DE4417593A1 - Vehicle speed control device - Google Patents

Vehicle speed control device

Info

Publication number
DE4417593A1
DE4417593A1 DE4417593A DE4417593A DE4417593A1 DE 4417593 A1 DE4417593 A1 DE 4417593A1 DE 4417593 A DE4417593 A DE 4417593A DE 4417593 A DE4417593 A DE 4417593A DE 4417593 A1 DE4417593 A1 DE 4417593A1
Authority
DE
Germany
Prior art keywords
vehicle
control
distance
speed
switch
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
DE4417593A
Other languages
English (en)
Inventor
Eiji Nishimura
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Mazda Motor Corp
Original Assignee
Mazda Motor Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP5117007A priority Critical patent/JPH06320985A/ja
Application filed by Mazda Motor Corp filed Critical Mazda Motor Corp
Publication of DE4417593A1 publication Critical patent/DE4417593A1/de
Withdrawn legal-status Critical Current

Links

Classifications

    • BPERFORMING OPERATIONS; TRANSPORTING
    • B60VEHICLES IN GENERAL
    • B60KARRANGEMENT OR MOUNTING OF PROPULSION UNITS OR OF TRANSMISSIONS IN VEHICLES; ARRANGEMENT OR MOUNTING OF PLURAL DIVERSE PRIME-MOVERS IN VEHICLES; AUXILIARY DRIVES FOR VEHICLES; INSTRUMENTATION OR DASHBOARDS FOR VEHICLES; ARRANGEMENTS IN CONNECTION WITH COOLING, AIR INTAKE, GAS EXHAUST OR FUEL SUPPLY OF PROPULSION UNITS IN VEHICLES
    • B60K31/00Vehicle fittings, acting on a single sub-unit only, for automatically controlling vehicle speed, i.e. preventing speed from exceeding an arbitrarily established velocity or maintaining speed at a particular velocity, as selected by the vehicle operator
    • B60K31/0008Vehicle fittings, acting on a single sub-unit only, for automatically controlling vehicle speed, i.e. preventing speed from exceeding an arbitrarily established velocity or maintaining speed at a particular velocity, as selected by the vehicle operator including means for detecting potential obstacles in vehicle path
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01SRADIO DIRECTION-FINDING; RADIO NAVIGATION; DETERMINING DISTANCE OR VELOCITY BY USE OF RADIO WAVES; LOCATING OR PRESENCE-DETECTING BY USE OF THE REFLECTION OR RERADIATION OF RADIO WAVES; ANALOGOUS ARRANGEMENTS USING OTHER WAVES
    • G01S13/00Systems using the reflection or reradiation of radio waves, e.g. radar systems; Analogous systems using reflection or reradiation of waves whose nature or wavelength is irrelevant or unspecified
    • G01S13/88Radar or analogous systems specially adapted for specific applications
    • G01S13/93Radar or analogous systems specially adapted for specific applications for anti-collision purposes
    • G01S13/931Radar or analogous systems specially adapted for specific applications for anti-collision purposes of land vehicles
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B60VEHICLES IN GENERAL
    • B60WCONJOINT CONTROL OF VEHICLE SUB-UNITS OF DIFFERENT TYPE OR DIFFERENT FUNCTION; CONTROL SYSTEMS SPECIALLY ADAPTED FOR HYBRID VEHICLES; ROAD VEHICLE DRIVE CONTROL SYSTEMS FOR PURPOSES NOT RELATED TO THE CONTROL OF A PARTICULAR SUB-UNIT
    • B60W2540/00Input parameters relating to occupants
    • B60W2540/18Steering angle
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01SRADIO DIRECTION-FINDING; RADIO NAVIGATION; DETERMINING DISTANCE OR VELOCITY BY USE OF RADIO WAVES; LOCATING OR PRESENCE-DETECTING BY USE OF THE REFLECTION OR RERADIATION OF RADIO WAVES; ANALOGOUS ARRANGEMENTS USING OTHER WAVES
    • G01S13/00Systems using the reflection or reradiation of radio waves, e.g. radar systems; Analogous systems using reflection or reradiation of waves whose nature or wavelength is irrelevant or unspecified
    • G01S13/88Radar or analogous systems specially adapted for specific applications
    • G01S13/93Radar or analogous systems specially adapted for specific applications for anti-collision purposes
    • G01S13/931Radar or analogous systems specially adapted for specific applications for anti-collision purposes of land vehicles
    • G01S2013/9319Controlling the accelerator
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01SRADIO DIRECTION-FINDING; RADIO NAVIGATION; DETERMINING DISTANCE OR VELOCITY BY USE OF RADIO WAVES; LOCATING OR PRESENCE-DETECTING BY USE OF THE REFLECTION OR RERADIATION OF RADIO WAVES; ANALOGOUS ARRANGEMENTS USING OTHER WAVES
    • G01S13/00Systems using the reflection or reradiation of radio waves, e.g. radar systems; Analogous systems using reflection or reradiation of waves whose nature or wavelength is irrelevant or unspecified
    • G01S13/88Radar or analogous systems specially adapted for specific applications
    • G01S13/93Radar or analogous systems specially adapted for specific applications for anti-collision purposes
    • G01S13/931Radar or analogous systems specially adapted for specific applications for anti-collision purposes of land vehicles
    • G01S2013/932Radar or analogous systems specially adapted for specific applications for anti-collision purposes of land vehicles using own vehicle data, e.g. ground speed, steering wheel direction
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01SRADIO DIRECTION-FINDING; RADIO NAVIGATION; DETERMINING DISTANCE OR VELOCITY BY USE OF RADIO WAVES; LOCATING OR PRESENCE-DETECTING BY USE OF THE REFLECTION OR RERADIATION OF RADIO WAVES; ANALOGOUS ARRANGEMENTS USING OTHER WAVES
    • G01S13/00Systems using the reflection or reradiation of radio waves, e.g. radar systems; Analogous systems using reflection or reradiation of waves whose nature or wavelength is irrelevant or unspecified
    • G01S13/88Radar or analogous systems specially adapted for specific applications
    • G01S13/93Radar or analogous systems specially adapted for specific applications for anti-collision purposes
    • G01S13/931Radar or analogous systems specially adapted for specific applications for anti-collision purposes of land vehicles
    • G01S2013/9321Velocity regulation, e.g. cruise control
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01SRADIO DIRECTION-FINDING; RADIO NAVIGATION; DETERMINING DISTANCE OR VELOCITY BY USE OF RADIO WAVES; LOCATING OR PRESENCE-DETECTING BY USE OF THE REFLECTION OR RERADIATION OF RADIO WAVES; ANALOGOUS ARRANGEMENTS USING OTHER WAVES
    • G01S13/00Systems using the reflection or reradiation of radio waves, e.g. radar systems; Analogous systems using reflection or reradiation of waves whose nature or wavelength is irrelevant or unspecified
    • G01S13/88Radar or analogous systems specially adapted for specific applications
    • G01S13/93Radar or analogous systems specially adapted for specific applications for anti-collision purposes
    • G01S13/931Radar or analogous systems specially adapted for specific applications for anti-collision purposes of land vehicles
    • G01S2013/9325Radar or analogous systems specially adapted for specific applications for anti-collision purposes of land vehicles for inter-vehicle distance regulation, e.g. navigating in platoons
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01SRADIO DIRECTION-FINDING; RADIO NAVIGATION; DETERMINING DISTANCE OR VELOCITY BY USE OF RADIO WAVES; LOCATING OR PRESENCE-DETECTING BY USE OF THE REFLECTION OR RERADIATION OF RADIO WAVES; ANALOGOUS ARRANGEMENTS USING OTHER WAVES
    • G01S13/00Systems using the reflection or reradiation of radio waves, e.g. radar systems; Analogous systems using reflection or reradiation of waves whose nature or wavelength is irrelevant or unspecified
    • G01S13/88Radar or analogous systems specially adapted for specific applications
    • G01S13/93Radar or analogous systems specially adapted for specific applications for anti-collision purposes
    • G01S13/931Radar or analogous systems specially adapted for specific applications for anti-collision purposes of land vehicles
    • G01S2013/9327Sensor installation details
    • G01S2013/93271Sensor installation details in the front of the vehicles

Description

Die vorliegende Erfindung betrifft eine Vorrichtung zur Ge­ schwindigkeitsregelung für Fahrzeuge, die eine F/B- (Rückführungs)-Regelung basierend auf einer Fahrzeug­ geschwindigkeit und eine F/B-Regelung basierend auf einem Fahrzeugabstand ausführen kann.The present invention relates to a device for Ge speed control for vehicles that have an F / B (Return) control based on a vehicle speed and F / B control based on one Can run vehicle distance.

Eine Funktion zur automatischen Geschwindigkeitsregelung enthält eine F/B-Regelung basierend auf einer Fahrzeug­ geschwindigkeit zum automatischen Beibehalten der Fahrzeug­ geschwindigkeit des eigenen Fahrzeugs, die eine durch einen Fahrer eingestellte Sollgeschwindigkeit des Fahrzeugs ist, und eine F/B-Regelung basierend auf einem Fahrzeugabstand zum Beibehalten des Fahrzeugabstands zu einem Fahrzeug davor bzw. voraus, damit er ein Abstand ist, der durch den Fahrer einge­ stellt ist. A function for automatic speed control contains F / B control based on a vehicle speed to automatically keep the vehicle speed of one's own vehicle, one by one Driver set target speed of the vehicle is, and F / B control based on a vehicle distance to Maintaining the vehicle distance from a vehicle in front or ahead so that it is a distance set by the driver represents is.  

Es sind viele Fahrzeuge mit derartigen Funktionen zur automa­ tischen Geschwindigkeitsregelung vorgeschlagen worden.There are many vehicles with such functions for automa table speed control has been proposed.

Beispielsweise offenbart das japanische offengelegte Patent mit der Nr. 63-269736 eine Vorrichtung zur automatischen Geschwindigkeitsregelung für Fahrzeuge mit sowohl der F/B-Re­ gelfunktion basierend auf der Fahrzeuggeschwindigkeit als auch der F/B-Regelfunktion basierend auf dem Fahrzeugabstand, wobei eine Regelverstärkung für die F/B-Regelung basierend auf einem Fahrzeugabstand in Übereinstimmung mit dem Fahrzustand in einem Betrieb mit automatischer Geschwindigkeitsregelung geändert wird, was ein schnelles Konvergieren zu einem Soll-Fahrzeugabstand zuläßt.For example, Japanese Patent Laid-Open discloses No. 63-269736 a device for automatic Cruise control for vehicles with both the F / B-Re gel function based on vehicle speed as well the F / B control function based on the vehicle distance, where a control gain for F / B control based on a Vehicle distance in accordance with the driving condition in an operation with automatic speed control is changing what a quick convergence to one Target vehicle distance allowed.

Das japanische offengelegte Patent mit der Nr. 3-118700 offen­ bart eine Vorrichtung zur automatischen Geschwindigkeitsrege­ lung für Fahrzeuge mit der automatischen F/B-Geschwindigkeitsregelungs-Funktion basierend auf dem Fahr­ zeugabstand, wobei ein Soll-Fahrzeugabstand in Übereinstimmung mit dem Reibungskoeffizienten einer Straßenoberfläche einge­ stellt wird.Japanese Patent Laid-Open No. 3-118700 has a device for automatic speed control for vehicles with automatic F / B cruise control function based on driving tool distance, with a target vehicle distance in accordance with the coefficient of friction of a road surface is posed.

Das japanische offengelegte Patent mit der Nr. 61-150835 of­ fenbart eine Vorrichtung zur automatischen Geschwindigkeitsre­ gelung für Fahrzeuge mit sowohl der F/B-Regelfunktion basierend auf der Fahrzeuggeschwindigkeit als auch der F/B-Re­ gelfunktion basierend auf dem Fahrzeugabstand, wobei die F/B-Regelung basierend auf der Fahrzeuggeschwindigkeit basier­ end auf vorherigen Fahrzeuggeschwindigkeitsdaten ausgeführt wird, wenn der Fahrzeugabstand nicht detektiert werden kann.Japanese Patent Laid-Open No. 61-150835 of discloses an automatic speed control device for vehicles with both the F / B control function based on the vehicle speed as well as the F / B-Re gel function based on the vehicle distance, the F / B control based on vehicle speed executed on previous vehicle speed data if the vehicle distance cannot be detected.

Das japanische offengelegte Patent mit der Nr. 61-6034 offen­ bart eine Vorrichtung zur automatischen Geschwindigkeitsrege­ lung für Fahrzeuge mit der F/B-Regelfunktion basierend auf der Fahrzeuggeschwindigkeit, wobei eine Soll-Fahr­ zeuggeschwindigkeit während eines Kurvenfahrens auf einer Straße in Übereinstimmung mit der Kurvenkrümmung eingestellt wird, so daß das Fahrzeug die Kurve mit einer geeigneten Soll-Fahrzeuggeschwindigkeit fahren kann.Japanese Patent Laid-Open No. 61-6034 has a device for automatic speed control for vehicles with the F / B control function based on the Vehicle speed, with a target driving tool speed while cornering on a  Road set in accordance with the curvature is so that the vehicle takes the curve with a suitable Target vehicle speed can drive.

Weiterhin wird bei einer Regelung, die die in dem japanischen offengelegten Patent mit der Nr. 58-29018 offenbarte F/B-Re­ gelung basierend auf der Fahrzeuggeschwindigkeit benutzt, die Beschleunigung eines Fahrzeugs in einem normalen Fahrzustand detektiert und wird durch Speichern von Beschleunigungsdaten in Übereinstimmung mit der Beschleunigungserzeugungsfrequenz bzw. -häufigkeit gelernt. Dieses Lernen stimmt mit einer Beschleunigung überein, die zu erhalten ist, wenn der F/B-Re­ gelbetrieb basierend auf der Fahrzeuggeschwindigkeit gelöscht ist, um wieder einen normalen Fahrbetrieb aufzunehmen, oder mit einer Beschleunigung, die erhalten wird, wenn der F/B-Re­ gelbetrieb basierend auf der Fahrzeuggeschwindigkeit von dem normalen Fahrbetrieb durch das Beschleunigungsgefühl ersetzt wird, das von einem Fahrer beabsichtigt ist (d. h. der ge­ lernten Beschleunigung).Furthermore, in a scheme that is in the Japanese published patent No. 58-29018 discloses F / B-Re used based on the vehicle speed Acceleration of a vehicle in a normal driving condition is detected and saved by storing acceleration data in accordance with the acceleration generation frequency learned or frequency. This learning agrees with one Acceleration to be obtained when the F / B-Re Gel operation deleted based on vehicle speed is to resume normal driving, or with an acceleration obtained when the F / B-Re gel operation based on the vehicle speed of the normal driving is replaced by the feeling of acceleration intended by a driver (i.e. the ge learned acceleration).

Da eine derartige automatische Geschwindigkeitsregelung durch einen Fahrer während des Fahrens ausgeführt wird, sind ver­ schiedene Operationsvorrichtungen erforderlich. Beispielswei­ se ist die Vorrichtung zur automatischen Geschwin­ digkeitsregelung des japanischen offengelegten Patents mit der Nr. 63-269736 mit einem LEERLAUF-Schalter, einem WIEDERAUFNAHME-Schalter und einem EINSTELL-Schalter versehen.Because such an automatic speed control by a driver is running while driving are ver different surgical devices required. For example se is the device for automatic speed regulation of the Japanese laid-open patent with the No. 63-269736 with one IDLE switch, one RESUME switch and a SET switch.

Ein Fahrzeug, das eine F/B-Regelung basierend auf der Fahr­ zeuggeschwindigkeit ausführen kann, ist normalerweise mit dem EINSTELL-Schalter versehen, um eine Soll-Fahrzeuggeschwindig­ keit einzustellen. Zum Zulassen, daß ein derartiges Fahrzeug eine F/B-Regelung basierend auf einem Fahrzeugabstand ausführt, ist ein Schalter zum Einstellen eines Soll-Fahrzeug­ abstands und ähnliches erforderlich. A vehicle that has F / B control based on driving tool speed is usually with the SET switch provided to a target vehicle speed setting. To allow such a vehicle F / B control based on a vehicle distance is a switch for setting a target vehicle distance and the like is required.  

Da ein herkömmliches Fahrzeug, das sowohl die F/B-Regelung basierend auf der Fahrzeuggeschwindigkeit als auch die F/B-Re­ gelung basierend auf einem Fahrzeugabstand ausführen kann, sind zwei Schalter zum jeweiligen Einstellen der Soll-Fahr­ zeuggeschwindigkeit und des Soll-Fahrzeugabstands nötig, viele Schalter sind um einen Fahrersitz angeordnet, und umständliche Operationen sind erforderlich. Zusätzlich werden solche Schalter bezüglich des Designs nicht bevorzugt.Since a conventional vehicle that has both the F / B scheme based on the vehicle speed as well as the F / B-Re can perform based on a vehicle distance, are two switches for setting the target driving speed and the target vehicle distance necessary, many Switches are arranged around a driver's seat, and cumbersome Operations are required. In addition, such Switch not preferred in terms of design.

Die vorliegende Erfindung ist gemacht worden, um die herkömmlichen Nachteile zu eliminieren, und hat als ihre Auf­ gabe, eine Vorrichtung zur automatischen Geschwin­ digkeitsregelung zu schaffen, bei der eine Operations­ einrichtung zum Einstellen einer Soll-Fahrzeuggeschwindigkeit auch zum Einstellen eines Soll-Fahrzeugabstands in einem Fahr­ zeug benutzt wird, das sowohl eine F/B-Regelung basierend auf der Fahrzeuggeschwindigkeit als auch eine F/B-Regelung basie­ rend auf dem Fahrzeugabstand ausführen kann.The present invention has been made to achieve the to eliminate conventional drawbacks, and has as its on gabe, a device for automatic speed to create a regulation in which an operation device for setting a target vehicle speed also for setting a target vehicle distance in a drive is used that both an F / B control based on the vehicle speed as well as an F / B control can run on the vehicle distance.

Zum Lösen der obigen Aufgabe ist gemäß einem Aspekt der vor­ liegenden Erfindung eine Vorrichtung zur automatischen Ge­ schwindigkeitsregelung geschaffen, die folgendes aufweist:
eine Operationseinrichtung zum Einstellen einer Soll-Fahrzeug­ geschwindigkeit über eine durch einen Fahrer ausgeführte Operation;
eine Einrichtung zur automatischen Geschwindigkeitsregelung basierend auf der Fahrzeuggeschwindigkeit zum Regeln einer Fahrzeuggeschwindigkeit zu der Soll-Fahrzeuggeschwindigkeit, die durch die Operationseinrichtung eingestellt ist;
eine Einrichtung zur automatischen Geschwindigkeitsregelung basierend auf einem Fahrzeugabstand zum Beibehalten eines Fahrzeugabstands zu einem Fahrzeug voraus, damit er ein vor­ bestimmter Soll-Fahrzeugabstand wird; und
eine Umwandlungseinrichtung zum Detektieren einer Operations­ information von der Operationseinrichtung unter einer vorbe­ stimmten Bedingung, zum Umwandeln der detektierten Operationsinformation in eine Information über einen Fahrzeug­ abstand, und zum Ausgeben der umgewandelten Information über einen Fahrzeugabstand zu der Einrichtung zur automatischen Geschwindigkeitsregelung basierend auf einem Fahrzeugabstand.
To achieve the above object, according to one aspect of the present invention, a device for automatic speed control is provided, which has the following:
an operation device for setting a target vehicle speed via an operation performed by a driver;
automatic speed control means based on the vehicle speed for regulating a vehicle speed to the target vehicle speed set by the operation means;
automatic cruise control based on a vehicle distance for maintaining a vehicle distance from a vehicle ahead to become a predetermined target vehicle distance; and
conversion means for detecting an operation information from the operation means under a predetermined condition, for converting the detected operation information into a vehicle distance information, and for outputting the converted vehicle distance information to the automatic cruise control device based on a vehicle distance.

Gemäß einem weiteren Aspekt der vorliegenden Erfindung ist eine Vorrichtung zur automatischen Geschwindigkeitsregelung geschaffen, die folgendes aufweist:
eine Operationseinrichtung zum Ausgeben eines vorbestimmten Signals in Übereinstimmung mit einer von einem Fahrer durch­ geführten Operation;
eine Einrichtung zur automatischen Geschwindigkeitsregelung basierend auf einer Fahrzeuggeschwindigkeit zum Umwandeln des Signals von der Operationseinrichtung in ein Soll-Fahrzeug­ geschwindigkeitssignal und zum Regeln einer Fahrzeuggeschwin­ digkeit zu einer Soll-Fahrzeuggeschwindigkeit auf der Basis des umgewandelten Signals in einem ersten Betrieb; und
eine Einrichtung zur automatischen Geschwindigkeitsregelung basierend auf einem Fahrzeugabstand zum Umwandeln des Signals von der Operationseinrichtung in ein Signal über einen Soll-Fahrzeugabstand und zum Beibehalten eines Fahrzeugabstand zu einem Fahrzeug voraus, damit er ein Soll-Fahrzeugabstand ist, auf der Basis des umgewandelten Signals in einem zweiten Betrieb.
According to a further aspect of the present invention, an automatic speed control device is provided, which has the following:
operation means for outputting a predetermined signal in accordance with an operation performed by a driver;
automatic speed control means based on a vehicle speed for converting the signal from the operation means into a target vehicle speed signal and for controlling a vehicle speed to a target vehicle speed based on the converted signal in a first operation; and
means for automatic cruise control based on a vehicle distance for converting the signal from the operation device into a signal about a target vehicle distance and for maintaining a vehicle distance to a vehicle ahead so that it is a target vehicle distance based on the converted signal in one second operation.

Gemäß einem weiteren Aspekt der vorliegenden Erfindung ist eine Vorrichtung zur automatischen Geschwindigkeitsregelung geschaffen, das eine automatische Geschwindigkeitsregelung basierend auf einer Fahrzeuggeschwindigkeit zum Regeln einer Fahrzeuggeschwindigkeit zu einer Soll-Fahrzeuggeschwindigkeit und eine automatische Geschwindigkeitsregelung basierend auf einem Fahrzeugabstand zum Beibehalten eines Fahrzeugabstands zu einem Fahrzeug voraus, damit er ein Soll-Fahrzeugabstand wird, einzeln ausführen kann, wobei die Vorrichtung folgendes aufweist:
ein Operationselement mit einem ersten Schalter, der von einem Fahrer betätigt bzw. niedergedrückt werden kann;
einen Operationssensor zum Detektieren der durch den Fahrer veranlaßten Operation des ersten Schalters;
einen Fahrzeuggeschwindigkeitssensor zum Detektieren einer Fahrzeuggeschwindigkeit;
einen Abstandssensor zum Detektieren eines Fahrzeugabstands zu dem Fahrzeug davon bzw. voraus;
einen Umwandlungsabschnitt zum Empfangen von Ausgangssignalen von dem Operationssensor, dem Fahrzeuggeschwindigkeitssensor und dem Abstandssensor, um dann, wenn der erste Schalter in einem Betrieb zur automatischen Geschwindigkeitsregelung ba­ sierend auf einer Fahrzeuggeschwindigkeit betrieben wird, Fahrzeuggeschwindigkeitsdaten, die zu jener Zeit durch den Fahrzeuggeschwindigkeitssensor detektiert werden, in Soll-Fahrzeuggeschwindigkeitsdaten umzuwandeln, und um dann, wenn der erste Schalter in einem Betrieb zur automatischen Geschwindigkeitsregelung basierend auf einem Fahrzeugabstand betrieben wird, Daten über einen Fahrzeugabstand, die zu jenem Zeitpunkt durch den Abstandssensor detektiert werden, in Daten über einen Soll-Fahrzeugabstand umzuwandeln; und
einen Regelabschnitt zum Regeln der Fahrzeuggeschwindigkeit zu der umgewandelten Soll-Fahrzeuggeschwindigkeit in dem Betrieb zur automatischen Geschwindigkeitsregelung basierend auf einer Fahrzeuggeschwindigkeit und zum Regeln des Fahrzeugabstands zu dem Fahrzeug voraus zu dem umgewandelten Soll-Fahrzeugabstand in dem Betrieb zur automatischen Geschwindigkeitsregelung basierend auf einem Fahrzeugabstand.
According to another aspect of the present invention, there is provided an automatic cruise control device that anticipates an automatic cruise control based on a vehicle speed for controlling a vehicle speed to a target vehicle speed and an automatic cruise control based on a vehicle distance for maintaining a vehicle distance to a vehicle he will be able to execute a target vehicle distance individually, the device having the following:
an operating element with a first switch that can be operated or depressed by a driver;
an operation sensor for detecting the driver's operation of the first switch;
a vehicle speed sensor for detecting a vehicle speed;
a distance sensor for detecting a vehicle distance to the vehicle therefrom or ahead;
a conversion section for receiving output signals from the operation sensor, the vehicle speed sensor, and the distance sensor, to, when the first switch is operated in an automatic cruise control operation based on a vehicle speed, vehicle speed data detected by the vehicle speed sensor at that time Convert target vehicle speed data, and, when the first switch is operated in an automatic speed control operation based on a vehicle distance, convert vehicle distance data detected by the distance sensor at that time into target vehicle distance data; and
a control section for controlling the vehicle speed to the converted target vehicle speed in the automatic speed control operation based on a vehicle speed and for controlling the vehicle distance to the vehicle ahead of the converted target vehicle distance in the automatic speed control operation based on a vehicle distance.

Es ist eine weitere Aufgabe der vorliegenden Erfindung, eine Vorrichtung zur automatischen Geschwindigkeitsregelung zu schaffen, die ruhige Operationen der Operationseinrichtung gewährleistet, die gemeinsam für einen Betrieb zur F/B-Re­ gelung eines Fahrzeugabstands und einem Betrieb zur F/B-Re­ gelung einer Fahrzeuggeschwindigkeit benutzt wird. It is another object of the present invention, one Automatic speed control device create the quiet operations of the surgical facility guaranteed to work together for F / B-Re determination of a vehicle distance and an operation for F / B-Re setting a vehicle speed is used.  

Es ist eine weitere Aufgabe der vorliegenden Erfindung, eine Vorrichtung zur automatischen Geschwindigkeitsregelung zu schaffen, die eine Operationseinrichtung hat, deren Operation zum Erhöhen der Soll-Fahrzeuggeschwindigkeit bei einer F/B-Re­ gelung basierend auf einer Fahrzeuggeschwindigkeit mit einer Operation zum Erniedrigen des Soll-Fahrzeugabstands bei einer F/B-Regelung basierend auf einem Fahrzeugabstand übereinstimmt.It is another object of the present invention, one Automatic speed control device create that has an operating facility whose operation to increase the target vehicle speed with an F / B-Re based on a vehicle speed with a Operation to decrease the target vehicle distance at one F / B control based on vehicle distance matches.

Es ist eine weitere Aufgabe, der vorliegenden Erfindung, eine Vorrichtung zur automatischen Geschwindigkeitsregelung zu schaffen, die den Soll-Fahrzeugabstand durch kontinuierliches Betätigen einer Operationseinrichtung (z. B. eines EINSTELL- Schalters) bei einer F/B-Regelung basierend auf einem Fahr­ zeugabstand erniedrigen kann.It is another object of the present invention Automatic speed control device create the target vehicle distance through continuous Actuation of an operating device (e.g. a SETTING Switch) with F / B control based on a drive can decrease the tool distance.

Es ist noch eine weitere Aufgabe der vorliegenden Erfindung, Vorrichtung zur automatischen Geschwindigkeitsregelung zu schaffen, die eine Operationseinrichtung hat, deren Operation zum Erniedrigen der Soll-Fahrzeuggeschwindigkeit bei einer F/B-Regelung basierend auf einer Fahrzeuggeschwindigkeit mit einer Operation zum Erhöhen des Soll-Fahrzeugabstands bei einer F/B-Regelung basierend auf einem Fahrzeugabstand übereinstimmt.It is still another object of the present invention Automatic speed control device create that has an operating facility whose operation to reduce the target vehicle speed at a F / B control based on vehicle speed with an operation to increase the target vehicle distance F / B control based on a vehicle distance matches.

Es ist eine weitere Aufgabe der vorliegenden Erfindung, eine Vorrichtung zur automatischen Geschwindigkeitsregelung zu schaffen, die den Soll-Fahrzeugabstand durch kontinuierliches Betätigen einer Operationseinrichtung (z. B. eines LEERLAUF- Schalters) bei einer F/B-Regelung basierend auf einem Fahr­ zeugabstand erhöhen kann.It is another object of the present invention, one Automatic speed control device create the target vehicle distance through continuous Operating an operating device (e.g. an IDLE Switch) with F / B control based on a drive distance between tools can increase.

Es ist eine weitere Aufgabe der vorliegenden Erfindung, eine Vorrichtung zur automatischen Geschwindigkeitsregelung zu schaffen, die eine Operationseinrichtung hat, deren Operation zum Einstellen einer Soll-Fahrzeuggeschwindigkeit bei einer F/B-Regelung basierend auf einer Fahrzeuggeschwindigkeit (z. B. einem Niederdrücken eines EINSTELL-Schalters für eine kurze Zeitperiode) mit einer Operation zum Einstellen eines Soll-Fahrzeugabstands bei einer F/B-Regelung basierend auf einem Fahrzeugabstand übereinstimmt.It is another object of the present invention, one Automatic speed control device create that has an operating facility whose operation for setting a target vehicle speed at a  F / B control based on vehicle speed (e.g. depressing an SET switch for a short time Time period) with an operation for setting a Target vehicle distance for F / B control based on corresponds to a vehicle distance.

Weitere Merkmale und Vorteile der vorliegenden Erfindung werden aus der folgenden Beschreibung im Zusammenhang mit den beigefügten Zeichnungen klar werden, wobei in allen Figuren gleiche Bezugszeichen dieselben oder ähnliche Teile bezeichnen.Other features and advantages of the present invention are related to the following description attached drawings will be clear, in all figures same reference numerals the same or similar parts describe.

Fig. 1 ist ein Diagramm, das den Aufbau des gesamten Sys­ tems zur automatischen Geschwindigkeitsregelung gemäß einem bevorzugten Ausführungsbeispiel der vor­ liegenden Erfindung zeigt; Fig. 1 is a diagram showing the structure of the entire automatic cruise control system according to a preferred embodiment of the present invention;

Fig. 2 ist ein funktionales Blockdiagramm, das den Betrieb des Systems zur automatischen Geschwindigkeits­ regelung des in Fig. 1 gezeigten Ausführungsbei­ spiels zeigt; Fig. 2 is a functional block diagram showing the operation of the automatic speed control system of the embodiment shown in Fig. 1;

Fig. 3 ist ein Flußdiagramm zum Erklären des Hauptprogramms der Regelungs-Ablauffolge des in Fig. 1 gezeigten Ausführungsbeispiels; Fig. 3 is a flowchart for explaining the main program of the control sequence of the embodiment shown in Fig. 1;

Fig. 4 ist ein Flußdiagramm zum Erklären des Hauptprogramms der Regelungs-Ablauffolge des in Fig. 1 gezeigten Ausführungsbeispiels; Fig. 4 is a flowchart for explaining the main program of the control sequence of the embodiment shown in Fig. 1;

Fig. 5 ist ein Flußdiagramm zum Erklären des Hauptprogramms der Regelungs-Ablauffolge des in Fig. 1 gezeigten Ausführungsbeispiels; Fig. 5 is a flowchart for explaining the main program of the control sequence of the embodiment shown in Fig. 1;

Fig. 6 ist ein Flußdiagramm zum Erklären des Hauptprogramms der Regelungs-Ablauffolge des in Fig. 1 gezeigten Ausführungsbeispiels; Fig. 6 is a flowchart for explaining the main program of the control sequence of the embodiment shown in Fig. 1;

Fig. 7 ist eine Kurve, die die Beziehung zwischen dem Gaspedalöffnungswinkel α, und dem entsprechenden Drosselöffnungswinkel TG zeigt; Fig. 7 is a graph showing the relationship between the accelerator opening angle α and the corresponding throttle opening angle TG;

Fig. 8 ist eine Kurve, die die Beziehung zwischen der Fahr­ zeuggeschwindigkeit Vn und dem Drosselöffnungsgrad TG zeigt, der in Übereinstimmung mit der Fahrzeugge­ schwindigkeit Vn eine konstante Beschleunigung a er­ halten kann; Fig. 8 is a graph showing the relationship between the vehicle speed V n and the throttle opening degree TG, which can maintain a constant acceleration a he in accordance with the vehicle speed V n ;

Fig. 9 ist ein Flußdiagramm, das die Rückkoppel- Regelungs-Ablauffolge des in Fig. 1 gezeigten Ausführungsbeispiels zeigt; Fig. 9 is a flowchart showing the feedback control sequence of the embodiment shown in Fig. 1;

Fig. 10 ist ein Flußdiagramm, das die Rückkoppel- Regelungs-Ablauffolge des in Fig. 1 gezeigten Ausführungsbeispiels zeigt; Fig. 10 is a flowchart showing the feedback control sequence of the embodiment shown in Fig. 1;

Fig. 11 ist ein Flußdiagramm, das die Rückkoppel- Regelungs-Ablauffolge des in Fig. 1 gezeigten Ausführungsbeispiels zeigt; Fig. 11 is a flowchart showing the feedback control sequence of the embodiment shown in Fig. 1;

Fig. 12 ist ein Zeitdiagramm zum Erklären der Operation, wenn eine F/B-Regelung basierend auf einer Fahrzeug­ geschwindigkeit gemäß der in den Fig. 9 bis 11 ge­ zeigten Regelungs-Ablauffolge zu einer F/B-Regelung basierend auf einem Fahrzeugabstand geschaltet ist; Fig. 12 is a time chart for explaining the operation when a F / B control is switched based on a vehicle speed as shown in FIGS. 9 to 11 ge showed regulation sequence to a F / B control based on a vehicle distance ;

Fig. 13 ist ein Zeitdiagramm zum Erklären einer Änderung der Regelgröße En und einer Änderung einer integralen Variable EvI bei der F/B-Regelung basierend auf einer Fahrzeuggeschwindigkeit gemäß der in den Fig. 9 bis 11 gezeigten Regelungs-Ablauffolge; Fig. 13 is a time chart for explaining a change of the control variable E n, and a change in an integral variable E VI in the F / B control based on a vehicle speed according to the shown in Figs to 11 regulation sequence. 9;

Fig. 14 ist ein Flußdiagramm, das die Regelungs-Ablauffolge zum Lernen bei dem in Fig. 1 gezeigten Ausführungs­ beispiel zeigt; Fig. 14 is a flowchart showing the control sequence for learning in the embodiment shown in Fig. 1;

Fig. 15 ist ein Flußdiagramm, das die Regelungs-Ablauffolge zum Lernen bei dem in Fig. 1 gezeigten Ausführungs­ beispiel zeigt; Fig. 15 is a flowchart showing the control sequence for learning in the embodiment shown in Fig. 1;

Fig. 16 ist eine Tabelle zum Erklären des Prinzips des Lernens eines Fahrzeugabstands; Fig. 16 is a table for explaining the principle of learning a vehicle spacing;

Fig. 17 ist eine Kurve zum Erklären des Prinzips des Lernens eines Fahrzeugabstands; Fig. 17 is a graph for explaining the principle of learning a vehicle distance;

Fig. 18 ist eine Kurve zum Erklären des Prinzips des Lernens einer Soll-Fahrzeuggeschwindigkeit beim Kurvenfahren eines Fahrzeugs; Fig. 18 is a graph for explaining the principle of learning is a target vehicle speed during cornering of a vehicle;

Fig. 19 ist eine Tabelle zum Erklären des Prinzips des Lernens einer Soll-Fahrzeuggeschwindigkeit beim Kur­ venfahren eines Fahrzeugs; Fig. 19 is a table for explaining the principle of learning a target vehicle speed at the cure venfahren of a vehicle;

Fig. 20 ist ein Flußdiagramm, das die Regelungs-Ablauffolge zum Detektieren eines Fehlens eines Signals und eines Fahrzeugs voraus zeigt; Fig. 20 is a flowchart showing the control sequence for detecting a lack of a signal and a vehicle ahead;

Fig. 21 ist ein Flußdiagramm, das die Regelungs-Ablauffolge zum Detektieren einer Verschlechterung der Lei­ stungsfähigkeit eines Abstandssensors zeigt; Fig. 21 is a flowchart showing the control sequence for detecting deterioration in performance of a distance sensor;

Fig. 22 ist ein Zeitdiagramm zum Erklären eines Übergangs von einer F/B-Regelung basierend auf einem Fahrzeugabstand zu der F/B-Regelung basierend auf einer Fahrzeuggeschwindigkeit beim Ausfall eines Signals; Fig. 22 is a time chart for explaining a transition from an F / B control based on a vehicle distance from the F / B control based on a vehicle speed when the failure of a signal;

Fig. 23 ist ein Flußdiagramm, das die Regelungs-Ablauffolge gemäß der ersten Abänderung zeigt; Fig. 23 is a flowchart showing the regulation sequence of the first modification;

Fig. 24 ist ein Flußdiagramm, das die Regelungs-Ablauffolge gemäß der ersten Abänderung zeigt; Fig. 24 is a flowchart showing the control sequence according to the first modification;

Fig. 25 ist ein Flußdiagramm, das die Regelungs-Ablauffolge gemäß der ersten Abänderung zeigt; Fig. 25 is a flowchart showing the control sequence according to the first modification;

Fig. 26 ist ein Flußdiagramm, das die Regelungs-Ablauffolge gemäß der zweiten Abänderung zeigt; Fig. 26 is a flowchart showing the control sequence according to the second modification;

Fig. 27 ist ein Flußdiagramm, das die Regelungs-Ablauffolge gemäß der dritten Abänderung zeigt; Fig. 27 is a flowchart showing the control sequence according to the third modification;

Fig. 28 ist ein Flußdiagramm, das die Regelungs-Ablauffolge gemäß der dritten Abänderung zeigt; Fig. 28 is a flowchart showing the control sequence according to the third modification;

Fig. 29 ist eine Ansicht zum Erklären des Grundes, warum ein Vorrichtung zur Geschwindigkeitsregelung dazu neigt, einen Sollwert beim Fahren einer Kurve zu verfehlen; und Fig. 29 is a view for explaining the reason why a device for speed control tends to miss a target value when cornering; and

Fig. 30 ist eine Ansicht zum Erklären des Grundes, warum ein Vorrichtung zur Geschwindigkeitsregelung dazu neigt, einen Sollwert zu verfehlen, wenn eine Fahrzeugka­ rosserie eine Nickbewegung durchführt. Fig. 30 is a view for explaining the reason why a device for speed control tends to miss a desired value when a Fahrzeugka rosserie performs a pitching motion.

Das bevorzugte Ausführungsbeispiel der vorliegenden Erfindung wird nachfolgend unter Bezugnahme auf die beigefügten Zeich­ nungen beschrieben. The preferred embodiment of the present invention will be described below with reference to the accompanying drawing described.  

SystemaufbauSystem structure

Fig. 1 zeigt den Aufbau eines Systems zur automatischen Gesch­ windigkeitsregelung, auf das die vorliegende Erfindung ange­ wendet wird. Dieses System kann eine Rückkoppel-Regelung zum Beibehalten der Fahrzeuggeschwindigkeit des eigenen Fahrzeugs ausführen, damit sie eine richtige Geschwindigkeit ist (wobei diese Regelung nachfolgend "F/B-Regelung basierend auf einer Fahrzeuggeschwindigkeit" oder "F/B-Regelung vom S-Typ" genannt wird), und eine Rückkoppel-Regelung zum Beibehalten des Ab­ stands zwischen Fahrzeugen zu einem Fahrzeug voraus, damit er ein richtiger Fahrzeugabstand ist (wobei diese Regelung nach­ folgend "F/B-Regelung basierend auf einem Fahrzeugabstand" oder "F/B-Regelung vom D-Typ" genannt wird). Das in Fig. 1 ge­ zeigte System umfaßt hauptsächlich einen Abstandssensor 10 zum Detektieren des Abstands zu dem Fahrzeug voraus (oder einem Objekt voraus bzw. davor), einen Motor 40 (das Bezugszeichen 44 bezeichnet einen Motor-Hauptkörper; und das Bezugszeichen 45 eine automatische Transmission), Operationsvorrichtungen (Sensoren/Schalter) 60 und eine Steuereinheit 20 zum Ausführen der Regelung dieses Ausführungsbeispiels. Das System dieses Ausführungsbeispiels ändert die Geschwindigkeit des eigenen Fahrzeugs, um eine konstante Fahrzeuggeschwindigkeit oder einen konstanten Fahrzeugabstand beizubehalten. Die Geschwin­ digkeit des eigenen Fahrzeugs wird durch Regeln des Öffnungs­ grads eines Drosselventils 42 durch ein Gaspedal 43 geändert. Die Steuereinheit 20 steuert das Gaspedal 43. Fig. 1 shows the structure of a system for automatic speed control, to which the present invention is applied. This system can perform a feedback control for maintaining the vehicle speed of the own vehicle so that it is a correct speed (hereinafter, this control "F / B control based on a vehicle speed" or "F / B control of the S type") and a feedback control for maintaining the distance between vehicles to a vehicle in advance so that it is a correct vehicle distance (this control according to the following "F / B control based on a vehicle distance" or "F / B- D-type regulation "is called). The system shown in Fig. 1 mainly includes a distance sensor 10 for detecting the distance to the vehicle ahead (or an object ahead or in front), an engine 40 (reference numeral 44 denotes an engine main body; and reference numeral 45 an automatic one) Transmission), operation devices (sensors / switches) 60 and a control unit 20 for performing the control of this embodiment. The system of this embodiment changes the speed of the own vehicle to maintain a constant vehicle speed or a constant vehicle distance. The speed of the own vehicle is changed by controlling the opening degree of a throttle valve 42 by an accelerator pedal 43 . The control unit 20 controls the accelerator pedal 43 .

Die Sensoren/Schalter 60 enthalten einen Wischerschalter (nicht gezeigt) zum Ausgeben eines Signals WP beim Betätigen eines Wischers 61, einen Lenkwinkelsensor (nicht gezeigt) zum Detektieren eines Lenkwinkel-Betriebswinkels (der nachfolgend Lenkwinkel genannt wird) R eines Lenkrads 62, einen HAUPT- Schalter 63 zum Starten einer automatischen Geschwindig­ keitsregelung, einen Gaspedalöffnungsgradsensor 64 zum Detek­ tieren eines Gaspedalöffnungsgrads α, einen Operationsschalter 65, einen Bremsschalter 66 zum Ausgeben eines Signals Br beim Niederdrücken eines Bremspedals und einen Bereichsschalter (nicht gezeigt) zum Ausgeben eines Bereichssignals einer Aus­ wahleinheit 67. Der Operationsschalter 65 hat drei Funk­ tionen, nämlich als EINSTELL-Schalter, als WIEDERAUFNAHME- Schalter und als LEERLAUF-Schalter, und gibt in Übereinstim­ mung mit seinem Betriebszustand (z. B. dem Niederdrücken eines zentralen Knopfes oder der vertikalen Schwingoperation oder Drehoperation eines Schaltkörpers) ein Signal SETSW, RESUMESW oder COASTSW aus. Die Signale von diesen Sensoren/Schaltern werden der Regeleinheit 20 eingegeben und werden bei einer Drossel-Öffnungsgrad-Regelung benutzt, d. h. einer Fahrzeug­ geschwindigkeitssteuerung der Steuereinheit 20.The sensors / switches 60 include a wiper switch (not shown) for outputting a signal WP when a wiper 61 is actuated, a steering angle sensor (not shown) for detecting a steering angle operating angle (hereinafter referred to as steering angle) R of a steering wheel 62 , a MAIN Switch 63 for starting automatic speed control, an accelerator opening degree sensor 64 for detecting an accelerator opening degree α, an operation switch 65 , a brake switch 66 for outputting a signal Br when a brake pedal is depressed, and a range switch (not shown) for outputting a range signal of a selection unit 67 . The operation switch 65 has three functions, namely, as the SET switch, the RESUME switch, and the IDLE switch, and is in accordance with its operating state (e.g., depression of a central button or the vertical swinging operation or rotating operation of a switch body) ) a signal SETSW, RESUMESW or COASTSW. The signals from these sensors / switches are input to the control unit 20 and are used in a throttle opening degree control, ie a vehicle speed control of the control unit 20th

Weiterhin ist in Fig. 1 gezeigt: ein Vergaser 41; ein Motor 44; und eine Transmission 45, die zusammen mit dem Drosselven­ til 42 und dem Gaspedal 43 eine Leistungseinheit 40 bilden. Ein Vorderrad ist mit dem Bezugszeichen 30 bezeichnet.Furthermore, in Fig 1 is shown: a carburetor 41;. a motor 44 ; and a transmission 45 , which together with the Drosselven valve 42 and the accelerator 43 form a power unit 40 . A front wheel is designated by reference number 30 .

Nachfolgend wird eine Funktion der Vorrichtung zur automa­ tischen Geschwindigkeitsregelung kurz beschrieben.A function of the device for automa table speed control briefly described.

Wenn ein Fahrer eine automatische Geschwindigkeitsregelung starten möchte, muß er oder sie den HAUPT-Schalter 63 ein­ schalten. Wenn der Schalter 63 eingeschaltet ist, ist die automatische Geschwindigkeitsregelung freigegeben. Das Opera­ tionselement (Schalter) 65 hat den EINSTELL-Schalter vom Druckknopftyp. Der Fahrer kann dieses Operationselement 65 in der Zeichenebene der Fig. 1 vertikal hin- und herbewegen. Wenn der Fahrer das Operationselement 65 in Fig. 1 nach oben bewegt, wird ein WIEDERAUFNAHME-Betrieb eingestellt; wenn er oder sie das Operationselement 65 nach unten bewegt, wird ein LEERLAUF-Betrieb eingestellt.If a driver wants to start an automatic cruise control, he or she must turn on the MAIN switch 63 . When switch 63 is turned on, automatic cruise control is enabled. The operation element (switch) 65 has the push button type SET switch. The driver can move this operating element 65 back and forth vertically in the drawing plane of FIG. 1. When the driver moves the operation member 65 upward in FIG. 1, a RESUME operation is set; when he or she moves the operation member 65 down, an IDLE operation is stopped.

Zum tatsächlichen Starten der automatischen Geschwindig­ keitsregelung muß der Fahrer den EINSTELL-Schalter wenigstens einmal niederdrücken. Wenn der EINSTELL-Schalter nieder­ gedrückt wird, wird die F/B-Regelung vom S-Typ (oder die F/B-Regelung vom D-Typ) in Übereinstimmung mit der Fahrzeugge­ schwindigkeit (oder dem Fahrzeugabstand) zu diesem Zeitpunkt ausgeführt. Danach regelt das System zur automatischen Ge­ schwindigkeitsregelung die Fahrzeuggeschwindigkeit oder den Fahrzeugabstand, bis der Betrieb der automatischen Geschwin­ digkeitsregelung gelöscht wird. Nachdem der Betrieb der auto­ matischen Geschwindigkeitsregelung zeitweilig durch Niederdrücken beispielsweise des Bremspedals gelöscht wird, wird dann, wenn der Fahrer das Operationselement 65 betätigt, um den WIEDERAUFNAHME-Betrieb einzustellen, die Fahrzeugge­ schwindigkeit oder der Fahrzeugabstand wieder auf eine Soll-Fahrzeuggeschwindigkeit TGV oder einen Soll-Fahrzeugab­ stand TGD eingestellt, die bzw. der gespeichert wurde, als zuvor der EINSTELL-Schalter gedrückt wurde. Wenn der LEERLAUF-Schalter gedrückt wird, verringert sich die Fahrzeug­ geschwindigkeit schrittweise oder erhöht sich der Fahrzeugab­ stand schrittweise.To actually start the automatic cruise control, the driver must depress the SET switch at least once. When the SET switch is depressed, the S-type F / B control (or the D-type F / B control) is executed in accordance with the vehicle speed (or the vehicle distance) at that time. The automatic speed control system then controls the vehicle speed or distance until the automatic speed control operation is canceled. After the operation of the automatic speed control is temporarily canceled by depressing the brake pedal, for example, when the driver operates the operation member 65 to set the RESUME operation, the vehicle speed or the vehicle distance is returned to a target vehicle speed TGV or a target -Vehicle clearance was set to TGD, which was saved when the SET button was pressed previously. When the IDLE switch is pressed, the vehicle speed decreases gradually or the vehicle distance increases gradually.

Fig. 2 ist ein schematisches funktionales Blockdiagramm der Regelung, die durch das in Fig. 1 gezeigte System ausgeführt wird. Die Regelungs-Ablauffolge dieses Systems besteht hauptsächlich aus einem Hauptprogramm 100, einem Block 200 zum Bestimmen, ob ein Signal von dem Fahrzeug voraus fehlt oder nicht, einem Block 300 zum Bestimmen, ob die Funktion des Sen­ sors 10 für einen Fahrzeugabstand beispielsweise durch Regen oder Schmutz verschlechtert ist oder nicht, einem Block 400 zum Bestimmen, ob sich das eigene Fahrzeug dreht oder nicht, einem Block 500 zum Ausführen der F/B-Regelung vom D-Typ oder der F/B-Regelung vom S-Typ, und zum Berechnen eines Soll-Dros­ selöffnungsgrads, und einem Block 900 zum Lernen. FIG. 2 is a schematic functional block diagram of the control performed by the system shown in FIG. 1. The control sequence of this system mainly consists of a main program 100 , a block 200 for determining whether a signal from the vehicle ahead is missing or not, a block 300 for determining whether the function of the sensor 10 for a vehicle distance, for example due to rain or Dirt is deteriorated or not, a block 400 for determining whether the own vehicle is rotating or not, a block 500 for performing the D-type F / B control or the S-type F / B control, and the Calculate a target throttle opening degree and a block 900 for learning.

In dem Hauptprogramm 100 werden, nachdem die Signale einge­ geben sind, eine Schalteroperations-Bestimmung, eine Bestim­ mung über das Aufstellen einer Bedingung zur automatischen Geschwindigkeitsregelung und eine normale Drosselregelung auf­ einanderfolgend ausgeführt, und ihre detaillierten Inhalte werden später beschrieben. Der F/B-Regelblock 500 ist grob in einen S-Typ-F/B-Regelabschnitt 510 und einen D-Typ-F/B- Regelabschnitt 520 eingeteilt, und der S-Typ-F/B- Regelabschnitt 510 ist weiterhin in einen Kurvenfahrbetrieb-S- Typ-F/B-Regelabschnitt 530 und einen Ausfall- (Fehler)-Betrieb-S-Typ-F/B-Regelabschnitt 540 eingeteilt. Der Lernblock 900 ist in einen Abschnitt 910 zum Lernen nach einer Beschleunigung und einen Abschnitt 920 zum Lernen nach einem Kurvenfahren eingeteilt. Der D-Typ-F/B-Regelabschnitt 520 regelt die Fahrzeuggeschwindigkeit, um den Fahrzeugabstand auf einem vorbestimmten Soll-Fahrzeugabstand beizubehalten. Der Abschnitt 920 zum Lernen nach einer Beschleunigung akkumuliert in einem Speicher 20m Daten über einen Fahrzeugabstand, die durch den Sensor 10 für einen Fahrzeugabstand detektiert werden, wenn die Regelung zur automatischen Geschwindig­ keitsregelung nicht aktiv ist.In the main program 100 , after the signals are input, a switch operation determination, a determination of setting an automatic cruise control condition, and a normal throttle control are performed consecutively, and their detailed contents will be described later. The F / B control block 500 is roughly divided into an S-type F / B control section 510 and a D-type F / B control section 520 , and the S-type F / B control section 510 is further shown in FIG a cornering operation S-type F / B control section 530 and a failure (failure) operation S-type F / B control section 540 . The learning block 900 is divided into a section 910 for learning after acceleration and a section 920 for learning after cornering. The D-type F / B control section 520 controls the vehicle speed to maintain the vehicle distance at a predetermined target vehicle distance. The section 920 for learning after an acceleration accumulates in a memory 20m data about a vehicle distance, which are detected by the sensor 10 for a vehicle distance when the automatic speed control is not active.

Bei der nachfolgend beschrieben Ablauffolge des Ausführungs­ beispiels ist ein Block 400 zur Bestimmung der Ablauffolge eines Kurvenfahrens/Beschleunigens in jener des Lernblocks 900 enthalten (Fig. 14 und 15).In the sequence of the exemplary embodiment described below, a block 400 for determining the sequence of cornering / acceleration is included in that of the learning block 900 ( FIGS. 14 and 15).

Vereinfachung des BetriebsSimplify operations

Ein Merkmal des Systems zur automatischen Geschwindigkeitsre­ gelung dieses Ausführungsbeispiels ist eine Vereinfachung des Schaltbetriebs. Diese Vereinfachung wird dadurch klar werden, daß man versteht, welche Regelung beim Betätigen des Opera­ tionsschalters 65 gestartet wird. Somit werden nachfolgend verschiedene Fahrzustände beispielhaft erklärt, und die Opera­ tionen der Regelung dieses Ausführungsbeispiels gemäß derar­ tiger Fahrzustände wird nachfolgend unter Bezugnahme auf die Flußdiagramme erklärt. A feature of the system for automatic cruise control of this embodiment is a simplification of the switching operation. This simplification will be clear from the fact that one understands which regulation is started when the operation switch 65 is operated. Thus, various driving conditions are explained below by way of example, and the operations of the control of this embodiment according to such driving conditions will be explained below with reference to the flowcharts.

Man beachte, daß drei wichtige Regelgrößen, die bei dem System dieses Ausführungsbeispiels benutzt werden, nachfolgend vor der Beschreibung der Regelung beschrieben werden.It should be noted that three important control variables that are used in the system of this embodiment are used below be described in the description of the regulation.

TG: Register zum Speichern des Soll-Drosselöffnungsgrads. Ein Drosselöffnungsgrad wird basierend auf einem Wert berechnet, der in dem Register TG gespeichert ist, und der berechnete Öffnungsgrad wird zu dem Gaspedal 43 ausgegeben.TG: Register for storing the target throttle opening degree. A throttle opening degree is calculated based on a value stored in the register TG, and the calculated opening degree is output to the accelerator pedal 43 .

TGV: Register zum Speichern der Soll-Fahrzeuggeschwindigkeit, die bei der S-Typ-F/B-Regelung benutzt wird. Bei der S-Typ-F/B-Regelung wird der Soll-Drosselöffnungsgrad TG basierend auf einer Abweichung zwischen TGV und der ge­ genwärtigen Fahrzeuggeschwindigkeit Vn bestimmt.TGV: Register for storing the target vehicle speed used in the S-type F / B control. In the S-type F / B control, the target throttle opening degree TG is determined based on a deviation between TGV and the current vehicle speed V n .

TGD: Register zum Speichern des Soll-Fahrzeugabstands, der bei der D-Typ-F/B-Regelung benutzt wird. Bei der D-Typ- F/B-Regelung wird der Soll-Drosselöffnungsgrad TG ba­ sierend auf einer Abweichung zwischen TGD und dem ge­ genwärtigen Fahrzeugabstand Dn bestimmt.TGD: Register for storing the target vehicle distance used in D-type F / B control. In the D-type F / B control, the target throttle opening degree TG is determined based on a deviation between TGD and the current vehicle distance D n .

Nachfolgend wird das in Fig. 3 gezeigte Hauptprogramm beschrieben. Dieses Hauptprogramm zeigt, wie einfach die Operation bei dem System dieses Ausführungsbeispiels ist.The main program shown in Fig. 3 will be described below. This main program shows how easy the operation is in the system of this embodiment.

Im Schritt S101 werden verschiedene Signale eingegeben. Die Signale enthalten ein Bereichssignal R von der Auswahleinheit 67, ein Bremssignal Br von dem Bremsschalter 66, einen Gaspe­ dalöffnungsgrad α von dem Gaspedalöffnungsgradsensor 64, Sig­ nale RESUMESW, SETSW, COASTSW oder dergleichen, die von dem Operationselement 65 ausgegeben werden, das vielseitig benutzt wird, ein Signal MAINSW von dem HAUPT-Schalter 63, einen Lenk­ winkel R, der den Lenkoperationswinkel des Lenkrads 62 dar­ stellt, ein Signal WP, das anzeigt, ob der Wischer gerade im Betrieb ist oder nicht, ein Fahrzeuggeschwindigkeitssignal Vn, das die gegenwärtige Fahrzeuggeschwindigkeit von dem Fahrzeug­ geschwindigkeitssensor 51 anzeigt, ein Signal D, das den ge­ genwärtigen Fahrzeugabstand anzeigt, der durch den Abstandssensor 10 detektiert wird, und ähnliches. Man beachte, daß ein Fahrzeugabstand Dn-1, eine Fahrzeuggeschwin­ digkeit Vn-1, und dergleichen, die in dem vorherigen Regelzyk­ lus gemessen wurden, in dem Speicher 20m in der Regeleinheit 20 gespeichert sind.Various signals are input in step S101. The signals include a range signal R from the selection unit 67 , a brake signal Br from the brake switch 66 , an accelerator opening degree α from the accelerator opening degree sensor 64 , signals RESUMESW, SETSW, COASTSW or the like, which are output from the operating element 65 , which is used in many ways , a MAINSW signal from the MAIN switch 63 , a steering angle R representing the steering operation angle of the steering wheel 62 , a signal WP indicating whether the wiper is in operation or not, a vehicle speed signal V n representing the current one Indicates vehicle speed from the vehicle speed sensor 51 , a signal D indicating the current vehicle distance, which is detected by the distance sensor 10 , and the like. Note that a vehicle distance D n-1 , a vehicle speed V n-1 , and the like, which were measured in the previous control cycle, are stored in the memory 20m in the control unit 20 .

Zustand ohne automatische GeschwindigkeitsregelungState without automatic speed control

In einem Zustand ohne automatische Geschwindigkeitsregelung sind die Signale MAINSW und RESUMESW 0. Daher werden, nachdem im Schritt S102 bestimmt ist, daß das Signal MAINSW 0 ist, die Inhalte der verschiedenen Flags und Register, die bei der Ablauffolge benutzt werden, initialisiert. Weiterhin wird im Schritt S172 (Fig. 5) bestimmt, daß das Signal RESUMESW 0 ist, und im Schritt S180 wird auch bestimmt, daß ein Flag RESUME in einem Rücksetzzustand ist. Im Schritt 196 (Fig. 6) wird der Soll-Drosselöffnungsgrad TG gemäß dem Gaspedalöffnungsgrad α in Übereinstimmung mit den in Fig. 7 gezeigten Kennlinien be­ stimmt, und der bestimmte TG wird im Schritt S198 zu dem Gaspedal 43 ausgegeben. Wie es oben beschrieben ist, wird in dem Zustand ohne automatische Geschwindigkeitsregelung eine normale Drosselöffnungsgrad-Regelung ausgeführt.In a state without automatic cruise control, the signals MAINSW and RESUMESW are 0. Therefore, after it is determined in step S102 that the signal MAINSW is 0, the contents of the various flags and registers used in the sequence are initialized. Furthermore, it is determined in step S172 ( FIG. 5) that the signal RESUMESW is 0 , and it is also determined in step S180 that a flag RESUME is in a reset state. In step 196 ( FIG. 6), the target throttle opening degree TG is determined according to the accelerator opening degree α in accordance with the characteristics shown in FIG. 7, and the determined TG is output to the accelerator pedal 43 in step S198. As described above, in the state without automatic speed control, normal throttle opening degree control is carried out.

Wenn der HAUPT-Schalter eingeschaltet istWhen the MAIN switch is on

Wenn der HAUPT-Schalter 63 eingeschaltet ist, geht der Ablauf aufeinanderfolgend weiter zu Schritt S102 → Schritt S104 → Schritt S140 → Schritt S172 → Schritt S180 → Schritt S196 → Schritt S198, und die normale Drossel-Regelung wird ausgeführt. When the MAIN switch 63 is turned on, the flow advances to step S102 → step S104 → step S140 → step S172 → step S180 → step S196 → step S198, and the normal throttle control is executed.

Wenn der EINSTELL-Schalter für eine kurze Zeitperiode einge­ schaltet istWhen the SET switch is on for a short period of time is switched

Der EINSTELL-Schalter wird normalerweise zum Einstellen einer gegenwärtigen Fahrzeuggeschwindigkeit benutzt, damit sie eine durch die automatische Geschwindigkeitsregelung geregelte Geschwindigkeit ist. Wie es oben beschrieben ist, kann das System dieses Ausführungsbeispiels sowohl die S-Typ-F/B- Regelung als auch die D-Typ-F/B-Regelung ausführen. Wenn die D-Typ-F/B-Regelung ausgeführt wird, wenn der EINSTELL-Schalter niedergedrückt wird, wird das Intervall Dn, das zu jenem Zeit­ punkt zu dem vorausfahrenden Fahrzeug gemessen wird, als Soll-Fahrzeugabstand TGD beibehalten; wenn die S-Typ-F/B- Regelung ausgeführt wird, wenn der EINSTELL-Schalter nieder­ gedrückt wird, wird die Fahrzeuggeschwindigkeit Vn des eigenen Fahrzeugs, die zu jenem Zeitpunkt gemessen wird, als Soll-Fahr­ zeuggeschwindigkeit TGV beibehalten.The SET switch is typically used to set a current vehicle speed to be a speed regulated by the automatic cruise control. As described above, the system of this embodiment can perform both the S-type F / B control and the D-type F / B control. When the D-type F / B control is carried out when the SET switch is depressed, the interval Dn measured at that time to the preceding vehicle is maintained as the target vehicle distance TGD; when the S-type F / B control is carried out when the SET switch is depressed, the vehicle speed V n of the own vehicle measured at that time is maintained as the target vehicle speed TGV.

Wenn im Schritt S104 bestimmt wird, daß das Signal SETSW 1 ist, wird im Schritt 106 ein Flag SET gesetzt, um zu spei­ chern, daß der Schalter niedergedrückt ist. Nachdem im Schritt S108 bestimmt ist, daß der Schalter für eine kurze Zeitperiode (weniger als 0,5 Sekunden) niedergedrückt wird, wird im Schritt S130 das Flag RESUME rückgesetzt, und der Zu­ stand eines Flags DV wird im Schritt S132 geprüft. Dieses Flag DV wird zum Speichern des F/B-Regelbetriebs benutzt, der gerade ausgeführt wird. DV = 1 bedeutet, daß die D-Typ-F/B- Regelung gerade ausgeführt wird; DV = 0 bedeutet, daß die S-Typ-F/B-Regelung ausgeführt wird. Wenn DV = 0 (wenn die S-Typ-F/B-Regelung ausgeführt wird), wird die gegenwärtige Fahrzeuggeschwindigkeit Vn im Schritt S134 derart eingestellt, daß sie eine Soll-Fahrzeuggeschwindigkeit (TGV = Vn) ist, und wird im Schritt S136 auch in einem Register MTGV gesetzt. Da das System zur automatischen Geschwindigkeitsregelung dieses Ausführungsbeispiels den F/B-Regelbetrieb automatisch zwischen der S-Typ-F/B-Regelung und der D-Typ-F/B-Regelung unabhängig von der durch einen Fahrer ausgeführten Operation schaltet, wird das Register MTGV zum Speichern einer notwendigen Soll-Fahrzeuggeschwindigkeit beim Ausführen eines automa­ tischen Schaltens benutzt (Schritt S524 in Fig. 9)
In den Schritten S142 bis S152 wird geprüft, ob Bedingungen zum Ausführen, einer automatischen Geschwindigkeitsregelung erfüllt sind. Die Bedingungen zum Freigeben der automatischen Geschwindigkeitsregelung sind folgende:
If it is determined in step S104 that the signal SETSW is 1, a flag SET is set in step 106 to save that the switch is depressed. After it is determined in step S108 that the switch is depressed for a short period of time (less than 0.5 seconds), the RESUME flag is reset in step S130 and the state of a flag DV is checked in step S132. This flag DV is used to store the F / B control mode that is currently being executed. DV = 1 means that the D-type F / B control is currently being carried out; DV = 0 means that the S-type F / B control is carried out. If DV = 0 (when the S-type F / B control is carried out), the current vehicle speed V n is set to be a target vehicle speed (TGV = V n ) in step S134 and becomes in step S136 also set in a register MTGV. Since the automatic speed control system of this embodiment automatically switches the F / B control operation between the S-type F / B control and the D-type F / B control regardless of the operation performed by a driver, the register becomes MTGV used to store a necessary target vehicle speed when performing automatic shifting (step S524 in FIG. 9)
In steps S142 to S152, it is checked whether conditions for executing an automatic cruise control are met. The conditions for enabling automatic cruise control are as follows:

  • 1.: Die gegenwärtige Fahrzeuggeschwindigkeit Vn fällt in einen Bereich von 40 km/h bis 120 km/h (Schritt S142);1: The current vehicle speed V n falls in a range from 40 km / h to 120 km / h (step S142);
  • 2.: das Bremspedal ist nicht niedergedrückt (Schritt S144);2 .: the brake pedal is not depressed (step S144);
  • 3.: die Auswahleinheit 67 ist nicht in einen R-(Umkehr-)- Bereich eingestellt (Schritt S146); und3: the selection unit 67 is not set in an R (reverse) range (step S146); and
  • 4.: das Gaspedal ist nicht niedergedrückt (Schritt S152).4: The accelerator pedal is not depressed (step S152).

Auch wenn der EINSTELL-Schalter niedergedrückt ist, geht der Ablauf, solange wie das Gaspedal niedergedrückt gehalten wird, aufeinanderfolgend weiter zu Schritt S152 → Schritt S172 → Schritt S178 → Schritt S196 → Schritt S198, und die normale Drosselregelung wird ausgeführt. Wenn das Gaspedal freige­ geben wird, geht der Ablauf vom Schritt S152 zum Schritt S154 weiter. Nachdem im Schritt S154 bestimmt ist, daß der LEERLAUF-Schalter AUS-geschaltet ist, springt der Ablauf zum Schritt S101 zurück. Man beachte, daß die S-Typ-F/B-Regelung, die die im Schritt S134 eingestellte Soll-Fahrzeuggeschwindig­ keit TGV benutzt, oder die D-Typ-F/B-Regelung, die den im Schritt S138 eingestellten Soll-Fahrzeugabstand TGD benutzt, im einzelnen später unter Bezugnahme auf das Rückkoppel-Pro­ gramm beschrieben wird (das später unter Bezugnahme auf die Fig. 9 bis 11 beschrieben wird).Even when the SET switch is depressed, as long as the accelerator pedal is kept depressed, the flow advances to step S152 → step S172 → step S178 → step S196 → step S198, and the normal throttle control is executed. When the accelerator pedal is released, the flow advances from step S152 to step S154. After it is determined in step S154 that the IDLE switch is turned OFF, the flow returns to step S101. Note that the S-type F / B control using the target vehicle speed TGV set in step S134 or the D-type F / B control using the target vehicle distance TGD set in step S138 used, will be described in detail later with reference to the feedback program (which will be described later with reference to Figs. 9 to 11).

Die Schritte S142 bis S152 zeigen auch Bedingungen zum Löschen des Betriebs der automatischen Geschwindigkeitsregelung. Ge­ nauer gesagt werden, wenn die gegenwärtige Fahrzeuggeschwindigkeit Vn niedriger als 40 km/h oder höher als 120 km/h wird (Schritt S142), wenn das Bremspedal nieder­ gedrückt wird (Schritt S144), oder wenn die Auswahleinheit 67 in den R-Bereich eingestellt wird (Schritt S146), das Flag SET, das anzeigt, daß die automatische Geschwindigkeitsrege­ lung ausgeführt wird, und das Flag RESUME, das anzeigt, daß die RESUME-Operation ausgeführt wird, in den Schritten S148 und S152 rückgesetzt. Wenn während der automatischen Geschwindigkeitsregelung detektiert wird, daß der Fahrer das Gaspedal niederdrückt (JA im Schritt S152), wird im Schritt S172 → Schritt S178 → Schritt S196 → Schritt S198 eine nor­ male Drosselregelung ausgeführt, damit sie eine Prioriät über eine Absicht des Fahrers hat, das Fahrzeug zu beschleunigen. Jedoch, da eine derartige Beschleunigungsoperation oft eine temporäre ist, wird der Betrieb der automatischen Geschwindigkeitsregelung nicht rückgesetzt. Genauer gesagt wird das Flag SET nicht rückgesetzt.Steps S142 to S152 also show conditions for canceling the automatic cruise control operation. More specifically, when the current vehicle speed V n becomes lower than 40 km / h or higher than 120 km / h (step S142), when the brake pedal is depressed (step S144), or when the selection unit 67 in the R- Range is set (step S146), the flag SET, which indicates that the automatic cruise control is being executed, and the flag RESUME, which indicates that the RESUME operation is being carried out, are reset in steps S148 and S152. If it is detected during the automatic cruise control that the driver depresses the accelerator pedal (YES in step S152), a normal throttle control is carried out in step S172 → step S178 → step S196 → step S198 so that it has priority over an intention of the driver to accelerate the vehicle. However, since such an accelerating operation is often a temporary one, the automatic cruise control operation is not reset. More specifically, the SET flag is not reset.

Wenn der EINSTELL-Schalter für 0.5 Sekunden oder länger ein­ geschaltet istWhen the SET switch is on for 0.5 seconds or longer is switched

Wenn der EINSTELL-Schalter für 0,5 Sekunden oder länger ein­ geschaltet gehalten wird, interpretiert dieses System zur automatischen Geschwindigkeitsregelung diese Operation da­ hingehend, daß der Fahrer beabsichtigt, das Fahrzeug zu be­ schleunigen. Daher wird in diesem Fall ein Soll-Dros­ selöffnungsgrad bestimmt, der das Fahrzeug von der Fahrzeug­ geschwindigkeit Vn zu jener Zeit mit einer vorbestimmten Beschleunigung beschleunigen kann, und die S-Typ-F/B-Regelung wird zwangsweise begonnen.If the SET switch is held on for 0.5 seconds or longer, this automatic cruise control system interprets this operation as meaning that the driver intends to accelerate the vehicle. Therefore, in this case, a target throttle opening degree is determined that can accelerate the vehicle from the vehicle speed V n at that time with a predetermined acceleration, and the S-type F / B control is forcibly started.

Genauer gesagt wird im Schritt S110 der Soll-Drosselöffnungs­ grad TG gemäß der Fahrzeuggeschwindigkeit Vn zu jener Zeit in Übereinstimmung mit den in Fig. 8 gezeigten Kennlinien be­ rechnen. Dieser Soll-Drosselöffnungsgrad TG läßt zu, daß ein Fahrzeug mit einer vorbestimmten Beschleunigung ª beim Fahren des Fahrzeugs auf einer flachen Straße beschleunigt wird (siehe Fig. 8). Weiterhin geht die Regelung aufeinanderfol­ gend weiter zu Schritt S112 (Fig. 4) → Schritt S118 → Schritt S120 → Schritt S121. Im Schritt S121 wird das Flag DV zurückgesetzt, um zu speichern, daß die folgende Regelung basierend auf der S-Typ-F/B-Steuerung auszuführen ist. Der Ablauf geht dann weiter zum Schritt S122 (Fig. 6), und der Drosselöffnungsgrad TG, der die Beschleunigung ª erhalten kann, wird zu dem Gaspedal 43 ausgegeben.More specifically, in step S110, the target throttle opening degree TG is calculated according to the vehicle speed V n at that time in accordance with the characteristics shown in FIG. 8. This target throttle opening degree TG allows a vehicle to be accelerated with a predetermined acceleration ª when driving the vehicle on a flat road (see FIG. 8). Furthermore, the control sequentially proceeds to step S112 ( FIG. 4) → step S118 → step S120 → step S121. In step S121, the flag DV is reset to store that the following control is to be carried out based on the S-type F / B control. The process then proceeds to step S122 ( FIG. 6), and the throttle opening degree TG, which can receive the acceleration ª, is output to the accelerator pedal 43 .

Man beachte, daß im Schritt S112 das Flag DV geprüft wird, und in Abhängigkeit von der S-Typ-F/B-Regelung oder der D-Typ-F/B- Regelung wird der gegenwärtige Fahrzeugabstand Dn in dem Regi­ ster TGD gespeichert (Schritt S116) oder die gegenwärtige Fahrzeuggeschwindigkeit Vn wird in den Registern TGV und MTGV gespeichert (Schritte S118 und S120). Wenn jedoch im Schritt S114 eingeschätzt wird, daß sich die Funktion des Sensors für einen Fahrzeugabstand beispielsweise aufgrund von Regen (Flag FAIL = 1) verschlechtert, oder wenn das Fahrzeug voraus fehlt (Flag VF = 1), geht der Ablauf auch dann, wenn die D-Typ-F/B- Regelung gerade ausgeführt wird (DV = 1), zwangsweise weiter zum Schritt S118, um die gegenwärtige Fahrzeuggeschwindigkeit Vn in den Registern TGV und MTGV einzustellen.Note that the flag DV is checked in step S112, and depending on the S-type F / B control or the D-type F / B control, the current vehicle distance D n is stored in the register TGD (Step S116) or the current vehicle speed V n is stored in the registers TGV and MTGV (steps S118 and S120). However, if it is judged in step S114 that the function of the vehicle distance sensor deteriorates due to rain, for example (flag FAIL = 1), or if the vehicle is missing ahead (flag VF = 1), the process continues even if the D type F / B control is currently being executed (DV = 1), forcibly proceeding to step S118 to set the current vehicle speed V n in the TGV and MTGV registers.

Auch nachdem der EINSTELL-Schalter freigegeben ist, geht die Ablauffolge, da das Flag SET im Schritt S106 schon gesetzt worden ist, aufeinanderfolgend weiter zu Schritt S104 → Schritt S140 → Schritt S142 → Schritt S144 → Schritt S146 → S152 Schritt S154. Die Regelung, die auszuführen ist, wenn das Flag SET gesetzt ist, wird gemäß der Regelungs-Ablauffolge ausgeführt, die in den Flußdiagrammen der Fig. 9 bis 11 ge­ zeigt ist, die eine "Rückkoppel-Regelung" zeigen. Even after the SET switch is released, since the flag SET has already been set in step S106, the sequence continues sequentially to step S104 → step S140 → step S142 → step S144 → step S146 → S152 step S154. The control to be performed when the SET flag is set is carried out in accordance with the control sequence shown in the flowcharts of FIGS . 9 to 11, which show "feedback control".

Wenn der WIEDERAUFNAHME-Schalter eingeschaltet istWhen the RESUME switch is on

Nachfolgend wird, ein Fall beschrieben, bei dem der WIEDERAUFNAHME-Schalter niedergedrückt ist.The following describes a case where the RESUME switch is depressed.

In diesem Fall geht der Ablauf aufeinanderfolgend weiter zu Schritt S101 (Fig. 3) → Schritt S102 → Schritt S104 → Schritt S140 → Schritt S172 (Fig. 5) → Schritt S176, und das Flag RESUME wird im Schritt S176 gesetzt. Ein Dros­ selöffnungsgrad TG, der eine vorbestimmte Beschleunigung ª in bezug zu der gegenwärtigen Fahrzeuggeschwindigkeit Vn erhalten kann, wird im Schritt S184 bestimmt, und der bestimmte TG wird im Schritt S122 zu dem Gaspedal 43 ausgegeben.In this case, the flow proceeds sequentially to step S101 ( Fig. 3) → step S102 → step S104 → step S140 → step S172 ( Fig. 5) → step S176, and the flag RESUME is set in step S176. A throttle opening degree TG that can obtain a predetermined acceleration ª with respect to the current vehicle speed V n is determined in step S184, and the determined TG is output to the accelerator pedal 43 in step S122.

Wenn das Flag RESUME einmal gesetzt ist, geht der Ablauf auch nachdem der WIEDERAUFNAHME-Schalter ausgeschaltet ist, aufein­ anderfolgend weiter zu Schritt S172 → Schritt S180 → Schritt S178 → . . . → Schritt S184 → Schritt S186. Dann wird diese Operation fortgeführt, bis im Schritt S182 bestimmt wird, daß die Fahrzeuggeschwindigkeit in einen Bereich von ± 3 km/h von der Soll-Fahrzeuggeschwindigkeit TGV fällt (in dem Fall der S-Typ-F/B-Regelung), oder bis im Schritt S190 bestimmt wird, daß der Abstand zwischen Fahrzeugen in einen Bereich von ± 1 m von dem Soll-Fahrzeugabstand TGD fällt (in dem Fall der D-Typ- F/B-Regelung). Genauer ausgedrückt wird die Beschleunigung oder das Abbremsen durchgeführt, bis der Fahrzeugabstand wied­ er den Soll-Fahrzeugabstand TGD erreicht, der im Schritt S138 gespeichert ist, und zwar in dem Fall der D-Typ-F/B-Regelung (JA im Schritt S180), oder bis die Fahrzeuggeschwindigkeit wieder die Soll-Fahrzeuggeschwindigkeit TGV erreicht, die im Schritt S134 eingestellt ist, und zwar in dem Fall der S-Typ- F/B-Regelung (NEIN im Schritt S180).Once the RESUME flag is set, the process also goes after the RESUME switch is off otherwise, proceed to step S172 → step S180 → step S178 →. . . → step S184 → step S186. Then this one Operation continues until it is determined in step S182 that the vehicle speed in a range of ± 3 km / h from the target vehicle speed TGV falls (in the case of S-type F / B control), or until it is determined in step S190, that the distance between vehicles in a range of ± 1 m falls from the target vehicle distance TGD (in the case of the D-type F / B control). Acceleration is more precisely expressed or braking until the vehicle distance again he reaches the target vehicle distance TGD, which in step S138 is stored, in the case of D-type F / B control (YES in step S180), or until the vehicle speed again reaches the target vehicle speed TGV, which in the Step S134 is set, in the case of the S-type F / B control (NO in step S180).

Während das Flag RESUME gesetzt ist (d. h. während die Fahr­ zeuggeschwindigkeit oder der Fahrzeugabstand wieder die Soll-Fahrzeuggeschwindigkeit oder den Soll-Fahrzeugabstand erreicht, wenn die Fahrzeuggeschwindigkeit oder der Fahrzeug­ abstand nahe an, die Soll-Fahrzeuggeschwindigkeit (Schritt S182) oder den Soll-Fahrzeugabstand (Schritt S190) gelangt, wird im Schritt S187 das Flag RESUME zurückgesetzt und das Flag SET wird gesetzt. Wenn das Flag SET gesetzt ist, wird dann der Drosselöffnungsgrad in Übereinstimmung mit der Rückkoppelregelung gesteuert, die in den Fig. 9 bis 11 gezeigt ist.While the RESUME flag is set (that is, while the vehicle speed or the vehicle distance again reaches the target vehicle speed or the target vehicle distance when the vehicle speed or the vehicle distance is close to the target vehicle speed (step S182) or the target vehicle distance (Step S190), the RESUME flag is reset and the SET flag is set in step S187, and when the SET flag is set, the throttle opening degree is controlled in accordance with the feedback control shown in Figs .

Im Schritt S192 wird geprüft, ob während der WIEDERAUF- NAHME-Operation bei der D-Typ-F/B-Regelung das eigene Fahrzeug dem Fahrzeug voraus über den Soll-Fahrzeugabstand hinaus zu nahe kommt. Bei diesem Ausführungsbeispiel wird geprüft, ob die folgende Beziehung erfüllt ist:In step S192, it is checked whether during the RETURN TAKE operation with D type F / B control your own vehicle ahead of the vehicle beyond the target vehicle distance comes close. In this embodiment, it is checked whether the following relationship is fulfilled:

Dn < TGD - 1 (1).D n <TGD - 1 (1).

Genauer gesagt wird, wenn der aktuelle Abstand zwischen Fahr­ zeugen Dn um 1 m oder mehr kleiner als der Soll-Fahrzeugabstand TGD wird, der Drosselöffnungsgrad im Schritt S194 erniedrigt, um das Fahrzeug abzubremsen.More specifically, when the current distance between vehicles D n becomes 1 m or more smaller than the target vehicle distance TGD, the throttle opening degree is lowered in step S194 to brake the vehicle.

Wenn der LEERLAUF-Schalter eingeschaltet istWhen the IDLE switch is on

Wenn der LEERLAUF-Schalter während der automatischen Geschwindigkeitsregelung eingeschaltet ist, wird das Fahrzeug abgebremst. Genauer ausgedrückt wird, wenn im Schritt S154 detektiert wird, daß der LEERLAUF-Schalter während der automa­ tischen Geschwindigkeitsregelung eingeschaltet ist, der Soll-Drosselöffnungsgrad TG im Schritt S156 auf 0 eingestellt, und der TG wird im Schritt S122 zu dem Gaspedal 43 ausgegeben, um das Fahrzeug abzubremsen. Zum Einstellen der Fahrzeug­ geschwindigkeit oder des Fahrzeugabstands zu dem Zeitpunkt des Niederdrückens des LEERLAUF-Schalters, damit sie oder er die Soll-Fahrzeuggeschwindigkeit TGV oder der Soll-Fahrzeugabstand TGD bei einer zukünftigen S-Typ-F/B-Regelung oder einer D-Typ- F/B-Regelung ist, wird die Fahrzeuggeschwindigkeit Vn oder der Fahrzeugabstand Dn in dem Register TGV oder TDG gespeichert (Schritt S162 oder S160).If the IDLE switch is turned on during automatic cruise control, the vehicle is braked. More specifically, when it is detected in step S154 that the IDLE switch is turned on during the automatic cruise control, the target throttle opening degree TG is set to 0 in step S156, and the TG is output to the accelerator pedal 43 in step S122 to to brake the vehicle. For setting the vehicle speed or the vehicle distance at the time the IDLE switch is depressed so that he or she can set the target vehicle speed TGV or the target vehicle distance TGD in a future S-type F / B control or a D-type F / B control, the vehicle speed V n or the vehicle distance D n is stored in the register TGV or TDG (step S162 or S160).

S-Typ-F/B-RegelungS-type F / B control

Bei diesem System wird, wenn der Fahrer den EINSTELL-Schalter niederdrückt, das Flag SET gesetzt (Schritt S106), und eine automatische Geschwindigkeitsregelung wird gemäß der S-Typ- F/B-Regelung ausgeführt, die die Fahrzeuggeschwindigkeit zu jenem Zeitpunkt als Soll-Fahrzeuggeschwindigkeit benutzt (Schritt S134). Genauer ausgedrückt ist die S-Typ-F/B- Regelung eine Voreinstellungsregelung. Der Grund dafür, warum die S-Typ-F/B-Regelung eine Voreinstellungsregelung ist, be­ steht darin, daß bei einem Initialisierungsverfahren im Schritt S170 sowohl das Flag DV als auch ein Flag LCKON rückgesetzt werden. Andererseits wird, wenn der Fahrer den WIEDERAUFNAHME-Schalter niederdrückt, eine Beschleunigung oder ein Abbremsen gegenüber der zuvor eingestellten Soll-Fahrzeug­ geschwindigkeit durchgeführt (Schritt S184). Nachdem die Fahrzeuggeschwindigkeit die Soll-Fahrzeuggeschwindigkeit er­ reicht hat (JA im Schritt S182), wird das Flag SET im Schritt S187 gesetzt, um die S-Typ-F/B-Regelung auszuführen. Genauer ausgedrückt wird, auch wenn die automatische Geschwindigkeitsregelung durch Niederdrücken des WIEDERAUFNAHME-Schalters gestartet wird, nachdem die Fahrzeug­ geschwindigkeit die Soll-Fahrzeuggeschwindigkeit erreicht hat, die S-Typ-F/B-Regelung auf dieselbe Weise wie in einem Fall ausgeführt, in dem die automatische Geschwindigkeitsregelung durch Niederdrücken des EINSTELL-Schalters gestartet wird.With this system, when the driver presses the SET switch depresses, the flag SET is set (step S106), and one automatic speed control is according to the S-type F / B control executed, which increases the vehicle speed used as the target vehicle speed at that time (Step S134). More specifically, the S-type F / B- Scheme a preset scheme. The reason why the S-type F / B control is a default control, be is that in an initialization process in Step S170 both the DV flag and an LCKON flag be reset. On the other hand, if the driver RESUME switch depresses an acceleration or braking compared to the previously set target vehicle speed performed (step S184). after the Vehicle speed is the target vehicle speed has reached (YES in step S182), the flag SET becomes in step S187 set to perform S type F / B control. More accurate is expressed, even if the automatic Cruise control by depressing the RESUME switch is started after the vehicle speed has reached the target vehicle speed, the S-type F / B control in the same way as in one case executed in which the automatic speed control is started by pressing the SET button.

Fig. 12 zeigt den Verlauf der Regelung, wobei das Flag RESUME gesetzt ist, eine Fahrzeuggeschwindigkeit V sich erhöht (Beschleunigung), das Flag SET gesetzt ist (S-Typ-F/B- Regelungsoperation), da die Fahrzeuggeschwindigkeit V die Soll-Fahrzeuggeschwindigkeit TGV erreicht hat, wonach der Fahrzeugabstand zu dem Fahrzeug davor erniedrigt wird und das Flag DV gesetzt wird. Fig. 12 shows the variation of the scheme, wherein the RESUME flag is set, a vehicle speed V is increased (acceleration), the set flag is set (S-type F / B control operation), since the vehicle speed V, the target vehicle speed TGV has reached, after which the vehicle distance to the vehicle in front is reduced and the flag DV is set.

Die S-Typ-F/B-Regelung wird nachfolgend unter Bezugnahme auf die Flußdiagramme in den Fig. 9 bis 11 beschrieben.The S-type F / B control will be described below with reference to the flow charts in Figs. 9 to 11.

Die Flußdiagramme in den Fig. 9 bis 11 enthalten sowohl die S-Typ-F/B-Regelung als auch die D-Typ-F/B-Regelung. Eine Re­ chenoperation für die S-Typ-F/B-Regelung wird im Schritt S596 durchgeführt, und eine Rechenoperation für die D-Typ-F/B- Regelung wird im Schritt S566 durchgeführt. Die S-Typ-F/B- Regelung wird zuerst erklärt, Bedingungen zum Verschieben der Regelung von der S-Typ-F/B-Regelung zu der D-Typ-F/B-Regelung werden dann erklärt, und darauffolgend wird die D-Typ-F/B- Regelung erklärt.The flowcharts in FIGS . 9 through 11 include both the S-type F / B control and the D-type F / B control. An arithmetic operation for S-type F / B control is performed in step S596, and an arithmetic operation for D-type F / B control is performed in step S566. The S-type F / B control is first explained, conditions for shifting control from the S-type F / B control to the D-type F / B control are then explained, and then the D -Type F / B control explained.

Ausführung der S-Typ-F/B-RegelungExecution of the S-type F / B control

Der Soll-Drosselöffnungsgrad TG bei der S-Typ-F/B-Regelung ist definiert durch:The target throttle opening degree TG in the S-type F / B control is defined by:

TG = KvI × EvI (2)TG = K vI × E vI (2)

+ KvP × En (3)+ K vP × E n (3)

- KvP (Vn-1 - Vn) (4)- K vP (V n-1 - V n ) (4)

wobei KvI und KvP Regelkonstanten sind, und En berechnet wird durch:where K vI and K vP are control constants , and E n is calculated by:

En = TGV - Vn (5).E n = TGV - V n (5).

EvI ist der integrale Wert von En und wird berechnet durch:E vI is the integral value of E n and is calculated by:

EvI = EvI + En (6).E vI = E vI + E n (6).

Der Ausdruck (2) ist für eine integrale Regelung und hat einen Effekt zum Stabilisieren einer Rückkoppelregelung. Der Ausdruck (3) ist für eine proportionale Regelung, und der Aus­ druck (4) ist für eine Differenzierungsregelung. Beide dieser Ausdrücke haben einen Effekt, eine schnelle Konvergenz zu einem Sollwert zuzulassen. Die Ausdrücke (2) bis (4) werden in den Schritten S596 und S598 berechnet.Expression (2) is for integral control and has one Effect to stabilize a feedback control. Of the  Expression (3) is for proportional regulation, and the off pressure (4) is for differentiation control. Both of these Expressions have an effect of quick convergence too allow a setpoint. Expressions (2) to (4) are calculated in steps S596 and S598.

Nimmt man wieder Bezug auf Fig. 9, wird im Schritt S501 geprüft, ob das Flag SET gesetzt ist. Wenn die Antwort im Schritt S501 NEIN ist, wird in den Flußdiagrammen in den Fig. 9 bis 11 keine Verarbeitung ausgeführt. Genauer ausgedrückt wird entweder die S-Typ-F/B-Regelung oder die D-Typ-F/B- Regelung nur dann gestartet, wenn das Flag SET gesetzt ist.Referring again to FIG. 9, it is checked in step S501 whether the SET flag is set. If the answer in step S501 is NO, no processing is carried out in the flowcharts in Figs. 9 to 11. More specifically, either the S-type F / B control or the D-type F / B control is only started if the SET flag is set.

Nachfolgend wird ein Fall beschrieben, bei dem das Flag SET gesetzt ist.A case where the flag SET is set.

Im Schritt S502 wird ein Flag ISD geprüft. Das Flag ISD wird gesetzt, wenn die Regelung zum ersten Mal in den D-Typ-F/B- Regelbetrieb eintritt, und wird rückgesetzt, während die S-Typ-F/B-Regelung ausgeführt wird. Daher geht die Regelung weiter zum Schritt S504. Im Schritt S504 wird geprüft, ob der gegenwärtige Fahrzeugabstand Dn zu dem Fahrzeug voraus einem Abstand Ds nahegekommen ist, was ein Ausführen der D-Typ-F/B- Regelung zuläßt. Nachdem die automatische Geschwindigkeits­ regelung gestartet ist, wird die folgende Beziehung für eine Weile beibehalten (JA im Schritt S504):A flag ISD is checked in step S502. The ISD flag is set when the control first enters the D-type F / B control mode and is reset while the S-type F / B control is being executed. Therefore, control goes to step S504. In step S504, it is checked whether the current vehicle distance D n to the vehicle ahead has come close to a distance D s , which allows the D-type F / B control to be carried out. After the automatic cruise control is started, the following relationship is maintained for a while (YES in step S504):

Dn < Ds (7).D n <D s (7).

Daher geht der Ablauf zum Schritt S506 weiter. Im Schritt S506 wird ein Flag ISV geprüft. Das Flag ISV wird gesetzt, wenn die Regelung zum ersten Mal in den S-Typ-F/B-Regelbetrieb eintritt, und somit geht die Regelung vom Schritt S506 zum Schritt S508 weiter. Genauer ausgedrückt, werden die Schritte S508 bis S518 jedesmal ausgeführt, wenn die Regelung zum ersten Mal in den S-Typ-F/B-Regelbetrieb eintritt. Therefore, the flow advances to step S506. In step A flag ISV is checked in S506. The ISV flag is set when the control is in S-type F / B control mode for the first time occurs, and thus control goes from step S506 to Step S508 continues. More specifically, the steps S508 to S518 executed every time the control for enters S-Type F / B regular operation for the first time.  

Im Schritt S508 werden der integrale Wert EvI im Ausdruck (2) und ein integraler Wert EdI (der später beschrieben wird) für die D-Typ-F/B-Regelung auf Null initialisiert. In den Schritten S510, S512 und S518 werden jeweils die Flags ISD, DV und ISF rückgesetzt. Im Schritt S516 wird das Flag ISV auf 1 gesetzt, um zu speichern, daß die Regelung gerade in den S-Typ-F/B-Regelbetrieb eingetreten ist. Dann geht der Ablauf weiter zum Schritt S592 (Fig. 11).In step S508, the integral value E vI in expression (2) and an integral value E dI (which will be described later) for the D-type F / B control are initialized to zero. In steps S510, S512 and S518, the flags ISD, DV and ISF are reset. In step S516, the ISV flag is set to 1 to store that the control has just entered the S-type F / B control mode. Then, the flow advances to step S592 ( Fig. 11).

Die Abweichung zwischen der Fahrzeuggeschwindigkeit Vn und der Soll-Fahrzeuggeschwindigkeit TGV wird gemäß Gleichung (5) im Schritt S592 berechnet, die integrale Variable EvI wird gemäß Gleichung (6) im Schritt S594 berechnet, und ein Soll-Dros­ selöffnungsgrad wird gemäß den Ausdrücken (2) bis (4) in den Schritten S596 und S598 berechnet. Im Schritt S602 wird eine Informationsnachricht, die anzeigt, daß das Fahrzeug ge­ genwärtig in dem S-Typ-F/B-Regelbetrieb fährt, für den Fahrer angezeigt. Im Schritt S606 wird der Soll-Drosselöffnungsgrad TG zu dem Gaspedal 43 ausgegeben.The deviation between the vehicle speed V n and the target vehicle speed TGV is calculated in accordance with equation (5) in step S592, the integral variable E vI is calculated in accordance with equation (6) in step S594, and a target throttle opening degree is calculated in accordance with the expressions (2) to (4) calculated in steps S596 and S598. In step S602, an information message indicating that the vehicle is currently running in the S-type F / B control mode is displayed to the driver. In step S606, the target throttle opening degree TG is output to the accelerator pedal 43 .

Wenn das Flag ISV einmal gesetzt ist, da im Schritt S506 JA bestimmt wird, solange wie der Fahrzeugabstand Dn zu dem Fahr­ zeug voraus den Abstand Ds überschreitet (was die D-Typ-F/B- Regelung zuläßt) (Dn < Ds), akkumuliert die integrale Variable EvI die Abweichungen von Dn von der Soll-Fahrzeuggeschwindig­ keit TGV (Schritt S594). Fig. 13 zeigt einen Zustand, in dem die Fahrzeuggeschwindigkeit Vn nahe zu der Soll-Fahrzeuggesch­ windigkeit TGV gelangt und zu TGV konvergiert. Genauer aus­ gedrückt erhöht sich die integrale Variable EvI, während die Fahrzeuggeschwindigkeit Vn kleiner als der Sollwert TGV ist. Jedoch dann, wenn die Fahrzeuggeschwindigkeit Vn zu dem Soll­ wert TGV konvergiert, konvergiert auch die integrale Variable EvI zu einem konstanten Wert. Once the ISV flag is set because YES is determined in step S506 as long as the vehicle distance D n to the vehicle ahead exceeds the distance D s (which allows the D-type F / B control) (D n < D s ), the integral variable E vI accumulates the deviations of D n from the target vehicle speed TGV (step S594). Fig. 13 shows a state in which the vehicle speed V n comes close to the target vehicle speed TGV and converges to TGV. Expressed more precisely, the integral variable E vI increases , while the vehicle speed V n is less than the target value TGV. However, when the vehicle speed V n converges to the target value TGV, the integral variable E vI also converges to a constant value.

Verschieben zu der D-Typ-F/B-RegelungMove to the D-type F / B control

Wenn die Soll-Fahrzeuggeschwindigkeit TGV höher als die Fahr­ zeuggeschwindigkeit des Fahrzeugs voraus ist, holt das eigene Fahrzeug das Fahrzeug voraus schließlich ein. In diesem Zu­ stand wird im Schritt S504 NEIN bestimmt, und der Ablauf geht weiter zum Schritt S520.If the target vehicle speed TGV is higher than the driving speed of the vehicle is ahead, catches up with your own Finally drive the vehicle ahead. In this To NO is determined in step S504, and the flow goes go to step S520.

Nachdem in den Schritten S520 und S528 bestätigt ist, daß die Funktion des Sensors für einen Fahrzeugabstand nicht ver­ schlechtert ist (FAIL = 0) und der Blick auf das Fahrzeug vor­ aus nicht aufgrund einer Nickbewegung des eigenen Fahrzeugs (VF = 0) fehlt, geht der Ablauf weiter zum Schritt S540 (Fig. 10), um zu prüfen, ob das Fahrzeug eine Kurve fährt (FLAG TRN = 1). Der Einfachheit halber nimmt man an, daß das eigene Fahrzeug geradeaus fährt. Danach geht die Regelung zum Schritt S542 weiter.After it is confirmed in steps S520 and S528 that the function of the sensor for a vehicle distance is not deteriorated (FAIL = 0) and the view of the vehicle is not missing due to a pitching movement of the own vehicle (VF = 0) the flow advances to step S540 ( FIG. 10) to check whether the vehicle is turning (FLAG TRN = 1). For the sake of simplicity, one assumes that the vehicle is driving straight ahead. Thereafter, control proceeds to step S542.

Im Schritt S542 wird ein Flag IST rückgesetzt. Da dieses Flag IST den Beginn der Drehoperation anzeigt, wird es während der Operation des Geradeausfahrens zurückgesetzt. Im Schritt S544 wird ein Flag ISD geprüft. Dieses Flag zeigt an, daß der Re­ gelbetrieb von der S-Typ-F/B-Regelung zu der D-Typ-F/B- Regelung verschoben wird. Daher geht die Steuerung weiter zum Schritt S546, da das Flag ISD jetzt rückgesetzt ist, weil der Fahrzeugabstand gegenwärtig in einen Abstandsbereich fällt, der die D-Typ-F/B-Regelung zuläßt. In den Schritten S546 bis S560 wird, da die Regelung in die D-Typ-F/B-Regelung eintritt, ein Soll-Fahrzeugabstand TGD eingestellt, und die integrale Variable EdI wird initialisiert.A flag IST is reset in step S542. Since this flag IST indicates the start of the turning operation, it is reset during the straight-ahead operation. A flag ISD is checked in step S544. This flag indicates that the control operation is shifted from the S-type F / B control to the D-type F / B control. Therefore, control proceeds to step S546 since the ISD flag is now reset because the vehicle distance currently falls within a distance range that allows D-type F / B control. In steps S546 to S560, since the control enters the D-type F / B control, a target vehicle distance TGD is set, and the integral variable E dI is initialized.

Genauer ausgedrückt wird im Schritt S546 geprüft, wie viele Male der Soll-Fahrzeugabstand TGD zuvor gelernt wurde. Das Lernen wird später beschrieben. In diesem Fall ist die Anzahl nÿ von Malen des Lernens klein und es ist folgendes angenommen:More specifically, it is checked in step S546 how many times the target vehicle distance TGD was previously learned. The learning will be described later. In this case the number n ÿ of times of learning is small and the following is assumed:

nÿ < ns (8)n ÿ <n s (8)

wobei ns eine vorbestimmte Konstante ist, die die Anzahl von Malen des Lernens darstellt, die durch Erfahrung bestimmt ist. Dann geht der Ablauf von einem Schritt S546 zu einem Schritt S550 weiter, und der Soll-Fahrzeugabstand TGD wird auf einen Abstand Dss eingestellt, der ein Erfahrungswert ist. Im Schritt S552 wird. EdI auf 0 rückgesetzt, um der Regelung die Tatsache zu zeigen, daß die Regelung erneut in die D-Typ-F/B- Regelung eingetreten ist. In den Schritten S554 und S556 werden die Flags IST und ISV rückgesetzt. Im Schritt S558 wird das Flag DV auf 1 gesetzt, um zu speichern, daß die Rege­ lung zu der D-Typ-F/B-Regelung vorschoben ist. Im Schritt S560 wird das Flag ISD auf 1 gesetzt, um zu speichern, daß ein Initialisieren (Schritt S552) zum Starten der D-Typ-F/B- Regelung beendet ist. In den Schritten S562 bis S566 wird eine Rechenoperation für die D-Typ-F/B-Regelung durchgeführt.where n s is a predetermined constant representing the number of times of learning determined by experience. Then, the process proceeds from a step S546 to a step S550, and the target vehicle distance TGD is set to a distance D ss that is an experience value. In step S552. E dI reset to 0 to show the control that the control has reentered the D-type F / B control. In steps S554 and S556, the flags IST and ISV are reset. In step S558, the flag DV is set to 1 to store that the control is advanced to the D-type F / B control. In step S560, the flag ISD is set to 1 to store that initialization (step S552) for starting the D-type F / B control is finished. In steps S562 to S566, an arithmetic operation for the D-type F / B control is performed.

Der Soll-Drosselöffnungsgrad TG in dem D-Typ-F/B-Regelbetrieb ist definiert durch:The target throttle opening degree TG in the D-type F / B control operation is defined by:

TG = KdI × EdI (10)TG = K dI × E dI (10)

+ KdP × En (11)+ K dP × E n (11)

- KdD (DN-1 - Dn) (12)- K dD (D N-1 - D n ) (12)

wobei KdI und KdD Regelkonstanten sind und En und EdI definiert sind durch:where K dI and K dD are control constants and E n and E dI are defined by:

En = TGD - Dn (13)E n = TGD - D n (13)

EdI = EdI + En (14).E dI = E dI + E n (14).

Wie bei der S-Typ-F/B-Regelung ist der Ausdruck (10) der inte­ grale Regelausdruck und hat einen Effekt zum Stabilisieren der Rückkoppelregelung. Der Ausdruck (11) ist der Proportional- Regelausdruck und hat einen Effekt, eine schnelle Konvergenz zu einem Sollwert zuzulassen. Der Ausdruck (12) ist für eine Differenzierungsregelung.As with the S-type F / B control, expression (10) is the inte grail rule expression and has an effect to stabilize the Feedback control. Expression (11) is the proportional Rule expression and has an effect of rapid convergence  to allow for a setpoint. Expression (12) is for one Differentiation scheme.

In den Schritten S568 bis S574 wird geprüft, ob das Fahrzeug voraus als ein Sollwert innerhalb eines Bereichs des Soll-Fahrzeugabstands enthalten bzw. verriegelt ist. Genauer ausgedrückt wird im Schritt S568 der Zustand des Flags LCKON geprüft, das anzeigt, daß das Fahrzeug voraus verriegelt ist. Wenn das Flag LCKON schon gesetzt worden ist, geht der Ablauf weiter zum Schritt S576; andererseits wird im Schritt S570 geprüft, ob der aktuelle Fahrzeugabstand Dn nahe zu dem Soll-Fahrzeugabstand TGD gekommen ist. Genauer ausgedrückt wird, wenn die folgende Beziehung erfüllt ist, bestimmt, daß der aktuelle Fahrzeugabstand Dn nahe zu dem Soll-Fahrzeugab­ stand TGD gekommen ist:In steps S568 to S574, it is checked whether the vehicle is contained or locked in advance as a target value within a range of the target vehicle distance. More specifically, in step S568, the state of the flag LCKON is checked, which indicates that the vehicle is locked ahead. If the LCKON flag has already been set, the flow advances to step S576; on the other hand, it is checked in step S570 whether the current vehicle distance D n has come close to the target vehicle distance TGD. More specifically, when the following relationship is satisfied, it is determined that the current vehicle distance D n has come close to the target vehicle distance TGD:

|TGD - Dn| < D₀ (15)| TGD - D n | <D₀ (15)

wobei D₀ eine vorbestimmte Konstante ist. Daher wird, wenn im Schritt S570 JA bestimmt wird, das Flag LCKON im Schritt S572 auf 1 gesetzt; wenn im Schritt S570 NEIN bestimmt wird, wird das Flag LCKON im Schritt S574 auf 0 rückgesetzt. Im Schritt S576 wird der Soll-Drosselöffnungsgrad eingestellt. In den Schritten S600 und S604 wird eine Nachricht zum Anzeigen, daß die D-Typ-F/B-Regelung gerade ausgeführt wird, angezeigt. Im Schritt S606 wird TG zu dem Gaspedal 43 ausgegeben.where D₀ is a predetermined constant. Therefore, if YES is determined in step S570, the flag LCKON is set to 1 in step S572; if NO is determined in step S570, the flag LCKON is reset to 0 in step S574. In step S576, the target throttle opening degree is set. In steps S600 and S604, a message indicating that the D-type F / B control is being executed is displayed. In step S606, TG is output to the accelerator pedal 43 .

In dem in Fig. 12 gezeigten Zeitdiagramm wird das Flag ISD zu einer Zeit t₁ gesetzt, zu der Dn < Ds erfüllt ist, und das Flag LCKON wird zu einer Zeit t₂ gesetzt, zu der |TGD - Dn| < D₀ (D₀ ist eine Konstante) erfüllt ist.In the timing chart shown in Fig. 12, the flag ISD is set at a time t 1 at which D n <D s is satisfied, and the flag LCKON is set at a time t 2 at which | TGD - D n | <D₀ (D₀ is a constant) is satisfied.

Wenn das Flag ISD einmal gesetzt ist, geht der Ablauf aufein­ anderfolgend weiter zu Schritt S544 → Schritt S562 → Schritt S564, . . ., bis eine Dreh- bzw. Kurvenfahroperation durch­ geführt wird und die D-Typ-F/B-Regelung ausgeführt wird. Once the ISD flag is set, the process goes on otherwise, proceed to step S544 → step S562 → step S564,. . . until a turning or cornering operation is carried out is performed and the D-type F / B control is carried out.  

Fahrzeugabstand, der für einen Fahrer passend istVehicle distance that is suitable for a driver

Die Bedeutung des Schritts S548, der bei der D-Typ-F/B- Regelung ausgeführt wird, wird nachfolgend erklärt.The meaning of step S548, which in D-type F / B- Regulation is carried out is explained below.

Die "Gewohnheit" eines Fahrers wird beim Einstellen des Fahr­ zeugabstands bei der D-Typ-F/B-Regelung in starkem Maße in Betracht gezogen. Einige Fahrer stellen relativ große Fahr­ zeugabstände ein, und andere Fahrer stellen relativ kleine Fahrzeugabstände ein. Wie es oben beschrieben ist, stellt bei dem System dieses Ausführungsbeispiels das System den Soll-Fahrzeugabstand TGD im Schritt S550 auf einen stan­ dardmäßigen Fahrzeugabstand Dss ein. Jedoch wird gewünscht, daß das System einen Fahrzeugabstand automatisch entsprechend der Vorliebe eines Fahrers einstellt. Daher benutzt man bei diesem System im Schritt S548 einen Fahrzeugabstand [Dÿ], der durch eine andere Regelungs-Ablauffolge eingestellt wird (Fig. 14 und 15), als Soll-Fahrzeugabstand TGD. Wie der Fahrzeugab­ stand [Dÿ] einzustellen ist, wird nachfolgend unter Bezugnahme auf die Flußdiagramme der Fig. 14 und 15 beschrieben.The "habit" of a driver is taken into account to a large extent when setting the vehicle distance in the D-type F / B control. Some drivers set relatively large vehicle distances and other drivers set relatively small vehicle distances. As described above, in the system of this embodiment, the system uses the target vehicle distance TGD in step S550 to a stan dardmäßigen vehicle distance D ss. However, it is desired that the system automatically adjust a vehicle distance based on a driver's preference. Therefore, in this system, in step S548, a vehicle distance [D ÿ ], which is set by a different control sequence ( FIGS. 14 and 15), is used as the target vehicle distance TGD. How to set the vehicle distance [D ist ] is described below with reference to the flowcharts of FIGS . 14 and 15.

Wenn der vom Fahrer bevorzugte Fahrzeugabstand nicht mit dem standardmäßigen Fahrzeugabstand Dss übereinstimmt, der durch das System eingestellt wird, resultiert diese fehlende Über­ einstimmung in häufigen Löschoperationen des Betriebs zur automatischen Geschwindigkeitsregelung. Dies ist so, weil der Regelbetrieb zu Beginn der automatischen Geschwindigkeitsrege­ lung bei diesem System die S-Typ-F/B-Regelung ist. Danach wird dann, wenn der Fahrzeugabstand nahe zu dem Abstand Ds kommt, der die D-Typ-F/B-Regelung zuläßt, der Regelbetrieb zu der D-Typ-F/B-Regelung verschoben, und die D-Typ-F/B-Regelung wird zu dem standardmäßigen Fahrzeugabstand Dss fortgeführt. Daher drückt er oder sie das Bremspedal nieder, wenn der stan­ dardmäßige Fahrzeugabstand Dss zu klein für einen bestimmten Fahrer ist; wenn der Abstand Dss für den Fahrer zu groß ist, drückt er oder sie das Gaspedal nieder. Das Betätigen des Brems- oder Gaspedals löscht den Betrieb zur automatischen Geschwindigkeitsregelung.If the driver's preferred vehicle distance does not match the standard vehicle distance D ss that is set by the system, this lack of agreement results in frequent delete operations of the automatic cruise control operation. This is because the control mode at the start of the automatic cruise control in this system is the S-type F / B control. Thereafter, when the vehicle distance comes close to the distance D s that allows the D-type F / B control, the control operation is shifted to the D-type F / B control, and the D-type F / B control continues to the standard vehicle distance D ss . Therefore, he or she depresses the brake pedal when the standard vehicle distance D ss is too small for a particular driver; if the distance D ss is too large for the driver, he or she depresses the accelerator pedal. Pressing the brake or accelerator pedal clears the automatic cruise control mode.

Dieses System lernt die "Gewohnheit" eines Fahrers beim Ein­ stellen des Fahrzeugabstands in einem Beschleunigungszustand während eines Geradeausfahrens. Die Ablauffolge, die in den Flußdiagrammen der Fig. 14 und 15 gezeigt ist, wird parallel zu jener ausgeführt, die in den Fig. 9 bis 11 gezeigt ist.This system learns the "habit" of a driver when setting the vehicle distance in an acceleration state while driving straight ahead. The sequence shown in the flowcharts of FIGS . 14 and 15 is carried out in parallel with that shown in FIGS . 9 to 11.

Bei der in Fig. 14 gezeigten Regelungs-Ablauffolge wird im Schritt S902 bestimmt, daß der gegenwärtige Lenkwinkel Rn während einer Geradeausfahrt einer neutralen Position (= N) entspricht. Im Schritt S904 wird bestimmt, daß das Flag TRN, das anzeigt, daß gerade eine Drehoperation ausgeführt wird, rückgesetzt wird, und der Ablauf geht dann weiter zum Schritt S916 (Fig. 15). Im Schritt S916 wird ein Flag ACC geprüft, um zu bestimmen, ob eine Beschleunigungsoperation (Vn < Vn-1) ge­ startet wird. Während der Geschwindigkeitsregelung (NEIN im Schritt S916) geht der Ablauf aufeinanderfolgend weiter zu Schritt S916 → Schritt S940 → Schritt S930 → Schritt S934 → Schritt S936, um das Beschleunigungsflag ACC rückzusetzten, um einen Beschleunigungszeitgeber ACCTMR rückzusetzen, und um einen über die Beschleunigung akkumulierten Abstand Dt rückzusetzen.In the control sequence shown in FIG. 14, it is determined in step S902 that the current steering angle R n corresponds to a neutral position (= N) during straight travel. In step S904, it is determined that the flag TRN, which indicates that a turning operation is being performed, is reset, and the flow then advances to step S916 ( Fig. 15). In step S916, a flag ACC is checked to determine whether an acceleration operation (V n <V n-1 ) is started. During the cruise control (NO in step S916), the flow sequentially proceeds to step S916 → step S940 → step S930 → step S934 → step S936 to reset the acceleration flag ACC, to reset an acceleration timer ACCTMR, and a distance accumulated by the acceleration Reset D t .

Wenn im Schritt S940 detektiert wird, daß die Beschleunigungs­ operation gestartet ist (Vn < Vn-1), wird das Flag ACC im Schritt S942 gesetzt, um zu speichern, daß die Beschleuni­ gungsoperation gestartet ist. Die Fahrzeuggeschwindigkeit Vn zu Beginn der Beschleunigungsoperation wird im Schritt S944 in einem Register VSPST gespeichert, und der Zeitgeber ACCTMR zum Speichern der Anzahl von Malen der Detektion des Beschleuni­ gungszustands wird im Schritt S946 um 1 inkrementiert. Im Schritt S948 wird der Fahrzeugabstand Dn zu den Inhalten des Registers Dt addiert. Genauer ausgedrückt wird im Schritt S948 die folgende Berechnung durchgeführt:If it is detected in step S940 that the acceleration operation has started (V n <V n-1 ), the flag ACC is set in step S942 to store that the acceleration operation has started. The vehicle speed V n at the start of the acceleration operation is stored in a register VSPST in step S944, and the timer ACCTMR for storing the number of times of detection of the acceleration state is incremented by 1 in step S946. In step S948, the vehicle distance D n is added to the contents of the register D t . More specifically, the following calculation is performed in step S948:

Dt = Dt + Dn (16).D t = D t + D n (16).

Das Register Dt akkumuliert den Fahrzeugabstand, nachdem die Beschleunigungsoperation gestartet ist.The register D t accumulates the vehicle distance after the acceleration operation is started.

Wenn das Beschleunigungsflag ACC einmal gesetzt ist, geht der Ablauf aufeinanderfolgend weiter zu Schritt S902 (Fig. 14) → Schritt S904 → Schritt S916 (Fig. 15) → Schritt S918 → Schritt S946 → Schritt S948, solange wie die Fahrzeugge­ schwindigkeit sich nicht verringert (Vn < VN-1). Somit wird der Zeitgeber ACCTMR hochgezählt, und der Fahrzeugabstand wird in dem Register Dt akkumuliert.Once the acceleration flag ACC is set, the flow proceeds sequentially to step S902 ( Fig. 14) → step S904 → step S916 ( Fig. 15) → step S918 → step S946 → step S948 as long as the vehicle speed does not decrease (V n <V N-1 ). Thus, the ACCTMR timer is counted up and the vehicle distance is accumulated in the register D t .

Wenn das Abbremsen des Fahrzeugs (VnVn-1) im Schritt S918 detektiert wird, wird die Fahrzeuggeschwindigkeit Vn zu jener Zeit im Schritt S920 in einem Register VSPEND gespeichert. Das Register VSPEND speichert die Fahrzeuggeschwindigkeit am Ende der Beschleunigungsoperation. In Schritt S922 wird während einer Beschleunigungsperiode eine durchschnittliche Fahrzeuggeschwindigkeit Vm als ein Durchschnittswert der Fahr­ zeuggeschwindigkeit VSPST zu Beginn der Beschleunigungsopera­ tion und der Fahrzeuggeschwindigkeit VSPEND am Ende der Be­ schleunigungsoperation auf der Basis der folgenden Gleichung berechnet:At that time, when the vehicle braking (V n V n-1 ) is detected in step S918, the vehicle speed V n is stored in a register VSPEND. The VSPEND register stores the vehicle speed at the end of the acceleration operation. In step S922, during an acceleration period, an average vehicle speed V m is calculated as an average value of the vehicle speed VSPST at the start of the acceleration operation and the vehicle speed VSPEND at the end of the acceleration operation based on the following equation:

Vm = (VSPST + VSPEND)/2 (17).V m = (VSPST + VSPEND) / 2 (17).

Im Schritt S924 wird eine Durchschnittsbeschleunigung Gm während der Beschleunigungsperiode als die Differenz zwischen der Fahrzeuggeschwindigkeit VSPST zu Beginn der Beschleuni­ gungsoperation und der Fahrzeuggeschwindigkeit VSPEND am Ende der Beschleunigungsoperation auf der Basis der folgenden Glei­ chung berechnet:In step S924, an average acceleration G m during the acceleration period is calculated as the difference between the vehicle speed VSPST at the start of the acceleration operation and the vehicle speed VSPEND at the end of the acceleration operation based on the following equation:

Gmn = (VSPEND - VSPST)/ACCTMR (18).G m n = (VSPEND - VSPST) / ACCTMR (18).

Im Schritt S926 wird während der Beschleunigungsperiode ein durchschnittlicher Fahrzeugabstand Dm basierend auf der fol­ genden Gleichung berechnet:In step S926, an average vehicle distance D m is calculated during the acceleration period based on the following equation:

Dm = Dt/ACCTMR (19).D m = D t / ACCTMR (19).

Im Schritt S928 wird während der Beschleunigungsperiode der Fahrzeugabstand Dm gelernt. Der Fahrzeugabstand, der die Indi­ vidualität eines Fahrers reflektiert, verändert sich in Abhängigkeit von der Fahrzeuggeschwindigkeit und der Be­ schleunigung. Bei diesem System wird eine statistische Ge­ samtzahl bzw. Gesamtheit bzw. Population des Lernens des Fahr­ zeugabstands Dm in Übereinstimmung mit der durchschnittlichen Fahrzeuggeschwindigkeit Vm und der durchschnittlichen Be­ schleunigung Gm geändert.In step S928, the vehicle distance D m is learned during the acceleration period. The vehicle distance, which reflects the individuality of a driver, changes depending on the vehicle speed and the acceleration. In this system, a statistical total of the learning of the vehicle distance D m is changed in accordance with the average vehicle speed V m and the average acceleration G m .

Fig. 16 zeigt eine Klassifizierung der Population des Lernens des Fahrzeugabstands. Genauer ausgedrückt wird bei diesem System die Beschleunigung Gm in zwei Gruppen (große und kleine Beschleunigungen) klassifiziert, und die Fahrzeuggeschwindig­ keit Vm wird in zwei Gruppen (hohe und niedrige Geschwindig­ keiten) klassifiziert. Wie in Fig. 16 gezeigt ist, werden die Anzahl nÿ von Proben und ein gelernter durchschnittlicher Fahrzeugabstand [Dÿ] für jede der vier Populationen gelernt, d. h. eine Population (durch ein Suffix (1,1) dargestellt) der kleinen Beschleunigung Gm und der niedrigen Fahrzeuggeschwin­ digkeit Vm, eine Population (durch ein Suffix (1,2) darges­ tellt) der kleinen Beschleunigung Gm und der hohen Fahrzeuggeschwindigkeit Vm, eine Population (durch ein Suffix (2,1) dargestellt) der großen Beschleunigung Gm und der nied­ rigen Fahrzeuggeschwindigkeit Vm, und eine Population (durch ein Suffix (2,2) dargestellt) der großen Beschleunigung Gm und der hohen Fahrzeuggeschwindigkeit Vm. Genauer ausgedrückt wird die Anzahl nÿ von Proben gemäß der folgenden Gleichung in jeder Periode vom Beginn bis zum Ende der Beschleunigung gelernt: Fig. 16 is a classification of the population of learning shows the vehicle distance. More specifically, in this system, the acceleration G m is classified into two groups (large and small accelerations), and the vehicle speed V m is classified into two groups (high and low speeds). As shown in Fig. 16, the number n ÿ of samples and a learned average vehicle distance [D ÿ ] are learned for each of the four populations, ie a population (represented by a suffix ( 1,1 )) of the small acceleration G m and the low vehicle speed V m , a population (represented by a suffix ( 1,2 )) of the small acceleration G m and the high vehicle speed V m , a population (represented by a suffix ( 2,1 )) of the large acceleration G m and the low vehicle speed V m , and a population (represented by a suffix ( 2.2 )) of the large acceleration G m and the high vehicle speed V m . More specifically, the number n ÿ of samples is learned according to the following equation in each period from the start to the end of the acceleration:

nÿ = nÿ + 1 (20).n ÿ = n ÿ + 1 (20).

Der durchschnittliche Fahrzeugabstand wird gemäß der folgenden Gleichung gelernt:The average vehicle distance is as follows Learned equation:

[Dÿ] = (Dÿ + Dm)/nÿ (21).[D ÿ ] = (D ÿ + D m ) / n ÿ (21).

Wenn der durchschnittliche Fahrzeugabstand [Dÿ] durch Ändern der Population entsprechend der durchschnittlichen Fahrzeug­ geschwindigkeit Vm und der durchschnittlichen Beschleunigung Gm gelernt wird, wie es oben beschrieben ist, kann der gelernte Abstand [Dÿ] das Verhalten eines Fahrers reflektieren. Fig. 17 zeigt das Konzept des Lernens des Soll-Fahrzeugabstands während der Beschleunigungsperiode. Wenn die Anzahl nÿ von Malen des Lernens ausreichend groß wird, wird, da die Lernge­ nauigkeit verbessert werden kann, der Soll-Fahrzeugabstand [Dÿ] im Schritt S548 in Fig. 10 durch Suchen in der Tabelle in Fig. 16 gemäß der durchschnittlichen Fahrzeuggeschwindigkeit und der durchschnittlichen Beschleunigung (die die letzten Einträge sind) erhalten, die zu jenem Zeitpunkt in den Regi­ stern Vm und Gm gespeichert sind. Es wird angenommen, daß der Abstand zwischen den Fahrzeugen [Dÿ], der am besten zu der "Gewohnheit" eines Fahrers paßt, entsprechend der durch­ schnittlichen Fahrzeuggeschwindigkeit und der durchschnitt­ lichen Beschleunigung zu jenem Zeitpunkt ist. Wenn die D-Typ- F/B-Regelung ausgeführt wird, um einen derartigen Fahrzeug­ abstand [Dÿ] als einen Soll-Abstand zu haben, kann eine ruhige D-Typ-F/B-Regelung automatisch ausgeführt werden. When the average vehicle distance [D y] is learned by changing the population according to the average vehicle speed V m and the average acceleration G m, as described above, the learned distance [D ÿ] The behavior can reflect a driver. Fig. 17 shows the concept of learning of the target inter-vehicle distance during acceleration period. If the number n ÿ of times of learning becomes sufficiently large, since the learning accuracy can be improved, the target vehicle distance [D ÿ ] in step S548 in FIG. 10 by searching the table in FIG. 16 according to the average Vehicle speed and average acceleration (which are the last entries) obtained at that time in the registers V m and G m . It is believed that the distance between the vehicles [D ÿ ] that best suits the "habit" of a driver is according to the average vehicle speed and the average acceleration at that time. When the D-type F / B control is carried out to have such a vehicle distance [D ÿ ] as a target distance, a quiet D-type F / B control can be carried out automatically.

Untersuchung des Dreh- bzw. Wende- bzw. KurvenfahrbetriebsInvestigation of turning, turning or cornering operations

Bei diesem System zur automatischen Geschwindigkeitsregelung wird dann, wenn eine Umgebung zuläßt, daß das Fahrzeug gleich­ zeitig die S-Typ-F/B-Regelung und die D-Typ-F/B-Regelung ausführt, vorzugsweise die D-Typ-F/B-Regelung ausgeführt. Dies erfolgt aus folgendem Grund. Solange wie nur die S-Typ- F/B-Regelung ausgeführt wird, nähert sich das eigene Fahrzeug bald dem Fahrzeug voraus, und eine unbequeme Operation zum Ändern der Einstellgeschwindigkeit ist erforderlich. Somit wird bei diesem Ausführungsbeispiel, wie es oben beschrieben ist, dann, wenn der Fahrzeugabstand in einen Abstandsbereich fällt, der ein Ausführen der D-Typ-F/B-Regelung während eines Ausführens der S-Typ-F/B-Regelung zuläßt, der Regelbetrieb zu der D-Typ-F/B-Regelung verschoben. Wenn jedoch das Fahrzeug während eines Ausführens der D-Typ-F/B-Regelung in eine Kurve eintritt, wird ein Weiterführen der D-Typ-F/B-Regelung nicht vorgezogen, da der Fahrzeugabstand von dem Fahrzeug voraus bei dem Eintritt in die Kurve zwangsweise beibehalten wird. Wei­ terhin kann bei der Kurve beispielsweise mit hoher Wahrschein­ lichkeit ein Seitenrand bzw. eine Leitplanke fehlerhaft als Fahrzeug voraus erkannt werden, und es ist weiterhin nicht vorzuziehen, die D-Typ-F/B-Regelung basierend auf dem fehler­ haft erkannten Fahrzeugabstand auszuführen. Somit wird bei diesem System dann, wenn das Fahrzeug während der D-Typ-F/B- Regelung in eine Kurve eintritt, der Regelbetrieb zu der S-Typ-F/B-Regelung geschaltet.With this system for automatic speed control becomes when an environment allows the vehicle to be the same the S-type F / B control and the D-type F / B control executes, preferably the D-type F / B control. This is because of the following reason. As long as just the S-type F / B control is carried out, the own vehicle approaches soon ahead of the vehicle, and an uncomfortable operation to Changing the setting speed is required. Consequently is in this embodiment as described above is when the vehicle distance is in a distance range that is performing D-type F / B control during a Carrying out the S-type F / B control allows the control operation to the D-type F / B control shifted. However, if the vehicle while executing D-type F / B control in a curve occurs, a continuation of the D-type F / B control will not preferred because the vehicle distance from the vehicle ahead at entry into the curve is forcibly maintained. Wei The curve may also have a high probability, for example a side edge or a guardrail faulty as Vehicle can be recognized ahead and it still isn't preferable the D-type F / B control based on the error recognized vehicle distance. Thus at this system if the vehicle during D-type F / B- Control enters a curve, the regular operation to the S-type F / B control switched.

Bei der S-Typ-F/B-Regelung während eines Drehens bzw. Kurven­ fahrens des Fahrzeugs ist die Soll-Fahrzeuggeschwindigkeit in Frage zu stellen. Die Soll-Fahrzeuggeschwindigkeit während eines Geradeausfahrens des Fahrzeugs ist für ein Fahrzeug zu hoch, das in einer Kurve fährt. Bei diesem System werden eine Geschwindigkeit VSPST bei dem Eingang der Kurve und eine Geschwindigkeit VSTEND bei dem Ausgang der Kurve gelernt, um automatisch eine Sicherheits-Soll-Fahrzeuggeschwindigkeit einzustellen, die zu der Vorliebe eines Fahrers paßt. Genauer ausgedrückt wird die Fahrzeuggeschwindigkeit Vn bei dem Eingang der Kurve derart bestimmt, daß sie eine zeitweilige Soll-Fahr­ zeuggeschwindigkeit TGV ist, und danach wird die Soll-Fahr­ zeuggeschwindigkeit TGV schrittweise mit einer Beschleunigung/Abbremsung Gÿ gemäß dem zuvor gelernten Ergeb­ nis erniedrigt.With the S-type F / B control while turning or cornering the vehicle, the target vehicle speed must be questioned. The target vehicle speed while the vehicle is traveling straight is too high for a vehicle that is traveling in a curve. In this system, a speed VSPST at the entry of the curve and a speed VSTEND at the exit of the curve are learned to automatically set a target safety vehicle speed that suits a driver's preference. More specifically, the vehicle speed V n at the entrance to the curve is determined to be a temporary target vehicle speed TGV, and then the target vehicle speed TGV is gradually decreased with an acceleration / deceleration G ÿ according to the previously learned result .

Dieses Untersuchungsprinzip der Drehoperation bei diesem Sys­ tem wird zuerst unter Bezugnahme auf die Flußdiagramme in den Fig. 14 und 15 beschrieben, und eine Verschiebelogik von der D-Typ-F/B-Regelung zu der S-Typ-F/B-Regelung und die S-Typ- F/B-Regeloperation während der Drehoperation wird darauffol­ gend beschrieben.This inspection principle of the turning operation in this system is first described with reference to the flowcharts in Figs. 14 and 15, and shift logic from D-type F / B control to S-type F / B control and the S-type F / B control operation during the turning operation will be described below.

Untersuchung der DrehoperationExamination of the turning operation

Im Schritt S902 in Fig. 14 wird durch Detektieren des Lenkwin­ kels Rn bestimmt, ob das Fahrzeug im Begriff ist, sich zu drehen, oder nicht. Wenn zum ersten Mal detektiert wird, daß der Lenkwinkel R nicht der neutralen Position entspricht, geht der Ablauf weiter zu Schritt S902 → Schritt S960 → Schritt S962, um das Flag TRN zu setzen, das anzeigt, daß eine Dreh­ operation ausgeführt wird. Der Fahrzeugabstand Dn an dem Ein­ gang der Kurve wird im Schritt S964 in einem Register DST ge­ speichert, und die Fahrzeuggeschwindigkeit Vn an dem Eingang der Kurve wird im Schritt S966 in einem Register VSPST gespei­ chert. Im Schritt S958 wird ein Zeitgeber TRNTMR, der eine Drehzeit angezeigt, inkrementiert. Weiterhin wird im Schritt S969 der gegenwärtige Lenkwinkel Rn in einem Register für einen maximalen Lenkwinkel MAXR gespeichert.In step S902 in FIG. 14, it is determined by detecting the steering angle R n whether the vehicle is about to turn or not. If it is first detected that the steering angle R does not correspond to the neutral position, the flow advances to step S902 → step S960 → step S962 to set the flag TRN, which indicates that a turning operation is being carried out. The inter-vehicle distance D n at which a transition of the curve is stored in step S964 in a register DST ge, and the vehicle speed V n at the entrance of the curve in step S966 in a register VSPST vomit chert. In step S958, a timer TRNTMR that indicates a rotation time is incremented. Furthermore, the current steering angle R n is stored in a register for a maximum steering angle MAXR in step S969.

Wenn das Flag TRN einmal gesetzt ist, bedeutet dies, daß eine Drehoperation ausgeführt wird, bis die Lenkradposition zu der neutralen Position zurückgebracht wird (Rn = N) . Der maximale Lenkwinkel MAXR wird erneuert (Schritt S972), und zwar durch Untersuchen, ob der Lenkwinkel Rn größer als das zuvor gespeicherte MAXR (Schritt S970) ist oder nicht, und zwar im Schritt S902 → Schritt S960. Im Schritt S974 wird der Dreh­ zeit-Zeitgeber TRNTMR inkrementiert.Once the TRN flag is set, it means that a turning operation is carried out until the steering wheel position is returned to the neutral position (R n = N). The maximum steering angle MAXR is renewed (step S972) by examining whether or not the steering angle R n is larger than the previously stored MAXR (step S970) in step S902 → step S960. In step S974, the rotation timer TRNTMR is incremented.

Wenn bestätigt wird, daß die Lenkwinkelposition zu der neu­ tralen Position zurückgebracht ist, geht der Ablauf weiter zu Schritt S902 → Schritt S904 → Schritt S906, um eine durchschnittliche Beschleunigung/Abbremsung G während des Drehens zu berechnen:If it is confirmed that the steering angle position is new central position is returned, the process continues Step S902 → Step S904 → Step S906 to one average acceleration / deceleration G during the To calculate turning:

G = (Vn - VSPST)/TRNMTR (22)G = (V n - VSPST) / TRNMTR (22)

wobei Vn die Fahrzeuggeschwindigkeit an dem Ausgang der Kurve ist. Daher stellt G in Gleichung (22) ein Erhöhen/Erniedrigen der Fahrzeuggeschwindigkeit während eines Drehens dar, und wenn G < 0 ist, dann stellt es die Beschleunigung dar; wenn G < 0 ist, stellt es das Abbremsen dar.where V n is the vehicle speed at the exit of the curve. Therefore, G in equation (22) represents an increase / decrease in vehicle speed during turning, and if G <0, it represents acceleration; if G <0, it represents braking.

Lernen während eines Kurvenfahrens bzw. DrehensLearn while cornering or turning

Im Schritt S908 wird die durchschnittliche Beschleunigung/Ab­ bremsung Gÿ gelernt. Dieses Lernen wird nachfolgend beschrieben.In step S908, the average acceleration / deceleration G ÿ is learned. This learning is described below.

Die Soll-Fahrzeuggeschwindigkeit TGV während eines Drehens des Fahrzeugs sollte die Individualität des Fahrers berücksich­ tigen. Wenn die Soll-Fahrzeuggeschwindigkeit derart einge­ stellt ist, daß sie die gelernte Fahrzeuggeschwindigkeit zu Beginn des Drehens ist, ändert sich die Fahrzeuggeschwindig­ keit stark, was die ruhige Bewegung stört. Aus diesem Grund ist es vorzuziehen, daß, wie es in Fig. 18 gezeigt ist, die aktuelle Fahrzeuggeschwindigkeit Vn zu jenem Zeitpunkt auf die Soll-Fahrzeuggeschwindigkeit TGV zu Beginn des Drehens (am Eingang einer Kurve) eingestellt wird, und danach die Fahr­ zeuggeschwindigkeit schrittweise zu der Soll-Fahrzeuggeschwin­ digkeit erniedrigt wird. Dies bedeutet, daß ein Lernen der Soll-Beschleunigung/-Abbremsung [Gÿ] bevorzugter als ein Lernen der Soll-Fahrzeuggeschwindigkeit ist. Dies ist so, weil sich die Vorliebe eines Fahrers in bezug zu der Be­ schleunigung/Abbremsung in Übereinstimmung mit der Ein­ gangs-Fahrzeuggeschwindigkeit Vn an dem Eingang einer Kurve und dem maximalen Lenkwinkel ändern sollte. Somit wird bei diesem System die Population zum Lernen der Soll-Beschleunigung/-Ab­ bremsung Gÿ in Übereinstimmung mit der Fahrzeuggeschwindigkeit VSPST an dem Eingang einer Kurve und dem maximalen Lenkwinkel MAXR während des Drehens geändert.The target vehicle speed TGV while turning the vehicle should take into account the individuality of the driver. If the target vehicle speed is set such that it is the learned vehicle speed at the start of turning, the vehicle speed changes greatly, which disturbs the smooth movement. For this reason, it is preferable that, as shown in Fig. 18, the current vehicle speed V n at that time is set to the target vehicle speed TGV at the start of turning (at the entrance of a curve), and then the vehicle speed is gradually reduced to the target vehicle speed. This means that learning the target acceleration / deceleration [G ÿ ] is more preferable than learning the target vehicle speed. This is because a driver's preference for acceleration / deceleration should change in accordance with the input vehicle speed V n at the entrance of a curve and the maximum steering angle. Thus, in this system, the population for learning the target acceleration / deceleration G ÿ is changed in accordance with the vehicle speed VSPST at the entrance of a curve and the maximum steering angle MAXR during turning.

Fig. 19 zeigt eine Klassifizierung von Populationen zum Lernen der Beschleunigung/Abbremsung G. Genauer ausgedrückt ist bei diesem System der maximale Lenkwinkel MAXR in zwei Gruppen (große und kleine Winkel) klassifiziert, und die Fahrzeug­ geschwindigkeit VSPST an dem Eingang einer Kurve ist in zwei Gruppen (hohe und niedrige Geschwindigkeiten) klassifiziert. Wie es in Fig. 19 gezeigt ist, wird die Anzahl cÿ von Proben bei jeder Population und die Beschleunigung/Abbremsung [Gÿ] für jede der vier Populationen gelernt, d. h. eine Population (dargestellt durch ein Suffix (1,1)) des kleinen maximalen Lenkwinkels MAXR und der niedrigen Eingangs-Fahrzeuggeschwin­ digkeit VSPST, eine Population (dargestellt durch ein Suffix (1,2)) des kleinen maximalen Lenkwinkels MAXR und der hohen Eingangs-Fahrzeuggeschwindigkeit VSPST, eine Population (dargestellt durch ein Suffix (2,1)) des großen maximalen Lenkwinkels MAXR und der niedrigen Eingangs-Fahrzeuggeschwin­ digkeit VSPST, und eine Population (dargestellt durch ein Suf­ fix (2,2)) des großen maximalen Lenkwinkels MAXR und der hohen Eingangs-Fahrzeuggeschwindigkeit VSPST. Genauer ausgedrückt wird beim Durchlaufen jeder Kurve die Anzahl cÿ von Proben gemäß der folgenden Gleichung gelernt: Fig. 19 shows a classification of populations for learning acceleration / deceleration G. More specifically, in this system, the maximum steering angle MAXR is classified into two groups (large and small angles), and the vehicle speed VSPST at the entrance of a curve is in two Groups (high and low speeds) classified. As shown in Fig. 19, the number c ÿ of samples in each population and the acceleration / deceleration [G ÿ ] for each of the four populations are learned, ie one population (represented by a suffix ( 1,1 )) of the small maximum steering angle MAXR and the low input vehicle speed VSPST, a population (represented by a suffix ( 1,2 )) the small maximum steering angle MAXR and high input vehicle speed VSPST, a population (represented by a suffix ( 2,1 )) the large maximum steering angle MAXR and the low input vehicle speed VSPST, and a population (represented by a Suf fix ( 2,2 )) the large maximum steering angle MAXR and the high input vehicle speed VSPST. More specifically, as each curve is traversed, the number c ÿ of samples is learned according to the following equation:

cÿ = cÿ + 1 (23)c ÿ = c ÿ + 1 (23)

und die Beschleunigung/Abbremsung wird gemäß der folgenden Gleichung gelernt:and the acceleration / deceleration is according to the following Learned equation:

[Gÿ] = (Gÿ + G)/cÿ (24).[G ÿ ] = (G ÿ + G) / c ÿ (24).

Wenn die Beschleunigung/Abbremsung [Gÿ] durch Ändern der Po­ pulation entsprechend dem Lenkwinkel MAXR und der Ein­ gangs-Fahrzeuggeschwindigkeit VSPST gelernt wird, kann die Beschleunigung/Abbremsung [Gÿ] die Gewohnheit eines Fahrers berücksichtigen bzw. reflektieren. Wenn die Anzahl cÿ von Malen des Lernens ausreichend groß wird, kann die Lerngenauig­ keit verbessert werden.If the acceleration / deceleration [G ÿ ] is learned by changing the population according to the steering angle MAXR and the input vehicle speed VSPST, the acceleration / deceleration [G ÿ ] can take into account or reflect a driver's habit. If the number c ÿ of times of learning becomes sufficiently large, the learning accuracy can be improved.

S-Typ-F/B-Regelung während eines DrehensS-type F / B control during turning

Eine Rückkoppelregelung zu Beginn der Drehoperation während der D-Typ-F/B-Regelung wird nachfolgend unter Bezugnahme auf die in den Fig. 9 bis 11 gezeigte Regelungs-Ablauffolge beschrieben.A feedback control at the start of the turning operation during the D-type F / B control will be described below with reference to the control sequence shown in FIGS. 9 to 11.

Wenn eine Drehoperation während der D-Typ-F/B-Regelung ge­ startet wird, da Flag SET = 1, Flag ISD = 1, Flag FAIL = 0, Flag VF = 0 und Flag TRN = 1 ist, geht die Regelung aufeinan­ derfolgend weiter zu Schritt S501 → Schritt S502 → Schritt S520 → Schritt S528 → Schritt S540 → Schritt S580. Im Schritt S580 wird ein Flag IST geprüft. Das Flag IST wird zum anfänglichen Regeln benutzt, um die Soll-Fahrzeuggeschwindig­ keit derart einzustellen, daß sie die Eingangs-Fahrzeugge­ schwindigkeit Vn ist, wenn sich der Fahrzeug-Fahrzustand von dem bis dahin durchgeführten Zustand des Geradeausfahrens zu dem Zustand des Kurvenfahrens ändert. Daher geht, da nun IST = 0 gilt, der Ablauf weiter zu Schritt S588, um die Soll-Fahr­ zeuggeschwindigkeit TGV derart einzustellen, daß sie die Ein­ gangs-Fahrzeuggeschwindigkeit Vn ist:If a turning operation is started during the D-type F / B control, since flag SET = 1, flag ISD = 1, flag FAIL = 0, flag VF = 0 and flag TRN = 1, the control goes sequentially go to step S501 → step S502 → step S520 → step S528 → step S540 → step S580. A flag IS is checked in step S580. The flag IST is used for initial control to set the target vehicle speed to be the input vehicle speed V n when the vehicle driving state changes from the straight running state to the cornering state up to that point. Therefore, since IST = 0, the flow goes to step S588 to set the target vehicle speed TGV to be the input vehicle speed V n :

TGV = Vn (25).TGV = V n (25).

Im Schritt S590 (Fig. 11) wird das Flag IST auf 1 gesetzt. In den Schritten S592 bis S606 wird die S-Typ-F/B-Regelung zu der Soll-Fahrzeuggeschwindigkeit TGV ausgeführt. Wenn das Flag IST einmal gesetzt ist, geht die Regelung weiter zu Schritt S580 → Schritt S582, und die Anzahl cÿ von Malen des Lernens wird im Schritt S582 geprüft, um zu bestimmen, ob ein Lernen ausreichend durchgeführt worden ist.In step S590 ( FIG. 11), the flag IST is set to 1. In steps S592 to S606, the S-type F / B control is carried out at the target vehicle speed TGV. Once the IST flag is set, control proceeds to step S580 → step S582, and the number c ÿ of times of learning is checked in step S582 to determine whether learning has been performed sufficiently.

Wenn die Anzahl von Malen des Lernens klein ist (NEIN im Schritt S582), wird die S-Typ-F/B-Regelung, die die Ein­ gangs-Fahrzeuggeschwindigkeit als die Soll-Fahrzeuggeschwin­ digkeit benutzt, ausgeführt. Jedoch dann, wenn die Anzahl von Malen des Lernens ausreichend groß wird (cÿ < cs), wird die Beschleunigung/Abbremsung [Gÿ] in Übereinstimmung mit dem maximalen Lenkwinkel MAXR und der Eingangs-Fahrzeuggeschwin­ digkeit VSPST zu jenem Zeitpunkt erhalten durch Suchen in der Tabelle in Fig. 19. Dann wird die Soll-Fahrzeuggeschwindig­ keit TGV gemäß der folgenden Gleichung erniedrigt:If the number of times of learning is small (NO in step S582), the S-type F / B control that uses the input vehicle speed as the target vehicle speed is executed. However, when the number of times of learning becomes sufficiently large (c ÿ <c s ), the acceleration / deceleration [G ÿ ] is obtained by searching in accordance with the maximum steering angle MAXR and the input vehicle speed VSPST at that time in the table in Fig. 19. Then, the target vehicle speed TGV is decreased according to the following equation:

TGV = TGV + [Gÿ] (26).TGV = TGV + [G ÿ ] (26).

Die Soll-Fahrzeuggeschwindigkeit TGV, die eingestellt wird, wie es oben beschrieben ist, soll zu der "Gewohnheit" des Fahrers am meisten in Übereinstimmung mit dem Lenkwinkel R und der Kurveneingangs-Fahrzeuggeschwindigkeit zu jener Zeit passen. Die S-Typ-F/B-Regelung, die diese Soll-Fahrzeugge­ schwindigkeit TGV benutzt, kann den Betrieb zur automatischen Geschwindigkeitsregelung während eines Intervalls von dem Ein­ gang zu dem Ausgang einer Kurve ruhig von der D-Typ-F/B- Regelung zu der S-Typ-F/B-Regelung verschieben. Nachdem der Regelbetrieb verschoben ist, kann eine ruhige S-Typ-F/B- Regelung, die zu der "Gewohnheit" des Fahrers paßt, automa­ tisch ausgeführt werden. The target vehicle speed TGV that is set as described above is said to be the "habit" of Driver most in accordance with the steering angle R and the cornering vehicle speed at that time fit. The S-type F / B control that this target vehicle gen speed used TGV, can operate automatically Cruise control during an interval from on going to the exit of a curve calmly from the D-type F / B- Shift control to S-type F / B control. After the Regular operation is postponed, a quiet S-type F / B- Regulation that fits the "habit" of the driver automa be carried out table.  

Regelung auf eine Verschlechterung des Signals hinRegulation on deterioration of the signal Untersuchung des Ausfalls eines Signals über einen FahrzeugabstandInvestigation of the loss of a signal over a Vehicle distance

Bei der Operation automatischen Geschwindigkeitsregelung ba­ sierend auf der D-Typ-F/B-Regelung ist es wichtig, den Fahr­ zeugabstand von dem Fahrzeug voraus immer zu detektieren. Zu diesem Zweck benutzt dieses System den Radarsensor 10 (Fig. 1). Jedoch, da die Fahrzeugkarosserie eine Nickbewegung auf einer aktuellen Straße macht, wird eine Licht- oder Schall­ welle, die von dem Sensor abgestrahlt wird, in starkem Maße nach oben oder nach unten gerichtet, und das abgestrahlte Licht (die Schallwelle) kann oft nicht das Fahrzeug voraus erreichen, oder die Welle, die durch das Fahrzeug voraus re­ flektiert wird, kann oft nicht zu dem Sensor 10 zurückgebracht werden. Ein derartiger Sensor ist anfällig gegenüber Regen oder Staub. In diesem Fall fehlt auch ein Signal. Wenn das Signal fehlt, ist es schwierig, die D-Typ-F/B-Regelung fort­ zuführen. Somit wird bei diesem System dann, wenn während der D-Typ-F/B-Regelung ein Signalausfall detektiert wird (das Flag VF = 1 für ein fehlendes Signal über einen Fahrzeugabstand, welches Flag anzeigt, daß das Signal über einen Fahrzeugab­ stand fehlt) oder wenn ein Zeichen, das eine Verschlechterung der Sensorfunktion anzeigt, detektiert wird (Flag FAIL = 1), der Regelbetrieb von der D-Typ-F/B-Regelung zu der S-Typ-F/B- Regelung als ein Betrieb zur automatischen Geschwindigkeitsre­ gelung geschaltet, der kein Signal über einen Fahrzeugabstand benötigt.In the automatic speed control operation based on the D-type F / B control, it is important to always detect the vehicle distance from the vehicle in advance. For this purpose, this system uses the radar sensor 10 ( Fig. 1). However, since the vehicle body nods on a current road, a light or sound wave radiated from the sensor is strongly directed up or down, and the radiated light (the sound wave) often cannot Reach vehicle ahead, or the wave reflected by the vehicle ahead re often cannot be returned to sensor 10 . Such a sensor is susceptible to rain or dust. In this case, a signal is also missing. If the signal is missing, it is difficult to continue the D-type F / B control. Thus, in this system, when a signal failure is detected during D-type F / B control (the flag VF = 1 for a missing signal about a vehicle distance, which flag indicates that the signal about a vehicle distance was missing) or when a sign indicating deterioration of the sensor function is detected (flag FAIL = 1), the control operation from the D-type F / B control to the S-type F / B control as an operation for automatic Cruise control switched, which does not require a signal over a vehicle distance.

Die Regelungs-Ablauffolge einer Untersuchung über das Fehlen eines Signals wird nachfolgend unter Bezugnahme auf Fig. 20 beschrieben. Bei dieser Ablauffolge wird dann, wenn der Fahr­ zeugabstand als ein unendlicher Abstand gemessen wird oder wenn die Abweichung zwischen dem aktuellen Fahrzeugabstand und dem Soll-Fahrzeugabstand TGD als ein unkontrollierbarer Abstand gemessen wird, ein Signalausfall-Zustand (VF = 1) bestimmt.The control sequence of an investigation for the absence of a signal is described below with reference to FIG. 20. In this sequence, when the vehicle distance is measured as an infinite distance or when the deviation between the current vehicle distance and the target vehicle distance TGD is measured as an uncontrollable distance, a signal failure condition (VF = 1) is determined.

Im Schritt S202 wird das Flag LCKON geprüft, das anzeigt, ob auf einen Sollwert verriegelt ist oder nicht. Eine Bedingung, die zum Einstellen dieses Flags LCKON benötigt wird, besteht darin, zu detektieren, daß die Abweichung zwischen dem Soll-Fahrzeugabstand, TGD und dem aktuellen Fahrzeugabstand Dn nicht groß ist, d. h. die folgende Beziehung erfüllt wird (Schritt S572 in Fig. 11):In step S202, the flag LCKON is checked, which indicates whether or not it is locked to a desired value. A condition required for setting this flag LCKON is to detect that the deviation between the target vehicle distance, TGD and the current vehicle distance D n is not large, that is, the following relationship is satisfied (step S572 in Fig. 11):

|TGD - Dn| < Ds (27)| TGD - D n | <D s (27)

wobei die Konstante Ds der Abstand ist, der zuläßt, daß dieses System die D-Typ-F/B-Regelung ausführt. Daher zeigt das Flag LCKON an, ob das Fahrzeug voraus innerhalb des Soll-Fahrzeug­ abstands verriegelt ist.where the constant D s is the distance that allows this system to perform the D-type F / B control. Therefore, the flag LCKON indicates whether the vehicle is locked ahead within the target vehicle distance.

Wenn der Fahrzeugabstand kein unendlicher Abstand ist, kann nicht untersucht werden, ob das Signal fehlerhaft oder normal ist. Somit wird bei der Ablauffolge in Fig. 20, wenn das Flag LCKON nicht gesetzt ist (d. h., wenn das Fahrzeug voraus nicht verriegelt ist), eine Untersuchung über ein Fehlen basierend darauf durchgeführt, ob das Abstandssignal einen unendlichen Abstand anzeigt oder nicht; wenn das Flag LCKON gesetzt ist (d. h., wenn das Fahrzeug voraus verriegelt ist), wird eine Untersuchung über ein Fehlen basierend auf der Differenz zwischen dem Soll-Fahrzeugabstand und dem aktuellen Fahrzeug­ abstand durchgeführt.If the vehicle distance is not an infinite distance, it cannot be examined whether the signal is faulty or normal. Thus, in the sequence in Fig. 20, if the flag LCKON is not set (ie, if the vehicle is not locked in advance), an absence check is performed based on whether or not the distance signal indicates an infinite distance; if the LCKON flag is set (ie, if the vehicle is locked ahead), an absence study is performed based on the difference between the target vehicle distance and the current vehicle distance.

Nachfolgend wird ein Fall erklärt, bei dem das Flag LCKON 0 ist, d. h., wenn die D-Typ-F/B-Regelung nicht durchgeführt wird. Wenn das Flag LCKON 0 ist, wenn der zuvor gemessene Fahrzeugabstand Dn-1 keinen unendlichen Abstand anzeigt (NEIN im Schritt S204), aber der gegenwärtig gemessene Fahrzeugab­ stand Dn einen unendlichen Abstand anzeigt (JA im Schritt S208), wird ein Fehlen des Signals über den Fahrzeugabstand im Schritt S210 gespeichert (VF = 1). Gegenteilig dazu wird dann, wenn sowohl der vorherige als auch der gegenwärtige ge­ messene Fahrzeugabstand keinen unendlichen Abstand anzeigt, das Flag VF im Schritt S214 gelöscht.The following explains a case where the flag LCKON is 0, that is, when the D-type F / B control is not performed. If the flag LCKON is 0, if the previously measured vehicle distance D n-1 does not indicate an infinite distance (NO in step S204), but the currently measured vehicle distance D n indicates an infinite distance (YES in step S208), an absence of Signals about the vehicle distance are stored in step S210 (VF = 1). On the contrary, if both the previous and the current measured vehicle distance do not indicate an infinite distance, the flag VF is cleared in step S214.

Wie es oben beschrieben ist, neigt ein Signal über einen Fahr­ zeugabstand D dazu, eine Störung aufgrund einer Nickbewegung der Fahrzeugkarosserie zu enthalten. Anders ausgedrückt kann der Fahrzeugabstand oft fehlerhaft gemessen werden. Ange­ sichts dieses Umstands ist es anzuraten, den Regelbetrieb beim Untersuchen eines Fehlens eines Signals basierend auf einem derartigen Signal über einen Fahrzeugabstand, das eine Störung enthält, sofort von der D-Typ-F/B-Regelung zu der S-Typ-F/B- Regelung zu verschieben, und die S-Typ-F/B-Regelung fort­ zuführen. Somit wird bei diesem System die Anzahl von Malen eines Fehlens eines Signals gezählt, und ein Regelbetrieb beim Verschieben von der D-Typ-F/B-Regelung zu der S-Typ-F/B- Regelung wird in Übereinstimmung mit der Anzahl von Malen eines Fehlens geändert (Schritt S528 in Fig. 9). Ein Zeit­ geber VT zählt die Anzahl von Malen eines Fehlens.As described above, a signal over a vehicle distance D tends to include a disturbance due to a pitching movement of the vehicle body. In other words, the vehicle distance can often be measured incorrectly. In view of this, it is advisable to immediately change the control operation from the D-type F / B control to the S-type F / when examining a lack of a signal based on such a signal about a vehicle distance including a disturbance. B control to postpone and continue the S type F / B control. Thus, in this system, the number of times a signal is absent is counted, and a control operation when shifting from the D-type F / B control to the S-type F / B control becomes in accordance with the number of times of missing changed (step S528 in Fig. 9). A timer VT counts the number of times of a miss.

Eine Bedingung, die zum Starten der Zähloperation des Zeit­ gebers VT erforderlich ist, ist ein Fall, bei dem sowohl der zuvor als auch der gegenwärtig gemessene Fahrzeugabstand einen unendlichen Abstand anzeigt (JA in den Schritten S204 und S206), oder ein Fall, bei dem ein unendlicher Abstand bei der gegenwärtigen Messung zum ersten Mal detektiert wird (NEIN im Schritt S204 und JA im Schritt S208). Eine Bedingung zum Löschen des Zeitgebers VT und des Flags VF ist ein Fall, bei dem die Signale über einen Fahrzeugabstand, die bei zwei oder mehreren kontinuierlichen Messungen erhalten werden, keinen unendlichen Abstand anzeigen. Anders ausgedrückt führt der Zeitgeber VT nachdem detektiert ist, daß das Signal über einen Fahrzeugabstand Dn zum ersten Mal einen unendlichen Abstand anzeigt, seine Zähloperation solange weiter, wie das Signal über einen Fahrzeugabstand kontinuierlich einen unendlichen Abstand anzeigt. Wenn die Signale, die bei zwei oder mehreren kontinuierlichen Messungen erhalten werden, keinen unendlichen Abstand anzeigen, werden der Zeitgeber VT und das Flag VG rückgesetzt.A condition required to start the counting operation of the timer VT is a case where both the previously and the currently measured vehicle distance indicate an infinite distance (YES in steps S204 and S206), or a case in which an infinite distance is detected for the first time in the current measurement (NO in step S204 and YES in step S208). A condition for clearing the timer VT and the flag VF is a case in which the vehicle distance signals obtained in two or more continuous measurements do not indicate an infinite distance. In other words, the timer VT, after detecting that the signal over a vehicle distance D n indicates an infinite distance for the first time, continues its counting operation as long as the signal over a vehicle distance continuously indicates an infinite distance. If the signals obtained from two or more continuous measurements do not indicate an infinite distance, the timer VT and the flag VG are reset.

Nachfolgend wird ein Fall beschrieben, bei dem das Soll-Ver­ riegelungsflag LCKON 1 ist, d. h. die D-Typ-F/B-Regelung wird gerade ausgeführt. Wenn bestimmt wird, daß die Differenz zwischen dem Soll-Fahrzeugabstand TGD und dem vorherigen ak­ tuellen Fahrzeugabstand Dn-1, nicht groß ist (im Schritt S218 ist die Ungleichung |TGD - Dn-1| < A erfüllt), aber die Diffe­ renz von dem gegenwärtig gemessenen Fahrzeugabstand Dn groß ist (|TGD - Dn-1| < A ist im Schritt S222 erfüllt), wird ein Fehlen des Signals über einen Fahrzeugabstand im Schritt S228 gespeichert (VF = 1). Gegenteilig dazu wird dann, wenn beide Differenzen von dem zuvor und gegenwärtig gemessenen Fahrzeug­ abstand nicht groß sind, das Flag VF im Schritt 224 rückge­ setzt. Eine Bedingung, die für den Zeitgeber VT erforderlich ist, um ein Zählen der Anzahl von Malen des Fehlens eines Sig­ nals zu starten ist ein Fall, bei dem sowohl die Differenzen von den zuvor und gegenwärtig gemessenen Fahrzeugabständen groß sind (JA in den Schritten S218 und S232) oder ein Fall, bei dem eine große Differenz von dem Fahrzeugabstand bei der gegenwärtigen Messung zum ersten Mal detektiert wird (NEIN im Schritt S218 und JA im Schritt S222). Eine Bedingung, die zum Löschen sowohl des Zeitgebers VT als auch des Flags VF erfor­ derlich ist, ist ein Fall, bei dem keine großen Differenzen von den Fahrzeugabständen bei zwei oder mehreren kontinuierlichen Messungen detektiert werden.A case is described below in which the target locking flag LCKON is 1, that is, the D-type F / B control is being executed. If it is determined that the difference between the target vehicle distance TGD and the previous current vehicle distance D n-1 is not large (in step S218, the inequality | TGD - D n-1 | <A is satisfied), but the differences limit of the currently measured vehicle distance D n is large (| TGD - D n-1 | <A is fulfilled in step S222), an absence of the signal about a vehicle distance is stored in step S228 (VF = 1). On the contrary, if both differences from the previously and currently measured vehicle distance are not large, the flag VF is reset in step 224. A condition required for the timer VT to start counting the number of times of missing a signal is a case where both the differences from the previously and currently measured vehicle distances are large (YES in steps S218 and S232) or a case where a large difference in the vehicle distance is detected for the first time in the current measurement (NO in step S218 and YES in step S222). A condition necessary for clearing both the timer VT and the flag VF is a case where no large differences in the vehicle distances are detected in two or more continuous measurements.

Detektion einer Verschlechterung der SensorfunktionDetection of deterioration in sensor function

Eine Logik zum Detektieren einer Verschlechterung der Funktion des Sensors, der beispielsweise durch Regen verunreinigt ist, wird nachfolgend unter Bezugnahme auf Fig. 21 beschrieben. Logic for detecting deterioration of the function of the sensor contaminated by rain, for example, will be described below with reference to FIG. 21.

Im Schritt S302 wird geprüft, ob der Wischer 61 aktiv ist. Wenn die Antwort im Schritt S302 JA ist, da es regnet und es sicher ist, daß die Sensorfunktion verschlechtert ist, wird im Schritt S320 das Flag FAIL gesetzt.In step S302, it is checked whether the wiper 61 is active. If the answer in step S302 is YES because it is raining and it is certain that the sensor function has deteriorated, the flag FAIL is set in step S320.

Im Schritt S304 und in nachfolgenden Schritten wird das Verhältnis des Zustands eines Fehlens eines Signals (VF = 1 in Fig. 20) des Sensors 10 untersucht, wenn der Wischer nicht aktiv ist. Ein Zeitgeber SMPTMR definiert im Schritt S304 ein Zeitintervall der oben angebenen Unterscheidung. Genauer aus­ gedrückt werden dann, wenn der Wischer nicht aktiv ist, die Inhalte des Zeitgebers SMPTMR im Schritt S306 hochgezählt, um eine Abtastzeit zu bestimmen. Eine Zeit CNT, während der das Flag VF für ein Fehlen eines Signals gesetzt worden ist, wird im Schritt S310 gemessen. Nach einem Verstreichen der Abtast­ zeit (B Minuten) (JA im Schritt S304), wird das Verhältnis des Fehlens eines Signal s pro Zeiteinheit (B Minuten) im Schritt S312 untersucht.In step S304 and subsequent steps, the ratio of the state of a missing signal (VF = 1 in FIG. 20) of the sensor 10 is examined when the wiper is not active. A timer SMPTMR defines a time interval of the above discrimination in step S304. More specifically, when the wiper is not active, the contents of the timer SMPTMR are counted up in step S306 to determine a sampling time. A time CNT during which the signal missing flag VF has been set is measured in step S310. After the lapse of the sampling time (B minutes) (YES in step S304), the ratio of the absence of a signal s per unit time (B minutes) is examined in step S312.

Ausfallverhältnis = CNT/B (28).Default ratio = CNT / B (28).

In den Schritten S314 und S316 werden der Zähler CNT und der Zeitgeber SMPTMR rückgesetzt, um nochmals das Ausfall­ verhältnis zu berechnen. Wenn das Ausfallverhältnis C% überschreitet (Schritt S318), wird bestimmt, daß die Sensor­ funktion verschlechtert ist, und das Flag FAIL wird im Schritt S320 auf 1 gesetzt.In steps S314 and S316, the counter CNT and the SMPTMR timer reset to redo the failure to calculate ratio. If the default ratio is C% exceeds (step S318), it is determined that the sensor function is deteriorated, and the flag FAIL is in step S320 set to 1.

Wie es oben beschrieben ist, wird bei diesem System dann, wenn der Zustand über ein Fehlen eines Signals auch für eine kurze Zeitperiode aufgrund von beispielsweise einer Nickbewegung der Fahrzeugkarosserie detektiert wird, dies in dem Flag VF ges­ peichert, und die entsprechende Ausfallzeit wird in dem Zeit­ geber für ein Fehlen des Fahrzeugabstands VT gespeichert. Wenn solche Fehlzustände in einem vorbestimmten Verhältnis oder öfter auftreten, wird bestimmt, daß die Sensorfunktion verschlechtert ist, und die Verschlechterung der Sensorfunk­ tion wird in dem Flag FAIL gespeichert.As described above, in this system, when the state about a lack of a signal even for a short Time period due to, for example, a pitching movement of the Vehicle body is detected, this in the flag VF tot saves, and the corresponding downtime is in the time encoder saved for a lack of vehicle distance VT. If such malfunctions in a predetermined ratio  or occur more often, it is determined that the sensor function is deteriorated, and the deterioration of the sensor radio tion is saved in the flag FAIL.

Betrieb der D-Typ-F/B-RegelungOperation of D-type F / B control

Der Einfluß des oben angegebenen Signalausfallzusta 28939 00070 552 001000280000000200012000285912882800040 0002004417593 00004 28820nds (VF = 1) und des Sensorverschlechterungszustands (FAIL = 1) bei der D-Typ-F/B-Regelung dieses Systems wird nachfolgend unter Be­ zugnahme auf die Flußdiagramme in den Fig. 9 bis 11 erklärt. Gemäß der Regelungs-Ablauffolge, die in diesen Flußdiagrammen gezeigt ist, wird dann, wenn es wahrscheinlich ist, daß das Sensorsignal nicht normal ist, der Regelbetrieb von der D-Typ- F/B-Regelung zu der S-Typ-F/B-Regelung verschoben. Dann werden etwas unterschiedliche Regeloperationen beim Ver­ schieben zu der S-Typ-F/B-Regelung in Abhängigkeit von der Dauer der Signalausfallzeit ausgeführt.The influence of the above Signalausfallzusta 28939 00070 552 001000280000000200012000285912882800040 0002004417593 00004 28820nds (VF = 1) and the sensor deterioration state (FAIL = 1) at the D-type F / B control of this system is hereinafter zugnahme under Be to the flowcharts in Figures explained. 9 to 11. According to the control sequence shown in these flowcharts, if the sensor signal is likely to be abnormal, the control operation becomes from the D-type F / B control to the S-type F / B - Regulation postponed. Then slightly different control operations are carried out when shifting to the S-type F / B control depending on the duration of the signal failure time.

Wenn bestimmt wird, daß die Sensorfunktion verschlechtert ist, d. h. wenn das Flag FAIL = 1 ist, geht der Ablauf weiter zu Schritt S520 → Schritt S522, und die gegenwärtige aktuelle Fahrzeuggeschwindigkeit Vn wird mit einer eingestellten Fahr­ zeuggeschwindigkeit MTGV verglichen, die gespeichert wird, wenn der EINSTELL-, WIEDERAUFNAHME- oder LEERLAUF-Schalter eingeschaltet ist. Wenn die zwei Fahrzeuggeschwindigkeiten eine Differenz von 10 km/h oder mehr dazwischen aufweisen (JA im Schritt S522), wird die eingestellte Fahrzeuggeschwindig­ keit MTGV im Schritt S524 derart eingestellt, daß sie die Soll-Fahrzeuggeschwindigkeit ist.If it is determined that the sensor function is deteriorated, that is, if the flag FAIL = 1, the flow advances to step S520 → step S522, and the current current vehicle speed V n is compared with a set vehicle speed MTGV, which is stored, when the SET, RESUME, or IDLE switch is on. If the two vehicle speeds have a difference of 10 km / h or more therebetween (YES in step S522), the set vehicle speed MTGV is set to be the target vehicle speed in step S524.

TGV = MTGV (29).TGV = MTGV (29).

Andererseits wird, wenn die zwei Fahrzeuggeschwindigkeiten keine Differenz von 10 km/h oder mehr dazwischen aufweisen, die gegenwärtige Fahrzeuggeschwindigkeit im Schritt S526 der­ art eingestellt, daß sie die Soll-Fahrzeuggeschwindigkeit ist.On the other hand, if the two vehicle speeds have no difference of 10 km / h or more between them, the current vehicle speed in step S526 of FIG Art set that it is the target vehicle speed.

TGV = Vn (30).TGV = V n (30).

Im Schritt S508 werden die integrale Variable EdI für die D-Typ-F/B-Regelung und die integrale Variable EvI für die S-Typ-F/B-Regelung rückgesetzt. Der Ablauf geht dann aufein­ anderfolgend weiter zu Schritt S508 → Schritt S510 → Schritt S512 → Schritt S514 → Schritt S516 → Schritt S518, um die verschiedenen Flags für die S-Typ-F/B-Regelung zu setzen.In step S508, the integral variable E dI for the D-type F / B control and the integral variable E vI for the S-type F / B control are reset. The flow then sequentially proceeds to step S508 → step S510 → step S512 → step S514 → step S516 → step S518 to set the various flags for the S-type F / B control.

Auch wenn keine Verschlechterung des Sensor detektiert wird (NEIN im Schritt S520), geht der Ablauf dann, wenn die Signa­ lausfallzeit VT länger als die Zeit Ts ist (JA im Schritt S530), weiter zu Schritt S522, um dieselbe Regelung aus­ zuführen wie in einem Fall, bei dem eine Sensorverschlechte­ rung detektiert ist.Even if no deterioration of the sensor is detected (NO in step S520), if the signal failure time VT is longer than the time T s (YES in step S530), the flow advances to step S522 to perform the same control as in a case where sensor deterioration is detected.

Wenn die Signalausfallzeit kurz ist, d. h., wenn VT Ts (NEIN im Schritt S530), geht der Ablauf weiter zu Schritt S532. Im Schritt S532 wird ein Flag ISF geprüft. Das Flag ISF zeigt an, daß die S-Typ-F/B-Regelung "zeitweilig" aufgrund des tem­ porären Signalausfalls ausgeführt wird. Daher wird im Schritt S532 NEIN bestimmt, die gegenwärtige Fahrzeuggeschwindigkeit Vn wird im Schritt S534 derart eingestellt, daß sie die Soll-Fahrzeuggeschwindigkeit TGV ist, und das Flag ISF wird im Schritt S536 auf 1 gesetzt. Im Schritt S538 wird zum Starten der S-Typ-F/B-Regelung die integrale Variable EvI auf 0 rückge­ setzt. In diesem Fall wird die integrale Variable EdI für die D-Typ-F/B-Regelung nicht rückgesetzt.If the signal dropout time is short, that is, if VT T s (NO in step S530), the flow advances to step S532. A flag ISF is checked in step S532. The ISF flag indicates that the S-type F / B control is "temporarily" due to the temporary signal dropout. Therefore, NO is determined in step S532, the current vehicle speed V n is set to be the target vehicle speed TGV in step S534, and the flag ISF is set to 1 in step S536. In step S538, the integral variable E vI is reset to 0 to start the S-type F / B control. In this case, the integral variable E dI for the D type F / B control is not reset.

Die Bedeutung des Schritts S538, in dem die integrale Variable EdI für die D-Typ-F/B-Regelung nicht rückgesetzt wird, wird nachfolgend erklärt.The meaning of step S538, in which the integral variable E dI for the D-type F / B control is not reset, is explained below.

Wenn im Schritt S530 bestimmt wird, daß die Ausfallzeit VT kürzer als Ts ist, bedeutet dies einen temporären Signalausfall (ein Signalausfall aufgrund beispielsweise einer Nickbewegung der Fahrzeugkarosserie). In diesem Fall wird erwartet, daß der Signalausfall-Zustand bald wiedergutgemacht wird. Daher wird die Zeit der S-Typ-F/B-Regelung aufgrund des Ausfall-Zu­ stands kurz werden. Wenn sich das System von dem Signalaus­ fall-Zustand für eine kurze Zeitperiode erholt hat, wird der Regelbetrieb vorzugsweise von der S-Typ-F/B-Regelung zu der D-Typ-F/B-Regelung zurückgebracht. Wenn die Regelungs-Ablauf­ folge zum Rücksetzen der integralen Variable EdI für die D-Typ- F/B-Regelung (EdI = 0) sogar bei einem Signalausfall für eine kurze Zeitperiode (NEIN im Schritt S530) programmiert ist, wird selbst dann, wenn die D-Typ-F/B-Regelung innerhalb einer kurzen Zeitperiode wieder aufgenommen wird, da die integrale Variable EdI, die während der vorherigen D-Typ-F/B-Regelperiode akkumuliert worden war, schon rückgesetzt worden ist, eine Kontinuität aufgrund eines Übergangs von Regelbetrieben wie beispielsweise von der D-Typ-F/B-Regelung → der S-Typ-F/B- Regelung → der D-Typ-F/B-Regelung verloren, was in einer ruckweisen Regelung resultiert. Bei diesem System, wie es oben beschrieben ist, geht der Ablauf dann, wenn ein Signa­ lausfall für eine kurze Zeitperiode auftritt, der Ablauf nicht vom Schritt S532 zum Schritt S508 weiter, und die integrale Variable EdI wird im Schritt S538 nicht rückgesetzt. Daher kann eine Kontinuität der Regelung sichergestellt werden, und eine ruhige Regelung kann erwartet werden, wenn der Regelbe­ trieb von der S-Typ-F/B-Regelung zu der D-Typ-F/B-Regelung zurückgebracht wird.If it is determined in step S530 that the downtime VT is shorter than T s , it means a temporary signal loss (a signal loss due to, for example, a pitching movement of the vehicle body). In this case, the dropout condition is expected to be restored soon. Therefore, the time of S-type F / B control will be short due to the failure condition. When the system has recovered from the signal drop condition for a short period of time, control operation is preferably returned from the S-type F / B control to the D-type F / B control. Even if the control sequence is programmed to reset the integral variable E dI for the D-type F / B control (E dI = 0) even in the case of a signal failure for a short period of time (NO in step S530) , if the D-type F / B control is resumed within a short period of time since the integral variable E dI that had accumulated during the previous D-type F / B control period has already been reset, one Continuity lost due to a transition from control operations such as D-type F / B control → S-type F / B control → D-type F / B control, which results in jerky control. In this system, as described above, when a signal failure occurs for a short period of time, the flow does not proceed from step S532 to step S508, and the integral variable E dI is not reset in step S538. Therefore, continuity of the control can be ensured, and quiet control can be expected when the control operation is returned from the S-type F / B control to the D-type F / B control.

Ein Fall, in dem sich die Signalausfallzeit schrittweise erhöht wird nachfolgend unter Bezugnahme auf Fig. 22 be­ schrieben. Während eines Ausführens der D-Typ-F/B-Regelung wird dann, wenn ein Signalausfall-Zustand (für VT Ts) zu einem Zeitpunkt t₁ detektiert wird, die integrale Variable EvI für die S-Typ-F/B-Regelung rückgesetzt, aber die Variable EdI für die D-Typ-F/B-Regelung wild aufbewahrt. Wenn der Signal­ ausfall-Zustand andauert und VT = Ts zu einem Zeitpunkt t₂ erfüllt wird, wie es in Fig. 22 gezeigt ist, werden sowohl die integrale Variable, EvI für die S-Typ-F/B-Regelung als auch die integrale Variable EdI für die D-Typ-F/B-Regelung im Schritt S508 zurückgesetzt. Daher geht der Ablauf ungleich der Fig. 22, wenn der Signalausfall-Zustand vor einem Zeitpunkt t₂ gelöscht wird, da die Variable EdI für die D-Typ-F/B-Regelung aufbewahrt gehalten wird, und das Flag ISD gesetzt gehalten wird, weiter zu Schritt S544 → Schritt S562, wodurch der Re­ gelbetrieb ruhig zu der D-Typ-F/B-Regelung zurückgebracht wird.A case in which the signal drop time increases gradually will be described below with reference to FIG. 22. During execution of the D-type F / B control, when a signal failure state (for VT T s ) is detected at a time t 1 , the integral variable E vI for the S-type F / B control reset, but the variable E dI for the D-type F / B control is kept wild. If the signal failure state persists and VT = T s at a time t₂ is satisfied, as shown in Fig. 22, both the integral variable, E vI for the S-type F / B control and integral variable E dI for D type F / B control reset in step S508. Is kept Therefore, the flow goes unlike the Fig. 22 when the signal failure condition clears t₂ before a time, is held as the variable E dI for the D-type F / B control stored, and the ISD flag is set, go to step S544 → step S562, whereby the control operation is quietly returned to the D-type F / B control.

Effekt des AusführungsbeispielsEffect of the embodiment

Gemäß dem oben angebenen Ausführungsbeispiel werden die fol­ gende Effekte erwartet.According to the above embodiment, the fol expected effects.

I: Da die "Vorliebe" und die "Gewohnheit" eines Fahrers bezüglich des Fahrzeugabstands bei einem Kurvenfahrzustand oder einem Beschleunigungszustand gelernt werden, wobei dem keine D-Typ-F/B-Regelung ausgeführt wird (Schritt S928 in Fig. 15), kann eine automatische Geschwindigkeitsregelung basierend auf dem Fahrzeugabstand Dÿ realisiert werden, der bei dem Fahrer kein Unbehagen verursacht.I: Since a driver's "preference" and "habit" regarding the vehicle distance in a cornering state or an acceleration state are learned, and D-type F / B control is not performed (step S928 in FIG. 15) an automatic speed control can be implemented based on the vehicle distance D ÿ , which does not cause any discomfort to the driver.

I-1: Weiterhin kann, da der Soll-Fahrzeugabstand Dÿ in Einheiten von Fahrzeuggeschwindigkeitsbereichen gelernt wird (Fig. 16), der Fahrzeugabstand Dÿ mit hoher Genauigkeit ge­ lernt werden.I-1: Further, since the target vehicle distance D ÿ is learned in units of vehicle speed ranges ( Fig. 16), the vehicle distance D ÿ can be learned with high accuracy.

I-2: Da der Soll-Fahrzeugabstand Dÿ in Einheiten von Berei­ chen der Beschleunigung/Abbremsung G gelernt wird (Fig. 16), kann der Fahrzeugabstand Dÿ mit hoher Genauigkeit eingestellt werden.I-2: Since the target vehicle distance D ÿ is learned in units of areas of acceleration / deceleration G ( Fig. 16), the vehicle distance D ÿ can be set with high accuracy.

I-3: Die Anzahl nÿ von Malen des Lernens, die durch Gleichung (20) vorgegeben ist, wird jedesmal nach oben gezählt, wenn eine Beschleunigungs-/Abbremsungsoperation durchgeführt wird. Genauer ausgedrückt erhöhen häufige Beschleunigungs-/Abbrem­ sungsoperationen den Wert der Anzahl nÿ von Malen des Lernens, und erniedrigen somit den gelernten Fahrzeugabstand [Dÿ], der durch Gleichung (21) vorgegeben ist. Wenn die Beschleuni­ gungs-/Abbremsungsoperation häufig durchgeführt wird, kann bestimmt werden, daß der Fahrer einen kleineren Fahrzeugab­ stand einstellen möchte.I-3: The number n ÿ times of learning, which is given by equation (20), is counted up each time an acceleration / deceleration operation is performed. More specifically, frequent acceleration / deceleration operations increase the value of the number n ÿ of times of learning, and thus decrease the learned vehicle distance [D ÿ ], which is given by equation (21). If the acceleration / deceleration operation is performed frequently, it can be determined that the driver wants to set a smaller vehicle distance.

II: Wenn der Verriegelungszustand des Fahrzeugs voraus beim Fahren unter der D-Typ-F/B-Regelung verloren wird (JA im Schritt S528) oder wenn bestimmt wird, daß die Genauigkeit des Sensors für einen Fahrzeugabstand verschlechtert ist (JA im Schritt S520), kann der Regelbetrieb ruhig von der bis dahin durchgeführten D-Typ-F/B-Regelung zu der S-Typ-F/B-Regelung verschoben werden.II: If the vehicle is locked in advance at Driving under the D-type F / B control is lost (YES in Step S528) or if it is determined that the accuracy of the Sensor for a vehicle distance is deteriorated (YES in Step S520), the control operation can be quiet from then carried out D-type F / B control to the S-type F / B control be moved.

II-1: Insbesondere dann, wenn der Verriegelungszustand des Fahrzeugs voraus während der D-Typ-F/B-Regelung verloren wird (JA im Schritt S528), oder wenn bestimmt wird, daß die Ge­ nauigkeit des auf dem Fahrzeugabstand basierenden Sensors verschlechtert ist (JA im Schritt S520), wird der Regelbetrieb "temporär" für eine Zeit Ts zu der S-Typ-F/B-Regelung ver­ schoben (NEIN im Schritt S530). Wenn der Regelbetrieb "tem­ porär" zu der S-Typ-F/B-Regelung verschoben wird, wird die integrale Variable EdI für bis dahin durchgeführte D-Typ-F/B- Regelung aufbewahrt (Schritt S538). Aus diesem Grund kann dann, wenn der Signalausfall-Zustand innerhalb einer kurzen Zeitperiode wiedererlangt wird (NEIN im Schritt S528), da die integrale Variable EdI für die vorherigen D-Typ-F/B-Regelung benutzt wird, eine "Lücke" zwischen der vorherigen D-Typ-F/B- Regelung und der auszuführenden D-Typ-F/B-Regelung eliminiert werden, und die Regelung kann ruhig zu der D-Typ-F/B-Regelung zurückgebracht werden. II-1: Especially when the locked state of the vehicle ahead is lost during the D-type F / B control (YES in step S528), or it is determined that the accuracy of the sensor based on the vehicle distance is deteriorated (YES in step S520), the control operation is temporarily shifted to the S-type F / B control for a time T s (NO in step S530). When the control operation is "temporarily" shifted to the S-type F / B control, the integral variable E dI is kept for the D-type F / B control performed until then (step S538). For this reason, if the signal failure state is recovered within a short period of time (NO in step S528), since the integral variable E dI is used for the previous D type F / B control, there can be a "gap" between the previous D-type F / B control and the D-type F / B control to be executed, and the control can be returned to the D-type F / B control with ease.

II-2: Da die Fahrzeuggeschwindigkeit dann, wenn das Fahr­ zeug voraus fehlt, in den Schritten S526 und S534 für die S-Typ-F/B-Regelung als Soll-Fahrzeuggeschwindigkeit einge­ stellt wird, kann eine große Veränderung der Fahrzeuggeschwin­ digkeit beim Verschieben von der D-Typ-F/B-Regelung zu der S-Typ-F/B-Regelung eliminiert werden.II-2: Because the vehicle speed when driving is missing in steps S526 and S534 for the S-type F / B control set as target vehicle speed is a big change in vehicle speed when moving from the D-type F / B control to the S-type F / B control can be eliminated.

II-3: Wenn der Ausfallzustand nach einem Verstreichen einer vorbestimmten Zeitperiode im Schritt S530 nicht wieder­ gutgemacht wird, kehrt der Ablauf zum Schritt S508 zurück, um beide intergralen Variablen EdI und EvI rückzusetzen. Wenn eine lange Zeitperiode verstrichen ist, kann sich eine Umgebungsbe­ dingung für das Fahren oft ändern. Daher ist es zum Beibe­ halten einer Regelzuverlässigkeit nicht vorzuziehen, Regelgrößen für eine lange Zeitperiode zu halten.II-3: If the failure state is not remedied after a lapse of a predetermined time period in step S530 again, the flow returns to step S508 back to reset both intergralen variables E dI and E VI. When a long period of time has passed, an environmental condition for driving can often change. Therefore, to maintain control reliability, it is not preferable to hold control variables for a long period of time.

III. Bei dem obigen Ausführungsbeispiel wird die S-Typ-F/B- Regelung ausgeführt, während das Fahrzeug eine Kurve fährt; sonst wird die D-Typ-F/B-Regelung ausgeführt (Schritt S586 in Fig. 10). Durch Benutzen der Beschleunigung/Abbremsung Gÿ, die in den Kurvenfahrzuständen bis dahin gelernt worden ist, wird die Fahrzeuggeschwindigkeit derart geregelt, daß sie in dem Kurvenfahrzustand die Soll-Fahrzeuggeschwindigkeit TGV erreicht (Schritt S586 in Fig. 10).III. In the above embodiment, the S-type F / B control is carried out while the vehicle is turning; otherwise, the D-type F / B control is carried out (step S586 in Fig. 10). By using the acceleration / deceleration G ÿ which has been learned in the cornering states until then, the vehicle speed is controlled so that it reaches the target vehicle speed TGV in the cornering state (step S586 in FIG. 10).

III-1: Die Beschleunigung/Abbremsung Gÿ wird basierend auf der Fahrzeuggeschwindigkeit VSPST an dem Eingang einer Kurve und der Fahrzeuggeschwindigkeit Vn an dem Ausgang der Kurve gelernt (Schritt S906).III-1: The acceleration / deceleration G ÿ is learned based on the vehicle speed VSPST at the input of a curve and the vehicle speed V n at the output of the curve (step S906).

IV-1: Der EINSTELL-Schalter dieses Ausführungsbeispiels wird nicht nur zum Einstellen der Soll-Fahrzeuggeschwindigkeit benutzt (Schritt S134 in Fig. 13), sondern auch zum Einstellen des Soll-Fahrzeugabstand (Schritt S138 in Fig. 13). IV-1: The SET switch of this embodiment is used not only to set the target vehicle speed (step S134 in Fig. 13) but also to set the target vehicle distance (step S138 in Fig. 13).

IV-2: Wenn der EINSTELL-Schalter kontinuierlich nieder­ gedrückt wird, kann nicht nur die Soll-Fahrzeuggeschwindig­ keit kontinuierlich erhöht oder erniedrigt werden (Schritt S118 in Fig. 4), sondern auch der Soll-Fahrzeugabstand kann kontinuierlich erniedrigt oder erhöht werden (Schritt S116 in Fig. 4). Ein Erhöhen (Erniedrigen) der Soll-Fahrzeuggeschwin­ digkeit und ein Erniedrigen (Erhöhen) des Soll-Fahrzeugabstand verursacht bei einem Fahrer bei Operationen kein Unbehagen.IV-2: When the SET switch is continuously depressed, not only can the target vehicle speed be continuously increased or decreased (step S118 in Fig. 4), but also the target vehicle distance can be continuously decreased or increased (step S116 in Fig. 4). Increasing (decreasing) the target vehicle speed and decreasing (increasing) the target vehicle distance does not cause discomfort to a driver during operations.

AbänderungenChanges

Verschiedene Änderungen und Abänderungen können innerhalb des Geistes und des Schutzumfangs der Erfindung durchgeführt werden.Various changes and changes can be made within the Spirit and scope of the invention become.

Erste Abänderung . . . Ruhige Regelungs-VerschiebungFirst change. . . Quiet regulation shift

Bei dem oben angeführten Ausführungsbeispiel wird der Regelbe­ trieb dann, wenn das Fahrzeug voraus während einer Ausführung der D-Typ-F/B-Regelung fehlend wird, von der D-Typ-F/B- Regelung zu der S-Typ-F/B-Regelung verschoben. Jedoch dann, wenn die Ausfallzeit des Signals für den Fahrzeugabstand kurz ist, wird die integrale Variable EvI für die S-Typ-F/B-Regelung rückgesetzt, aber die integrale Variable EdI für die D-Typ-F/B- Regelung, die während der bis dahin durchgeführten D-Typ-F/B- Regelung akkumuliert worden ist, wird nicht rückgesetzt, da erwartet wird, daß das Signal innerhalb der kurzen Zeitperiode wiedererlangt wird (siehe Schritt S538 in Fig. 9).In the above embodiment, when the vehicle is absent during execution of the D-type F / B control, the control operation is changed from the D-type F / B control to the S-type F / B control postponed. However, if the downtime of the signal for the vehicle distance is short, the integral variable E vI for the S-type F / B control is reset, but the integral variable E dI for the D-type F / B control that has been accumulated during the D-type F / B control so far is not reset because the signal is expected to be recovered within the short period of time (see step S538 in Fig. 9).

Bei der ersten Abänderung, die nachfolgend beschrieben wird, ist die Halteoperation der integralen Variable weiterentwick­ elt, und die integrale Variable, die während der Periode eines einzigen Regelbetriebs berechnet worden ist, wird für den an­ deren Regelbetrieb übernommen. Eine gesteuerte Variable m für den Drosselöffnungsgrad TG ist bei der ersten Abänderung wie folgt definiert. Genauer ausgedrückt gilt für die D-Typ-F/B-Regelung:The first change, which is described below, is the hold operation of the integral variable evolve elt, and the integral variable that occurs during the period of a only regular operation has been calculated for the their regular operation taken over. A controlled variable m for the throttle opening degree TG is like for the first modification  follows defined. More specifically, applies to the D-type F / B control:

m = m + KdI × (Dn - TGD)
+ KdP × (Dn - Dn-1)
- KdD × (2Dn-2 - Dn-1 - Dn) (31).
m = m + K dI × (D n - TGD)
+ K dP × (D n - D n-1 )
- K dD × (2D n-2 - D n-1 - D n ) (31).

Für die S-Typ-F/B-Regelung gilt:The following applies to S type F / B control:

m = m + KvI × (Dn - TGVn)
+ KvP × {(TGVn - TGVn-1) - (Vn - Vn-1)}
- KvD × (Vn + Vn-2 - 2Vn-1) (32).
m = m + K vI × (D n - TGV n )
+ K vP × {(TGV n - TGV n-1 ) - (V n - V n-1 )}
- K vD × (V n + V n-2 - 2V n-1 ) (32).

Die Variable m ist den Gleichungen (31) und (32) gemeinsam. Daher wird dann, wenn der Regelbetrieb von der D-Typ-F/B- Regelung zu der S-Typ-F/B-Regelung verschoben wird, der Wert der integralen Variable m bei der D-Typ-F/B-Regelung für die S-Typ-F/B-Regelung übernommen.The variable m is common to equations (31) and (32). Therefore, if the regular operation of the D-type F / B- Control is shifted to the S-type F / B control, the value of the integral variable m in the D-type F / B control for the S-type F / B control adopted.

Die Fig. 23 bis 25 sind Flußdiagramme, die eine Regelungs-A­ blauffolge der Rückkopplung bei der ersten Abänderung zeigen. Die Regelungs-Ablauffolge, die in den Fig. 23 bis 25 gezeigt ist, ist jener, die in den Fig. 9 bis 11 bei dem obigen Ausführungsbeispiel gezeigt ist, in vielerlei Hinsicht gleich. Jedoch sind zum Übernehmen des integralen Werts, wie es oben beschrieben ist, ein Schritt S536 in Fig. 9 und ein Schritt S552 in Fig. 10 von der Ablauffolge der ersten Abänderung weggelassen. Eine Rechenoperation für die S-Typ-F/B-Regelung basierend auf der Gleichung (32) wird im Schritt S596′ in Fig. 24 durchgeführt, und eine Rechenoperation für die D-Typ-F/B- Regelung basierend auf der Gleichung (31) wird im Schritt S566′ (Fig. 25) durchgeführt. Auch die Schritte S592, S594, S562 und S564 in Fig. 11 sind weggelassen. Figs. 23 to 25 are flowcharts showing a regulation-A blauffolge the feedback in the first modification. The control sequence shown in Figs. 23 to 25 is the same as that shown in Figs. 9 to 11 in the above embodiment in many respects. However, to take the integral value as described above, a step S536 in FIG. 9 and a step S552 in FIG. 10 are omitted from the sequence of the first modification. A computing operation for S-type F / B control based on equation (32) is performed in step S596 'in FIG. 24, and a computing operation for D-type F / B control based on equation ( 31) is performed in step S566 '( Fig. 25). Steps S592, S594, S562 and S564 in Fig. 11 are also omitted.

Man beachte, daß die Regelgröße m im Schritt S508′ (Fig. 23) auf 0 rückgesetzt wird. Wenn im Schritt S504 bestimmt wird, daß das Fahrzeug mit einem Abstand fährt, der keine D-Typ-F/B- Regelung zuläßt, und wenn die S-Typ-F/B-Regelung zu starten ist, ist es Unsinn, die Regelgröße m bei der bis dahin durch­ geführten D-Typ-F/B-Regelung zu übernehmen. Aus diesem Grund geht der Ablauf dann, wenn das Signal für einen Fahrzeugab­ stand ausfällt und der Regelbetrieb von der D-Typ-F/B-Regelung zu der S-Typ-F/B-Regelung verschoben wird, da die Regelgröße m bei der D-Typ-F/B-Regelung für die S-Typ-F/B-Regelung übernom­ men werden sollte, nicht vom Schritt S524 oder S526 weiter zu einem Schritt S508′, sondern zu einem Schritt S510, um zu ver­ hindern, daß der Wert m in Fig. 23 gelöscht wird, was ungleich der Regelungs-Ablauffolge in Fig. 9 ist.Note that the controlled variable m is reset to 0 in step S508 '( FIG. 23). If it is determined in step S504 that the vehicle is running at a distance that does not allow D-type F / B control, and if the S-type F / B control is to be started, it is nonsense the control variable m to be adopted for the D-type F / B control carried out up to that point. For this reason, the process goes on when the signal for a vehicle distance fails and the control mode is shifted from the D-type F / B control to the S-type F / B control, since the controlled variable m at D-type F / B control for the S-type F / B control should be adopted, not from step S524 or S526 to a step S508 ', but to a step S510 to prevent that the value m in FIG. 23 is cleared, which is different from the control sequence in FIG. 9.

Effekt der ersten AbänderungEffect of the first change

Gemäß der ersten Abänderung, die oben beschrieben ist, kann, da die Regelgröße m übernommen wird, der Regelbetrieb ruhig zwischen der S-Typ-F/B-Regelung und der D-Typ-F/B-Regelung geschaltet werden, und ein Fahrer ist frei davon, sich unbeha­ glich zu fühlen. Bei dem obigen Ausführungsbeispiel wird die integrale Variable EvI im Schritt S538 in Fig. 9 aufbewahrt, wenn der Regelbetrieb temporär zu der S-Typ-F/B-Regelung ver­ schoben wird. Bei dieser Abänderung wird weiterhin ein Aufbe­ wahren positiv durchgeführt.According to the first modification described above, since the controlled variable m is adopted, the control operation can be smoothly switched between the S-type F / B control and the D-type F / B control, and a driver is free from feeling uncomfortable. In the above embodiment, the integral variable E vI is retained in step S538 in Fig. 9 when the control operation is temporarily shifted to the S-type F / B control. With this amendment, retention is still performed positively.

Zweite Abänderung . . . Lernen der Gewohnheit eines FahrersSecond amendment. . . Learning a driver's habit

Die zweite Abänderung betrifft die Lernlogik der Beschleuni­ gung/Abbremsung beim Drehen eines Fahrzeugs, und ihre Rege­ lungs-Ablauffolge ist in Fig. 26 gezeigt. Unterschiede von der Ablauffolge des Lernens, die in den Fig. 14 und 15 gezeigt ist, bestehen darin, daß ein unterschiedliches Lernverfahren benutzt wird, und daß keine Logik zum Lernen einer "Gewohn­ heit" eines Fahrers, das zu einer Beschleunigung gehört, in einem Beschleunigungszustand programmiert ist. Man beachte, daß für das Flag TRN, das anzeigt, daß eine Drehoperation ausgeführt wird, der Zeitgeber TRNTMR zum Zählen der Drehzeit, die Beschleunigung/Abbremsung Gÿ und ähnliches dieselben Zeichen wie jene in Fig. 14 und dergleichen benutzt werden.The second modification concerns the learning logic of acceleration / deceleration when turning a vehicle, and its control sequence is shown in FIG. 26. Differences from the learning sequence shown in Figs. 14 and 15 are that a different learning method is used and that no logic for learning a driver's "habit" associated with acceleration in one Acceleration state is programmed. Note that, for the flag TRN, which indicates that a turning operation is being carried out, the timer TRNTMR for counting the turning time, the acceleration / deceleration G ÿ and the like, the same characters as those in Fig. 14 and the like are used.

Im Schritt S400 in Fig. 26 wird geprüft, ob die Lenkwinkelposition die neutrale Position ist (Rn = N). Wenn eine Drehopera­ tion gestartet ist, geht der Ablauf, da Rn ≠ N erfüllt ist, zu Schritt S420 → Schritt S422 weiter, um das Flag TRN zu setzen. Weiterhin wird der Fahrzeugabstand Dn von dem Fahrzeug voraus zu jener Zeit in dem Register DST gespeichert (Schritt S424), die Fahrzeuggeschwindigkeit Vn wird in dem Register VSPST gespeichert (Schritt S426) und der Lenkwinkel Rn wird in dem Register MAXR gespeichert (Schritt S428). Im Schritt S430 wird der Zeitgeber TRNTMR zum Speichern der Drehzeit nach oben gezählt. Man beachte, daß die Schritte S432 und S434 einem Erneuerungsprogramm des Registers MAXR entsprechen.In step S400 in Fig. 26, it is checked whether the steering angle position is the neutral position (R n = N). When a turning operation is started, since R n ≠ N is satisfied, the process proceeds to step S420 → step S422 to set the flag TRN. Further, the vehicle distance D n from the vehicle ahead at that time is stored in the register DST (step S424), the vehicle speed V n is stored in the register VSPST (step S426), and the steering angle R n is stored in the register MAXR (step S428). In step S430, the timer TRNTMR is counted up to store the rotation time. Note that steps S432 and S434 correspond to a MAXR register renewal program.

Solange wie die Position des Lenkwinkels R des Lenkwinkels nicht zu der neutralen Position zurückgebracht ist, wird die Operation des nach oben Zählens des Zeitgebers TRNTMR im Schritt S430 fortgeführt.As long as the position of the steering angle R of the steering angle is not returned to the neutral position, the Operation of counting up the timer TRNTMR in Step S430 continued.

Wenn das Fahrzeug aus einer Kurve oder einer Ecke kommt, und der Lenkwinkel zu der neutralen Position zurückgebracht ist, werden Beschleunigungs-/Abbremsungsdaten Gÿ, die der Ein­ gangs-Fahrzeuggeschwindigkeit VSPST entsprechen, und der maxi­ male Lenkwinkel MAXR während des Drehens im Schritt S404 gesucht und von jenen ausgelesen, die bis dahin gelernt worden sind.When the vehicle comes out of a curve or a corner and the steering angle is returned to the neutral position, acceleration / deceleration data G ÿ corresponding to the input vehicle speed VSPST and the maximum steering angle MAXR during turning in step S404 sought and read by those who have been learned up to that point.

In den Schritten S406 und S408 werden der Fahrzeugabstand DST an dem Eingang der Kurve und der Fahrzeugabstand Dn an dem Aus­ gang der Kurve miteinander verglichen. Wenn im Schritt S406 bestimmt wird, daß die folgende Beziehung erfüllt ist (Ds1 ist eine positive Konstante):In steps S406 and S408, the vehicle distance DST at the entrance to the curve and the vehicle distance D n at the exit from the curve are compared with one another. When it is determined in step S406 that the following relationship is satisfied (D s1 is a positive constant):

DST - Dn < Ds1 (33),DST - D n <D s1 (33),

d. h., wenn der Fahrzeugabstand an dem Ausgang der Kurve kleiner als jener an dem Eingang der Kurve wird, wird be­ stimmt, daß ein Fahrer eine "Vorliebe" (oder eine "Gewohn­ heit") eines Haltens eines kleinen Fahrzeugabstand hat, und die Beschleunigung/Abbremsung wird im Schritt S412 wie folgt berechnet:d. i.e. when the vehicle distance at the exit of the curve becomes smaller than that at the entrance to the curve true that a driver has a "preference" (or a "habit unit ") of keeping a small vehicle distance, and the acceleration / deceleration is as follows in step S412 calculated:

[Gÿ] = [Gÿ] + ΔG (34).[G ÿ ] = [G ÿ ] + ΔG (34).

Da ΔG eine positive Konstante ist, hat die Gleichung (34) einen Lerneffekt zum Erhöhen der Beschleunigung/Abbremsung [Gÿ]. Andererseits erfolgt folgendes: Wenn im Schritt S408 bestimmt wird, daß die folgende Beziehung erfüllt ist:Since ΔG is a positive constant, the equation (34) has a learning effect for increasing the acceleration / deceleration [G ÿ ]. On the other hand, the following occurs: When it is determined in step S408 that the following relationship is satisfied:

DST - Dn < Ds1 (35),DST - D n <D s1 (35),

d. h., wenn der Fahrzeugabstand an dem Ausgang der Kurve größer als jener an dem Eingang der Kurve wird, wird bestimmt, daß ein Fahrer einer "Vorliebe" (oder eine "Gewohnheit") zum Halten eines großen Fahrzeugabstand hat, und die Beschleuni­ gung/Abbremsung wird im Schritt S410 wie folgt berechnet:d. that is, when the vehicle distance at the exit of the curve is larger than that at the entrance to the curve, it is determined that a driver of a "preference" (or a "habit") to Maintaining a large vehicle distance, and accelerating Acceleration / deceleration is calculated in step S410 as follows:

[Gÿ] = [Gÿ] - ΔG (36).[G ÿ ] = [G ÿ ] - ΔG (36).

Die Beschleunigung/Abbremsung [Gÿ), die durch Gleichung (34) oder (36) gegeben ist, wird beim Bestimmen des Soll-Dros­ selöffnungsgrads der Fig. 10 benutzt (Schritt S586), d. h. be­ nutzt in:The acceleration / deceleration [G ÿ ), which is given by equation (34) or (36), is used in determining the target throttle opening degree of FIG. 10 (step S586), ie used in:

TGV = TGV + [Gÿ].TGV = TGV + [G ÿ ].

Daher wird auch bei der zweiten Abänderung der Soll-Dros­ selöffnungsgrad durch Berücksichtigen der Beschleunigung/Ab­ bremsung [Gÿ] bestimmt, die bis dahin gelernt worden ist. Anders ausgedrückt wird bei der zweiten Abänderung, da der Drosselöffnungsgrad TGV, der in Übereinstimmung mit [Gÿ] erhöht oder erniedrigt wird, durch die in Fig. 10 gezeigte Regelungs-Ablauffolge erhalten, die Fahrzeuggeschwindigkeit wird geregelt, um sich auf diese Weise in einem Kurvenfahrzus­ tand zu erhöhen oder zu erniedrigen, und folglich wird der Fahrzeugabstand eingestellt, um mit der Vorliebe eines Fahrers übereinzustimmen.Therefore, even with the second modification, the target throttle opening degree is determined by taking into account the acceleration / deceleration [G ÿ ] that has been learned up to that point. In other words, in the second modification, since the throttle opening degree TGV which is increased or decreased in accordance with [G ÿ ] is obtained by the control sequence shown in Fig. 10, the vehicle speed is controlled to be in one way Increase or decrease cornering condition, and consequently the vehicle distance is adjusted to match a driver's preference.

Effekt der zweiten AbänderungEffect of the second amendment

Gemäß der in Fig. 26 gezeigten Regelungs-Ablauffolge kann, da der Zähler cÿ zum Zählen der Anzahl von Malen des Lernens von der in den Fig. 14 und 15 gezeigten Regelungs-Ablauffolge weggelassen werden kann, die Regelungs-Ablauffolge vereinfacht werden.According to the control sequence shown in FIG. 26, since the counter c ÿ for counting the number of times of learning can be omitted from the control sequence shown in FIGS. 14 and 15, the control sequence can be simplified.

Dritte Abänderung . . . Untersuchung über ein dazwischen fah­ rendes bzw. einfädelndes FahrzeugThird amendment. . . Investigation of an in between moving or threading vehicle

Die dritte Abänderung ist gemacht, um einen Fall, bei dem ein anderes Fahrzeug zwischen das Fahrzeug voraus und das eigene Fahrzeug fährt, von einem Fall zu unterscheiden, bei dem eine Straßenoberfläche oder eine Leitplanke fehlerhaft als Fahrzeug voraus bestimmt wird, und um eine richtige Regelung entspre­ chend diesen Fällen auszuführen. Der Grund, warum ein derar­ tiger Untersuchungsfehler auftritt, wird nachfolgend unter Bezugnahme auf die Fig. 29 und 30 erklärt.The third modification is made to distinguish a case in which another vehicle is traveling between the vehicle ahead and the own vehicle from a case in which a road surface or a guard rail is erroneously determined to be a vehicle ahead, and a proper control to execute accordingly in these cases. The reason why such an inspection error occurs will be explained below with reference to FIGS . 29 and 30.

Wenn ein Fahrzeug in einer Kurve fährt, erscheint dann, wenn die Kurve schärfer ist, für eine lange Zeitperiode eine Straßenbegrenzung vor dem eigenen Fahrzeug. Da der Sensor für einen Fahrzeugabstand 10 eine reflektierte Welle benutzt, wird eine durch die Straßenbegrenzung reflektierte Welle fehlerhaft als jene von dem Fahrzeug voraus detektiert, wie es in Fig. 29 gezeigt ist. Wie es in Fig. 30 gezeigt ist, wird dann, wenn die Fahrzeugkarosserie eine Nickbewegung durchführt, eine durch die Straßenoberfläche reflektierte Welle fehlerhaft als jene von dem Fahrzeug voraus detektiert. Somit wird bei der dritten Abänderung, wenn ein Zustand, bei dem der Abstand zu dem Fahrzeug voraus (oder einem Gegenstand voraus, der ein Fahrzeug zu sein scheint), der durch den Sensor gemessen wird, kleiner als der Soll-Fahrzeugabstand TGD ist, über eine vor­ bestimmte Zeitperiode (Tss) andauert, bestimmt, daß der Abstand nicht fehlerhaft gemessen ist, sondern ein anderes Fahrzeug zwischen das Fahrzeug voraus und das eigene Fahrzeug gefahren ist. In diesem Fall wird der Regelbetrieb schnell von der S-Typ-F/B-Regelung zu der- D-Typ-F/B-Regelung umgeschaltet. Zum Ausführen einer derartigen Regelung sind bei der Rege­ lungs-Ablauffolge gemäß der dritten Abänderung die Schritte S218 bis S232 in Fig. 20 bei dem obigen Ausführungsbeispiel zu jenen der Ablauffolge abgeändert, die in Fig. 27 gezeigt ist. Auch sind einige Schritte in Fig. 9 abgeändert, wie es in Fig. 28 gezeigt ist.When a vehicle is cornering, if the curve is sharper, a road boundary appears in front of the vehicle for a long period of time. Since the vehicle distance sensor 10 uses a reflected wave, a wave reflected by the road boundary is erroneously detected as that from the vehicle ahead, as shown in FIG. 29. As shown in FIG. 30, when the vehicle body nods, a wave reflected by the road surface is erroneously detected as that from the vehicle ahead. Thus, in the third modification, when a state in which the distance to the vehicle ahead (or an object ahead that appears to be a vehicle) measured by the sensor is smaller than the target vehicle distance TGD, is over that lasts a certain period of time (T ss ), determines that the distance is not measured incorrectly, but that another vehicle has traveled between the vehicle in front and the vehicle in question. In this case, control mode is quickly switched from S-type F / B control to D-type F / B control. To carry out such control, in the control sequence according to the third modification, steps S218 to S232 in FIG. 20 in the above embodiment are modified from those in the sequence shown in FIG. 27. Some steps in FIG. 9 are also modified, as shown in FIG. 28.

Bei der Ablauffolge, die in Fig. 27 gezeigt ist, wird eine Abweichung zwischen dem Soll-Fahrzeugabstand TGD und dem Ab­ stand Dn zu dem Gegenstand voraus zu jener Zeit berechnet und wird mit einem Schwellenwert A verglichen. Dann wird das Vergleichsergebnis in einem Flag für einen Fahrzeugabstand DF gespeichert. Genauer ausgedrückt sind die Inhalte des Flags DF wie folgt:In the sequence shown in FIG. 27, a deviation between the target vehicle distance TGD and the distance D n from the object ahead at that time is calculated and is compared with a threshold value A. Then the comparison result is stored in a flag for a vehicle distance DF. More precisely, the contents of the DF flag are as follows:

DF = 0 → der Soll-Fahrzeugabstand TGD stimmt mit dem aktuellen Fahrzeugabstand Dn überein.DF = 0 → the target vehicle distance TGD corresponds to the current vehicle distance D n .

DF = 1 → der aktuelle Fahrzeugabstand Dn ist größer als der Soll-Fahrzeugabstand TGD.DF = 1 → the current vehicle distance D n is greater than the target vehicle distance TGD.

DF = 2 → der aktuelle Fahrzeugabstand Dn ist kleiner als der Soll-Fahrzeugabstand TGD. DF = 2 → the current vehicle distance D n is smaller than the target vehicle distance TGD.

Basierend auf diesem Flag DF und der Signalausfallzeit VT, die im Schritt S212 in Fig. 20 gemessen wird, wird ein Einfädeln eines Fahrzeugs und eine fehlerhafte Erkennung eines Fahrzeugs voraus gemäß der Ablauffolge, die in Fig. 28 gezeigt ist, von­ einander unterschieden.Based on this flag DF and the signal failure time VT measured in step S212 in FIG. 20, a threading of a vehicle and an erroneous recognition of a vehicle ahead are discriminated from each other according to the sequence shown in FIG. 28.

Genauer ausgedrückt wird in den Schritten S1100 und S1102 in Fig. 28 der Wert-des Flags DF geprüft. Wenn DF = 0 ist, d. h., wenn das Fahrzeug voraus mit dem Soll-Fahrzeugabstand TGD ver­ riegelt ist, geht der Ablauf weiter zu Schritt S540, und die­ selbe D-Typ-F/B-Regelung wie bei dem obigen Ausführungsbeispiel (Fig. 10) wird ausgeführt.More specifically, the value of the flag DF is checked in steps S1100 and S1102 in FIG. 28. If DF = 0, that is, if the vehicle is locked ahead with the target vehicle distance TGD, the flow advances to step S540, and the same D-type F / B control as in the above embodiment ( Fig. 10) is running.

Wenn DF = 1 ist, wird der in dem Signalausfall-Zeitgeber VT gehaltene Wert mit einem vorbestimmten Schwellenwert TSL im Schritt S1104 verglichen. Man beachte, daß der Zeitgeber VT die Zeit hält, die in den Schritten S1011, S1012, S1025 und S1035 gemessen wird, d. h. die kontinuierliche Zeit eines Zu­ stands, in dem der aktuelle Fahrzeugabstand größer oder kleiner als der Soll-Fahrzeugabstand ist. Der Schwellenwert TSL ist im wesentlichen derselbe wie Ts im Schritt S530 in Fig. 9. Das heißt, wenn VT < TSL gilt, geht der Ablauf zu Schritt S522 weiter, um den Regelbetrieb "vollständig" von der D-Typ- F/B-Regelung zu der S-Typ-F/B-Regelung zu verschieben; wenn VT TSL gilt, geht der Ablauf weiter zu Schritt S532, um den Re­ gelbetrieb "temporär" von der D-Typ-F/B-Regelung zu der S-Typ- F/B-Regelung zu verschieben. Der Unterschied zwischen der "vollständigen" und der "temporären" Verschiebung zu der S-Typ-F/B-Regelung ist schon bei dem obigen Ausführungsbeis­ piel beschrieben worden. Das heißt, wenn der aktuelle Fahr­ zeugabstand Dn größer als der Soll-Fahrzeugabstand ist, wird die Regelung zu der S-Typ-F/B-Regelung verschoben, weil es sinnlos ist, die D-Typ-F/B-Regelung fortzuführen.If DF = 1, the value held in the dropout timer VT is compared with a predetermined threshold T SL in step S1104. Note that the timer VT holds the time measured in steps S1011, S1012, S1025 and S1035, that is, the continuous time of a state in which the current vehicle distance is larger or smaller than the target vehicle distance. The threshold T SL is substantially the same as T s in step S530 in Fig. 9. That is, if VT <T SL , the flow advances to step S522 to make the control operation "complete" from the D-type F / B control to shift to S type F / B control; if VT T SL holds, the flow advances to step S532 to "temporarily" shift the control operation from the D-type F / B control to the S-type F / B control. The difference between the "complete" and the "temporary" shift to the S-type F / B control has already been described in the example above. That is, if the current vehicle distance D n is greater than the target vehicle distance, the control is shifted to the S-type F / B control because it makes no sense to continue the D-type F / B control .

Andererseits, wenn DF = 2 ist, geht der Ablauf zu Schritt S1106, und die Ausfallzeit VT und der Schwellenwert Tss werden miteinander verglichen. Selbst wenn der aktuelle Fahrzeugab­ stand Dn kleiner als der Soll-Fahrzeugabstand ist (DF = 2), d. h. es ist auch dann, wenn ein Gegenstand, der ein Fahrzeug zu sein scheint, einen kleinen Abstand vor dem eigenen Fahr­ zeug vorhanden ist, da detektiert wird, daß die Zeit VT, während der der Gegenstand voraus vorhanden ist, näher als die Position des Soll-Fahrzeugabstands ist, kürzer als die Schwel­ lenwertzeit Tss ist, sehr wahrscheinlich, daß der Gegenstand aufgrund einer Nickbewegung oder eines Kurvenfahrzustands de­ tektiert wird. Aus diesem Grund bleibt die Regelung nicht bei der D-Typ-F/B-Regelung und geht weiter zu Schritt S1106, um den Regelbetrieb "temporär" zu der S-Typ-F/B-Regelung zu ver­ schieben. Im Gegensatz dazu wird dann, wenn ein Gegenstand, der ein Fahrzeug zu sein scheint, einen kleinen Abstand vor­ handen ist, und wenn die Zeit VT, in der der Gegenstand voraus einen kleinen Abstand vor dem eigenen Fahrzeug vorhanden ist, länger als die Schwellenwertzeit Tss ist, der Gegenstand als ein Fahrzeug bestimmt, das zwischen das Fahrzeug voraus und das eigene Fahrzeug gefahren bzw. eingefädelt ist. Der Ablauf geht dann weiter zu Schritt S540, um die D-Typ-F/B-Regelung fortzuführen. Genauer ausgedrückt wird die D-Typ-F/B-Regelung unter Benutzung eines dazwischen fahrenden bzw. einfädelnden Fahrzeugs als ein Ziel ausgeführt.On the other hand, when DF = 2, the flow goes to step S1106, and the downtime VT and the threshold T ss are compared with each other. Even if the current vehicle distance D n is smaller than the target vehicle distance (DF = 2), that is, even if an object that appears to be a vehicle is a small distance in front of the vehicle, there is it is detected that the time VT during which the object is in front is closer than the position of the target vehicle distance is shorter than the threshold value time T ss, it is very likely that the object will be detected due to a pitching movement or a cornering state . For this reason, the control does not remain with the D-type F / B control and goes to step S1106 to shift the control operation "temporarily" to the S-type F / B control. In contrast, when an object that appears to be a vehicle is a short distance away, and when the time VT in which the object is a small distance ahead of the own vehicle becomes longer than the threshold time T ss , the object is determined as a vehicle that is driven or threaded between the vehicle ahead and the own vehicle. The flow then proceeds to step S540 to continue the D-type F / B control. More specifically, the D-type F / B control is carried out using an intervening vehicle as a target.

Effekt der dritten AbänderungEffect of the third amendment

Gemäß der dritten Abänderung, die oben beschrieben ist, kann nicht nur ein dazwischen fahrendes Fahrzeug voraus genau be­ stimmt werden, sondern es kann auch die D-Typ-F/B-Regelung fortgeführt werden, während ein Zielfahrzeug der D-Typ-F/B- Regelung von dem vorangehenden Fahrzeug voraus zu dem da­ zwischen fahrenden Fahrzeug geändert werden, wodurch die Si­ cherheit verbessert wird.According to the third modification described above, not just be a vehicle in between exactly ahead be true, but it can also use the D-type F / B control to be continued while a target vehicle of D-type F / B- Regulation from the preceding vehicle ahead to that be changed between moving vehicle, whereby the Si security is improved.

Wie es offensichtlich ist, können sehr viele verschiedene Ausführungsbeispiele der vorliegenden Erfindung gemacht werden, ohne von ihrem Geist und Schutzumfang abzuweichen, und es soll verstanden werden, daß die Erfindung nicht auf ihre spezifischen Ausführungsbeispiele beschränkt ist, außer wie es in den angehängten Ansprüchen definiert ist.As is obvious, there can be many different ones Embodiments of the present invention made  without deviating from their spirit and scope, and it should be understood that the invention is not limited to its specific embodiments is limited except how it is defined in the appended claims.

Claims (20)

1. Vorrichtung zur Geschwindigkeitsregelung, die folgendes auf­ weist:
eine Operationseinrichtung zum Einstellen einer Soll-Fahrzeug­ geschwindigkeit über eine durch einen Fahrer ausgeführte Operation;
eine Einrichtung zur automatischen Geschwindigkeitsregelung ba­ sierend auf einer Fahrzeuggeschwindigkeit zum Regeln einer Fahr­ zeuggeschwindigkeit zu der durch die Operationseinrichtung eingestellten Soll-Fahrzeuggeschwindigkeit;
eine Einrichtung zur automatischen Geschwindigkeitsregelung ba­ sierend auf einem Fahrzeugabstand zum Beibehalten eines Fahr­ zeugabstands zu einem Fahrzeug voraus als einen vorbestimmten Soll-Fahrzeugabstand; und
eine Umwandlungseinrichtung zum Detektieren einer Operationsin­ formation von der Operationseinrichtung unter einer vorbestimmten Bedingung, zum Umwandeln der detektierten Oper­ ationsinformation in eine Fahrzeugabstands-Information und zum Ausgeben der umgewandelten Fahrzeugabstands-Information zu der Einrichtung zur automatischen Geschwindigkeitsregelung basierend auf dem Fahrzeugabstand.
1. A speed control device comprising:
an operation device for setting a target vehicle speed via an operation performed by a driver;
a device for automatic speed control based on a vehicle speed for regulating a vehicle speed to the target vehicle speed set by the operating device;
means for automatic cruise control based on a vehicle distance for maintaining a vehicle distance from a vehicle ahead as a predetermined target vehicle distance; and
conversion means for detecting operation information from the operation means under a predetermined condition, for converting the detected operation information into vehicle distance information, and for outputting the converted vehicle distance information to the automatic cruise control device based on the vehicle distance.
2. Vorrichtung nach Anspruch 1, die weiterhin folgendes aufweist:
eine Einrichtung zum exklusiven Schalten eines Fahrbetriebs zwischen einem auf einer Fahrzeuggeschwindigkeit basierenden Betrieb, bei dem die Einrichtung zur automatischen Geschwindig­ keitsregelung basierend auf der Fahrzeuggeschwindigkeit ar­ beitet, und einem auf einem Fahrzeugabstand basierenden Betrieb, bei dem die Einrichtung zur automatischen Geschwindigkeitsrege­ lung basierend auf dem Fahrzeugabstand arbeitet.
2. The apparatus of claim 1, further comprising:
means for exclusively switching a driving operation between a vehicle speed-based operation in which the automatic speed control device operates based on the vehicle speed and a vehicle distance-based operation in which the automatic speed control device based on the vehicle distance is working.
3. Vorrichtung nach Anspruch 1, wobei die Umwandlungseinrichtung eine Operationsinformation der Operationseinrichtung zum Erhöhen der Soll-Fahrzeuggeschwindigkeit durch den Fahrer unter der vor­ bestimmten Bedingung in eine Operationsinformation umwandelt, die eine Operation zum Erniedrigen des Soll-Fahrzeugabstands unter der vorbestimmten Bedingung bedeutet, und die umgewandelte Operationsinformation zu der Einrichtung zur automatischen Geschwindigkeitsregelung basierend auf dem Fahrzeugabstand ausgibt.3. The apparatus of claim 1, wherein the converting means an operation information of the operation device for increasing the target vehicle speed by the driver under the front converts certain condition into operational information, which is an operation to decrease the target vehicle distance means under the predetermined condition, and the converted one Operation information on the device for automatic Cruise control based on vehicle distance issues.
4. Vorrichtung nach Anspruch 1, wobei die Umwandlungseinrichtung eine Operationsinformation der Operationseinrichtung zum Ernie­ drigen der Soll-Fahrzeuggeschwindigkeit durch den Fahrer unter der vorbestimmten Bedingung in eine Operationsinformation umwan­ delt, die eine Operation zum Erhöhen des Soll-Fahrzeugabstands unter der vorbestimmten Bedingung bedeutet, und die umgewandelte Operationsinformation zu der Einrichtung zur automatischen Geschwindigkeitsregelung basierend auf dem Fahrzeugabstand ausgibt. 4. The apparatus of claim 1, wherein the converting means operation information of the operation facility for Ernie Drigen below the target vehicle speed convert the predetermined condition into operation information delt, an operation to increase the target vehicle distance means under the predetermined condition, and the converted one Operation information on the device for automatic Cruise control based on vehicle distance issues.  
5. Vorrichtung nach Anspruch 1, wobei die Umwandlungseinrichtung eine Operationsinformation der Operationseinrichtung zum Eins­ tellen der Soll-Fahrzeuggeschwindigkeit durch den Fahrer unter der vorbestimmten Bedingung in eine Operationsinformation zum Einstellen des Soll-Fahrzeugabstands unter der vorbestimmten Bedingung umwandelt und die umgewandelte Operationsinformation zu der Einrichtung zur automatischen Geschwindigkeitsregelung basierend auf dem Fahrzeugabstand ausgibt.5. The apparatus of claim 1, wherein the converting means an operation information of the operation device for one set the target vehicle speed by the driver the predetermined condition into an operation information for Setting the target vehicle distance below the predetermined Condition converted and the converted operation information to the device for automatic cruise control based on the vehicle distance.
6. Vorrichtung nach Anspruch, 3, wobei die Operationseinrichtung einen EINSTELL-Schalter vom Druckknopftyp zum Einstellen der Soll-Fahrzeuggeschwindigkeit aufweist, und die Umwandlungsein­ richtung während der EINSTELL-Schalter unter der vorbestimmten Bedingung kontinuierlich niedergedrückt wird, ein Signal, das die Niederdrückoperation anzeigt, in ein Signal zum Erhöhen einer Fahrzeuggeschwindigkeit umwandelt, einen Abstand zu dem Fahrzeug voraus, der erhalten wird, wenn der EINSTELL-Schalter losgelassen wird, derart einstellt, daß er der Soll-Fahrzeugab­ stand ist, und den Soll-Fahrzeugabstand zu der Einrichtung zur automatischen Geschwindigkeitsregelung basierend auf dem Fahr­ zeugabstand ausgibt.6. The device according to claim 3, wherein the operating device a push button type SET switch for setting the Has target vehicle speed, and the conversion direction during the SET switch below the predetermined one Condition is continuously depressed, a signal that the depress operation indicates a raise signal a vehicle speed converts a distance to that Vehicle ahead which is obtained when the SET switch is released so that it sets the target vehicle is, and the target vehicle distance to the facility automatic cruise control based on driving outputs tool distance.
7. Vorrichtung nach Anspruch 4, wobei die Operationseinrichtung einen LEERLAUF-Schalter zum Erniedrigen der Soll-Fahrzeuggesch­ windigkeit hat, und die Umwandlungseinrichtung, während der LEERLAUF-Schalter unter der vorbestimmten Bedingung kontinuier­ lich niedergedrückt wird, ein Signal, das die Niederdrückoper­ ation anzeigt, in ein Signal zum Erniedrigen einer Fahrzeuggeschwindigkeit umwandelt, einen Abstand zu dem Fahrzeug voraus, der erhalten wird, wenn der LEERLAUF-Schalter losge­ lassen wird, derart einstellt, daß er der Soll-Fahrzeugabstand ist, und den Soll-Fahrzeugabstand zu der Einrichtung zur automa­ tischen Geschwindigkeitsregelung basierend auf dem Fahrzeugab­ stand ausgibt. 7. The device according to claim 4, wherein the operating device an IDLE switch to lower the target vehicle speed has windiness, and the conversion device during the IDLE switch continuously under the predetermined condition is depressed, a signal that the depressing opera ation indicates in a signal to humiliate one Vehicle speed converts a distance to the vehicle ahead, which is obtained when the IDLE switch is released is set such that it is the target vehicle distance is, and the target vehicle distance to the device for automa table speed control based on the vehicle stood out.  
8. Vorrichtung nach Anspruch 5, wobei die Operationseinrichtung einen EINSTELL-Schalter vom Druckknopftyp zum Einstellen der Soll-Fahrzeuggeschwindigkeit hat, und wenn detektiert wird, daß der EINSTELL-Schalter für eine kurze Zeitperiode unter der vor­ bestimmten Bedingung niedergedrückt ist, die Umwandlungseinrich­ tung einen Abstand zu dem Fahrzeug voraus, der erhalten wird, wenn der EINSTELL-Schalter niedergedrückt wird, derart ein­ stellt, daß er der Soll-Fahrzeugabstand ist, und den Soll-Fahr­ zeugabstand zu der Einrichtung zur automatischen Geschwindig­ keitsregelung basierend auf dem Fahrzeugabstand ausgibt.8. The device according to claim 5, wherein the operating device a push button type SET switch for setting the Has target vehicle speed, and if it is detected that the SET switch for a short period of time under the certain condition is depressed, the conversion device distance from the vehicle that is obtained when the SET switch is depressed represents that it is the target vehicle distance and the target driving Distance to the automatic speed device control based on the vehicle distance.
9. Vorrichtung nach Anspruch 2, wobei die vorbestimmte Bedingung gemäß einer Operationszeit der durch den Fahrer betätigten Ope­ rationseinrichtung in dem Betrieb basierend auf dem Fahrzeugab­ stand bestimmt wird.9. The apparatus of claim 2, wherein the predetermined condition according to an operation time of the ope operated by the driver rationseinrichtung in the operation based on the vehicle was determined.
10. Vorrichtung nach Anspruch 1, wobei die Operationseinrichtung einen WIEDERAUFNAHME-Schalter hat, der eine Operation zum Wied­ eraufnehmen einer automatischen Geschwindigkeitsregelungs- Operation bedeutet, nachdem die automatische Geschwindigkeitsregelungs-Operation temporär gelöscht ist, und die Umwandlungseinrichtung die Einrichtung zur automatischen Geschwindigkeitsregelung basierend auf dem Fahrzeugabstand in­ struiert, eine automatische Geschwindigkeitsregelung basierend auf einem Fahrzeugabstand neu zu starten, wenn der WIEDERAUFNAHME-Schalter unter der vorbestimmten Bedingung nie­ dergedrückt ist.10. The apparatus of claim 1, wherein the surgical device has a RESUME switch that performs an operation to resume record an automatic cruise control Operation means after the automatic Cruise control operation is temporarily deleted, and the conversion device the device for automatic Cruise control based on the vehicle distance in structured, an automatic speed control based to restart at a vehicle distance if the RESUME switch never under the predetermined condition is depressed.
11. Vorrichtung nach Anspruch 1, wobei die Operationseinrichtung wenigstens einen EINSTELL-Schalter, einen LEERLAUF-Schalter und einen WIEDERAUFNAHME-Schalter hat, die ein nahe einem Lenkrad angeordnetes Operationselement bilden.11. The device according to claim 1, wherein the operating device at least one SET switch, an IDLE switch and has a RESUME switch that is near a steering wheel form arranged surgical element.
12. Vorrichtung zur Geschwindigkeitsregelung, die folgendes aufweist:
eine Operationseinrichtung zum Ausgeben eines vorbestimmten Sig­ nals in Übereinstimmung mit einer durch einen Fahrer aus­ geführten Operation;
eine Einrichtung zur automatischen Geschwindigkeitsregelung ba­ sierend auf einer Fahrzeuggeschwindigkeit zum Umwandeln des Sig­ nals von der Operationseinrichtung in ein Soll-Fahrzeugge­ schwindigkeitssignal und zum Steuern einer Fahrzeuggeschwindig­ keit zu einer Soll-Fahrzeuggeschwindigkeit auf der Basis des umgewandelten Signals in einem ersten Betrieb; und
eine Einrichtung zur automatischen Geschwindigkeitsregelung ba­ sierend auf einem Fahrzeugabstand zum Umwandeln des Signals von der Operationseinrichtung in ein Soll-Fahrzeugabstandssignal und zum Beibehalten eines Fahrzeugabstands zu einem Fahrzeug voraus als einen Soll-Fahrzeugabstand auf der Basis des umgewandelten Signals in einem zweiten Betrieb.
12. A speed control device comprising:
operation means for outputting a predetermined signal in accordance with an operation performed by a driver;
automatic speed control means based on a vehicle speed for converting the signal from the operation means into a target vehicle speed signal and for controlling a vehicle speed to a target vehicle speed based on the converted signal in a first operation; and
means for automatic cruise control based on a vehicle distance for converting the signal from the operation device into a target vehicle distance signal and for maintaining a vehicle distance to a vehicle ahead as a target vehicle distance based on the converted signal in a second operation.
13. Vorrichtung nach Anspruch 12, wobei die Operationseinrichtung wenigstens einen EINSTELL-Schalter, einen LEERLAUF-Schalter und einen WIEDERAUFNAHME-Schalter hat, die ein nahe einem Lenkrad angeordnetes Operationselement bilden.13. The apparatus of claim 12, wherein the surgical device at least one SET switch, an IDLE switch and has a RESUME switch that is near a steering wheel form arranged surgical element.
14. Vorrichtung nach Anspruch 12, wobei die Operationseinrichtung einen EINSTELL-Schalter vom Druckknopftyp zum Einstellen einer Soll-Fahrzeuggeschwindigkeit hat, und die Einrichtung zur auto­ matischen Geschwindigkeitsregelung basierend auf dem Fahrzeugab­ stand, während der EINSTELL-Schalter kontinuierlich niedergedrückt wird, ein Signal, das die Niederdrückoperation anzeigt, in ein Signal zum Erhöhen der Fahrzeuggeschwindigkeit umwandelt, und einen Abstand zu einem Fahrzeug voraus, der er­ halten wird, wenn der EINSTELL-Schalter losgelassen wird, derart einstellt, daß er der Soll-Fahrzeugabstand ist.14. The apparatus of claim 12, wherein the surgical device a push button type SET switch for setting one Has target vehicle speed, and the facility to auto matic speed control based on the vehicle stopped while the SET switch was on is depressed, a signal indicating the depressing operation indicates a signal to increase the vehicle speed converts, and a distance ahead of a vehicle that he will stop when the SET switch is released sets that it is the target vehicle distance.
15. Vorrichtung nach Anspruch 12, wobei die Operationseinrichtung einen LEERLAUF-Schalter zum Erniedrigen der Soll-Fahrzeuggesch­ windigkeit hat, und die Einrichtung zur automatischen Geschwin­ digkeitsregelung basierend auf dem Fahrzeugabstand, während der LEERLAUF-Schalter kontinuierlich niedergedrückt wird, ein Sig­ nal, das die Niederdrückoperation anzeigt, in ein Signal zum Erniedrigen der Fahrzeuggeschwindigkeit umwandelt, und einen Abstand zu dem Fahrzeug voraus, der erhalten wird, wenn der LEERLAUF-Schalter losgelassen wird, derart einstellt, daß er der Soll-Fahrzeugabstand ist.15. The apparatus of claim 12, wherein the surgical device an IDLE switch to lower the target vehicle speed windy, and the device for automatic speed regulation based on the vehicle distance during the  IDLE switch is continuously depressed, a sig signal indicating the depressing operation into a signal to Decreasing the vehicle speed converts, and one Distance ahead of the vehicle obtained when the IDLE switch is released so that it is the Target vehicle distance is.
16. Vorrichtung nach Anspruch 12, wobei die Operationseinrichtung einen EINSTELL-Schalter vom Druckknopftyp hat zum Einstellen der Soll-Fahrzeuggeschwindigkeit, und wenn detektiert wird, daß der EINSTELL-Schalter für eine kurze Zeitperiode niedergedrückt wird, die Einrichtung zur automatischen Geschwindigkeitsregelung basierend auf dem Fahrzeugabstand einen Abstand zu dem Fahrzeug voraus, der beim Niederdrücken des EINSTELL-Schalters erhalten wird, derart einstellt, daß er der Soll-Fahrzeugabstand ist.16. The apparatus of claim 12, wherein the surgical device has a push button type SET switch for setting the Target vehicle speed, and if it is detected that the SET switch depressed for a short period of time the device for automatic cruise control a distance to the vehicle based on the vehicle distance in advance, which is obtained when the SET switch is depressed is set such that it is the target vehicle distance.
17. Vorrichtung nach Anspruch 12, das weiterhin folgendes aufweist:
eine Einrichtung dafür, daß dann, wenn die Regelvorrichtung ge­ startet wird, ein Einstellen eines Steuerbetriebs der Regelvor­ richtung in dem ersten Betrieb zum Regeln der Fahrzeuggeschwin­ digkeit zu der Soll-Fahrzeuggeschwindigkeit durchgeführt wird; und
eine Einrichtung dafür, daß dann, wenn in dem ersten Betrieb detektiert wird, daß der Fahrzeugabstand nahe zu einem vorbe­ stimmten Soll-Fahrzeugabstand gelangt, ein Ändern des Regelbe­ triebs der Regelvorrichtung von dem ersten Betrieb zu dem zweiten Betrieb erfolgt zum Beibehalten des Fahrzeugabstands als den Soll-Fahrzeugabstand.
17. The apparatus of claim 12, further comprising:
means for, when the control device is started, setting control operation of the control device in the first operation for controlling the vehicle speed to the target vehicle speed; and
means for, when it is detected in the first operation that the vehicle distance gets close to a predetermined target vehicle distance, changing the control operation of the control device from the first operation to the second operation is carried out to maintain the vehicle distance as that Target vehicle distance.
18. Vorrichtung zur Geschwindigkeitsregelung, die eine Geschwindig­ keitsregelung basierend auf einer Fahrzeuggeschwindigkeit zum Regeln einer Fahrzeuggeschwindigkeit zu einer Soll-Fahrzeug­ geschwindigkeit und eine Geschwindigkeitsregelung basierend auf einem Fahrzeugabstand zum Beibehalten eines Fahrzeugabstands zu einem Fahrzeug voraus als Soll-Fahrzeugabstand individuell ausführen kann, wobei die Vorrichtung folgendes aufweist:
ein Operationselement mit einem ersten Schalter, der von einem Fahrer niedergedrückt werden kann;
einen Operationssensor zum Detektieren der durch den Fahrer ver­ anlaßten Operation des ersten Schalters;
einen Fahrzeuggeschwindigkeitssensor zum Detektieren einer Fahrzeuggeschwindigkeit;
einen Abstandssensor zum Detektieren eines Fahrzeugabstands zu dem Fahrzeug voraus;
einen Umwandlungsabschnitt zum Empfangen von Ausgangssignalen von dem Operationssensor, dem Fahrzeuggeschwindigkeitssensor und dem Abstandssensor, um dann, wenn der erste Schalter in einem Be­ trieb zur automatischen Geschwindigkeitsregelung basierend auf einer Fahrzeuggeschwindigkeit betrieben wird, Fahrzeuggeschwin­ digkeitsdaten, die zu jener Zeit durch den Fahrzeuggeschwindig­ keitssensor detektiert werden, in Soll-Fahrzeuggeschwindig­ keitsdaten umzuwandeln, und um dann, wenn der erste Schalter in einem Betrieb zur automatischen Geschwindigkeitsregelung basie­ rend auf einem Fahrzeugabstand betrieben wird, Fahrzeugabstands­ daten, die zu jener Zeit durch den Abstandssensor detektiert werden, in Soll-Fahrzeugabstandsdaten umzuwandeln; und
einen Regelabschnitt zum Regeln der Fahrzeuggeschwindigkeit zu der umgewandelten Soll-Fahrzeuggeschwindigkeit in dem Betrieb zur automatischen Geschwindigkeitsregelung basierend auf der Fahrzeuggeschwindigkeit und zum Regeln des Fahrzeugabstands zu dem Fahrzeug voraus zu dem umgewandelten Soll-Fahrzeugabstand in dem Betrieb zur automatischen Geschwindigkeitsregelung basierend auf dem Fahrzeugabstand.
18. A cruise control device that can individually execute a cruise control based on a vehicle speed for controlling a vehicle speed to a target vehicle speed and a cruise control based on a vehicle distance to maintain a vehicle distance from a vehicle ahead as a target vehicle distance, wherein the device has the following:
an operating element with a first switch that can be depressed by a driver;
an operation sensor for detecting the operation of the first switch caused by the driver;
a vehicle speed sensor for detecting a vehicle speed;
a distance sensor for detecting a vehicle distance from the vehicle ahead;
a conversion section for receiving output signals from the operation sensor, the vehicle speed sensor, and the distance sensor, and when the first switch is operated in an automatic speed control operation based on a vehicle speed, vehicle speed data detected by the vehicle speed sensor at that time convert to target vehicle speed data and, when the first switch is operated in an automatic cruise control operation based on a vehicle distance, convert vehicle distance data detected by the distance sensor at that time to target vehicle distance data; and
a control section for controlling the vehicle speed to the converted target vehicle speed in the automatic speed control operation based on the vehicle speed and for controlling the vehicle distance to the vehicle ahead of the converted target vehicle distance in the automatic speed control operation based on the vehicle distance.
19. Vorrichtung nach Anspruch 18, wobei der erste Schalter ein EINSTELL-Schalter vom Druckknopftyp ist, und wenn in dem Betrieb zur automatischen Geschwindigkeitsregelung basierend auf dem Fahrzeugabstand detektiert wird, daß der EINSTELL-Schalter für eine vorbestimmte Zeitperiode niedergedrückt ist, die Umwand­ lungseinrichtung einen Fahrzeugabstand, der erhalten wird, wenn der EINSTELL-Schalter losgelassen wird, derart einstellt, daß er der Soll-Fahrzeugabstand ist. 19. The apparatus of claim 18, wherein the first switch is on SET button is of the push button type, and when in operation for automatic speed control based on the Vehicle distance is detected that the SET switch for is depressed for a predetermined period of time, the conversion a vehicle distance that is obtained when the SET switch is released so that it is the target vehicle distance.  
20. Vorrichtung nach Anspruch 18, wobei das Operationselement einen LEERLAUF-Schalter als einen zweiten Schalter aufweist, und die Umwandlungseinrichtung dann, wenn in dem Betrieb zur automa­ tischen Geschwindigkeitsregelung basierend auf dem Fahrzeugab­ stand detektiert wird, daß der LEERLAUF-Schalter niedergedrückt ist, ein Fahrzeugabstand, der erhalten wird, wenn der LEERLAUF- Schalter losgelassen wird, derart einstellt, daß er der Soll-Fahrzeugabstand ist.20. The apparatus of claim 18, wherein the surgical element IDLE switch as a second switch, and the Conversion device if in the operation for automa table speed control based on the vehicle it is detected that the IDLE switch is depressed is a vehicle distance that is obtained when the IDLE Release switch is set so that it is the Target vehicle distance is.
DE4417593A 1993-05-19 1994-05-19 Vehicle speed control device Withdrawn DE4417593A1 (de)

Priority Applications (1)

Application Number Priority Date Filing Date Title
JP5117007A JPH06320985A (ja) 1993-05-19 1993-05-19 Vehicle speed control device

Publications (1)

Publication Number Publication Date
DE4417593A1 true DE4417593A1 (de) 1994-11-24

Family

ID=14701157

Family Applications (1)

Application Number Title Priority Date Filing Date
DE4417593A Withdrawn DE4417593A1 (de) 1993-05-19 1994-05-19 Vehicle speed control device

Country Status (3)

Country Link
US (1) US5695020A (de)
JP (1) JPH06320985A (de)
DE (1) DE4417593A1 (de)

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE19509492A1 (de) * 1995-03-16 1996-09-19 Daimler Benz Ag Method and device for limiting the speed of a motor vehicle
DE19719475A1 (de) * 1997-05-07 1998-11-12 Man Nutzfahrzeuge Ag Operating parts, operating management and visual displays for a vehicle speed controller and a distance-controlled vehicle speed controller
DE19719476A1 (de) * 1997-05-07 1998-11-12 Man Nutzfahrzeuge Ag Bedienhebel und Bedienmanagement für einen abstandsgeregelten Fahrgeschwindigkeitsregler
WO1999037498A1 (de) * 1998-01-24 1999-07-29 Bayerische Motoren Werke Aktiengesellschaft Abstandsbezogenes elektronisch gesteuertes fahrgeschwindigkeitsregelsystem
WO2000009357A1 (en) * 1998-08-12 2000-02-24 Lucas Industries Plc Method of and apparatus for controlling headway
US6233516B1 (en) 1998-01-14 2001-05-15 Nissan Motor Co., Ltd. Apparatus and method for controlling inter-vehicle distance to another vehicle traveling ahead of automotive vehicle equipped with the apparatus and method
DE19913620B4 (de) * 1998-03-30 2004-08-12 Nissan Motor Co., Ltd., Yokohama Device for distance-controlled driving of a motor vehicle
EP1144217B1 (de) * 1998-07-29 2004-09-22 TRW Limited Geschwindigkeitsregelanlage mit sollgeschwindigkeitsreduzierung zur einhaltung eines bestimmten abstands zu einem führungsfahrzeug, fahrzeug mit einer derartigen anlage, verfahren zur entsprechenden steuerung eines fahrzeugs und computer programm zur realisierung des verfahrens

Families Citing this family (32)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP3143063B2 (ja) * 1996-06-07 2001-03-07 株式会社日立製作所 Travel control device for moving objects
US6199001B1 (en) 1996-12-19 2001-03-06 Toyota Jidosha Kabushiki Kaisha Control system for controlling the behavior of a vehicle based on accurately detected route information
JPH10184877A (ja) * 1996-12-24 1998-07-14 Toyota Motor Corp Control device for stepped transmission
JPH115456A (ja) * 1997-06-16 1999-01-12 Hino Motors Ltd Auto cruise equipment
GB2328542A (en) * 1997-08-20 1999-02-24 Jaguar Cars Vehicle adaptive cruise control
JP3402173B2 (ja) * 1998-01-08 2003-04-28 日産自動車株式会社 Automatic speed controller
DE19832870C1 (de) * 1998-07-22 1999-04-08 Porsche Ag Bedienelement für eine Abstandsregeleinrichtung für Fahrzeuge
US6263282B1 (en) * 1998-08-27 2001-07-17 Lucent Technologies, Inc. System and method for warning of dangerous driving conditions
JP3799837B2 (ja) * 1998-10-16 2006-07-19 株式会社デンソー Notification device for cruise control device
US6148251A (en) * 1999-01-12 2000-11-14 Trw Inc. Touchtone electronic steering wheel
JP3675235B2 (ja) * 1999-06-30 2005-07-27 日産自動車株式会社 Vehicle travel control device
JP3675240B2 (ja) * 1999-07-19 2005-07-27 日産自動車株式会社 Vehicle tracking control device
JP3627582B2 (ja) * 1999-07-30 2005-03-09 日産自動車株式会社 Vehicle tracking control device
US6275764B1 (en) * 1999-12-22 2001-08-14 Visteon Global Technologies, Inc. Method and system for providing a headway function to an adaptive speed control activation switch
JP2003522072A (ja) * 2000-02-09 2003-07-22 コンティネンタル・テーベス・アクチエンゲゼルシヤフト・ウント・コンパニー・オッフェネ・ハンデルスゲゼルシヤフト Circuit and device for adjusting and controlling the running speed of an automobile
JP2001260704A (ja) * 2000-03-22 2001-09-26 Fujitsu Ten Ltd 走行支援システム
JP4742451B2 (ja) * 2000-07-11 2011-08-10 トヨタ自動車株式会社 走行制御装置
US6945346B2 (en) * 2000-09-28 2005-09-20 Automotive Distance Control Systems Gmbh Method for operating a driver support system for motor vehicles
JP3777970B2 (ja) * 2000-11-02 2006-05-24 日産自動車株式会社 Preceding vehicle tracking control device
JP3909647B2 (ja) * 2000-12-13 2007-04-25 本田技研工業株式会社 Auto cruise equipment
US6860351B2 (en) * 2001-10-15 2005-03-01 Caterpillar Inc Apparatus and method for data communication
DE10218698A1 (de) * 2002-04-26 2003-11-13 Bosch Gmbh Robert Driver assistance system
JP3918686B2 (ja) * 2002-08-30 2007-05-23 株式会社日立製作所 Driving control apparatus and control method for automobile
JP2007513821A (ja) * 2003-11-14 2007-05-31 コンティネンタル・テーベス・アクチエンゲゼルシヤフト・ウント・コンパニー・オッフェネ・ハンデルスゲゼルシヤフト 追尾及び距離制御を改善する方法
JP4419531B2 (ja) * 2003-11-20 2010-02-24 日産自動車株式会社 車両用運転操作補助装置および車両用運転操作補助装置を備える車両
DE102004051909A1 (de) * 2004-09-30 2006-04-06 Robert Bosch Gmbh Verfahren und Vorrichtung zur Beeinflussung der Längsgeschwindigkeit eines Kraftfahrzeugs
AT459502T (de) 2004-12-10 2010-03-15 Volvo Lastvagnar Ab Verfahren und rechnerprogramm an einem fahrzeug zur einstellung des abstands zu einem fahrzeug davor
JP2007099225A (ja) * 2005-10-07 2007-04-19 Denso Corp Vehicle automatic travel control device
JP4631824B2 (ja) * 2006-07-31 2011-02-23 株式会社デンソー Auto cruise device and program
CN102282598B (zh) * 2009-01-20 2015-02-18 丰田自动车株式会社 队列行驶控制系统及车辆
US9014915B2 (en) * 2011-07-25 2015-04-21 GM Global Technology Operations LLC Active safety control for vehicles
DE102013102087A1 (de) 2013-03-04 2014-09-04 Conti Temic Microelectronic Gmbh Method for operating a driver assistance system of a vehicle

Family Cites Families (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPH0141528B2 (de) * 1981-08-13 1989-09-06 Nippon Denso Co
JPS646342Y2 (de) * 1983-05-23 1989-02-17
JPH0344005B2 (de) * 1984-06-15 1991-07-04 Nippon Jidosha Buhin Sogo Kenkyusho Kk
JPS616034A (en) * 1984-06-20 1986-01-11 Nissan Motor Co Ltd Car running control device
JPS61146644A (en) * 1984-12-19 1986-07-04 Nissan Motor Co Ltd Vehicle running control device
JPH0617088B2 (ja) * 1984-12-25 1994-03-09 日産自動車株式会社 車両走行制御装置
US4763746A (en) * 1985-12-24 1988-08-16 Toyota Jidosha Kabushiki Kaisha Vehicle speed control system
JP2524997B2 (ja) * 1987-03-19 1996-08-14 日産自動車株式会社 Constant-speed running control device for vehicle
JPS63269736A (en) * 1987-04-27 1988-11-08 Mazda Motor Corp Constant speed drive device for automobile
JPS6412930A (en) * 1987-07-02 1989-01-17 Mitsubishi Electric Corp Constant-speed travel device for vehicle
US5189619A (en) * 1989-09-05 1993-02-23 Toyota Jidosha Kabushiki Kaisha AI-based adaptive vehicle control system
JPH03118700A (en) * 1989-09-29 1991-05-21 Mazda Motor Corp Fixed-speed traveling device for vehicle
KR940001633B1 (ko) * 1990-01-17 1994-02-28 미쯔비시 덴끼 가부시끼가이샤 Driving control
US5014200A (en) * 1990-02-20 1991-05-07 General Motors Corporation Adaptive cruise system
JPH0412144A (en) * 1990-04-28 1992-01-16 Aisin Seiki Co Ltd Vehicle speed control device
JPH0438600A (en) * 1990-06-04 1992-02-07 Mitsubishi Electric Corp Controller for traveling of vehicle
US5173859A (en) * 1990-11-05 1992-12-22 General Motors Corporation Automatic vehicle deceleration
JP2987778B2 (ja) * 1990-11-30 1999-12-06 アイシン精機株式会社 車両速度制御装置
US5165497A (en) * 1991-02-26 1992-11-24 Chi C Y Automatic safety driving distance control device for a vehicle
DE4200694B4 (de) * 1992-01-14 2004-04-29 Robert Bosch Gmbh Method for speed and distance control of a vehicle
DE4209060C2 (de) * 1992-03-20 1994-12-15 Daimler Benz Ag Method for regulating the distance between moving motor vehicles
JP3438279B2 (ja) * 1993-05-19 2003-08-18 マツダ株式会社 Vehicle speed control device

Cited By (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE19509492A1 (de) * 1995-03-16 1996-09-19 Daimler Benz Ag Method and device for limiting the speed of a motor vehicle
US5665026A (en) * 1995-03-16 1997-09-09 Mercedes-Benz Ag Method and apparatus for limiting the speed of a motor vehicle
DE19509492C2 (de) * 1995-03-16 1998-08-27 Daimler Benz Ag Method and device for limiting the speed of a motor vehicle
DE19719475A1 (de) * 1997-05-07 1998-11-12 Man Nutzfahrzeuge Ag Operating parts, operating management and visual displays for a vehicle speed controller and a distance-controlled vehicle speed controller
DE19719476A1 (de) * 1997-05-07 1998-11-12 Man Nutzfahrzeuge Ag Bedienhebel und Bedienmanagement für einen abstandsgeregelten Fahrgeschwindigkeitsregler
US6233516B1 (en) 1998-01-14 2001-05-15 Nissan Motor Co., Ltd. Apparatus and method for controlling inter-vehicle distance to another vehicle traveling ahead of automotive vehicle equipped with the apparatus and method
DE19901175B4 (de) * 1998-01-14 2005-08-04 Nissan Motor Co., Ltd., Yokohama Device and method for controlling the vehicle distance from a motor vehicle to another, preceding vehicle
WO1999037498A1 (de) * 1998-01-24 1999-07-29 Bayerische Motoren Werke Aktiengesellschaft Abstandsbezogenes elektronisch gesteuertes fahrgeschwindigkeitsregelsystem
US6405820B1 (en) 1998-01-24 2002-06-18 Bayerische Motoren Werke Aktiengesellschaft Distance-related electronic driving speed regulating system
DE19802704A1 (de) * 1998-01-24 1999-08-26 Bayerische Motoren Werke Ag Abstandsbezogenes elektronisch gesteuertes Fahrgeschwindigkeitsregelsystem
DE19913620B4 (de) * 1998-03-30 2004-08-12 Nissan Motor Co., Ltd., Yokohama Device for distance-controlled driving of a motor vehicle
EP1144217B1 (de) * 1998-07-29 2004-09-22 TRW Limited Geschwindigkeitsregelanlage mit sollgeschwindigkeitsreduzierung zur einhaltung eines bestimmten abstands zu einem führungsfahrzeug, fahrzeug mit einer derartigen anlage, verfahren zur entsprechenden steuerung eines fahrzeugs und computer programm zur realisierung des verfahrens
WO2000009357A1 (en) * 1998-08-12 2000-02-24 Lucas Industries Plc Method of and apparatus for controlling headway

Also Published As

Publication number Publication date
JPH06320985A (ja) 1994-11-22
US5695020A (en) 1997-12-09

Similar Documents

Publication Publication Date Title
Moon et al. Design, tuning, and evaluation of a full-range adaptive cruise control system with collision avoidance
EP1548678B1 (de) Verfahren und Computerprogramm zum Erkennen von Unaufmerksamkeiten des Fahrers eines Fahrzeugs
DE102004011699B4 (de) Device for determining a lane deviation of a vehicle
EP1940665B1 (de) Abstands- und geschwindigkeitsregler mit stauerkennung
EP0766024B1 (de) Gangwechselsteuerung für Automatikgetriebe in Kraftfahrzeugen mit einem elektronischen Steuergerät
DE102016000493B4 (de) Method for operating a vehicle system and motor vehicle
US6879890B2 (en) Lane keep control apparatus and method for automotive vehicle
DE102006057552B4 (de) System and method for measuring the distance of a preceding vehicle
DE102011117850B4 (de) Method for operating a vehicle system of a motor vehicle and motor vehicle
DE69819984T2 (de) Device for controlling the movement of a vehicle
DE10336905B4 (de) Adaptive vehicle speed control system and method
EP1920268B1 (de) Verfahren für die erfassung eines verkehrsraums
EP2054869B1 (de) Verfahren und vorrichtung zur fahrerassistenz durch erzeugung von spurinformationen zur unterstützung oder zum ersatz von spurinformationen einer videobasierten spurinformationseinrichtung
EP1926646B1 (de) Verfahren und vorrichtung zum durchführen eines ausweichmanövers
DE102017103972A1 (de) Autonomous vehicle control taking into account a probability factor
DE602005000709T2 (de) Distance-related cruise control system
DE602004007083T2 (de) Driver adaptive collision warning system
EP1485268B1 (de) Geschwindigkeitsregler mit stop &amp; go funktion
EP1276626B2 (de) Abstandsbezogenes verfahren zur regelung der geschwindigkeit eines fahrzeugs
DE69837288T2 (de) VEHICLE AND DEVICE AND METHOD FOR DRIVING CONTROL THEREOF
DE112007001039B4 (de) Device and method for controlling the drive power for a vehicle
DE69935471T2 (de) Yaw angle control method for motor vehicles
DE4337872C2 (de) Distance measuring device and vehicle speed control device for maintaining an inter-vehicle distance
DE60207800T2 (de) Control system for a vehicle for keeping the lane
DE19654691B4 (de) Obstacle warning system for a vehicle

Legal Events

Date Code Title Description
8110 Request for examination paragraph 44
8139 Disposal/non-payment of the annual fee