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-39); Gly 8 Lys 26 ' 34 -bis(N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP-l (7-39);
  • Lys 26 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-40);
  • Lys 34 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-40);
  • Lys 26 ' 34 bis(N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-40);
  • Gly 8 Lys 26 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-40); Gly 8 Lys 34 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1(7-40);
  • Lys 26 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP-l(7-36);
  • Lys 34 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP-l(7-36);
  • Lys 26 - 34 bis(N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP-l(7-36); Gly 8 Lys 26 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-36);
  • Lys 26 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP-l(7-36)amide;
  • Lys 34 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP-l(7-36)amide; Lys 2634 -bis(N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-36)amide; Gly 8 Lys 26 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-36)amide; Gly 8 Lys 34 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-36)amide; Gly 8 Lys 26 ' 34 -bis(N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP-l(7-36)amide; Lys 26 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-35); Lys 34 (N ⁇ -( ⁇ -carboxynonade
  • Gly 8 Arg 26 Lys 34 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-37) ; Lys 26 (N ⁇ -( ⁇ -carboxynonadecanoyl))Arg 34 -GLP- 1 (7-37); Gly 8 Lys 26 (N ⁇ -( ⁇ -carboxynonadecanoyl))Arg 34 -GLP-l(7-37); Arg 26 ' 34 Lys 36 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-37); Gly 8 Arg 26 ' 34 Lys 36 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-37) ; Arg 26 Lys 34 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-37) ; Arg 26 Lys 34 (N ⁇
  • Gly 8 Lys 26 (N ⁇ -( ⁇ -carboxynonadecanoyl))Arg 34 -GLP-l(7-39); Arg 26 ' 34 Lys 36 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-39); Gly 8 Arg 26 ' 34 Lys 36 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-39); Arg 26 Lys 34 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-40); Gly 8 Arg 26 Lys 34 (N ⁇ -( ⁇ -carboxynonadecanoyl))-GLP- 1 (7-40); Lys 26 (N ⁇ -( ⁇ -carboxynonadecanoyl))Arg 34 -GLP- 1 (7-40); Gly 8 Lys 26 (N ⁇ -( ⁇ -carboxyn
  • Lys 34 (N ⁇ -(7-deoxycholoyl))-GLP- 1 (7-36); Lys 26 (N ⁇ -(7-deoxycholoyl))-GLP- 1 (7-35);
  • Lys 34 (N ⁇ -(7-deoxycholoyl))-GLP- 1 (7-35);
  • Lys 26 - 34 bis(N ⁇ -(7-deoxycholoyl))-GLP-l(7-35);
  • Gly 8 Lys 34 (N ⁇ -(7-deoxycholoyl))-GLP- 1 (7-35);
  • Lys 26 (N ⁇ -(7-deoxycholoyl))-GLP- 1 (7-36)amide;
  • Lys 34 (N ⁇ -(7-deoxycholoyl))-GLP- 1 (7-36)amide;
  • Lys 26 ' 34 bis(N ⁇ -(7-deoxycholoyl))-GLP- 1 (7-36)amide; Gly 8 Lys 26 (N ⁇ -(7-deoxycholoyl))-GLP- 1 (7-36)amide;
  • Lys 26 (N ⁇ -(choloyl))-GLP-l(7-37); Lys 34 (N ⁇ -(choloyl))-GLP-l(7-37); Lys neglect26 0 .3 J 4 4 -bis(N ⁇ -(choloyl))-GLP- 1 (7-37);
  • Lys 26 (N ⁇ -(7-deoxycholoyl))Arg 34 -GLP- 1 (7-38);
  • Arg 26 - 34 Lys 36 (N ⁇ -(7-deoxycholoyl))-GL ⁇ > - 1 (7-38);
  • Arg 26 ' 34 Lys 38 (N ⁇ -(7-deoxycholoyl))-GLP- 1 (7-38);
  • Lys 26 (N ⁇ -(choloyl))-GLP-l(7-38);
  • Lys 34 (N ⁇ -(choloyl))-GLP-l(7-38);
  • Lys 26 (N ⁇ -(choloyl))-GLP-l(7-39); Lys 34 (N ⁇ -(choloyl))-GLP-l(7-39);
  • Lys 26 (N ⁇ -(choloyl))-GLP- 1(7-40);
  • Lys 34 (N ⁇ -(choloyl))-GLP- 1 (7-40);
  • Lys 2634 bis(N ⁇ -(choloyl))-GLP- 1 (7-40);
  • Gly 8 Lys 26 (N ⁇ -(choloyl))-GLP- 1 (7-40): Gly 8 Lys 34 (N ⁇ -(choloyl))-GLP- 1 (7-40);
  • Lys 26 (N ⁇ -(choloyl))-GLP- 1 (7-36);
  • Lys 34 (N ⁇ -(choloyl))-GLP- 1 (7-36); Lys 26 ' 34 -bis(N ⁇ -(choloyl))-GLP- 1 (7-36);
  • Lys 34 (N ⁇ -(choloyl))-GLP- 1(7-36); Lys 26 (N ⁇ -(choloyl))-GLP-l(7-35):
  • Lys 34 (N ⁇ -(choloyl))-GLP-l(7-35);
  • Lys 2634 bis(N ⁇ -(choloyl))-GLP- 1 (7-35);
  • Gly 8 Lys 34 (N ⁇ -(choloyl))-GLP-l(7-35): ' Gly 8 Lys 26 - 34 -bis( ⁇ -(choloyl))-GLP- 1(7-35);
  • Lys 26 (N ⁇ -(choloyl))-GLP-l(7-36)amide
  • Lys 34 (N ⁇ -(choloyl))-GLP- 1 (7-36)amide;
  • Lys 26 (N ⁇ -(lithocholoyl))-GLP- 1 (7-37); .
  • Lys 34 (N ⁇ -(lithocholoyl))-GLP- 1 (7-37);
  • Lys 2634 bis(N ⁇ -(lithocholoyl))-GLP- 1 (7-37);
  • Lys 26 (N ⁇ -(choloyl))Arg 34 -GLP-l(7-38);
  • Lys 26 (N ⁇ -(lithocholoyl))-GLP- 1 (7-38);
  • Lys 34 (N ⁇ -(lithocholoyl))-GLP- 1 (7-38):
  • Lys 26 4 bis(N ⁇ -(lithocholoyl))-GLP-l(7-38); Gly 8 Lys 26 (N ⁇ -(lithocholoyl))-GLP- 1(7-38);
  • Gly 8 Lys 34 (N ⁇ -(lithocholoyl))-GLP- 1 (7-38); Gly 8 Lys 2634 -bis(N ⁇ -(lithocholoyl))-GLP- 1 (7 Arg 26 Lys 34 (N ⁇ -(lithocholoyl))-GLP- 1 (7-38); Gly 8 Arg 26 Lys 34 (N ⁇ -(choloyl))-GLP- 1 (7-39); Lys 26 (N ⁇ -(choloyl))Arg 34 -GLP-l(7-39); Gly 8 Lys 26 (N ⁇ -(choloyl))Arg 34 -GLP-l(7-39);
  • Lys 26 (N ⁇ -(lithocholoyl))-GLP-l(7-39); Lys 34 (N ⁇ -(lithocholoyl))-GLP-l(7-39);
  • Lys 26 (N ⁇ -(choloyl))Arg 34 -GLP- 1 (7-40);
  • Lys 26 (N ⁇ -(lithocholoyl))-GLP- 1 (7-40);
  • Lys 34 (N ⁇ -(lithocholoyl))-GLP- 1 (7-40);
  • Lys 2634 bis(N ⁇ -(lithocholoyl))-GLP- 1 (7-40);
  • Gly 8 Lys 26 (N ⁇ -(lithocholoyl))-GLP- 1 (7-40);
  • Gly 8 Lys 34 (N ⁇ -(lithocholoyl))-GLP- 1 (7-40);
  • Lys 26 (N ⁇ -(lithocholoyl))-GLP- 1 (7-36);
  • Lys 34 (N ⁇ -(lithocholoyl))-GLP-l(7-36); • Lys 26 4 -bis(N ⁇ -(lithocholoyl))-GLP-l(7-36);
  • Lys 34 (N ⁇ -(lithocholoyl))-GLP-l(7-36); Lys 26 (N ⁇ -(lithocholoyl))-GLP-l(7-35); Lys 34 (N ⁇ -(lithocholoyl))-GLP-l(7-35);
  • Gly 8 Lys 34 (N ⁇ -(lithocholoyl))-GLP- 1 (7-35);
  • Gly 8 Lys 26 4 -bis(N ⁇ -(lithocholoyl))-GLP- 1 (7-35);
  • Lys 26 (N ⁇ -(lithocholoyl))-GLP-l(7-36)amide;
  • Lys 34 (N ⁇ -(lithocholoyl))-GLP-l(7-36)amide
  • Lys 26 4 bis(N ⁇ -(lithocholoyl))-GLP- 1 (7 36)amide; Gly 8 Lys 26 (N ⁇ -(lithocholoyl))-GLP- 1 (7-36)amide;
  • Gly 8 Arg 26 4 Lys 36 (N ⁇ -(lithocholoyl))-GLP-l(7-37);
  • Gly 8 Arg 26 Lys 34 (N ⁇ -(lithocholoyl))-GLP- 1 (7-38);
  • Lys 26 (N ⁇ -(lithocholoyl))Arg 34 -GLP- 1 (7-38);
  • Lys 26 (N ⁇ -(lithocholoyl))Arg 34 -GLP- 1 (7-39);
  • Lys 26 (N ⁇ -(lithocholoyl))Arg 34 -GLP- 1 (7-40);
  • the most preferred GLP-1 derivative is Arg 34 , Lys 26 (N ⁇ -( ⁇ -Glu(N ⁇ -hexadecanoyl)))-
  • a parent peptide for a derivative of the invention is
  • a parent peptide for a derivative of the invention is:
  • the parent peptide is selected from the group comprising Arg 26 -GLP-l(7-37), Arg 34 -GLP-l(7-37), Lys 36 -GLP- 1(7-37), Arg 26 ' 34 Lys 36 - GLP-l(7-37), Arg 26 Lys 36 -GLP-l(7-37), Arg 34 Lys 36 -GLP- 1(7-37), Gly 8 Arg 26 -GLP- 1(7-37), Gly 8 Arg 34 -GLP-l(7-37), Gly 8 Lys 36 -GLP-l(7-37), Gly 8 Lys 36 -GLP-l(7-37), Gly 8 Arg 26 4 Lys 36 -GLP-l(7-37), Gly 8 Arg 26 Lys 36 -GLP- 1(7-37) and Gly 8 Arg 34 Lys 36 -GLP-l(7-37).
  • the parent peptide is selected from the group comprising Arg 26 Lys 38 -GLP-l(7-38), Arg 26 4 Lys 38 -GLP-l(7-38), Arg 26 4 Lys 36 ' 38 -GLP- 1(7-38), Gly 8 Arg 26 Lys 38 -GLP-l(7-38) and Gly 8 Arg 26 4 Lys 3638 -GLP-l(7-38).
  • the parent peptide is selected from the group comprising Arg 26 Lys 39 -GLP- 1(7-39), Arg 26 4 Lys 3639 -GLP-l(7-39), Gly 8 Arg 26 Lys 39 -GLP- 1(7-39) and Gly 8 Arg 26 4 Lys 36 9 -GLP- 1(7-39).
  • the parent peptide is selected from the group comprising Arg 34 Lys 40 -GLP- 1(7-40), Arg 26 4 Lys 36 ' 40 -GLP- 1(7-40), Gly 8 Arg 34 Lys 40 -GLP- 1(7-40) and Gly 8 Arg 26 4 Lys 36,40 -GLP- 1(7-40).
  • the parent peptide is:
  • the parent peptide is:
  • GLP-1 analogues and derivatives which can be used according to the present invention includes those referred to in WO 99/43705 ( ⁇ ovo Nordisk A/S), WO 99/43706 (Novo Nordisk A/S), WO 99/43707 (Novo Nordisk A/S), WO 98/08871 (Novo Nordisk A/S), WO 99/43708 (Novo Nordisk A/S), WO 99/43341 (Novo Nordisk A/S), WO 87/06941 (The General Hospital Corporation), WO 90/11296 (The General Hospital Corporation), WO 91/11457 (Buckley et al.), WO 98/43658 (Eli Lilly & Co.), EP 0708179-A2 (Eli Lilly & Co.), EP 0699686-A2 (Eli Lilly & Co.) which are included herein by reference.
  • protracted acting GLP-1 derivatives in particular those described in WO 98/08871 are more preferred.
  • the most preferred GLP-1 derivatives are those in which the parent peptide has the formula GLP-1 (7-C), wherein C is 36, 37, 38, 39, 40, 41 , 42, 43, 44 and 45, wherein optionally a total of up to fifteen, preferably up to ten amino acid residues have been exchanged with any ⁇ -amino acid residue which can be coded for by the genetic code, said parent peptide comprising one or two lipophilic substituents having 4 to 40 carbon atoms, preferably from 8 to 25 carbon atoms, optionally via a spacer (such as ⁇ -Glu or ⁇ -Ala).
  • the substituents are preferably selected from acyl groups of straight-chained or branched fatty acids.
  • GLP-1 analogues and derivatives that include an N-terminal imidazole group and optionally an unbranched C 6 -C ⁇ o acyl group attached to the lysine residue in position 34 are also embodiments of the invention.
  • the GLP-1 agonist is selected from ex- endin as well as analogs, derivatives, and fragments thereof, e.g. exendin-3 and -4.
  • exendin examples include those disclosed in WO 9746584 and US 5424286.
  • US 5424286 describes a method for stimulating insulin release with exendin polypeptide(s).
  • exendin-3 and -4 and fragments are useful in treatment of diabetes mellitus (types I or II) and prevention of hyperglycaemia. They normalise hyperglycaemia through glucose-dependent, insulin-independent and insulin- dependent mechanisms.
  • Exendin-4 is specific for exendin receptors, i.e. it does not interact with vasoactive intestinal peptide receptors.
  • WO 9746584 describes truncated versions of exendin peptide(s) for treating diabetes. The disclosed peptides increase secretion and biosynthesis of insulin, but reduce those of glucagon. The truncated peptides can be made more economically than full length versions.
  • the GLP-1 agonist is a non-peptide.
  • the GLP-1 agonist is a molecule, preferably a non-peptide, which binds to a GLP-1 receptor with an affinity constant, KTJ, below 1 ⁇ M, preferably below
  • GLP-1 means GLP-l(7-37) or GLP-1 (7-36) amide.
  • treatment is defined as the management and care of a patient for the purpose of combating the disease, condition, or disorder and includes the administration of a GLP-1 agonist to prevent the onset of the symptoms or complications, or alleviating the symptoms or complications, or eliminating the disease, condition, or disorder.
  • Treatment includes modulate, inhibit, decrease, reduce or arrest beta cell degeneration, such as necrosis or apoptosis of beta cells, in particular the programmed ⁇ -cell death known as apoptosis of ⁇ - cells as well as prevention of beta cell degeneration, such as necrosis or apoptosis of beta cells, in particular prevention of apoptosis of ⁇ -cells
  • beta cell degeneration is intended to mean loss of beta cell function, beta cell dysfunction, and death of beta cells, such as necrosis or apoptosis of beta cells.
  • a GLP-1 agonist is intended to indicate a molecule, preferably
  • GLP-1 or an analogue or a derivative thereof, or exendin or an analogue or a derivative thereof, or a non-peptide which binds to a GLP-1 receptor with an affinity constant, K-Q, below 1 ⁇ M, preferably below 100 nM.
  • K-Q affinity constant
  • Methods for identifying GLP-1 agonists are described in WO 93/19175 (Novo Nordisk A/S).
  • a GLP-1 agonist is also intended to comprise active metabolites and prodrugs thereof, such as active metabolites and prodrugs of GLP- 1 or an analogue or a derivative thereof, or exendin or an analogue or a derivative thereof, or a non-peptide.
  • a “metabolite” is an active derivative of a GLP-1 agonist produced when the GLP-1 agonist is metabolized.
  • a “prodrug” is a compound which is either metabolized to a GLP-1 agonist or is metabolized to the same metabolite(s) as a GLP- 1 agonist.
  • an analogue is used to designate a peptide wherein one or more amino acid residues of the parent peptide have been substituted by another amino acid residue and/or wherein one or more amino acid residues of the parent peptide have been deleted and/or wherein one or more amino acid residues have been added to trie parent peptide. Such addition can take place either in the peptide, at the N-terminal end or at the C-terminal end of the parent peptide, or any combination thereof.
  • derivative is used in the present text to designate a peptide in which one or more of the amino acid residues of the parent peptide have been chemically modified, e.g. by alkylation, acylation, ester formation or amide formation.
  • a GLP-1 derivative is used in the present text to designate a derivative of GLP-1 or an analogue thereof.
  • the parent peptide from which such a deriva- tive is formally derived is in some places referred to as the "GLP-1 moiety" of the derivative.
  • WO 98/08871 Novo Nordisk A/S.
  • the route of administration may be any route, which effectively transports the active compound to the appropriate or desired site of action, such as oral, nasal, pulmonary, trans- dermal or parenteral.
  • compositions (or medicaments) containing a GLP-1 agonist may be administered parenterally to patients in need of such a treatment.
  • Parenteral administration may be performed by subcutaneous, intramuscular or intravenous injection by means of a syringe, optionally a pen-like syringe.
  • parenteral administration can be performed by means of an infusion pump.
  • a further option is a composition which may be a powder or a liquid for the administration of the GLP-1 agonist in the form of a nasal or pulmonal spray.
  • the GLP-1 agonist can also be administered transdermally, e.g. from a patch, optionally a iontophoretic patch, or transmucosally, e.g.
  • the GLP-1 agonist in particular GLP-1 or an analogue thereof
  • the implanted cells may be encapsulated in semi permeable membranes, e.g. macro- or microen- capsulated.
  • compositions containing a GLP-1 agonist may be prepared by conventional techniques, e.g. as described in Remington's Pharmaceutical Sciences, 1985 or in Remington: The Science and Practice of Pharmacy, 19 th edition, 1995.
  • the injectable compositions of the GLP-1 agonist can be prepared using the conventional techniques of the pharmaceutical industry which involves dissolving and mixing the ingredients as appropriate to give the desired end product.
  • the GLP-1 agonist is dissolved in an amount of water which is somewhat less than the final volume of the composition to be prepared.
  • An isotonic agent, a preservative and a buffer is added as required and the pH value of the solution is adjusted - if necessary - using an acid, e.g. hydrochloric acid, or a base, e.g. aqueous sodium hydroxide as needed.
  • the volume of the solution is adjusted with water to give the desired concentration of the ingredients.
  • isotonic agents are sodium chloride, mannitol and glycerol.
  • preservatives examples include phenol, m-cresol, methyl p-hydroxybenzoate and benzyl alcohol.
  • solutions containing a GLP-1 agonist may also contain a surfactant in order to improve the solubility and/or the stability of the GLP-1 agonist.
  • a composition for nasal administration of certain peptides may, for example, be prepared as described in European Patent No. 272097 (to Novo Nordisk A/S) or in WO 93/18785.
  • the GLP-1 agonist is provided in the form of a composition suitable for administration by injection.
  • a composition can either be an injectable solution ready for use or it can be an amount of a solid composition, e.g. a lyophilised product, which has to be dissolved in a solvent before it can be injected.
  • the injectable solution preferably contains not less than about 2 mg/ml, preferably not less than about 5 mg/ml, more preferred not less than about 10 mg/ml of the GLP-1 agonist and, preferably, not more than about 100 mg/ml of the GLP-1 agonist.
  • the GLP-1 agonist can be used in the treatment of various diseases. The particular GLP-1 agonist to be used and the optimal dose level for any patient will depend on the disease to be treated and on a variety of factors including the efficacy of the specific peptide derivative employed, the age, body weight, physical activity, and diet of the patient, on a possible combination with other drugs, and on the severity of the case. It is recommended that the dosage of the GLP-1 agonist be determined for each individual patient by those skilled in the art.
  • the male Zucker Diabetic Fatty fa/fa (ZDF) rat is a model of Type 2 diabetes.
  • the rats are insulin resistant but normoglycemic from birth and they develop diabetes from about week 7 to week 10 of age.
  • the animals go through a state of impaired glucose tolerance.
  • the animals are hyperinsulinemic before diabetes onset and during the early stages of diabetes, they later lose glucose-stimulated insulin secretion and finally become almost completely insulinopenic.
  • Bromodeoxyuridine (BrDU) is incorporated in newly synthesized DNA and thus will label replicating cells.
  • the rats Six hours before sacrifice the rats were given an injection of 100 mg BrDU/kg intraperitoneally. After sacrifice the pancreata were fixed in 4% PFA, dehydrated, embedded in paraffin, and 3-4 mm sections double stained for BrDU and insulin for the measurement of beta-cell proliferation rate.
  • Insulin was stained with guinea pig anti-insulin, peroxidase-coupled rabbit anti-guinea pig Ig, and developed with AEC to give a red stain.
  • BrDU was stained by monoclonal mouse anti- BrDU, biotinylated goat anti-mouse Ig, avidin peroxidase, and developed with DAB and CuS0 4 to give a dark brown stain.
  • BrDU stained nuclei of cells with insulin stained cytoplasm was examined in more than 1500 cells per section. The examination of the sections were carried out with the origin of the sections blinded to the observer.
  • the beta-cells were stained for insulin as described above.
  • the nonbeta-cells were stained with a mixture of monoclonal mouse anti-glucagon + rabbit anti-somatostatin + rabbit anti-pancreatic polypeptide, detected by biotinylated swine anti-multible Ig' s, avidin peroxi- dase, and developed with DAB and CuS0 to give a dark brown stain.
  • the volume fractions of beta- and nonbeta-cells were estimated by point counting stereologic techniques.
  • the beta-cell fraction of the total pancreas was significantly higher in the rats given Arg 34 , Lys 26 (N- ⁇ -( ⁇ -Glu(N- ⁇ -hexadecanoyl)))-GLP-l(7-37) at 30 ng/g for 6 weeks compared to vehicle treated rats, while there was no further increase in rats given doses of 150 ng/g (fig. 2).
  • Arg 34 Lys 26 (N- ⁇ -( ⁇ -Glu(N- ⁇ -hexadecanoyl)))-GLP- 1(7-37)
  • This difference strongly indicates that an inhibition of apoptosis facilitated by the administered GLP-1 compound has taken place.
  • beta-cell apoptosis by GLP-1 or GLP-1 analogs, that is GLP-1 agonists, can be shown in vitro by measuring inhibition of free fatty acid (FFA), glu- cose, sulfonylurea, or cytokine induced apoptosis in beta cells.
  • FFA free fatty acid
  • glu- cose glu- cose
  • sulfonylurea sulfonylurea
  • cytokine induced apoptosis in beta cells.
  • pancreatic islet e.g. rat, mouse and human, isolated and cultured as described in, e.g. Diabetologia 19, 439, 1980; Transplantation, 68, 597, 1999; J. Mol. Med., 77, 93, 1999, Diabetes 48, 1230, 1999, J. Bio. Chem. 274, 18686, 1999; Proc. Natl. Acad. Sci. 95, 2498, 1999; . J. Bio.
  • islets can be isolated and cultured as described in J. Bio. Chem, 273, 33501, 1998, and incubated in O-30 mM glucose as described in. J. Bio. Chem, 273, 33501, 1998, in order to induce apoptosis.
  • the islets can be co-incubated with GLP-1 or GLP-1 analogs.
  • apoptosis can be induced with 100-500 microM tolbutamide as described in J. Bio. Chem, 273, 33501, 1998.
  • the islets can be co-incubated with GLP-1 or GLP-1 analogs. Characterization of apoptotic beta cells can be analyzed as described below and as in . J. Bio. Chem, 273, 33501, 1998.
  • In vitro assays for characterizing the effect of GLP-1 or analogs thereof on the prevention of beta-cell apoptosis induced by cytokines Briefly, human and rat islets can be isolated and cultured as described in, e.g. Diabetologia 42, 55, 1999. Cytokine induced apoptosis of rat and human beta cells can be done as describe in Diabetologia 42, 55, 1999.
  • the islets can be co-incubated with GLP-1 or GLP-1 analogs. Characterization of apoptotic beta cells can be analyzed as described below and as described in Diabetologia 42, 55, 1999.
  • Apoptosis and inhibition thereof can be detected in the following way:
  • the free 3' OH strand breaks resulting from DNA degradation which is associated with apoptosis can be detected with the terminal deoxynucleotidyl transferase-mediated dUTP-X3' nick end-labeling (TUNEL) technique (J Cell Biol 199: 493, 1992) or using the following kits e.g. In Situ Cell Death Detection kit; Boehringer Mannheim, Mannheim or ApoTag, Oncor, Gaithersburg, MD).
  • TUNEL terminal deoxynucleotidyl transferase-mediated dUTP-X3' nick end-labeling
  • Apoptosis can also be detected by electrophoresis of the soluble DNA fraction isolated from cultured islets by quantifying the ladder-like appearance as described in (PNAS 95: 2498, 1998).
  • apoptosis can be detected by double staining of cultured beta cells/islets with the DNA binding dyes Hoechst 33342 and propidium iodide as described in (Diabetologia 42 : 55, 1999).
  • Example 2
  • Neonatal rats were sacrificed and pancreata were aseptically isolated. Islets of Langerhans were isolated by standard techniques. Intact islets were cultured in 6-well tissue culture plates at 750 islets/well (Nunc, Roskilde, Denmark) with or without 40 U/ml recombinant rat inter- leukin 1, 100 U/ml interferon- ⁇ , and 100 U/ml tumor necrosis factor- ⁇ (all from Peprotech, London, UK) and the indicated doses of the GLP-1 derivative, Arg 34 , Lys 26 (N- ⁇ -( ⁇ -Glu(N- ⁇ - hexadecanoyl)))-GLP- 1(7-37).
  • Figure 3 shows that 24 hours incubation with the cytokine mix induced a substantial apoptosis in the neonatal rat islets cells.
  • islet cells were cultures in the presence of 100 nM of Arg 34 , Lys 26 (N- ⁇ -( ⁇ -Glu(N- ⁇ -hexadecanoyl)))-GLP-l(7-37), an approximately 50 % reduc- tion in the cytokine-induced apoptosis was observed.
  • the figure also shows that Arg 34 ,
  • Lys 26 (N- ⁇ -( ⁇ -Glu(N- ⁇ -hexadecanoyl)))-GLP- 1(7-37) itself had no effect on the level of islet cell apoptosis.
  • Arg 34 Lys 26 (N- ⁇ -( ⁇ -Glu(N- ⁇ -hexadecanoyl)))- GLP-l(7-37), is able to block cytokine-induced apoptosis in islet cells ex vivo.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Neurosurgery (AREA)
  • Diabetes (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Immunology (AREA)
  • Endocrinology (AREA)
  • Hematology (AREA)
  • Psychology (AREA)
  • Hospice & Palliative Care (AREA)
  • Psychiatry (AREA)
  • Emergency Medicine (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Obesity (AREA)
  • Cardiology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Epidemiology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)

Abstract

This invention relates to a method for modulating, inhibiting or decreasing or preventing beta cell degeneration, loss of beta cell function, beta cell dysfunction, and/or death of beta cells, such as necrosis or apoptosis of beta cells in a subject comprising administering a GLP-1 agonist to said subject.

Description

SE OF GLP-1 AGONISTS FOR THE INHIBITION OF BETA CELL DEGENERATION
The present invention relates to a method for modulating, inhibiting or decreasing or preventing beta cell degeneration, loss of beta cell function, beta cell dysfunction, and/or death of beta cells, such as necrosis or apoptosis of beta cells in a subject comprising adminis- tering a GLP-1 agonist to said subject.
Background
What most textbooks of pathology describe as cell death is coagulative necrosis. This is an abnormal morphological appearance, detected in tissue examined under the microscope. The changes, which affect aggregates of adjacent cells or functionally related cohorts of cells, are seen in a variety of contexts produced by accident, injury, or disease. Among the environmental perturbations that may cause cell necrosis are oxygen deprivation (anoxia), hyper- thermia, immunological attack, and exposure to various toxins that inhibit crucial intracellular metabolic processes. Coagulative necrosis is the classical form of cell change seen when tis- sues autolyze (digest themselves) in vitro.
Apoptosis is an active process of cellular self-destruction that is regulated by extrinsic and intrinsic signals occurring during normal development. It is well documented that apoptosis plays a key role in regulation of pancreatic endocrine beta cells. There is increasing evidence that in adult mammalians the beta-cell mass is submitted to dynamic changes to adapt insulin production for maintaining euglycemia in particular conditions, such as pregnancy and obesity (J. Dev. Physiol. 5: 373, 1983 and Endocrinology 130: 1459, 1992). The control of beta cell mass depends on a subtle balance between cell proliferation, growth and cell death (apoptosis). A disruption of this balance may lead to impairment of glucose homeostasis. For example, it is noteworthy that glucose intolerance develops with aging when beta cell replica- tion rates are reduced (Diabetes 32: 14, 1983) and human autopsy studies repeatedly showed a 40-60% reduction of beta cell mass in patients with non- insulin-dependent-diabetes mellitus compared with nondiabetic subjects (Am. J. Med. 70: 105, 1981 and Diabetes Res. 9: 151, 1988). It is generally agreed that insulin resistance is an invariable accompaniment of obesity but that normoglycemia is maintained by compensatory hyperinsulinemia until the beta cells become unable to meet the increased demand for insulin, at which point Type 2 Diabetes begins. Apoptosis is also associated with diseases states such as cancer, immunological disorders, like multiple sclerosis, and AIDS, and neurodegenerative disorders (Science 267: 1449, 1995), like Alzheimers disease, stroke, and Parkinson's disease.
Description of the invention
Accordingly, the present invention relates to use of a GLP-1 agonist for the preparation of a medicament for treatment of beta cell degeneration, such as necrosis or apoptosis of* β-cells.
Furthermore, the present invention relates to use of a GLP-1 agonist for the prepara- tion of a medicament for modulation of beta cell degeneration, such as necrosis or apoptosis of β-cells.
Furthermore, the present invention relates to use of a GLP-1 agonist for the preparation of a medicament for inhibition of beta cell degeneration, such as necrosis or apoptosis of β-cells. Furthermore, the present invention relates to use of a GLP-1 agonist for the preparation of a medicament for decreasing beta cell degeneration, such as necrosis or apoptosis of β- cells.
Furthermore, the present invention relates to use of a GLP-1 agonist for the preparation of a medicament for reduction of beta cell degeneration, such as necrosis or apoptosis of β-cells.
Furthermore, the present invention relates to use of a GLP-1 agonist for the preparation of a medicament for arresting beta cell degeneration, such as necrosis or apoptosis of β- cells.
Furthermore, the present invention relates to use of a GLP-1 agonist preventing beta cell degeneration for the preparation of a medicament for prevention of beta cell degeneration, such as necrosis or apoptosis of β-cells.
Moreover, the invention relates to a method for treatment of beta cell degeneration, such as necrosis or apoptosis of β-cells, in a subject comprising administering a GLP-1 agonist to said subject. Furthermore, the invention relates to a method for modulation of beta cell degeneration, such as necrosis or apoptosis of β-cells, in a subject comprising administering a GLP-1 agonist to said subject. Furthermore, the invention relates to a method for inhibition of beta cell degeneration- such as necrosis or apoptosis of β-cells, in a subject comprising administering a GLP-1 agonist to said subject.
Furthermore, the invention relates to a method for decreasing beta cell degeneration, such as necrosis or apoptosis of β-cells, in a subject comprising administering a GLP-1 agonist to said subject.
Furthermore, the invention relates to a method for reduction of beta cell degeneration- such as necrosis or apoptosis of β-cells, in a subject comprising administering a GLP-1 agonist to said subject. Furthermore, the invention relates to a method for arresting beta cell degeneration, such as necrosis or apoptosis of β-cells, in a subject comprising administering a GLP-1 agonist to said subject.
Furthermore, the invention relates to a method for prevention of beta cell degeneration, such as necrosis or apoptosis of β-cells, in a subject comprising administering a GLP-1 agonist to said subject.
In one embodiment of the invention beta cell degeneration is necrosis of beta cells. In another embodiment of the invention beta cell degeneration is apoptosis of beta cells. In a further embodiment said apoptosis is induced by a cytokine. The cytokine may be any cytokine or mixtures thereof, such as interleukin 1 (IL-1), IL-2, IL-3, IL-5, IL-6, IL-7, IL- 8, IL-9, IL-12, IL-14, IL-17, interferon-γ, tumor necrosis factor-α, TNF-β, granulocyte macrophage colony stimulating factor, monocyte chemoattractant protein- 1 , or mixtures thereof.
The subject is preferably a mammal, more preferably a human. The use according any of the above uses in a regimen which additionally comprises treatment with human growth hormone, a growth hormone releasing agent or a growth factor such as prolactin or placental lactogen; the use of human growth hormone, a growth hormone releasing agent or a growth factor such as prolactin or placental lactogen for the preparation of a medicament for inhibiting the beta cell degeneration, such as necrosis or apoptosis of β-cells in a subject; the use of human growth hormone, a growth hormone releasing agent or a growth factor such as prolactin or placental lactogen for the preparation of a medicament for treatment of beta cell degeneration, such as necrosis or apoptosis of β-cells in a subject. In one embodiment of the invention the GLP-1 agonist is GLP-l(7-37) or GLP-1(7- 36) amide.
In a further embodiment of the invention the GLP-1 agonist is a GLP-1 analogue. In a further embodiment of the invention the GLP-1 analogue is selected from the Thr8, Met8, Gly8 and Val8 analogues of GLP-1 (7-37) and GLP-l(7-36) amide, more preferred the Gly8 and Val8 analogues of GLP- 1 (7-37) and GLP- 1 (7-36) amide, most preferred the Val 8 analogues of GLP- 1(7-37) and GLP-1 (7-36) amide.
In a further embodiment of the invention the GLP-1 analogue has the formula II: 7 8 9 10 11 12 13 14 15 16 17 His-Xaa-Xaa-Gly-Xaa-Phe-Thr-Xaa-Asp-Xaa-Xaa-
18 19 20 21 22 23 24 25 26 27 28 Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Phe-
29 30 31 32 33 34 35 36 37 38
Ile-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa
39 40 41 42 43 44 45 Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa (II) wherein
Xaa at position 8 is Ala, Gly, Ser, Thr, Leu, He, Val, Glu, Asp, Met, or Lys,
Xaa at position 9 is Glu, Asp, or Lys,
Xaa at position 11 is Thr, Ala, Gly, Ser, Leu, He, Val, Glu, Asp, or Lys, Xaa at position 14 is Ser, Ala, Gly, Thr, Leu, He, Val, Glu, Asp, or Lys,
Xaa at position 16 is Val, Ala, Gly, Ser, Thr, Leu, He, Tyr, Glu, Asp, or Lys,
Xaa at position 17 is Ser, Ala, Gly, Thr, Leu, He, Val, Glu, Asp, or Lys,
Xaa at position 18 is Ser, Ala, Gly, Thr, Leu, He, Val, Glu, Asp, or Lys,
Xaa at position 19 is Tyr, Phe, Tip, Glu, Asp, or Lys, Xaa at position 20 is Leu, Ala, Gly, Ser, Thr, Leu, He. Val, Glu, Asp, or Lys,
Xaa at position 21 is Glu, Asp, or Lys,
Xaa at position 22 is Gly, Ala, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys, Xaa at position 23 is Gin, Asn, Arg, Glu, Asp, or Lys, Xaa at position 24 is Ala, Gly, Ser, Thr, Leu, He, Val, Arg, Glu, Asp, or Lys, Xaa at position 25 is Ala, Gly, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys, Xaa at position 26 is Lys, Arg, Gin, Glu, Asp, or His, Xaa at position 27 is Glu, Asp, or Lys,
Xaa at position 30 is Ala, Gly, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys, Xaa at position 31 is Trp, Phe, Tyr, Glu, Asp, or Lys, Xaa at position 32 is Leu, Gly, Ala, Ser, Thr, He, Val, Glu, Asp, or Lys, Xaa at position 33 is Val, Gly, Ala, Ser, Thr, Leu, He, Glu, Asp, or Lys, Xaa at position 34 is Lys, Arg, Glu, Asp, or His,
Xaa at position 35 is Gly, Ala, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys, Xaa at position 36 is Arg, Lys, Glu, Asp, or His,
Xaa at position 37 is Gly, Ala, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys, or is deleted, Xaa at position 38 is Arg, Lys, Glu, Asp, or His, or is deleted, Xaa at position 39 is Arg, Lys, Glu, Asp, or His, or is deleted,
Xaa at position 40 is Asp, Glu, or Lys, or is deleted, Xaa at position 41 is Phe, Trp, Tyr, Glu, Asp, or Lys, or is deleted, Xaa at position 42 is Pro, Lys, Glu, or Asp, or is deleted, Xaa at position 43 is Glu, Asp, or Lys, or is deleted, Xaa at position 44 is Glu, Asp, or Lys, or is deleted, and
Xaa at position 45 is Val, Glu, Asp, or Lys, or is deleted, or (a) a C-l-6-ester thereof, (b) amide, C-l-6-alkylamide, or C-l-6-dialkylamide thereof and/or (c) a pharmaceutically acceptable salt thereof, provided that (i) when the amino acid at position 37, 38, 39, 40, 41, 42, 43 or 44 is deleted, then each amino acid downstream of the amino acid is also deleted. In a further embodiment of the GLP- 1 analogue of formula II, the amino acids at positions 37-45 are absent.
In another embodiment of the GLP-1 analogue of formula II, the amino acids at posi- tions 38-45 are absent.
In another embodiment of the GLP-1 analogue of formula II, the amino acids at positions 39-45 are absent. In another embodiment of the GLP-1 analogue of formula II, Xaa at position 8 is Ala, Gly, Ser, Thr, Met, or Val.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 8 is Gly, Thr, Met, or Val. In another embodiment of the GLP-1 analogue of formula II, Xaa at position 8 is Val.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 9 is Glu. In another embodiment of the GLP-1 analogue of formula II, Xaa at position 11 is Thr. In another embodiment of the GLP-1 analogue of formula II, Xaa at position 14 is Ser. In another embodiment of the GLP-1 analogue of formula II, Xaa at position 16 is Val. In another embodiment of the GLP- 1 analogue of formula II, Xaa at position 17 is Ser.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 18 is Ser, Lys, Glu, or Asp.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 19 is Tyr, Lys, Glu, or Asp. In another embodiment of the GLP- 1 analogue of formula II, Xaa at position 20 is Leu,
Lys, Glu, or Asp.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 21 is Glu, Lys, or Asp.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 22 is Gly, Glu, Asp, or Lys.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 23 is Gin, Glu, Asp, or Lys.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 24 is Ala, Glu, Asp, or Lys. In another embodiment of the GLP-1 analogue of formula II, Xaa at position 25 is Ala,
Glu, Asp, or Lys.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 26 is Lys, Glu, Asp, or Arg.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 27 is Glu, Asp, or Lys.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 30 is Ala, Glu, Asp, or Lys. In another embodiment of the GLP-1 analogue of formula II, Xaa at position 31 is Trp, Glu, Asp, or Lys.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 32 is Leu, Glu, Asp, or Lys. In another embodiment of the GLP-1 analogue of formula II, Xaa at position 33 is Val,
Glu, Asp, or Lys.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 34 is Lys, Arg, Glu, or Asp.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 35 is Gly, Glu, Asp, or Lys.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 36 is Arg, Lys, Glu, or Asp.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 37 is Gly, Glu, Asp, or Lys. In another embodiment of the GLP- 1 analogue of formula II, Xaa at position 38 is Arg, or Lys, or is deleted.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 39 is deleted.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 40 is de- leted.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 41 is deleted.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 42 is deleted. In another embodiment of the GLP-1 analogue of formula II, Xaa at position 43 is deleted.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 44 is deleted.
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 45 is de- leted. In another embodiment of the GLP-1 analogue of formula II, Xaa at position 26 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-36).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 26 is Arg, each of Xaa at positions 38-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-37).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 26 is Arg, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP-l(7-38). In another embodiment of the GLP-1 analogue of formula II, Xaa at position 34 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-36).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 34 is Arg, each of Xaa at positions 38-45 is deleted, and each of the other Xaa is the amino acid in native GLP-l(7-37).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 34 is Arg, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP-l(7-38).
In another embodiment of the GLP-1 analogue of formula II, Xaa at positions 26 and 34 is Arg, Xaa at position 36 is Lys, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-36).
In another embodiment of the GLP-1 analogue of formula II, Xaa at positions 26 and 34 is Arg, Xaa at position 36 is Lys, each of Xaa at positions 38-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-37). In another embodiment of the GLP- 1 analogue of formula II, Xaa at positions 26 and 34 is Arg, Xaa at position 36 is Lys, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-38).
In another embodiment of the GLP-1 analogue of formula II, Xaa at positions 26 and 34 is Arg, Xaa at position 38 is Lys, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-38). In another embodiment of the GLP-1 analogue of formula II, Xaa at position 8 is Thr, Ser, Gly, or Val, Xaa at position 37 is Glu, Xaa at position 36 is Lys, each of Xaa at positions 38- 45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-37).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 8 is Thr, Ser, Gly, or Val, Xaa at position 37 is Glu, Xaa at position 36 is Lys, each of Xaa at positions 39- 45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-38).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 8 is Thr, Ser, Gly or Val, Xaa at position 37 is Glu, Xaa at position 38 is Lys, each of Xaa at positions 39- 45 is deleted, and each of the other Xaa is the amino acid in native GLP-l(7-38). In another embodiment of the GLP- 1 analogue of formula II, Xaa at position 18, 23 or
27 is Lys, and Xaa at positions 26 and 34 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP-l(7-36).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 18, 23 or 27 is Lys, and Xaa at positions 26 and 34 is Arg, each of Xaa at positions 38-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1 (7-37).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 18, 23 or 27 is Lys, and Xaa at positions 26 and 34 is Arg, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-38).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 8 is Thr, Ser, Gly, or Val, Xaa at position 18, 23 or 27 is Lys, and Xaa at position 26 and 34 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-36).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 8 is Thr, Ser, Gly, or Val, Xaa at position 18, 23 or 27 is Lys, and Xaa at position 26 and 34 is Arg, each of Xaa at positions 38-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-37).
In another embodiment of the GLP-1 analogue of formula II, Xaa at position 8 is Thr, Ser, Gly, or Val, Xaa at position 18, 23 or 27 is Lys, and Xaa at position 26 and 34 is Arg, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-38).
Such GLP-1 analogues includes, but is not limited to, Arg26-GLP- 1(7-37); Arg34-GLP- 1(7-37); Lys36-GLP- 1(7-37); Arg26'34Lys36-GLP- 1(7-37); Arg26'34Lys38GLP-l(7-38); Arg26 4Lys39-GLP- 1(7-39); Arg26 4Lys40-GLP- 1(7-40); Arg26Lys36-GLP-l(7-37); Arg34Lys36-
GLP-l(7-37); Arg26Lys39-GLP-l(7-39); Arg34Lys40-GLP- 1(7-40); Arg26 4Lys36'39-GLP-l(7-39);
Arg26 4Lys36'40-GLP-l(7-40); Gly8Arg26-GLP-l(7-37); Gly8Arg34-GLP-l(7-37); Nal8-GLP-1(7-
37); Thr8-GLP- 1(7-37); Gly8-GLP-l(7-37); Met8-GLP-l(7-37); Gly8Lys36-GLP- 1(7-37); Gly8Arg26 4Lys36-GLP-l(7-37); Gly8Arg2634Lys39-GLP-l(7-39); Gly8Arg26'34Lys40-GLP-l(7-
40); Gly8Arg26Lys36-GLP-l(7-37); Gly8Arg34Lys36-GLP- 1(7-37); Gly8Arg26Lys39-GLP-l(7-39);
Gly8Arg34Lys40-GLP-l(7-40); Gly8Arg26'34Lys36-39-GLP-l(7-39); Gly8Arg26'34Lys36'40-GLP-l(7-
40); Arg26 4Lys38GLP-l(7-38); Arg26 4Lys39GLP-l(7-39); Arg26 Lys40GLP- 1 (7-40);
Arg 6-34Lys41GLP-l(7-41); Arg26'34Lys42GLP-l(7-42); Arg26'34Lys43GLP-l(7-43); Arg26-34Lys44GLP- 1(7-44); Arg26'34Lys45GLP- 1(7-45); Arg26 4Lys38GLP-l(l -38);
Arg26'34Lys39GLP-l(l-39); Arg26'34Lys40GLP-l(l-40); Arg26'34Lys41GLP-l(l -41);
Arg26'34Lys42GLP- 1(1-42); Arg26 4Lys43GLP-l(l-43); Arg26 4Lys44GLP-l(l -44);
Arg26 4Lys45GLP- 1 ( 1 -45); Arg26'34Lys38GLP- 1 (2-38); Arg26 4Lys39GLP- 1 (2-39);
Arg26'34Lys40GLP- 1 (2-40); Arg26'34Lys41 GLP- 1 (2-41 ); Arg26'34Lys42GLP- 1 (2-42); Arg26'34Lys43GLP- 1(2-43); Arg26,34Lys44GLP-l(2-44); Arg26'34Lys45GLP-l(2-45);
Arg26-34Lys38GLP- 1 (3-38); Arg26'34Lys39GLP- 1 (3-39); Arg26'34Lys40GLP- 1(3 -40);
Arg26'34Lys41 GLP- 1 (3-41 ); Arg26 4Lys42GLP- 1 (3-42); Arg26'34Lys43GLP-l (3 -43);
Arg26'34Lys44GLP-l(3-44); Arg26'34Lys45GLP-l(3-45); Arg26-34Lys38GLP-l(4-38);
Arg26'34Lys39GLP-l(4-39); Arg26-34Lys40GLP-l(4-40); Arg26'34Lys 1GLP-l(4-41); Arg26'34Lys42GLP- 1 (4-42); Arg26'34Lys43GLP- 1 (4-43); Arg26'34Lys44GLP- 1 (4-44);
Arg26-34Lys45GLP- 1 (4-45); Arg26 4Lys38GLP- 1 (5-38); Arg2"4Lys39GLP- 1 (5-39);
Arg26'34Lys40GLP- 1 (5-40); Arg2634Lys4lGLP- 1(5-41); Arg26'34Lys42GLP- 1 (5 -42);
Arg26'34Lys43GLP-l(5-43); Arg26-34Lys44GLP-l(5-44); Arg26'34Lys45GLP-l(5-45);
Arg26-34Lys38GLP-l(6-38); Arg26'34Lys39GLP-l(6-39); Arg26'34Lys40GLP-l(6-4O); Arg26-34Lys41GLP-l(6-41); Arg26'34Lys42GLP- 1(6-42); Arg26'34Lys43GLP- 1(6-43);
Arg26*34Lys44GLP- 1(6-44); Arg26'34Lys45GLP- 1(6-45); Arg26Lys38GLP-l(l-38); Arg34Lys38GLP-
1(1-38); Arg26'34Lys36'38GLP-l(l-38); Arg26Lys38GLP- 1(7-38); Arg34Lys38GLP- 1(7-38);
Arg26'34Lys36'38GLP-l(7-38); Arg26'34Lys38GLP- 1(7-38); Arg26Lys39GLP-l(l -39);
Arg34Lys39GLP-l(l-39); Arg26-34Lys36 9GLP-l(l-39); Arg26Lys39GLP-l(7-39); Arg34Lys39GLP- 1(7-39) and Arg26'34Lys36 9GLP-l(7-39). Each one of these specific GLP-1 analogues constitutes an alternative embodiment of the invention.
In a still further embodiment of the invention the GLP-1 agonist is a GLP-1 derivative. In a further embodiment of the invention the GLP-1 derivative has one or more lipophilic substituents attached to the parent peptide. The lipophilic substituents make the profile of action of the parent GLP-1 peptide more protracted, make the parent GLP-1 peptide more me- tabolically and physically stable, and/or increase the water solubility of the parent GLP-1 pep- tide.
The lipophilic substituent is characterised by having a solubility in water at 20°C in the range from about 0.1 mg/100 ml water to about 250 mg/100 ml water, preferable in the range from about 0.3 mg/100 ml water to about 75 mg/100 ml water. For instance, octanoic acid (C8) has a solubility in water at 20°C of 68 mg/100 ml, decanoic acid (CIO) has a solubility in water at 20°C of 15 mg/100 ml, and octadecanoic acid (C 18) has a solubility in water at 20°C of 0.3 mg/100 ml.
In a further embodiment of the invention the GLP-1 derivatives preferably have three lipophilic substituents, more preferably two lipophilic substituents, and most preferably one lipophilic substituent. Each lipophilic substituent(s) preferably has 4-40 carbon atoms, more preferably 8-30 carbon atoms, even more preferably 8-25 carbon atoms, even more preferably 12-25 carbon atoms, and most preferably 14-18 carbon atoms.
The lipophilic substituent(s) contain a functional group which can be attached to one of the following functional groups of an amino acid of the parent GLP-1 peptide: (a) the amino group attached to the alpha-carbon of the N-terminal amino acid,
(b) the carboxy group attached to the alpha-carbon of the C-terminal amino acid,
(c) the epsilon-amino group of any Lys residue,
(d) the carboxy group of the R group of any Asp and Glu residue,
(e) the hydroxy group of the R group of any Tyr, Ser and Thr residue, (f) the amino group of the R group of any Trp, Asn, Gin, Arg, and His residue, or
(g) the thiol group of the R group of any Cys residue.
In an embodiment, a lipophilic 'substituent is attached to the carboxy group of the R group of any Asp and Glu residue.
In another embodiment, a lipophilic substituent is attached to the carboxy group attached to the alpha-carbon of the C-terminal amino acid.
In a most preferred embodiment, a lipophilic substituent is attached to the epsilon- amino group of any Lys residue. Each lipophilic substituent contains a functional group which may be attached to a functional group of an amino acid of the parent GLP-1 peptide. For example, a lipophilic substituent may contain a carboxy 1 group which can be attached to an amino group of the parent GLP-1 peptide by means of an amide bond. In an embodiment, the lipophilic substituent comprises a partially or completely hydrogenated cyclopentanophenathrene skeleton.
In another embodiment, the lipophilic substituent is a straight-chain or branched alkyl group.
In another embodiment, the lipophilic substituent is an acyl group of a straight-chain or branched fatty acid. Preferably, the lipophilic substituent is an acyl group having the formula CH3(CH2)nCO-, wherein n is an integer from 4 to 38, preferably an integer from 12 to 38, and most preferably is CH3(CH2)12CO-, CH3(CH24CO-, CH3(CH26CO-, CH3(CH28C0-, CH3(CH2)20CO- and CH3(CH2)22CO-. In a more preferred embodiment, the lipophilic substituent is tetradecanoyl. In a most preferred embodiment, the lipophilic substituent is hexadecanoyl.
In another embodiment of the present invention, the lipophilic substituent has a group which is negatively charged such as a carboxylic acid group. For example, the lipophilic substituent may be an acyl group of a straight-chain or branched alkane α,ω-dicarboxylic acid of the formula HOOC(CH2)mCO-, wherein m is an integer from 4 to 38, preferably an integer from 12 to 38, and most preferably is HOOC(CH2)*4CO-, HOOC(CH26CO-, HOOC(CH2)*8CO-, HOOC(CH2)20CO- or HOOC(CH2)22CO-.
In a preferred embodiment of the invention, the lipophilic substituent is attached to the parent GLP-1 peptide by means of a spacer. A spacer must contain at least two functional groups, one to attach to a functional group of the lipophilic substituent and the other to a functional group of the parent GLP-1 peptide.
In an embodiment, the spacer is an amino acid residue except Cys or Met, or a dipeptide such as Gly-Lys. For purposes of the present invention, the phrase "a dipeptide such as Gly- Lys" means any combination of two amino acids except Cys or Met, preferably a dipeptide wherein the C-terminal amino acid residue is Lys, His or Trp, preferably Lys, and the N-terminal amino acid residue is Ala, Arg, Asp, Asn, Gly, Glu, Gin, He, Leu, Val, Phe, Pro, Ser, Tyr, Thr, Lys, His and Trp. Preferably, an amino group of the parent peptide forms an amide bond with a carboxylic group of the amino acid residue or dipeptide spacer, and an amino group of the amino acid residue or dipeptide spacer forms an amide bond with a carboxyl group of the lipophilic substituent.
Preferred spacers are lysyl, glutamyl, asparagyl, glycyl, beta-alanyl and gamma- aminobutanoyl, each of which constitutes an individual embodiment. Most preferred spacers are glutamyl and beta-alanyl. When the spacer is Lys, Glu or Asp, the carboxyl group thereof may form an amide bond with an amino group of the amino acid residue, and the amino group thereof may form an amide bond with a carboxyl group of the lipophilic substituent. When Lys is used as the spacer, a further spacer may in some instances be inserted between the ε-amino group of Lys and the lipophilic substituent. In one embodiment, such a further spacer is succinic acid which forms an amide bond with the ε-amino group of Lys and with an amino group present in the lipophilic substituent. In another embodiment such a further spacer is Glu or Asp which forms an amide bond with the ε-amino group of Lys and another amide bond with a carboxyl group present in the lipophilic substituent, that is, the lipophilic substituent is a Nε-acylated lysine residue. In another embodiment, the spacer is an unbranched alkane ,ω-dicarboxylic acid group having from 1 to 7 methylene groups, which spacer forms a bridge between an amino group of the parent peptide and an amino group of the lipophilic substituent. Preferably, the spacer is succinic acid.
In a further embodiment, the lipophilic substituent with the attached spacer is a group of the formula CH3(CH2)pNH-CO(CH2)qCO-, wherein p is an integer from 8 to 33 , preferably from 12 to 28 and q is an integer from 1 to 6, preferably 2.
In a further embodiment, the lipophilic substituent with the attached spacer is a group of the formula CH3(CH2)rCO-NHCH(COOH)(CH2)2CO-, wherein r is an integer from 4 to 24, preferably from 10 to 24. In a further embodiment, the lipophilic substituent with the attached spacer is a group of the formula CH3(CH2)SCO-NHCH((CH2)2COOH)CO-, wherein s is an integer from 4 to 24, preferably from 10 to 24.
In a further embodiment, the lipophilic substituent is a group of the formula COOH(CH2)tCO- wherein t is an integer from 6 to 24. In a further embodiment, the lipophilic substituent with the attached spacer is a group of the formula -NHCH(COOH)(CH2)4NH-CO(CH2)uCH3, wherein u is an integer from 8 to 18. In a further embodiment, the lipophilic substituent with the attached spacer is a group of the formula CH3(CH2)vCO-NH-(CH2)z-CO, wherein v is an integer from 4 to 24 and z is an integer from 1 to 6.
In a further embodiment, the lipophilic substituent with the attached spacer is a group of the formula -NHCH(COOH)(CH2)4NH-COCH((CH2)2COOH)NH-CO(CH2)wCH3, wherein w is an integer from 10 to 16.
In a further embodiment, the lipophilic substituent with the attached spacer is a group of the formula -NHCH(COOH)(CH2)4NH-CO(CH2)2CH(COOH)NHCO(CH2)xCH3, wherein x is zero or an integer from 1 to 22, preferably 10 to 16. In a further embodiment the GLP- 1 derivative is derived from a GLP- 1 fragment selected from the group comprising GLP-l(7-35), GLP-1 (7-36), GLP-1 (7-36)amide, GLP-l(7-37), GLP- 1(7-38), GLP-l(7-39), GLP-1 (7-40) and GLP-1 (7-41) or an analogue thereof.
In a further embodiment of the GLP-1 derivative the designation analogue comprises derivatives wherein a total of up to fifteen, preferably up to ten amino acid residues have been exchanged with any -amino acid residue.
In a further embodiment of the GLP-1 derivative the designation analogue comprises derivatives wherein a total of up to fifteen, preferably up to ten amino acid residues have been exchanged with any α-amino acid residue which can be coded for by the genetic code.
In a further embodiment of the GLP-1 derivative the designation analogue comprises de- rivatives wherein a total of up to six amino acid residues have been exchanged with another α- arnino acid residue which can be coded for by the genetic code.
In a further embodiment the GLP-1 derivative is a GLP-1 derivative of formula I:
7 8 9 10 11 12 13 14 15 16 17 His-Xaa-Xaa-Gly-Xaa-Phe-Thr-Xaa-Asp-Xaa-Xaa-
18 19 20 21 22 23 24 25 26 27 28 Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Phe-
29 30 31 32 33 34 35 36 37 38 Ile-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa
39 40 41 42 43 44 45 Xaa-Xaa-Xaa-Xaa-Xaa-Xaa-Xaa
(I) wherein
Xaa at position 8 is Ala, Gly, Ser, Thr, Leu, He, Val, Glu, Asp, Met, or Lys, Xaa at position 9 is Glu, Asp, or Lys,
Xaa at position 11 is Thr, Ala, Gly, Ser, Leu, He, Val, Glu, Asp, or Lys, Xaa at position 14 is Ser, Ala, Gly, Thr, Leu, He, Val, Glu, Asp, or Lys, Xaa at position 16 is Val, Ala, Gly, Ser, Thr, Leu, He, Tyr, Glu, Asp, or Lys, Xaa at position 17 is Ser, Ala, Gly, Thr, Leu, He, Val, Glu, Asp, or Lys, Xaa at position 18 is Ser, Ala, Gly, Thr, Leu, He, Val, Glu, Asp, or Lys, Xaa at position 19 is Tyr, Phe, Tip, Glu, Asp, or Lys,
Xaa at position 20 i is Leu, Ala, Gly, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys, Xaa at position 21 is Glu, Asp, or Lys, Xaa at position 22 ; is Gly, Ala, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys, Xaa at position 23 is Gin, Asn, Arg, Glu, Asp, or Lys, Xaa at position 24 ■ is Ala, Gly, Ser, Thr, Leu, He, Val, Arg, Glu, Asp, or Lys, Xaa at position 25 > is Ala, Gly, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys, Xaa at position 26 i is Lys, Arg, Gin, Glu, Asp, or His, Xaa at position 27 ' is Glu, Asp, or Lys, Xaa at position 30 i is Ala, Gly, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys,
Xaa at position 31 is Trp, Phe, Tyr, Glu, Asp, or Lys, Xaa at position 32 is Leu, Gly, -Ala, Ser, Thr, He, Val, Glu, Asp, or Lys, Xaa at position 33 is Val, Gly, Ala, Ser, Thr, Leu, He, Glu, Asp, or Lys, Xaa at position 34 is Lys, Arg, Glu, Asp, or His, Xaa at position 35 is Gly, Ala, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys, Xaa at position 36 is Arg, Lys, Glu, Asp, or His,
Xaa at position 37 is Gly, Ala, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys, or is deleted, Xaa at position 38 is Arg, Lys, Glu, Asp, or His, or is deleted, Xaa at position 39 is Arg, Lys, Glu, Asp, or His, or is deleted, Xaa at position 40 is Asp, Glu, or Lys, or is deleted, Xaa at position 41 is Phe, Trp, Tyr, Glu, Asp, or Lys, or is deleted,
Xaa at position 42 is Pro, Lys, Glu, or Asp, or is deleted, Xaa at position 43 is Glu, Asp, or Lys, or is deleted, Xaa at position 44 is Glu, Asp, or Lys, or is deleted, and Xaa at position 45 is Val, Glu, Asp, or Lys, or is deleted, or (a) a C- 1 -6-ester thereof, (b) amide, C- 1 -6-alkylamide, or C- 1 -6-dialkylamide thereof and/or (c) a pharmaceutically acceptable salt thereof, provided that
(i) when the amino acid at position 37, 38, 39, 40, 41, 42, 43 or 44 is deleted, then each amino acid downstream of the amino acid is also deleted, (ii) the derivative of the GLP-1 analog contains only one or two Lys,
(iii) the ε-amino group of one or both Lys is substituted with a lipophilic substituent optionally via a spacer,
(iv) the total number of different amino acids between the derivative of the GLP-1 analog and the corresponding native form of GLP-1 does not exceed six. In a further embodiment of the GLP-1 derivative of formula I, the amino acids at positions 37-45 are absent.
In another embodiment of the GLP-1 derivative of formula I, the amino acids at positions 38-45 are absent.
In another embodiment of the GLP-1 derivative of formula I, the amino acids at posi- tions 39-45 are absent.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 8 is Ala, Gly, Ser, Thr, Leu, He, Val, Glu, Asp, or Lys, In another embodiment of the GLP-1 derivative of formula I, Xaa at position 8 is Ala, Gly, Ser, Thr, or Nal.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 9 is Glu. In another embodiment of the GLP-1 derivative of formula I, Xaa at position 11 is Thr. In another embodiment of the GLP-1 derivative of formula I, Xaa at position 14 is Ser.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 16 is Val. In another embodiment of the GLP-1 derivative of formula I, Xaa at position 17 is Ser. In another embodiment of the GLP-1 derivative of formula I, Xaa at position 18 is Ser, Lys, Glu, or Asp. In another embodiment of the GLP- 1 derivative of formula I, Xaa at position 19 is Tyr,
Lys, Glu, or Asp.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 20 is Leu, Lys, Glu, or Asp.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 21 is Glu, Lys, or Asp.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 22 is Gly, Glu, Asp, or Lys.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 23 is Gin, Glu, Asp, or Lys. In another embodiment of the GLP- 1 derivative of formula I, Xaa at position 24 is Ala,
Glu, Asp, or Lys.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 25 is Ala, Glu, Asp, or Lys.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 26 is Lys, Glu, Asp, or Arg.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 27 is Glu, Asp, or Lys.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 30 is Ala, Glu, Asp, or Lys. In another embodiment of the GLP- 1 derivative of formula I, Xaa at position 31 is Trp ,
Glu, Asp, or Lys. In another embodiment of the GLP-1 derivative of formula I, Xaa at position 32 is Leu, Glu, Asp, or Lys.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 33 is Val, Glu, Asp, or Lys. In another embodiment of the GLP-1 derivative of formula I, Xaa at position 34 is Lys,
Arg, Glu, or Asp.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 35 is Gly, Glu, Asp, or Lys.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 36 is Arg, Lys, Glu, or Asp.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 37 is Gly, Glu, Asp, or Lys.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 38 is Arg, or Lys, or is deleted. In another embodiment of the GLP-1 derivative of formula I, Xaa at position 39 is deleted.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 40 is deleted.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 41 is de- leted.
In another embodiment of the GLP-1 derivative of formula I. Xaa at position 42 is deleted.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 43 is deleted. In another embodiment of the GLP-1 derivative of formula I, Xaa at position 44 is deleted.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 45 is deleted.
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 26 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP-l(7-36). In another embodiment of the GLP- 1 derivative of formula I, Xaa at position 26 is Arg, each of Xaa at positions 38-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-37).
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 26 is Arg, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP-l(7-38).
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 34 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP-l(7-36). In another embodiment of the GLP- 1 derivative of formula I, Xaa at position 34 is Arg, each of Xaa at positions 38-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-37).
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 34 is Arg, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-38).
In another embodiment of the GLP-1 derivative of formula I, Xaa at positions 26 and 34 is Arg, Xaa at position 36 is Lys, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP-l(7.-36).
In another embodiment of the GLP-1 derivative of formula I, Xaa at positions 26 and 34 is Arg, Xaa at position 36 is Lys, each of Xaa at positions 38-45 is deleted, and each of the other Xaa is the amino acid in native GLP-1 (7-37).
In another embodiment of the GLP-1 derivative of formula I, Xaa at positions 26 and 34 is Arg, Xaa at position 36 is Lys, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP-l(7-38). In another embodiment of the GLP-1 derivative of formula I, Xaa at positions 26 and 34 is Arg, Xaa at position 38 is Lys, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-38).
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 8 is Thr, Ser, Gly or Val, Xaa at position 37 is Glu, Xaa at position 36 is Lys, each of Xaa at positions 38- 45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-37). In another embodiment of the GLP-1 derivative of formula I, Xaa at position 8 is Thr, Ser, Gly or Val, Xaa at position 37 is Glu, Xaa at position 36 is Lys, each of Xaa at positions 39- 45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-38).
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 8 is Thr, Ser, Gly or Val, Xaa at position 37 is Glu, Xaa at position 38 is Lys, each of Xaa at positions 39- 45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-38).
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 18, 23 or 27 is Lys, and Xaa at positions 26 and 34 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-36). In another embodiment of the GLP-1 derivative of formula I, Xaa at position 18, 23 or
27 is Lys, and Xaa at positions 26 and 34 is Arg, each of Xaa at positions 38-45 is deleted, and each of the other Xaa is the amino acid in native GLP-l(7-37).
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 18, 23 or 27 is Lys, and Xaa at positions 26 and 34 is Arg, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP-l(7-38).
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 8 is Thr, Ser, Gly, or Val, Xaa at position 18, 23 or 27 is Lys, and Xaa at position 26 and 34 is Arg, each of Xaa at positions 37-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-36). In another embodiment of the GLP-1 derivative of formula I, Xaa at position 8 is Thr,
Ser, Gly, or Val, Xaa at position 18, 23 or 27 is Lys, and Xaa at position 26 and 34 is Arg, each of Xaa at positions 38-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-37).
In another embodiment of the GLP-1 derivative of formula I, Xaa at position 8 is Thr, Ser, Gly, or Val, Xaa at position 18, 23 or 27 is Lys, and Xaa at position 26 and 34 is Arg, each of Xaa at positions 39-45 is deleted, and each of the other Xaa is the amino acid in native GLP- 1(7-38).
Such GLP-1 derivatives includes, but is not limited to, Lys34 (Nε-(γ-glutamyl(Nα-tetradecanoyl))) GLP-1 (7-37), Arg26'34,Lys8(Nε-(γ-glutamyl(Nα-hexadecanoyl))) GLP-1 (7-37), Arg34,Lys2o(Nε-(γ-ghιtamyl(Nα-dodecanoyl))) GLP-1 (7-37), Arg34,Lys26(Nε-(β-alanyl(Nα-hexadecanoyl))) GLP-1 (7-37), Arg34,Lys26(Nε-(α-glutamyl(Nα-hexadecanoyl))) GLP-1 (7-37), Arg34,Lys26(Nε-(piperidinyl-4-carbony l(N-hexadecanoyl))) GLP- 1 (7-37), Arg34,Lys26(Nε-(γ-glutamyl(Nα-decanoyl))) GLP-1 (7-37),
Glu2223'30Arg26-34Ly s38(Nε-(γ-glutamyl(Nα-tetradecanoyl)))-GLP- 1 (7-38)-OH, Glu23,26Arg34Lys38(Nε-(γ-glutamyl(Nα-tetradecanoyl)))-GLP-l(7-38)-OH,
Lys26-34-bis(Nε-(γ-glutamyl(Nα-tetradecanoyl)))-GLP- 1 (7-37)-OH,
Ly s26-34-bis(Nε-(γ-glutamyl(Nα-hexadecanoyl)))-GLP- 1(7-37)-OH,
Arg34Lys26(Nε-(γ-glutamyl(Nα-hexadecanoyl)))-GLP- 1 (7-37)-OH,
Arg26'34Lys38(Nε-(γ-glutamyl(Nα-tetradecanoyl)))-GLP- 1 (7-38)-OH, Arg26'34Lys38(Nε-(γ-glutamyl(Nα-hexadecanoyl)))-GLP- 1 (7-38)-OH,
Arg34Lys26(Nε-(γ-glutamyl(Nα-tetradecanoyl)))-GLP-l(7-37)-OH,
Arg2634Lys38(Nε-(γ-glutamyl(Nα-octadecanoyl)))-GLP- 1 (7-38)-OH.
Glu22'23*30Arg26"34Lys38(Nε-(γ-glutamyl(Nα-tetradecanoyl)))-GLP-l(7-38)-OH,
Glu23'26Arg34Lys38(Nε-(γ-glutamyl(Nα-tetradecanoyl)))-GLP- 1 (7-38)-OH, Lys26'34-bis(Nε-(ω-carboxytridecanoyl))-GLP-l(7-37)-OH,
Lys26'34-bis(Nε-(γ-glutamyl(Nα-tetradecanoyl)))-GLP-l(7-37)-OH,
Arg26'34Lys38(Nε-(ω-carboxypentadecanoyl))-GLP- 1 (7-38)-OH,
Lys26-34-bis(Nε-(γ-glutamyl(Nα-hexadecanoyl)))-GLP- 1 (7-37)-OH,
Arg34Lys26(Nε-(γ-glutamyl(Nα-hexadecanoyl)))-GLP-l(7-37)-OH, Arg26'34Lys38(Nε-(γ-glutamyl(Nα-tetradecanoyl)))-GLP- 1 (7-38)-OH,
Arg26'34Lys38(Nε-(ω-carboxypentadecanoyl))-GLP- 1 (7-38)-OH,
Arg26'34Lys38(Nε-(γ-glutamyl(Nα-hexadecanoyl)))-GLP- 1 (7-38)-OH,
Arg ' 8'23'26'30'34Lys38(Nε-hexadecanoy 1)-GLP- 1(7-38)-OH,
Arg26,34Lys38(Nε-(ω-carboxytridecanoyl))-GLP-l(7-38)-OH, Arg34Lys26(Nε-(γ-glutamy l(Nα-tetradecanoyl)))-GLP- 1(7-37)-OH,
Arg26,34Lys38(Nε-(γ-glutamyl(Nα-octadecanoyl)))-GLP- 1 (7-38)-OH,
Glu22'23'30Arg26'34Lys38(Nε-(β-alanyl(N(?-tetradecanoyl)))-GLP-l(7-38)-OH,
Glu23'26Arg34Ly s38(Nε-(β-alanyl(Nα-tetradecanoyl)))-GLP- 1 (7-38)-OH,
Lys26'34-bis(Nε-(β-alanyl(Nα-tetradecanoyl)))-GLP- 1 (7-37)-OH, Lys26'34-bis(Nε-(β-alanyl(Nα-hexadecanoyl)))-GLP-l(7-37)-OH, Arg34Lys26(Nε-(β-alanyl(Nα-hexadecanoyl)))-GLP- 1 (7-37)-OH,
Arg26'34Lys38(Nε-(β-alanyl(Nα-tetradecanoyl)))-GLP- 1 (7-38)-OH,
Arg26'34Lys38(Nε-(β-alanyl(Nα-hexadecanoyl)))-GLP- 1 (7-38)-OH,
Arg34Lys26(Nε-(β-alanyl(Nα-tetradecanoyl)))-GLP-l(7-37)-OH, Arg26'34Lys38(Nε-(β-alanyl(Nα-octadecanoyl)))-GLP- 1 (7-38)-OH.
Glu22-23'30Arg26-34Lys38(Nε-(β-alanyl(Nα-tetradecanoyl)))-GLP- 1 (7-38)-OH,
Glu23'26Arg34Ly s38(Nε-(β-alanyl(Nα-tetradecanoyl)))-GLP- 1 (7-38)-OH,
Lys26,34-bis(Nε-(β-alanyl(Nα-tetradecanoyl)))-GLP- 1 (7-37)-OH,
Lys26'34-bis(Nε-(β-alanyl(Nα-hexadecanoyl)))-GLP- 1 (7-37)-OH, Arg34Lys26(Nε-(β-alanyl(Nα-hexadecanoyl)))-GLP-l(7-37)-OH,
Arg26'34Lys38(Nε-(β-alanyl(Nα-tetradecanoyl)))-GLP-l(7-38)-OH,
Arg26'34Lys38(Nε-(β-alanyl(Nα-hexadecanoyl)))-GLP- 1 (7-38)-OH,
Arg34Lys26(Nε-(β-alanyl(Nα-tetradecanoyl)))-GLP- 1 (7-37)-OH,
Arg26-34Lys38(Nε-(β-alanyl(Nα-octadecanoyl)))-GLP- 1 (7-38)-OH, Lys26(Nε-tetradecanoyl)-GLP-l(7-37);
Lys34(Nε-tetradecanoyl)-GLP-l(7-37);
Lys26'34-bis(Nε-tetradecanoyl)-GLP-l(7-37);
Gly8Lys26(Nε-tetradecanoyl)-GLP-l(7-37);
Gly8Lys34(Nε-tetradecanoyl)-GLP- 1 (7-37); Gly8Lys26,34-bis(Nε-tetradecanoyl)-GLP- 1 (7-37);
Val8Lys26(Nε-tetradecanoyl)-GLP-l(7-37);
Val8Lys3 (Nε-tetradecanoyl)-GLP-l(7-37);
Val8Lys2634-bis(Nε-tetradecanoyl)-GLP- 1 (7-37);
Arg26Lys34(Nε-tetradecanoyl)-GLP-l(7-37); Lys26(Nε-tetradecanoyl)-GLP- 1 (7-38);
Lys34(Nε-tetradecanoyl)-GLP-l(7-38);
Lys26'34-bis(Nε-tetradecanoyl)-GLP-l(7-38);
Gly8Lys26(Nε-tetradecanoyl)-GLP- 1 (7-38);
Gly8Lys3 (Nε-tetradecanoyl)-GLP- 1 (7-38); Gly8Lys26'34-bis(Nε-tetradecanoyl)-GLP-l(7-38); Arg26Lys34(Nε-tetradecanoyl)-GLP- 1 (7-38); Lys26(Nε-tetradecanoyl)-GLP- 1 (7-39); Lys34(Nε-tetradecanoyl)-GLP-l(7-39); Lys26*34-bis(Nε-tetradecanoyl)-GLP-l(7-39); Gly8Lys26(Nε-tetradecanoyl)-GLP-l(7-39); Gly8Lys34(Nε-tetradecanoyl)-GLP-l(7-39); Gly8Lys26'34-bis(Nε-tetradecanoyl)-GLP- 1 (7-39); Arg26Lys34(Nε-tetradecanoyl)-GLP-l(7-39); Lys26(Nε-tetradecanoyl)-GLP- 1 (7-40); Lys34(Nε-tetradecanoyl)-GLP- 1 (7-40);
Lys26'34-bis(Nε-tetradecanoyl)-GLP- 1 (7-40);
Gly8Lys26(Nε-tetradecanoyl)-GLP-l(7-40);
Gly8Lys34(Nε-tetradecanoyl)-GLP- 1 (7-40);
Gly8Lys26'34-bis(Nε-tetradecanoyl)-GLP- 1 (7-40); Arg26Lys34(Nε-tetradecanoyl)-GLP-l (7-40);
Lys26(Nε-tetradecanoyl)-GLP-l(7-36);
Lys34(Nε-tetradecanoyl)-GLP- 1 (7-36);
Lys26'34-bis(Nε-tetradecanoyl)-GLP-l(7-36);
Gly8Lys26(Nε-tetradecanoyl)-GLP-l(7-36); Gly8Lys34(Nε-tetradecanoyl)-GLP-l(7-36);
Gly8Lys26 4-bis(Nε-tetradecanoyl)-GLP-l(7-36);
Arg26Lys34(Nε-tetradecanoyl)-GLP- 1 (7-36);
Lys26(Nε-tetradecanoyl)-GLP-l(7-35);
Lys34(Nε-tetradecanoyl)-GLP-l(7-35); Lys2634-bis(Nε-tetradecanoyl)-GLP-l(7-35);
Gly8Lys26(Nε-tetradecanoyl)-GLP-l(7-35);
Gly8Lys34(Nε-tetradecanoyl)-GLP- 1 (7-35);
Gly8Lys26,34-bis(Nε-tetradecanoyl)-GLP-l(7-35);
Arg26Lys34(Nε-tetradecanoyl)-GLP- 1 (7-35); Lys26(Nε-tetradecanoyl)-GLP- 1 (7-36)amide; Lys34(Nε-tetradecanoy 1)-GLP- 1(7-36)amide;
Lys26'34-bis(Nε-tetradecanoyl)-GLP-l(7-36)amide;
Gly8Lys26(Nε-tetradecanoyl)-GLP-l(7-36)amide;
Gly8Lys34(Nε-tetradecanoyl)-GLP-l(7-36)amide; Gly8Lys26-34-bis(Nε-tetradecanoyl)-GLP- 1 (7-36)amide;
Arg26Lys34(Nε-tetradecanoyl)-GLP-l(7-36)amide;
Gly8Arg26Lys34(Nε-tetradecanoyl)-GLP- 1 (7-37);
Lys26(Nε-tetradecanoyl)Arg34-GLP-l(7-37);
Gly8Lys26(Nε-tetradecanoyl)Arg34-GLP- 1 (7-37); Arg26'34Lys36(Nε-tetradecanoyl)-GLP- 1 (7-37);
Gly8 Arg2634Ly s36(Nε-tetradecanoyl)-GLP- 1 (7-37) ;
Gly8Arg26Lys34(Nε-tetradecanoyl)-GLP- 1 (7-38);
Lys26(Nε-tetradecanoyl)Arg34-GLP- 1 (7-38);
Gly8Lys26(Nε-tetradecanoyl)Arg34-GLP- 1 (7-38); Arg26'34Lys36(Nε-tetradecanoyl)-GLP-l (7-38);
Arg26-34Lys38(Nε-tetradecanoyl)-GLP-l(7-38);
Gly8Arg26'34Lys36(Nε-tetradecanoyl)-GLP- 1 (7-38);
Gly8Arg26Lys34(Nε-tetradecanoyl)-GLP-l(7-39);
Lys26(Nε-tetradecanoyl)Arg34-GLP-l(7-39); Gly8Lys26(Nε-tetradecanoyl)Arg34-GLP- 1 (7-39);
Arg26'34Lys36(Nε-tetradecanoyl)-GLP- 1 (7-39);
Gly8Arg26'34Lys36(Nε-tetradecanoyl)-GLP-l(7-39);
Gly8Arg26Lys34(Nε-tetradecanoyl)-GLP-l(7-40);
Lys26(Nε-tetradecanoyl)Arg34-GLP- 1 (7-40); Gly8Lys26(Nε-tetradecanoyl)Arg34-GLP- 1 (7-40);
Arg26'34Lys36(Nε-tetradecanoyl)-GLP- 1 (7-40);
Gly8Arg26'34Lys36(Nε-tetradecanoyl)-GLP- 1 (7-40);
Lys26(Nε-(ω-carboxynonadecanoyl))-GLP-l(7-37);
Lys34(Nε-(ω-carboxynonadecanoyl))-GLP-l(7-37); Lys26'34-bis(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-37); Gly8Lys26(Nε-(ω-carboxynonadecanoyl))-GLP-l(7-37);
Gly8Lys34(Nε-(ω-carboxynonadecanoyl))-GLP-l(7-37);
Gly8Lys26,34-bis(Nε-(ω-carboxynonadecanoyl))-GLP-l(7-37);
Lys26(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-38); Lys34(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-38);
Lys26-34-bis(Nε-(ω-carboxynonadecanoyl))-GLP-l(7-38);
Gly8Lys26(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-38);
Gly8Lys34(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-38);
Gly8Lys26'34-bis(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-38); Lys26(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-39) ;
Lysj4(Nε-(ω-carboxynonadecanoyl))-GLP-l(7-39);
Lys26'34-bis(Nε-(ω-carboxynonadecanoyl))-GLP-l(7-39);
Gly8Lys26(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-39);
Gly8Lys34(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-39); Gly8Lys26'34-bis(Nε-(ω-carboxynonadecanoyl))-GLP-l (7-39);
Lys26(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-40);
Lys34(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-40);
Lys26'34-bis(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-40);
Gly8Lys26(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-40); Gly8Lys34(Nε-(ω-carboxynonadecanoyl))-GLP- 1(7-40);
Gly8Lys26'34-bis(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-40);
Lys26(Nε-(ω-carboxynonadecanoyl))-GLP-l(7-36);
Lys34(Nε-(ω-carboxynonadecanoyl))-GLP-l(7-36);
Lys26-34-bis(Nε-(ω-carboxynonadecanoyl))-GLP-l(7-36); Gly8Lys26(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-36);
Gly8Lys34(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-36);
Gly8Lys26'34-bis(Nε-(ω-carboxynonadecanoyl))-GLP-l(7-36);
Lys26(Nε-(ω-carboxynonadecanoyl))-GLP-l(7-36)amide;
Lys34(Nε-(ω-carboxynonadecanoyl))-GLP-l(7-36)amide; Lys2634-bis(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-36)amide; Gly8Lys26(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-36)amide; Gly8Lys34(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-36)amide; Gly8Lys26'34-bis(Nε-(ω-carboxynonadecanoyl))-GLP-l(7-36)amide; Lys26(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-35); Lys34(Nε-(ω-carboxynonadecanoyl))-GLP-l (7-35);
Lys26,34-bis(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-35); Gly8Lys26(Nε-(ω-carboxynonadecanoyl))-GLP-l(7-35); Gly8Lys34(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-35); Gly8Lys26'34-bis(Nε-(ω-carboxynonadecanoyl))-GLP-l(7-35); Arg26Lys34(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-37);
Gly8 Arg26Lys34(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-37) ; Lys26(Nε-(ω-carboxynonadecanoyl))Arg34-GLP- 1 (7-37); Gly8Lys26(Nε-(ω-carboxynonadecanoyl))Arg34-GLP-l(7-37); Arg26'34Lys36(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-37); Gly8Arg26'34Lys36(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-37) ; Arg26Lys34(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-38); Gly8Arg26Lys34(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-38); Lys26(Nε-(ω-carboxynonadecanoyl))Arg34-GLP- 1 (7-38); Gly8Lys26(Nε-(ω-carboxynonadecanoyl))Arg34-GLP-l(7-38); Arg26-34Lys36(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-38); Arg26-34Lys38(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-38); Gly8Arg26-34Lys36(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-38); Arg26Lys34(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-39); Gly8Arg26Lys34(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-39); Lys26(Nε-(ω-carboxynonadecanoyl))Arg34-GLP- 1 (7-39);
Gly8Lys26(Nε-(ω-carboxynonadecanoyl))Arg34-GLP-l(7-39); Arg26'34Lys36(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-39); Gly8Arg26'34Lys36(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-39); Arg26Lys34(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-40); Gly8Arg26Lys34(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-40); Lys26(Nε-(ω-carboxynonadecanoyl))Arg34-GLP- 1 (7-40); Gly8Lys26(Nε-(ω-carboxynonadecanoyl))Arg34-GLP-l(7-40); Arg26'34Lys36(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-40); Gly8Arg26'34Lys36(Nε-(ω-carboxynonadecanoyl))-GLP- 1 (7-40); Lys26(Nε-(7-deoxycholoyl))-GLP-l (7-37); Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-37); Lys26'34-bis(Nε-(7-deoxycholoyl))-GLP-l(7-37); Gly8Lys26(Nε-(7-deoxycholoyl))-GLP-l(7-37); Gly8Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-37); Gly8Lys2634-bis(Nε-(7-deoxycholoyl))-GLP- 1 (7-37); Arg26Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-37); Lys26(Nε-(7-deoxycholoyl))-GLP- 1 (7-38); Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-38); Lys26'34-bis(Nε-(7-deoxycholoyl))-GLP-l(7-38); Gly8Lys26(Nε-(7-deoxycholoyl))-GLP- 1 (7-38); Gly8Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-38); Gly8Lys26'34-bis(Nε-(7-deoxycholoyl))-GLP- 1 (7-38); Arg26Lys34(Nε-(7-deoxycholoyl))-GLP-l(7-38); Lys26(Nε-(7-deoxycholoyl))-GLP-l(7-39); Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-39);
Lys26-34-bis(Nε-(7-deoxycholoyl))-GLP-l(7-39); Gly8Lys26(Nε-(7-deoxycholoyl))-GLP- 1 (7-39); Gly8Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-39); Gly8Lys26'34-bis(Nε-(7-deoxycholoyl))-GLP-l(7-39); Arg26Lys34(Nε-(7-deoxycholoyl))-GLP-l (7-39); Lys26(Nε-(7-deoxycholoyl))-GLP- 1 (7-40); Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-40); Lys26"34-bis(Nε-(7-deoxycholoyl))-GLP-l(7-40); Gly8Lys26(Nε-(7-deoxycholoyl))-GLP-l(7-40); Gly8Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-40); Gly8Lys2634-bis(Nε-(7-deoxycholoyl))-GLP-l(7-40); Arg26Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-40); Lys26(Nε-(7-deoxycholoyl))-GLP-l(7-36); Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-36); Lys26'34-bis(Nε-(7-deoxycholoyl))-GLP- 1 (7-36);
Gly8Lys26(Nε-(7-deoxycholoyl))-GLP- 1 (7-36);
Gly8Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-36);
Gly8Lys26'34-bis(Nε-(7-deoxycholoyl))-GLP-l(7-36);
Arg26Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-36); Lys26(Nε-(7-deoxycholoyl))-GLP- 1 (7-35);
Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-35);
Lys26-34-bis(Nε-(7-deoxycholoyl))-GLP-l(7-35);
Gly8Lys26(Nε-(7-deoxycholoyl))-GLP- 1 (7-35);
Gly8Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-35); Gly8Lys26'34-bis(Nε-(7-deoxycholoyl))-GLP- 1 (7-35);
Arg26Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-35);
Lys26(Nε-(7-deoxycholoyl))-GLP- 1 (7-36)amide;
Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-36)amide;
Lys26'34-bis(Nε-(7-deoxycholoyl))-GLP- 1 (7-36)amide; Gly8Lys26(Nε-(7-deoxycholoyl))-GLP- 1 (7-36)amide;
Gly8Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-36)amide;
Gly8Lys26'34-bis(Nε-(7-deoxycholoyl))-GLP-l(7-36)amide;
Arg26Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-36)amide;
Gly8Arg26Lys34(Nε-(7-deoxycholoyl))-GLP-l(7-37); Lys26(Nε-(7-deoxycholoyl))Arg34-GLP- 1 (7-37);
Gly8Lys26(Nε-(7-deoxycholoyl))Arg34-GLP-l(7-37);
Arg26'34Lys36(Nε-(7-deoxycholoyl))-GLP-l(7-37);
Gly8Arg26'34Lys36(Nε-(7-deoxycholoyl))-GLP- 1 (7-37);
Lys26(Nε-(choloyl))-GLP-l(7-37); Lys34(Nε-(choloyl))-GLP-l(7-37); Lys „260.3J 4 4-bis(Nε-(choloyl))-GLP- 1 (7-37);
Gly8Lys26(Nε-(choloyl))-GLP- 1 (7-37);
Gly8Lys 4(Nε-(choloyl))-GLP- 1 (7-37);
Gly8Lys26'34-bis(Nε-(choloyl))-GLP- 1 (7-37); Arg26Lys34(Nε-(choloyl))-GLP-l(7-37);
Gly8Arg26Lys34(Nε-(7-deoxycholoyl))-GLP-l(7-38);
Lys26(Nε-(7-deoxycholoyl))Arg34-GLP- 1 (7-38);
Gly8Lys26(Nε-(7-deoxycholoyl))Arg34-GLP-l(7-38);
Arg26-34Lys36(Nε-(7-deoxycholoyl))-GLΪ>- 1 (7-38); Arg26'34Lys38(Nε-(7-deoxycholoyl))-GLP- 1 (7-38);
Gly8Arg2634Lys36(NE-(7-deoxycholoyl))-GLP- 1 (7-38);
Lys26(Nε-(choloyl))-GLP-l(7-38);
Lys34(Nε-(choloyl))-GLP-l(7-38);
Lys26'34-bis(Nε-(choloyl))-GLP- 1 (7-38); Gly8Lys26(Nε-(choloyl))-GLP-l(7-38);
Gly8Lys34(Nε-(choloyl))-GLP-l(7-38);
Gly8Lys26'34-bis(Nε-(choloyl))-GLP-l(7-38);
Arg26Lys34(Nε-(choloyl))-GLP-l(7-38);
Gly8Arg26Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-39); Lys26(Nε-(7-deoxycholoyl))Arg34-GLP- 1 (7-39);
Gly8Lys26(Nε-(7-deoxycholoyl))Arg34-GLP-l (7-39);
Arg26'34Lys36(Nε-(7-deoxycholoyl))-GLP-l(7-39);
Gly8Arg26'34Lys36(Nε-(7-deoxycholoyl))-GLP-l(7-39);
Lys26(Nε-(choloyl))-GLP-l(7-39); Lys34(Nε-(choloyl))-GLP-l(7-39);
Lys26'34-bis(Nε-(choloyl))-GLP-l(7-39);
Gly8Lys26(Nε-(choloyl))-GLP-l(7-39);
Gly8Lys34(Nε-(choloyl))-GLP-l(7-39);
Gly8Lys2634-bis(Nε-(choloyl))-GLP-l(7-39); Arg26Lys34(Nε-(choloyl))-GLP- 1 (7-39); Gly8Arg26Lys34(Nε-(7-deoxycholoyl))-GLP- 1 (7-40); Lys26(Nε-(7-deoxycholoyl))Arg34-GLP-l(7-40);
Gly8Lys26(Nε-(7-deoxycholoyl))Arg3 -GLP- 1 (7-40):
Arg263 Ly s36(Nε-(7-deoxycholoyl))-GLP- 1 (7-40): Gly8Arg26-34Lys( ε-(7-deoxycholoyl))-GLP- 1 (7-40):
Lys26(Nε-(choloyl))-GLP- 1(7-40);
Lys34(Nε-(choloyl))-GLP- 1 (7-40);
Lys2634-bis(Nε-(choloyl))-GLP- 1 (7-40);
Gly8Lys26(Nε-(choloyl))-GLP- 1 (7-40): Gly8Lys34(Nε-(choloyl))-GLP- 1 (7-40);
Gly8Lys2634-bis(Nε-(choloyl))-GLP- 1 (7-40);
Arg26Lys34(Nε-(choloyl))-GLP- 1 (7-40);
Lys26(Nε-(choloyl))-GLP- 1 (7-36);
Lys34(Nε-(choloyl))-GLP- 1 (7-36); Lys26'34-bis(Nε-(choloyl))-GLP- 1 (7-36);
Gly8Lys26(Nε-(choloyl))-GLP-l(7-36);
Gly8Lys34(Nε-(choloyl))-GLP- 1 (7-36);
Gly8Lys26-34-bis(Nε-(choloyl))-GLP-l(7-36);
Arg26Lys34(Nε-(choloyl))-GLP- 1(7-36); Lys26(Nε-(choloyl))-GLP-l(7-35):
Lys34(Nε-(choloyl))-GLP-l(7-35);
Lys2634-bis(Nε-(choloyl))-GLP- 1 (7-35);
Gly8Lys26(Nε-(choloyl))-GLP-l(7-35);
Gly8Lys34(Nε-(choloyl))-GLP-l(7-35): ' Gly8Lys26-34-bis( ε-(choloyl))-GLP- 1(7-35);
Arg26Lys34(Nε-(choloyl))-GLP- 1(7-35);
Lys26(Nε-(choloyl))-GLP-l(7-36)amide;
Lys34(Nε-(choloyl))-GLP- 1 (7-36)amide;
Lys26'34-bis(Nε-(choloyl))-GLP-l(7-36)amide; Gly8Lys26(Nε-(choloyl))-GLP-l (7-36)amide; Gly8Lys34(Nε-(choloyl))-GLP- 1 (7-36)amide;
Gly8Lys26 4-bis(Nε-(choloyl))-GLP- 1 (7-36)amide;
Arg26Lys34(Nε-(choloyl))-GLP- 1 (7-36)amide:
Gly8Arg26Lys34(Nε-(choloyl))-GLP-l(7-37): Lys26(Nε-(choloyl))Arg34-GLP- 1 (7-37):
Gly8Lys26(Nε-(choloyl))Arg34-GLP- 1(7-37);
Arg26 4Lys36(Nε-(choloyl))-GLP- 1(7-37);
Gly8Arg26"34Lys36(Nε-(choloyl))-GLP-l(7-37);
Lys26(Nε-(lithocholoyl))-GLP- 1 (7-37); . Lys34(Nε-(lithocholoyl))-GLP- 1 (7-37);
Lys2634-bis(Nε-(lithocholoyl))-GLP- 1 (7-37);
Gly8Lys26(Nε-(lithocholoyl))-GLP-l(7-37);
Gly8Lys34(Nε-(lithocholoyl))-GLP- 1 (7-37);
Gly8Lys26 4-bis(Nε-(lithocholoyl))-GLP-l(7-37); Arg26Lys34(Nε-(lithocholoyl))-GLP- 1 (7-37);
Gly8Arg26Lys34(Nε-(choloyl))-GLP-l(7-38);
Lys26(Nε-(choloyl))Arg34-GLP-l(7-38);
Gly8Lys26(Nε-(choloyl))Arg34-GLP- 1 (7-38);
Arg26 4Lys36(Nε-(choloyl))-GLP- 1 (7-38); Arg2634Lys38(Nε-(choloyl))-GLP- 1 (7-38);
Gly8Arg2634Lys36(Nε-(choloyl))-GLP- 1 (7-38);
Lys26(Nε-(lithocholoyl))-GLP- 1 (7-38);
Lys34(Nε-(lithocholoyl))-GLP- 1 (7-38):
Lys26 4-bis(Nε-(lithocholoyl))-GLP-l(7-38); Gly8Lys26(Nε-(lithocholoyl))-GLP- 1(7-38);
Gly8Lys34(Nε-(lithocholoyl))-GLP- 1 (7-38); Gly8Lys2634-bis(Nε-(lithocholoyl))-GLP- 1 (7 Arg26Lys34(Nε-(lithocholoyl))-GLP- 1 (7-38); Gly8Arg26Lys34(Nε-(choloyl))-GLP- 1 (7-39); Lys26(Nε-(choloyl))Arg34-GLP-l(7-39); Gly8Lys26(Nε-(choloyl))Arg34-GLP-l(7-39);
Arg26 4Lys36(Nε-(choloyl))-GLP-l(7-39);
Gly8Arg26 4Lys36( ε-(choloyl))-GLP- 1 (7-39);
Lys26(Nε-(lithocholoyl))-GLP-l(7-39); Lys34(Nε-(lithocholoyl))-GLP-l(7-39);
Lys26 4-bis(Nε-(lithocholoyl))-GLP-l(7-39);
Gly8Lys26(Nε-(lithocholoyl))-GLP-l(7-39);
Gly8Lys34(Nε-(lithocholoyl))-GLP-l(7-39);
Gly8Lys2634-bis(Nε-(lithocholoyl))-GLP- 1 (7-39); Arg26Lys34(Nε-(lithocholoyl))-GLP-l(7-39);
Gly8Arg26Lys34(Nε-(choloyl))-GLP- 1 (7-40);
Lys26(Nε-(choloyl))Arg34-GLP- 1 (7-40);
Gly8Lys26(Nε-(choloyl))Arg34-GLP- 1 (7-40);
Arg2634Lys36(Nε-(choloyl))-GLP- 1 (7-40.); Gly8Arg26 4Lys36(Nε-(choloyl))-GLP- 1 (7-40);
Lys26(Nε-(lithocholoyl))-GLP- 1 (7-40);
Lys34(Nε-(lithocholoyl))-GLP- 1 (7-40);
Lys2634-bis(Nε-(lithocholoyl))-GLP- 1 (7-40);
Gly8Lys26(Nε-(lithocholoyl))-GLP- 1 (7-40); Gly8Lys34(Nε-(lithocholoyl))-GLP- 1 (7-40);
Gly8Lys26 4-bis(Nε-(lithocholoyl))-GLP-l(7-40);
Arg26Lys34(Nε-(lithocholoyl))-GLP-l(7-37);
Lys26(Nε-(lithocholoyl))-GLP- 1 (7-36);
Lys34(Nε-(lithocholoyl))-GLP-l(7-36); • Lys26 4-bis(Nε-(lithocholoyl))-GLP-l(7-36);
Gly8Lys26(Nε-(lithocholoyl))-GLP-l(7-36);
Gly8Lys34(Nε-(lithocholoyl))-GLP-l(7-36);
Gly8Lys26 4-bis(Nε-(lithocholoyl))-GLP- 1 (7-36);
Arg26Lys34(Nε-(lithocholoyl))-GLP-l(7-36); Lys26(Nε-(lithocholoyl))-GLP-l(7-35); Lys34(Nε-(lithocholoyl))-GLP-l(7-35);
Lys26 4-bis(Nε-(lithocholoyl))-GLP-l(7-35);
Gly8Lys26(Nε-(lithocholoyl))-GLP- 1 (7-35);
Gly8Lys34(Nε-(lithocholoyl))-GLP- 1 (7-35); Gly8Lys26 4-bis(Nε-(lithocholoyl))-GLP- 1 (7-35);
Arg26Lys34(Nε-(lithocholoyl))-GLP- 1 (7-35);
Lys26(Nε-(lithocholoyl))-GLP-l(7-36)amide;
Lys34(Nε-(lithocholoyl))-GLP-l(7-36)amide;
Lys26 4-bis(Nε-(lithocholoyl))-GLP- 1 (7 36)amide; Gly8Lys26(Nε-(lithocholoyl))-GLP- 1 (7-36)amide;
Gly8Lys34(Nε-(lithocholoyl))-GLP- 1 (7-36)amide;
Gly8Lys26 4-bis(Nε-(lithocholoyl))-GLP-l(7-36)amide;
Arg26Lys34(Nε-(Iithocholoyl))-GLP- 1 (7-36)amide;
Gly8Arg26Lys34(Nε-(lithocholoyl))-GLP-l(7-37); Lys26(Nε-(lithocholoyl))Arg34-GLP-l(7-37);
Gly8Lys26(Nε-(lithocholoyl))Arg34-GLP-l(7-37);
Arg26 4Lys36(Nε-(lithocholoyl))-GLP- 1 (7-37);
Arg26 4Lys38(Nε-(lithocholoyl))-GLP-l(7-37);
Gly8Arg26 4Lys36(Nε-(lithocholoyl))-GLP-l(7-37); Gly8Arg26Lys34(Nε-(lithocholoyl))-GLP- 1 (7-38);
Lys26(Nε-(lithocholoyl))Arg34-GLP- 1 (7-38);
Gly8Lys26(Nε-(lithocholoyl))Arg34-GLP- 1 (7-38);
Arg26 4Lys36(Nε-(lithocholoyl))-GLP- 1 (7-38);
Arg26 4Lys38(Nε-(lithocholoyl))-GLP- 1 (7-38); Gly8Arg26 4Lys36(Nε-(lithocholoyl))-GLP-l(7-38);
Gly8Arg26Lys34(Nε-(lithocholoyl))-GLP-l(7-39);
Lys26(Nε-(lithocholoyl))Arg34-GLP- 1 (7-39);
Gly8Lys26(Nε-(lithocholoyl))Arg34-GLP-l(7-39);
Arg26 4Lys36(Nε-(lithocholoyl))-GLP-l(7-39); Gly8Arg26 4Lys36(Nε-(lithocholoyl))-GLP-l(7-39); Gly8Arg26Lys34(Nε-(lithocholoyl))-GLP-l(7-40);
Lys26(Nε-(lithocholoyl))Arg34-GLP- 1 (7-40);
Gly8Lys26(Nε-(lithocholoyl))Arg34-GLP-l(7-40);
Arg2634Lys36(Nε-(lithocholoyl))-GLP- 1 (7-40) and Gly8Arg26 4Lys36(Nε-(lithocholoyl))-GLP- 1(7-40). Each one of these specific GLP-1 derivatives constitutes an alternative embodiment of the invention.
The most preferred GLP-1 derivative is Arg34, Lys26(Nε-(γ-Glu(Nα-hexadecanoyl)))-
GLP-l(7-37).
In a further embodiment of the GLP-1 derivative, a parent peptide for a derivative of the invention is
Arg26-GLP-l(7-37); Arg34-GLP-l(7-37); Lys36-GLP- 1(7-37); Arg2634Lys36-GLP- 1(7-37);
Arg26 4Lys38GLP- 1(7-38); Arg26 4Lys39-GLP- 1(7-39); Arg2634Lys40-GLP-l (7-40);
Arg26Lys36-GLP-l(7-37); Arg34Lys36-GLP-l(7-37); Arg26Lys39-GLP-l(7-39);
Arg34Lys40-GLP- 1 (7-40); Arg26 4Lys36 9-GLP- 1 (7-39); Arg26 4Lys36'40-GLP- 1 (7-40); Gly8Arg26-GLP-l(7-37); Gly8Arg34-GLP-l(7-37); Gly8Lys36-GLP- 1(7-37);
Gly8Arg2o 4Lys3o-GLP-l(7-37); Gly8Arg26 4Lys39-GLP-l(7-39); Gly8Arg26'34Lys40-GLP-l(7-
40); Gly8Arg26Lys36-GLP-l(7-37); Gly8Arg34Lys36-GLP-l(7-37); Gly8Arg26Lys39-GLP-l(7-39);
Gly8Arg34Lys40-GLP-l(7-40); Gly8Arg26 4Lys36 9-GLP-l(7-39);
Gly8Arg2634Lys36'40-GLP- 1(7-40); Val8Arg26-GLP-l(7-37); Val8Arg34-GLP-l(7-37); Val8Lys36- GLP-l(7-37); Val8Arg26 4Lys36-GLP- 1(7-37): Val8Arg2634Lys39-GLP-l(7-39);
Val8Arg26 4Lys40-GLP-l(7-40); Val8Arg26Lys36-GLP-l(7-37); Val8Arg34Lys35-GLP-l(7-37);
Val8Arg26Lys39-GLP- 1 (7-39); Val8Arg34Lys40-GLP- 1 (7-40); Val8Arg263 Ly s36 9-GLP-l (7-39) ; or Val8Arg26 4Lys36'40-GLP- 1 (7-40).
In a further embodiment of the GLP-1 derivative, a parent peptide for a derivative of the invention is:
Arg26 4Lys38GLP-l(7-38); Arg26 4Lys39GLP-l(7-39); Arg26 4Lys40GLP-l(7-4O);
Arg26 4Lys41GLP-l(7-41); Arg26 4Lys42GLP-l(7-42); Arg2634Lys43GLP-l(7-43);
Arg26 4Lys44GLP- 1(7-44); Arg26 4Lys45GLP- 1(7-45); Arg26Lys38GLP-l(7-38); Arg34Lys38GLP- 1(7-38); Arg26 4Lys36 8GLP-l(7-38); Arg26 4Lys38GLP-l(7-38); Arg26Lys39GLP-l(l-39); Arg34Lys39GLP- 1(1-39); Arg26 4Lys3639GLP-l(l-39); Arg26Lys39GLP-l(7-39); Arg34Lys39GLP- 1 (7-39); Arg26 4Lys3639GLP- 1 (7-39). In a further embodiment of the GLP-1 derivative, the parent peptide is selected from the group comprising Arg26-GLP-l(7-37), Arg34-GLP-l(7-37), Lys36-GLP- 1(7-37), Arg26'34Lys36- GLP-l(7-37), Arg26Lys36-GLP-l(7-37), Arg34Lys36-GLP- 1(7-37), Gly8Arg26-GLP- 1(7-37), Gly8Arg34-GLP-l(7-37), Gly8Lys36-GLP-l(7-37), Gly8Arg26 4Lys36-GLP-l(7-37), Gly8Arg26Lys36-GLP- 1(7-37) and Gly8Arg34Lys36-GLP-l(7-37).
In a further embodiment of the GLP-1 derivative, the parent peptide is selected from the group comprising Arg26Lys38-GLP-l(7-38), Arg26 4Lys38-GLP-l(7-38), Arg26 4Lys36'38-GLP- 1(7-38), Gly8Arg26Lys38-GLP-l(7-38) and Gly8Arg26 4Lys3638-GLP-l(7-38).
In a further embodiment of the GLP-1 derivative, the parent peptide is selected from the group comprising Arg26Lys39-GLP- 1(7-39), Arg26 4Lys3639-GLP-l(7-39), Gly8Arg26Lys39-GLP- 1(7-39) and Gly8Arg26 4Lys36 9-GLP- 1(7-39).
In a further embodiment of the GLP-1 derivative, the parent peptide is selected from the group comprising Arg34Lys40-GLP- 1(7-40), Arg26 4Lys36'40-GLP- 1(7-40), Gly8Arg34Lys40-GLP- 1(7-40) and Gly8Arg26 4Lys36,40-GLP- 1(7-40). In a further embodiment of the GLP-1 derivative, the parent peptide is:
Arg26-GLP- 1(7-36); Arg34-GLP-l(7-36); Arg26 4Lys36-GLP- 1(7-36); Arg26-GLP-l(7-36)amide; Arg34-GLP-l(7-36)amide; Arg26'34Lys36-GLP-l(7-36)amide; Arg26-GLP-l(7-37); Arg34-GLP- 1(7-37); Arg26 4Lys36-GLP-l(7-37); Arg26-GLP- 1(7-38); Arg34-GLP-l(7-38) ; Arg26 4Lys38GLP-l(7-38); Arg26-GLP- 1(7-39); Arg34-GLP- 1(7-39); Arg26 4Lys39-GLP-l(7-39); Gly8Arg26-GLP- 1(7-36); Gly8Arg34-GLP-l(7-36); Gly8Arg2634Lys36-GLP-l(7-36); Gly8Arg26- GLP- 1 (7-36)amide; Gly8Arg34-GLP- 1 (7-36)amide; Gly8Arg26 4Lys36-GLP- 1 (7-36)amide; Gly8Arg26-GLP- 1(7-37); Gly8Arg34-GLP-l(7-37); Gly8Arg26 4Lys36-GLP-l(7-37); Gly8Arg26- GLP-l(7-38); Gly8Arg34-GLP-l(7-38) ; Gly8Arg26 4Lys38GLP-l(7-38); Gly8Arg26-GLP-l(7-39); Gly8Arg34-GLP- 1 (7-39); Gly8Arg2634Lys39-GLP- 1(7-39); Val8Arg26-GLP- 1(7-36); Val8Arg34-GLP-l(7-36); Nal8Arg2634Lys36-GLP-l(7-36); Val8Arg26- GLP-l(7-36)amide; Val8Arg34-GLP-l(7-36)amide; Val8Arg26 4Lys36-GLP-l (7-36)amide; Val8Arg26-GLP- 1(7-37); Val8Arg34-GLP- 1(7-37); Nal8Arg26 4Lys36-GLP-l(7-37); Val8Arg26- GLP-l(7-38); Val8Arg34-GLP-l(7-38); Nal8Arg26 4Lys38GLP-l(7-38); Val8 Arg26-GLP-1 (7-39); Val8Arg34-GLP- 1 (7-39); Val8Arg26 4Lys39-GLP- 1 (7-39); Ser8Arg26-GLP- 1(7-36); Ser8Arg34-GLP- 1(7-36); Ser8Arg2634Lys36-GLP-l(7-36); Ser8Arg26- GLP-l(7-36)amide; Ser8Arg34-GLP-l(7:36)amide; Ser8Arg2634Lys36-GLP-l (7-36)amide; Ser8Arg26-GLP- 1(7-37); Ser8Arg34-GLP- 1(7-37); Ser8Arg26'34Lys36-GLP-l(7-37); Ser8Arg26- GLP-l(7-38); Ser8Arg34-GLP-l(7-38) ; Ser8Arg26 4Lys38GLP-l(7-38); Ser8Arg26-GLP-l(7-39);
Ser8Arg34-GLP- 1 (7-39); Ser8Arg26 4Lys39-GLP- 1 (7-39);
Thr8Arg26-GLP- 1 (7-36); Thr8Arg34-GLP- 1(7-36); Thr8Arg26 4Lys36-GLP-l(7-36); Thr8Arg26-
GLP-l(7-36)amide; Thr8Arg34-GLP-l(7-36)amide; Thr8Arg26 4Lys36-GLP- 1 (7-36)amide; Thr8Arg26-GLP- 1(7-37); Thr8Arg34-GLP- 1(7-37): Thr8Arg26 4Lys36-GLP-l(7-37); Thr8Arg26-
GLP-l(7-38); Thr8Arg34-GLP-l(7-38) ; Thr8Arg2634Lys38GLP-l(7-38); Thr8Arg26-GLP-l(7-39);
Thr8Arg34-GLP- 1 (7-39); Thr8Arg26 4Lys39-GLP- 1 (7-39);
Val8Glu35Arg2634Lys36-GLP-l(7-36); Val8Glu35Arg26 4Lys36-GLP-l(7-36)amide;
Val8Glu36Arg2634Lys37GLP-l(7-37); Val8Glu37Arg2634Lys38GLP-l(7-38); Val8Glu38Arg26 4Lys39-GLP-l(7-39); Val8Glu35Arg26 4Lys36-GLP-l(7-36);
Val8Glu35Arg26 4Lys36-GLP-l(7-36)amide; Val8Glu36Arg2634Lys37GLP-l(7-37);
Val8Glu37Arg2634Lys38GLP-l(7-38); Val8Glu38Arg2634Lys39-GLP-l(7-39);
Val8Asp35Arg26'34Lys36-GLP-l(7-36); Val8Asp35Arg26 4Lys36-GLP-l(7-36)amide;
Val8Asp36Arg26 4Lys37GLP-l(7-37); Val8Asp37Arg26 4Lys38GLP-l(7-38); Val8Asp38Arg26'34Lys39-GLP-l(7-39); Val8Asp35Arg26 4Lys3o-GLP-l(7-36);
Val8Asp35Arg26 4Lys36-GLP-l(7-36)amide; Val8Asp36Arg26 4Lys37GLP-l(7-37);
Val8Asp37Arg2634Lys38GLP-l(7-38); Val8Asp38Arg26 4Lys39-GLP-l(7-39);
Ser8Glu35Arg2634Lys36-GLP-l(7-36); Ser8Glu35Arg26 4Lys36-GLP-l(7-36)amide;
Ser8Glu36Arg2634Lys37GLP-l(7-37); Ser8Glu37Arg26 4Lys38GLP-l(7-38); Ser8Glu38Arg26-34Lys39-GLP-l(7-39); Ser8Glu35Arg26 4Lys36-GLP-l(7-36);
Ser8Glu35 Arg2634Lys36-GLP- 1 (7-36)amide: Ser8Glu36Arg26 4Lys37GLP- 1 (7-37) ;
Ser8Glu37Arg2634Lys38GLP-l(7-38); Ser8Glu38Arg2634Lys39-GLP-l(7-39);
Ser8Asp35Arg26 4Lys36-GLP- 1(7-36); Ser8 Asp35Arg 634Lys36-GLP-l(7-36)amide;
Ser8Asp36Arg26 4Lys37GLP- 1 (7-37); Ser8Asp37Arg2634Lys38GLP- 1 (7-38); Ser8Asp38Arg26 4Lys39-GLP-l(7-39); Ser8Asp35Arg2634Lys36-GLP-l(7-36);
Ser8Asp35Arg2634Lys 6-GLP-l(7-36)amide: Ser8Asp36Arg2634Lys37GLP-l(7-37);
Ser8 Asp37Arg26 4Lys38GLP- 1(7-38); Ser8 Asp38Arg2634Lys39-GLP- 1(7-39);
Thr8Glu35Arg2634Lys36-GLP-l(7-36); Thr8Glu35Arg2634Lys36-GLP-l(7-36)amide;
Thr8Glu36Arg2634Lys37GLP-l(7-37); Thr8Glu37Arg26 4Lys38GLP-l(7-38); Thr8Glu38Arg2634Lys39-GLP- 1 (7-39); Thr8Glu35Arg 634Lys36-GLP- 1(7-36);
Tru-8Glu35Arg26-34Lys36-GLP-l(7-36)amide; Thr8Glu36Arg26 4Lys37GLP-l(7-37);
Thr8Glu37Arg2634Lys38GLP-l(7-38); Thr8Glu38Arg26 4Lys39-GLP-l(7-39); Thr8Asp35Arg26 4Lys3o-GLP-l(7-36);Thr8Asp35Arg26'34Lys36-GLP-l(7-36)amide;
Thr8Asp36Arg26 4Lys37GLP- 1 (7-37); Thr8 Asp37Arg26 4Lys38GLP-l (7-38);
Thr8Asp38Arg26-34Lys39-GLP-l(7-39);Thr8Asp35Arg26 4Lys36-GLP-l(7-36);
Thr8Asp35Arg26 4Lys36-GLP-l(7-36)amide;Thr8Asp36Arg2634Lys37GLP-l(7-37); Thr8Asp37Arg26 4Lys38GLP-l(7-38);Thr8Asp8Arg2634Lys39-GLP-l(7-39):
Gly8Glu35Arg26 4Lys36-GLP-l(7-36);Gly8Glu35Arg2634Lys36-GLP-l(7-36)amide;
Gly8Glu36Arg26 4Lys37GLP- 1 (7-37); Gly8Glu37Arg2634Lys38GLP- 1 (7-38);
Gly8Glu38Arg26 4Lys39-GLP- 1 (7-39); Gly8Glu35Arg26 4Lys36-GLP- 1(7-36);
Gly8Glu35Arg26 4Lys36-GLP-l(7-36)amide;Gly8Glu36Arg2634Lys37GLP-l(7-37); Gly8Glu37Arg26 4Lys38GLP- 1 (7-38); Gly8Glu38Arg26 4Lys39-GLP- 1 (7-39);
Gly8Asp35Arg26 4Lys36-GLP-l(7-36);Gly8Asp35Arg2634Lys36-GLP-l(7-36)amide;
Gly8Asp36Arg26'34Lys37GLP-l(7-37);Gly8Asp37Arg26 4Lys38GLP-l(7-38);
Gly8Asp38Arg26'34Lys39-GLP-l(7-39);Gly8Asp35Arg26'34Lys36-GLP-l(7-36);
Gly8Asp35Arg26'34Lys36-GLP-l(7-36)amide;Gly8Asp36Arg26 4Lys37GLP-l(7-37); Gly8Asp37Arg26'34Lys38GLP-l(7-38);Gly8Asp38Arg26 4Lys39-GLP-l(7-39);
Arg26 4Lys18-GLP-l(7-36);Arg26 4Lys18-GLP-l(7-36)amide;Arg26 4Lys18GLP-l(7-37);
Arg26 4Lys18GLP-l(7-38);Gly8Asp19Arg26>34Lys18-GLP-l(7-36);Gly8Asp17Arg26 4Lys18-GLP-
1(7-36); Gly8Asp19Arg26 4Lys18-GLP-l (7-36)amide; Gly8Asp17Arg26'34Lys18-GLP-l(7-
36)amide; Gly8Asp19Arg26 4Lys18GLP- 1 (7-37); Gly8Asp19Arg26 4LysI8GLP- 1 (7-38); Gly8Asp17Arg2634Lys18GLP-l(7-38);
Arg2634Lys23-GLP- 1 (7-36); Arg26 4Lys23-GLP- 1 (7-36)amide; Arg2634Lys23GLP- 1 (7-37);
Arg26 4Lys23GLP- 1 (7-38); Gly8Asp2Arg2634Lys23-GLP- 1 (7-36); Gly8Asp22 Arg2634Lys23-GLP-
1(7-36); Gly8Asp24Arg2634Lys23-GLP-l (7-36)amide; Gly8Asp22Arg26 4Lys23-GLP-l(7-
36)amid lee;; GGllyy88AAsspp2244AArrsg26 4Lys23GLP-l(7-37); Gly8Asp24Arg26 4Lys23GLP- 1 (7-38); Gly8Asp22Arg26 4Lys23GLP-l(7-38);
Arg jLys '-GLP- 1 (7-36); Arg-&-34Lys' '-GLP- 1 (7-36)amide; Arg2634Lys27GLP-l(7-38);Gly8Asp28Arg2634Lys27-GLP-l(7-36);Gly8Asp26Arg26 4Lys27-GLP- 1(7-36); Gly8Asp28Arg2634Lys27-GLP-l (7-36)amide; Gly8Asp26Arg26 4Lys27-GLP-l(7- 36)amide;Gly8Asp28Arg2634Lys27GLP-l(7-37);Gly8Asp28Arg2634Lys27GLP-l(7-38); Gly8Asp26Arg26 4Lys27GLP-l(7-38);
Arg26 4Lys18-GLP- 1 (7-36); Arg26 4Lys18-GLP- 1 (7-36)amide; Arg26'34Lys18GLP- 1 (7-37); Arg26 4Lys18GLP-l(7-38);Val8Asp19Arg26'34Lys18-GLP-l(7-36);Val8Asp17Arg26 4Lys18-GLP- 1(7-36); Val8 Asp19Arg26 4Lys18-GLP-l(7-36)amide; Val8 Asp17Arg26 4Lys18-GLP-l(7-36)amide; Val8Asp19Arg26 4Lys18GLP-l(7-37);Val8Asp19Arg26 4Lys18GLP-l(7-38); Val8Asp17Arg26 4Lys18GLP-l(7-38);
Arg26 4Lys23-GLP- 1 (7-36); Arg26 4Lys23-GLP- 1 (7-36)amide; Arg26'34Lys23GLP- 1 (7-37); Arg2634Lys23GLP-l(7-38); Val8Asp24Arg2634Lys23-GLP- 1(7-36); Val8Asp22Arg26 4Lys23-GLP-
1 (7-36); Val8Asp24Arg26 4Lys23-GLP- 1 (7-36)amide; Val8Asp22Arg26 4Lys23-GLP- 1 (7-36)amide; Val8Asp24Arg26 4Lys23GLP-l(7-37);Val8Asp24Arg26 4Lys23GLP-l(7-38);
Val8Asp22Arg26 4Lys23GLP-l(7-38);
Arg26 4Lys27-GLP- 1 (7-36); Arg26 4Lys27-GLP- 1 (7-36)amide; Arg26 4Lys27GLP- 1 (7-37); Arg26 4Lys27GLP-l(7-38); Val8Asp28Arg6'34Lys27-GLP-l(7-36); Val8Asp26Arg26 4Lys27-GLP-
1 (7-36); Val8Asp28Arg26 4Lys27-GLP- 1 (7-36)amide; Val8Asp26Arg26 4Lys27-GLP- 1 (7-36)amide;
Val8Asp28Arg26 4Lys27GLP- 1 (7-37); Val8Asp28Arg26 4Lys27GLP- 1 (7-38);
Val8Asp26Arg26 4Lys27GLP-l(7-38);
Arg2634Lys18-GLP-l(7-36);Arg26 4Lys18-GLP-l(7-36)amide;Arg26 4Lys18GLP-l(7-37); Arg26 4Lys18GLP-l(7-38); Ser8Asp19Arg26'34Lys18-GLP-l(7-36); Ser8Asp17Arg26'34Lys18-GLP-
1(7-36); Ser8Asp19Arg6 4Lys18-GLP-l(7-36)amide; Ser8 Asp17Arg2634Lys18-GLP-l(7-36)amide;
Ser8Asp19Arg26'34Lys18GLP-l(7-37);Ser8Asp19Arg26 4Lys18GLP-l(7-38);
Ser8Asp17Arg26 4Lys18GLP-l(7-38);
Arg26 4Lys23-GLP- 1 (7-36); Arg26 4Lys23-GLP- 1 (7-36)amide; Arg26 4Lys23GLP- 1 (7-37); Arg26 4Lys23GLP-l(7-38); Ser8Asp24Arg26 4Lys23-GLP- 1(7-36); Ser8Asp22Arg26'34Lys23-GLP-
1 (7-36); Ser8Asp24Arg26 4Lys23-GLP- 1 (7-36)amide; Ser8Asp22Arg26 4Lys23-GLP- 1 (7-36)amide ;
Ser8Asp24Arg26 4Lys23GLP- 1 (7-37); Ser8Asp24Arg26 4Lys23GLP- 1 (7-38);
Ser8Asp22Arg26 4Lys23GLP-l(7-38);
Arg26 4Lys27-GLP- 1 (7-36); Arg26 4Lys27-GLP- 1 (7-36)amide; Arg26 4Lys27GLP- 1 (7-37); Arg26 4Lys27GLP-l(7-38); Ser8Asp28Arg26 4Lys27-GLP-l(7-36); Ser8Asp26Arg26'34Lys27-GLP-
1 (7-36); Ser8Asp28Arg26 4Lys27-GLP- 1 (7-36)amide; Ser8Asp26Arg26'34Lys27-GLP- 1 (7-36)amide ;
Ser8Asp28Arg26 4Lys27GLP-l(7-37);Ser8Asp28Arg26 4Lys27GLP-l(7-38);
Ser8Asp26Arg26 4Lys27GLP- 1 (7-38);
Arg26 4Lys18-GLP-l(7-36);Arg26 4Lys18-GLP-l(7-36)amide;Arg26 4Lys18GLP-l(7-37); Arg2634Lys18GLP- 1(7-38); Thr8Asp19Arg26 4Lys18-GLP- 1(7-36); Thr8Asp17Arg26'34Lys18-GLP-
1 (7-36); Thr8 Asp19Aι^6 Lysi 8-GLP- 1 (7-36)amide; Thr8 Asp ' 7Arg26 4Lys18-GLP- 1 (7-36)amide; Thr8Asp19Arg26'34LysI8GLP-l(7-37);Thr8Asp,9Arg26 4Lys18GLP-l(7-38);
Thr8Asp17Arg26 4Lys18GLP-l(7-38);
Arg6 4Lys23-GLP-l (7-36); Arg2634Lys23-GLP- 1 (7-36)amide; Arg26 4Lys23GLP- 1 (7-37);
Arg26 4Lys23GLP- 1 (7-38); Thr8Asp24Arg2634Lys23-GLP- 1 (7-36); Thr8Asp22Arg26'34Lys23-GLP- 1 (7-36); Thr8Asp24Arg26 4Lys23-GLP- 1 (7-36)amide; Thr8Asp22Arg2634Lys23-GLP- 1 (7-36)amide;
Thr8Asp24Arg26'34Lys23GLP-l(7-37);Thr8Asp24Arg26 4Lys23GLP-l(7-38);
Thr8Asp22Arg26 4Lys23GLP-l(7-38);
Arg26 4Lys27-GLP- 1 (7-36); Arg26 4Lys27-GLP- 1 (7-36)amide; Arg2634Lys27GLP- 1 (7-37);
Arg26 4Lys27GLP-l(7-38);Thr8Asp28Arg26 4Lys27-GLP-l(7-36);Thr8Asp26Arg2634Lys27-GLP- 1(7-36); Thr8Asp28Arg26 4Lys27-GLP-l(7-36)amide; Thr8Asp26Arg26 4Lys27- GLP-1 (7-36)amide;
Thr8 Asp28Arg26 4Lys27GLP- 1 (7-37) ; Thr8 Asp28Arg26 4Lys27GLP- 1 (7-38);
Thr8Asp26Arg2634Lys27GLP-l(7-38).
In a further embodiment of the GLP-1 derivative, the parent peptide is:
Arg26Lys36-GLP- 1(7-36); Arg34Lys36-GLP-l(7-36); Arg26Lys36-GLP- 1(7-37); Arg34Lys36-GLP- 1(7-37); Arg26Lys37-GLP-l(7-37); Arg34Lys37-GLP-l(7-37); Arg26Lys39-GLP- 1(7-39);
Arg34Lys39-GLP-l(7-39);Arg6 4Lys36 9-GLP-l(7-39);
Arg26Lys18-GLP-l(7-36); Arg34Lys18-GLP-l(7-36); Arg26Lys18GLP- 1(7-37); Arg34LysGLP-
1(7-37); Arg26Lys18GLP-l(7-38); Arg34Lys18GLP-l(7-38); Arg26Lys18GLP- 1(7-39);
Arg34Lys18GLP-l(7-39); Arg26Lys23-GLP-l(7-36); Arg34Lys23-GLP-l(7-36); Arg26Lys23GLP- 1(7-37); Arg34Lys23GLP-
1(7-37); Arg26Lys23GLP-l(7-38); Arg34Lys23GLP- 1(7-38); Arg26Lys23GLP-l(7-39);
Arg34Lys23GLP-l(7-39);
Arg26Lys27-GLP- 1(7-36); Arg34Lys27-GLP-l(7-36); Arg26Lys27GLP- 1(7-37); Arg34Lys27GLP-
1(7-37); Arg26Lys27GLP-l(7-38); Arg34Lys27GLP-l(7-38); Arg26Lys27GLP- 1(7-39); Arg34Lys27GLP-l(7-39);
Arg2634Lys18 6-GLP-l(7-36);Arg26 4Lys18GLP-l(7-37);Arg26 4Lys18 7GLP-l(7-37);
Arg26 4Lys18 8GLP-l(7-38); Arg26 4Lys18 9GLP-l(7-39); Arg26 4Lys2336-GLP- 1(7-36);
Arg2634Lys23GLP- 1(7-37); Arg26 4Lys23'37GLP-l(7-37); Arg2634Lys23 8GLP-l (7-38);
Arg26 4Lys23 9GLP-l(7-39);Arg26 4Lys27 6-GLP-l(7-36);Arg2634Lys27GLP-l(7-37); Arg26 4Lys27 7GLP-l(7-37); Arg26 4Lys27'38GLP-l(7-38); Arg2634Lys2739GLP- 1(7-39);
Gly8GLP- 1(7-36); Gly 8GLP- 1(7-37); Gly8GLP-l(7-38); Gly8GLP- 1(7-39) Gly8Arg26Lys36-GLP- 1 (7-36); Gly8Arg34Lys36-GLP- 1 (7-36); Gly8Arg26Lys36-GLP- 1 (7-37); Gly8Arg34Lys36-GLP- 1 (7-37); Gly8Arg26Lys37-GLP- 1 (7-37); Gly8Arg34Lys37-GLP- 1 (7-37); Gly8Arg26Lys39-GLP-l(7-39); Gly8Arg34Lys39-GLP-l(7-39); Gly8Arg26 4Lys36 9-GLP-l(7-39); Gly8Arg26LysI8-GLP-l(7-36); Gly8Arg34Lys,8-GLP-l(7-36); Gly8Arg26Lys18GLP-l(7-37); Gly8Arg34Lys18GLP-l(7-37); Gly8Arg26Lys,8GLP- 1(7-38); Gly8Arg34Lys18GLP- 1(7-38);
Gly8Arg26Lys18GLP-l(7-39); Gly8Arg34Lys18GLP-l(7-39);
Gly8Arg26Lys23-GLP-l (7-36); Gly8Arg34Lys23-GLP- 1 (7-36); Gly8 Arg26Lys23GLP- 1(7-37);
Gly8Arg34Lys23GLP- 1 (7-37); Gly8Arg26Lys23GLP- 1 (7-38); Gly8Arg34Lys23GLP- 1 (7-38);
Gly8Arg26Lys23GLP-l(7-39); Gly8Arg34Lys23GLP-l(7-39); Gly8 Arg26Lys27-GLP-l (7-36); Gly8Arg34Lys27-GLP- 1(7-36); Gly8Arg26Lys27GLP- 1(7-37);
Gly8Arg34Lys27GLP-l(7-37); Gly8Arg26Lys27GLP-l(7-38); Gly8Arg34Lys27GLP-l(7-38);
Gly8Arg26Lys27GLP-l(7-39); Gly8Arg34Lys27GLP-l(7-39);
Gly8Arg26 4Lys1836-GLP-l(7-36); Gly8Arg2634Lys18GLP-l(7-37); Gly8Arg26'34Lys18'37GLP-l(7-
37); Gly8Arg26'34Lys18 8GLP-l(7-38); Gly8Arg2634Lys18'39GLP-l(7-39); Gly8Arg26 4Lys23'36- GLP-l(7-36); Gly8Arg26 4Lys23GLP- 1(7-37); Gly8Arg26'34Lys23 7GLP-l(7-37);
Gly8Arg26 4Lys23 8GLP- 1 (7-38); Gly8 rg26'34Lys23 9GLP- 1 (7-39); GIy8Arg26 4Lys27'36-GLP-
1 (7-36); Gly8Arg26 4Lys27GLP- 1 (7-37); Gly8Arg26'34Lys2737GLP- 1 (7-37);
Gly8Arg26 4Lys27,38GLP-l(7-38); Gly8Arg26 4Lys27 9GLP-l(7-39);
Val8GLP-l(7-36); Val8GLP-l(7-37); Val8GLP-l(7-38); Val8GLP-l(7-39) Val8Arg26Lys36-GLP- 1(7-36); Val8Arg34Lys36-GLP- 1(7-36); Val8Arg26Lys36-GLP- 1(7-37);
Val8Arg34Lys36-GLP- 1 (7-37); Val8Arg26Lys37-GLP- 1 (7-37); Val8Arg34Lys37-GLP- 1 (7-37);
Val8Arg26Lys39-GLP-l (7-39); Val8Arg34Lys39-GLP- 1 (7-39); Val8Arg26 4Lys36 9-GLP-l(7-39) ;
Val8Arg26Lys18-GLP-l (7-36); Val8Arg34Lys18-GLP- 1 (7-36); Val8Arg26Lys18GLP- 1(7-37);
Val8Arg34Lys18GLP-l(7-37); Val8Arg26Lys18GLP-l(7-38); Val8Arg34Lys18GLP-l (7-38); Val8Arg26Lys18GLP-l(7-39); Val8Arg34Lys18GLP- 1(7-39);
Val8Arg26Lys23-GLP- 1 (7-36); Val8Arg34Lys23-GLP- 1 (7-36); Val8Arg26Lys23GLP- 1 (7-37);
Val8Arg34Lys23GLP-l(7-37); Val8Arg26Lys23GLP-l(7-38); Val8Arg34Lys23GLP- l(7-38);
Val8Arg26Lys23GLP-l(7-39); Val8Arg34Lys23GLP-l(7-39);
Val8Arg26Lys27-GLP- 1 (7-36); Val8Arg34Lys27-GLP- 1 (7-36); Val8Arg26Lys27GLP- 1 (7-37); Val8Arg34Lys27GLP- 1(7-37); Val8Arg26Lys27GLP-l(7-38); Val8Arg34Lys27GLP- 1 (7-38);
Val8Arg26Lys27GLP-l(7-39); Val8Arg34Lys27GLP-l(7-39); Val8Arg26 4Lys18 6-GLP-l(7-36); Val8Arg26 4Lys18GLP-l(7-37); Val8Arg26 4Lys18 7GLP-l(7- 37); Val8Arg26 4Lys18 8GLP-l(7-38); Val8Arg2634Lys18 9GLP-l(7-39); Val8Arg26 4Lys2336- GLP-l(7-36); Nal8Arg26 4Lys23GLP-l(7-37); Val8Arg26 4Lys23 7GLP-l(7-37); Val8Arg26 4Lys23 8GLP- 1 (7-38); Val8Arg26'34Lys23 9GLP- 1 (7-39); Val8Arg26'34Lys27'36-GLP- 1(7-36); Val8Arg26'34Lys27GLP-l(7-37); Val8Arg26 4Lys27 7GLP- 1(7-37); Val8Arg26 4Lys27 8GLP- 1 (7-38); Val8Arg26'34Lys27 9GLP- 1 (7-39).
GLP-1 analogues and derivatives which can be used according to the present invention includes those referred to in WO 99/43705 (Νovo Nordisk A/S), WO 99/43706 (Novo Nordisk A/S), WO 99/43707 (Novo Nordisk A/S), WO 98/08871 (Novo Nordisk A/S), WO 99/43708 (Novo Nordisk A/S), WO 99/43341 (Novo Nordisk A/S), WO 87/06941 (The General Hospital Corporation), WO 90/11296 (The General Hospital Corporation), WO 91/11457 (Buckley et al.), WO 98/43658 (Eli Lilly & Co.), EP 0708179-A2 (Eli Lilly & Co.), EP 0699686-A2 (Eli Lilly & Co.) which are included herein by reference.
However, protracted acting GLP-1 derivatives, in particular those described in WO 98/08871 are more preferred. The most preferred GLP-1 derivatives are those in which the parent peptide has the formula GLP-1 (7-C), wherein C is 36, 37, 38, 39, 40, 41 , 42, 43, 44 and 45, wherein optionally a total of up to fifteen, preferably up to ten amino acid residues have been exchanged with any α-amino acid residue which can be coded for by the genetic code, said parent peptide comprising one or two lipophilic substituents having 4 to 40 carbon atoms, preferably from 8 to 25 carbon atoms, optionally via a spacer (such as γ-Glu or β-Ala). The substituents are preferably selected from acyl groups of straight-chained or branched fatty acids.
GLP-1 analogues and derivatives that include an N-terminal imidazole group and optionally an unbranched C6-Cιo acyl group attached to the lysine residue in position 34 are also embodiments of the invention. In a still further embodiment of the invention the GLP-1 agonist is selected from ex- endin as well as analogs, derivatives, and fragments thereof, e.g. exendin-3 and -4.
Examples of exendin as well as analogs, derivatives, and fragments thereof to be included within the present invention are those disclosed in WO 9746584 and US 5424286. US 5424286 describes a method for stimulating insulin release with exendin polypeptide(s). The ex- endin polypeptides disclosed include HGEGTFTSDLSKQMEEEAVRLFIE LKNGGX; wherein X = P or Y, and HX1X2GTFITSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS; wherein X1X2 = SD (exendin-3) or GE (exendin-4)). The exendin-3 and -4 and fragments are useful in treatment of diabetes mellitus (types I or II) and prevention of hyperglycaemia. They normalise hyperglycaemia through glucose-dependent, insulin-independent and insulin- dependent mechanisms. Exendin-4 is specific for exendin receptors, i.e. it does not interact with vasoactive intestinal peptide receptors. WO 9746584 describes truncated versions of exendin peptide(s) for treating diabetes. The disclosed peptides increase secretion and biosynthesis of insulin, but reduce those of glucagon. The truncated peptides can be made more economically than full length versions.
In a still further embodiment of the invention the GLP-1 agonist is a non-peptide. In a further embodiment the GLP-1 agonist is a molecule, preferably a non-peptide, which binds to a GLP-1 receptor with an affinity constant, KTJ, below 1 μM, preferably below
100 nM.
Any possible combination of two or more of the embodiments described herein, is comprised within the scope of the present invention.
The term "GLP-1" means GLP-l(7-37) or GLP-1 (7-36) amide. The term "treatment" is defined as the management and care of a patient for the purpose of combating the disease, condition, or disorder and includes the administration of a GLP-1 agonist to prevent the onset of the symptoms or complications, or alleviating the symptoms or complications, or eliminating the disease, condition, or disorder. Treatment includes modulate, inhibit, decrease, reduce or arrest beta cell degeneration, such as necrosis or apoptosis of beta cells, in particular the programmed β-cell death known as apoptosis of β- cells as well as prevention of beta cell degeneration, such as necrosis or apoptosis of beta cells, in particular prevention of apoptosis of β-cells
The term "beta cell degeneration" is intended to mean loss of beta cell function, beta cell dysfunction, and death of beta cells, such as necrosis or apoptosis of beta cells. In the present context "a GLP-1 agonist" is intended to indicate a molecule, preferably
GLP-1 or an analogue or a derivative thereof, or exendin or an analogue or a derivative thereof, or a non-peptide, which binds to a GLP-1 receptor with an affinity constant, K-Q, below 1 μM, preferably below 100 nM. Methods for identifying GLP-1 agonists are described in WO 93/19175 (Novo Nordisk A/S). In the present context "a GLP-1 agonist" is also intended to comprise active metabolites and prodrugs thereof, such as active metabolites and prodrugs of GLP- 1 or an analogue or a derivative thereof, or exendin or an analogue or a derivative thereof, or a non-peptide. A "metabolite" is an active derivative of a GLP-1 agonist produced when the GLP-1 agonist is metabolized. A "prodrug" is a compound which is either metabolized to a GLP-1 agonist or is metabolized to the same metabolite(s) as a GLP- 1 agonist.
In the present text, the designation "an analogue" is used to designate a peptide wherein one or more amino acid residues of the parent peptide have been substituted by another amino acid residue and/or wherein one or more amino acid residues of the parent peptide have been deleted and/or wherein one or more amino acid residues have been added to trie parent peptide. Such addition can take place either in the peptide, at the N-terminal end or at the C-terminal end of the parent peptide, or any combination thereof. The term "derivative" is used in the present text to designate a peptide in which one or more of the amino acid residues of the parent peptide have been chemically modified, e.g. by alkylation, acylation, ester formation or amide formation.
The term "a GLP-1 derivative" is used in the present text to designate a derivative of GLP-1 or an analogue thereof. In the present text, the parent peptide from which such a deriva- tive is formally derived is in some places referred to as the "GLP-1 moiety" of the derivative. For a description of suitable dosage forms, dosage ranges, pharmaceutical formulations etc. reference is made to WO 98/08871 (Novo Nordisk A/S).
The route of administration may be any route, which effectively transports the active compound to the appropriate or desired site of action, such as oral, nasal, pulmonary, trans- dermal or parenteral.
Pharmaceutical compositions (or medicaments) containing a GLP-1 agonist may be administered parenterally to patients in need of such a treatment. Parenteral administration may be performed by subcutaneous, intramuscular or intravenous injection by means of a syringe, optionally a pen-like syringe. Alternatively, parenteral administration can be performed by means of an infusion pump. A further option is a composition which may be a powder or a liquid for the administration of the GLP-1 agonist in the form of a nasal or pulmonal spray. As a still further option, the GLP-1 agonist can also be administered transdermally, e.g. from a patch, optionally a iontophoretic patch, or transmucosally, e.g. bucally. As a still further option, the GLP-1 agonist (in particular GLP-1 or an analogue thereof) can also be administered by gene therapy, such as by implanting a cell line transformed with a vector such that it secretes the GLP- 1 agonist. The implanted cells may be encapsulated in semi permeable membranes, e.g. macro- or microen- capsulated. The above mentioned possible ways to administer a GLP-1 agonist are not considered as limiting the scope of the invention.
Pharmaceutical compositions containing a GLP-1 agonist may be prepared by conventional techniques, e.g. as described in Remington's Pharmaceutical Sciences, 1985 or in Remington: The Science and Practice of Pharmacy, 19th edition, 1995.
Thus, the injectable compositions of the GLP-1 agonist can be prepared using the conventional techniques of the pharmaceutical industry which involves dissolving and mixing the ingredients as appropriate to give the desired end product.
According to one procedure, the GLP-1 agonist is dissolved in an amount of water which is somewhat less than the final volume of the composition to be prepared. An isotonic agent, a preservative and a buffer is added as required and the pH value of the solution is adjusted - if necessary - using an acid, e.g. hydrochloric acid, or a base, e.g. aqueous sodium hydroxide as needed. Finally, the volume of the solution is adjusted with water to give the desired concentration of the ingredients. Examples of isotonic agents are sodium chloride, mannitol and glycerol.
Examples of preservatives are phenol, m-cresol, methyl p-hydroxybenzoate and benzyl alcohol.
Examples of suitable buffers are sodium acetate and sodium phosphate. Further to the above-mentioned components, solutions containing a GLP-1 agonist may also contain a surfactant in order to improve the solubility and/or the stability of the GLP-1 agonist.
A composition for nasal administration of certain peptides may, for example, be prepared as described in European Patent No. 272097 (to Novo Nordisk A/S) or in WO 93/18785. According to one embodiment of the present invention, the GLP-1 agonist is provided in the form of a composition suitable for administration by injection. Such a composition can either be an injectable solution ready for use or it can be an amount of a solid composition, e.g. a lyophilised product, which has to be dissolved in a solvent before it can be injected. The injectable solution preferably contains not less than about 2 mg/ml, preferably not less than about 5 mg/ml, more preferred not less than about 10 mg/ml of the GLP-1 agonist and, preferably, not more than about 100 mg/ml of the GLP-1 agonist. The GLP-1 agonist can be used in the treatment of various diseases. The particular GLP-1 agonist to be used and the optimal dose level for any patient will depend on the disease to be treated and on a variety of factors including the efficacy of the specific peptide derivative employed, the age, body weight, physical activity, and diet of the patient, on a possible combination with other drugs, and on the severity of the case. It is recommended that the dosage of the GLP-1 agonist be determined for each individual patient by those skilled in the art.
Experimental
Example 1
The male Zucker Diabetic Fatty fa/fa (ZDF) rat is a model of Type 2 diabetes. The rats are insulin resistant but normoglycemic from birth and they develop diabetes from about week 7 to week 10 of age. During the transitional period, the animals go through a state of impaired glucose tolerance. Although the animals are hyperinsulinemic before diabetes onset and during the early stages of diabetes, they later lose glucose-stimulated insulin secretion and finally become almost completely insulinopenic.
We have studied the effects of Arg34, Lys26(N-ε-(γ-Glu(N-α-hexadecanoyl)))-GLP-l(7-37) therapy during a period of time when the animals would normally progress from having impaired glucose tolerance to having overt Type 2 diabetes. Three groups of male ZDF rats (Genetic Models Inc, Indianapolis, Indiana, USA) were studied and dosed subcutaneously bi- daily with either vehicle (group A), 30 (group B) or 150 μg/kg (group C) of Arg34, Lys26(N-ε- (γ-Glu(N-α-hexadecanoyl)))-GLP-l(7-37), n=6 per group. Animals were between 7 and 8 weeks old when dosing was initiated, and fed glucose levels were not different between the groups before dosing began. However, they were elevated compared to a group of non- diabetic Sprague-Dawley rats who had fed glucose levels significantly below the ZDF ani- mals (6.4±0.6 vs 5.8±0.8, mean±SD, p<0.02). This demonstrates the relative impaired glucose tolerant state of the ZDF animals when the study began.
Bromodeoxyuridine (BrDU) is incorporated in newly synthesized DNA and thus will label replicating cells. Six hours before sacrifice the rats were given an injection of 100 mg BrDU/kg intraperitoneally. After sacrifice the pancreata were fixed in 4% PFA, dehydrated, embedded in paraffin, and 3-4 mm sections double stained for BrDU and insulin for the measurement of beta-cell proliferation rate.
Insulin was stained with guinea pig anti-insulin, peroxidase-coupled rabbit anti-guinea pig Ig, and developed with AEC to give a red stain. BrDU was stained by monoclonal mouse anti- BrDU, biotinylated goat anti-mouse Ig, avidin peroxidase, and developed with DAB and CuS04 to give a dark brown stain. BrDU stained nuclei of cells with insulin stained cytoplasm was examined in more than 1500 cells per section. The examination of the sections were carried out with the origin of the sections blinded to the observer.
The rats treated with Arg34, Lys26(N-ε-(γ-Glu(N-α-hexadecanoyl)))-GLP-l(7-37) showed a dose dependent increase in the fraction of beta-cells that had incorporated BrDU as a result of stimulated cell proliferation (fig. 1).
Neighbor sections were stained for insulin and the combination of glucagon-somatostatin- pancreatic polypeptide for the measurement of the relative mass of islet beta-cells and non- beta-cells. The beta-cells were stained for insulin as described above. The nonbeta-cells were stained with a mixture of monoclonal mouse anti-glucagon + rabbit anti-somatostatin + rabbit anti-pancreatic polypeptide, detected by biotinylated swine anti-multible Ig' s, avidin peroxi- dase, and developed with DAB and CuS0 to give a dark brown stain. The volume fractions of beta- and nonbeta-cells were estimated by point counting stereologic techniques.
The beta-cell fraction of the total pancreas was significantly higher in the rats given Arg34, Lys26(N-ε-(γ-Glu(N-α-hexadecanoyl)))-GLP-l(7-37) at 30 ng/g for 6 weeks compared to vehicle treated rats, while there was no further increase in rats given doses of 150 ng/g (fig. 2). We have shown that volume of beta-cells after treatment with Arg34, Lys26(N-ε-(γ-Glu(N-α- hexadecanoyl)))-GLP- 1(7-37) increase at a dose (30 ng/g) where proliferation was not seen. This difference strongly indicates that an inhibition of apoptosis facilitated by the administered GLP-1 compound has taken place.
Furthermore, specific inhibition of beta-cell apoptosis by GLP-1 or GLP-1 analogs, that is GLP-1 agonists, can be shown in vitro by measuring inhibition of free fatty acid (FFA), glu- cose, sulfonylurea, or cytokine induced apoptosis in beta cells.
In vitro assays for characterizing the effect of GLP-1 or analogs thereof on the prevention of beta-cell apoptosis induced by FFA: Briefly, pancreatic islet, e.g. rat, mouse and human, isolated and cultured as described in, e.g. Diabetologia 19, 439, 1980; Transplantation, 68, 597, 1999; J. Mol. Med., 77, 93, 1999, Diabetes 48, 1230, 1999, J. Bio. Chem. 274, 18686, 1999; Proc. Natl. Acad. Sci. 95, 2498, 1999; . J. Bio. Chem, 273, 33501, 1998; Diabetologia 42, 55, 1999, with or without 0.1 -10 mM long-chain FF As (2:1 oleate/palmitate; Sigma) and with GLP-1 or GLP-1 analogs. Characterization of apoptotic beta cells can be analyzed as described below.
In vitro assays for characterizing the effect of GLP-1 or analogs thereof on the prevention of beta-cell apoptosis induced by glucose or sulfonylureas: Briefly, islets can be isolated and cultured as described in J. Bio. Chem, 273, 33501, 1998, and incubated in O-30 mM glucose as described in. J. Bio. Chem, 273, 33501, 1998, in order to induce apoptosis. In order to prevent the glucose induced apoptosis the islets can be co-incubated with GLP-1 or GLP-1 analogs. Alternatively apoptosis can be induced with 100-500 microM tolbutamide as described in J. Bio. Chem, 273, 33501, 1998. In order to prevent the tolbutamide induced apop- tosis the islets can be co-incubated with GLP-1 or GLP-1 analogs. Characterization of apoptotic beta cells can be analyzed as described below and as in . J. Bio. Chem, 273, 33501, 1998. In vitro assays for characterizing the effect of GLP-1 or analogs thereof on the prevention of beta-cell apoptosis induced by cytokines: Briefly, human and rat islets can be isolated and cultured as described in, e.g. Diabetologia 42, 55, 1999. Cytokine induced apoptosis of rat and human beta cells can be done as describe in Diabetologia 42, 55, 1999. In order to prevent the cytokine induced apoptosis -the islets can be co-incubated with GLP-1 or GLP-1 analogs. Characterization of apoptotic beta cells can be analyzed as described below and as described in Diabetologia 42, 55, 1999.
Apoptosis and inhibition thereof can be detected in the following way: The free 3' OH strand breaks resulting from DNA degradation which is associated with apoptosis can be detected with the terminal deoxynucleotidyl transferase-mediated dUTP-X3' nick end-labeling (TUNEL) technique (J Cell Biol 199: 493, 1992) or using the following kits e.g. In Situ Cell Death Detection kit; Boehringer Mannheim, Mannheim or ApoTag, Oncor, Gaithersburg, MD). Preparation of pancreatic sections or islet cultures for apoptosis staining using the TUNEL technique is described in (Diabetologia 42: 566, 1999 and Diabetes 48: 738, 1999).
Apoptosis can also be detected by electrophoresis of the soluble DNA fraction isolated from cultured islets by quantifying the ladder-like appearance as described in (PNAS 95: 2498, 1998).
Finally apoptosis can be detected by double staining of cultured beta cells/islets with the DNA binding dyes Hoechst 33342 and propidium iodide as described in (Diabetologia 42 : 55, 1999). Example 2
Neonatal rats were sacrificed and pancreata were aseptically isolated. Islets of Langerhans were isolated by standard techniques. Intact islets were cultured in 6-well tissue culture plates at 750 islets/well (Nunc, Roskilde, Denmark) with or without 40 U/ml recombinant rat inter- leukin 1, 100 U/ml interferon-γ, and 100 U/ml tumor necrosis factor-α (all from Peprotech, London, UK) and the indicated doses of the GLP-1 derivative, Arg34, Lys26(N-ε-(γ-Glu(N-α- hexadecanoyl)))-GLP- 1(7-37). After 24 hours of in vitro culture, single cell suspensions were obtained from the islets by gentle triturating in trypsin. After 2 rounds of washing, islet cells were reacted with annexin V-FITC and propedium iodide (PI) using a commercial staining kit according to the manufactures recommendations (Pharmingen, San Diego, CA, USA). At the end of incubation the samples were analyzed by flow cytometry using a FACScalibur (Becton Dickinson, Mountain View, CA, USA). Dead cells were excluded by gating on Pi-negative cells, 25000 viable cells were acquired per sample. Data were analyzed using the CellQuest software (Becton Dickinson).
Figure 3 shows that 24 hours incubation with the cytokine mix induced a substantial apoptosis in the neonatal rat islets cells. When islet cells were cultures in the presence of 100 nM of Arg34, Lys26(N-ε-(γ-Glu(N-α-hexadecanoyl)))-GLP-l(7-37), an approximately 50 % reduc- tion in the cytokine-induced apoptosis was observed. The figure also shows that Arg34,
Lys26(N-ε-(γ-Glu(N-α-hexadecanoyl)))-GLP- 1(7-37) itself had no effect on the level of islet cell apoptosis. These data demonstrate that Arg34, Lys26(N-ε-(γ-Glu(N-α-hexadecanoyl)))- GLP-l(7-37), is able to block cytokine-induced apoptosis in islet cells ex vivo.

Claims

Claims
1. Use of a GLP- 1 agonist for the preparation of a medicament for treatment of beta cell degeneration.
2. The use according to claim 1 wherein the beta cell degeneration is apoptosis of β-cells.
3. The use according to claim 1 or 2 wherein the GLP-1 agonist is selected from a GLP-1 analogue, a GLP-1 derivative wherein at least one amino acid residue of the parent peptide has a li- pophilic substituent attached, exendin or an analogue or derivative thereof, or a non-peptide, which binds to a GLP-1 receptor with an affinity constant, K-Q, below 1 μM.
4. The use according to claim 1, 2 or 3 wherein the GLP-1 derivative is Arg34, Lys26(N-ε-(γ- Glu(N-α-hexadecanoyl)))-GLP- 1 (7-37).
5. A method for treatment of beta cell degeneration in a subject comprising administering a GLP-1 agonist to said subject.
6. The method according to claim 5 wherein the beta cell degeneration is apoptosis of β-cells.
7. The method according to claim 5 or 6 wherein the GLP-1 agonist is selected from a GLP-1 analogue, a GLP-1 derivative wherein at least one amino acid residue of the parent peptide has a lipophilic substituent attached, exendin or an analogue or derivative thereof, or a non-peptide, which binds to a GLP-1 receptor with an affinity constant, K-Q, below 1 μM.
8. The method according to claim 5, 6 or 7 wherein the GLP-1 derivative is Arg34, Lys26(N-ε-(γ- Glu(N-α-hexadecanoyl)))-GLP- 1(7-37).
EP00974350A 1999-11-12 2000-11-10 Use of glp-1 agonists for the inhibition of beta cell degeneration Withdrawn EP1239871A1 (en)

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
DK162899 1999-11-12
DKPA199901628 1999-11-12
DKPA200000270 2000-02-22
DK200000270 2000-02-22
PCT/DK2000/000625 WO2001035988A1 (en) 1999-11-12 2000-11-10 Use of glp-1 agonists for the inhibition of beta cell degeneration

Publications (1)

Publication Number Publication Date
EP1239871A1 true EP1239871A1 (en) 2002-09-18

Family

ID=26065974

Family Applications (1)

Application Number Title Priority Date Filing Date
EP00974350A Withdrawn EP1239871A1 (en) 1999-11-12 2000-11-10 Use of glp-1 agonists for the inhibition of beta cell degeneration

Country Status (4)

Country Link
EP (1) EP1239871A1 (en)
JP (1) JP2003516322A (en)
AU (1) AU1269501A (en)
WO (1) WO2001035988A1 (en)

Families Citing this family (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7048906B2 (en) 1995-05-17 2006-05-23 Cedars-Sinai Medical Center Methods of diagnosing and treating small intestinal bacterial overgrowth (SIBO) and SIBO-related conditions
PL205713B1 (en) 1998-12-07 2010-05-31 Sod Conseils Rech Applic Glp-1 analogues
WO2000034331A2 (en) 1998-12-07 2000-06-15 Societe De Conseils De Recherches Et D'applications Scientifiques Sas Analogues of glp-1
DE60114996T2 (en) * 2000-03-08 2006-08-10 Novo Nordisk A/S LOWERING OF THE SERUM CHOLESTEROL
PL205971B1 (en) 2001-09-24 2010-06-30 Imp Innovations Ltd Modification of feeding behavior
WO2003059372A2 (en) * 2001-12-29 2003-07-24 Novo Nordisk A/S Combined use of a glp-1 compound and a modulator of diabetic late complications
AU2003201998C1 (en) 2002-01-10 2012-10-25 Imperial Innovations Limited Modification of feeding behavior
JP2005535569A (en) * 2002-04-04 2005-11-24 ノボ・ノルデイスク・エー/エス GLP-1 agonists and cardiovascular complications
AU2003232172A1 (en) 2002-06-14 2003-12-31 Novo Nordisk A/S Combined use of a modulator of cd3 and a glp-1 compound
GB0300571D0 (en) 2003-01-10 2003-02-12 Imp College Innovations Ltd Modification of feeding behaviour
WO2004074315A2 (en) * 2003-02-19 2004-09-02 Societe De Conseils De Recherches Et D'applications Scientifiques (S.C.R.A.S.) Analogues of glp-1
US20060228331A1 (en) 2003-10-10 2006-10-12 Novo Nordisk A/S IL-21 Derivatives and variants
EP1711523B1 (en) 2003-12-16 2012-10-10 Ipsen Pharma Analogues of glp-1
US20080125403A1 (en) 2004-04-02 2008-05-29 Merck & Co., Inc. Method of Treating Men with Metabolic and Anthropometric Disorders
TWI428346B (en) 2006-12-13 2014-03-01 Imp Innovations Ltd Novel compounds and their effects on feeding behaviour
US9050347B2 (en) 2011-01-25 2015-06-09 Viviabiotech, S.L. 1,2,4-oxadiazole derivatives as drugs modulating the GLP-1 peptide receptor
WO2014202727A1 (en) 2013-06-20 2014-12-24 Novo Nordisk A/S Glp-1 derivatives and uses thereof
BR112015032875A2 (en) * 2013-07-04 2017-11-07 Novo Nordisk As derived from glp-1 peptides, and uses thereof
ES2741507T3 (en) 2014-04-07 2020-02-11 Novo Nordisk As Double-acylated glp-1 compounds
EP3226906B1 (en) 2014-11-27 2019-06-12 Novo Nordisk A/S Glp-1 derivatives and uses thereof
JP6691125B2 (en) 2014-12-17 2020-04-28 ノヴォ ノルディスク アー/エス GLP-1 derivative and use thereof

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5614492A (en) * 1986-05-05 1997-03-25 The General Hospital Corporation Insulinotropic hormone GLP-1 (7-36) and uses thereof
WO1997029180A1 (en) * 1996-02-06 1997-08-14 Eli Lilly And Company Diabetes therapy
JP3149958B2 (en) * 1996-08-30 2001-03-26 ノボ ノルディスク アクティーゼルスカブ GLP-1 derivative
AU5027299A (en) * 1998-07-31 2000-02-28 Novo Nordisk A/S Use of glp-1 and analogues for preventing type ii diabetes
DE19921537A1 (en) * 1999-05-11 2000-11-23 Dieter Hoersch Treating carbohydrate metabolism disorders, especially diabetes, comprises activating insulin-secreting b-cells using glucagon-related peptide, glucose-dependent insulinotropic polypeptide, exendin-4 or related drugs

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO0135988A1 *

Also Published As

Publication number Publication date
WO2001035988A1 (en) 2001-05-25
AU1269501A (en) 2001-05-30
JP2003516322A (en) 2003-05-13

Similar Documents

Publication Publication Date Title
US6569832B1 (en) Inhibition of beta cell degeneration
EP1100530B1 (en) In-vitro stimulation of beta cell proliferation
WO2001035988A1 (en) Use of glp-1 agonists for the inhibition of beta cell degeneration
US7179788B2 (en) Biphasic mixtures of GLP-1 and insulin
JP5695097B2 (en) GLP-1, EXENDIN-4, peptide analogue thereof and use thereof
RU2440097C2 (en) Method of treating insulin-independent diabetes and obesity, osmotic delivery system and method for making it
WO2022111370A1 (en) Glp-1/glucagon receptor dual-agonist and application thereof
CN109745547A (en) GLP-1R/GCGR dual agonist polypeptide in the treatment of biliary cirrhosis
KR20100080519A (en) Compositions and methods of using proislet peptides and analogs thereof
US20090202494A1 (en) Combined use of glp-1 agonists and gastrin for regulating blood glucose levels
JP2008545712A (en) Peptides, derivatives and analogs thereof, and methods of using them
US20030045464A1 (en) Glucagon-like peptide-1 crystals
EP1263458B1 (en) Lowering serum cholesterol
JP2005506362A (en) Compositions and methods for the treatment of diabetes
US20230183310A1 (en) Polypeptide Compounds and Use Thereof in the Prevention or Treatment of Diabetes or Diabetic Complications
US7423019B2 (en) Agent for inducing conversion of intestinal cells into insulin-producing cells and antidiabetic drug
CN105492459A (en) Modified INGAP peptides for treating diabetes
US20080280815A1 (en) Lowering Serum Lipids
US20240277816A1 (en) Polypeptide conjugate and application thereof in preparation of drug for treating diseases related to glucose metabolism
AU2002330064A1 (en) Biphasic mixtures of GLP-1 and insulin

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20020612

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE TR

AX Request for extension of the european patent

Free format text: AL;LT;LV;MK;RO;SI

17Q First examination report despatched

Effective date: 20031014

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION HAS BEEN WITHDRAWN

18W Application withdrawn

Effective date: 20080912