CN111334517A

CN111334517A - Waterlogging-resistant bZIP transcription factor of soybean and application thereof

Info

Publication number: CN111334517A
Application number: CN202010316576.4A
Authority: CN
Inventors: 林延慧; 夏长剑; 徐靖; 朱红林; 唐力琼; 王效宁; 侯本军; 王新华
Original assignee: Grain Crop Research Institute Hainan Academy Of Agricultural Sciences
Current assignee: Grain Crop Research Institute Hainan Academy Of Agricultural Sciences
Priority date: 2020-04-21
Filing date: 2020-04-21
Publication date: 2020-06-26

Abstract

The invention provides a waterlogging-resistant bZIP transcription factor of soybean and application thereof, belonging to the technical field of waterlogging-resistant genes. The nucleotide sequence of the waterlogging-resistant bZIP transcription factor Glyma04g04170 of the soybean is shown as SEQ ID No. 1. The amino acid sequence of the coded waterlogging-resistant bZIP transcription factor Glyma04g04170 protein of the soybean is shown as SEQ ID No. 2. Under the waterlogging stress of soybean, the transcriptome data is consistent with the RT-qPCR result, and the expression level of the Glyma04g04170 gene shows significant down-regulation expression, which indicates that the gene continuously responds to the waterlogging stress tolerance in a negative regulation mode. Based on the action of the gene in waterlogging tolerance, the invention provides a soybean waterlogging tolerance bZIP transcription factor Glyma04g04170 and application of a coded protein thereof in waterlogging tolerance plant breeding or construction of waterlogging tolerance transgenic plants.

Description

Waterlogging-resistant bZIP transcription factor of soybean and application thereof

Technical Field

The invention belongs to the technical field of waterlogging-resistant genes, and particularly relates to a waterlogging-resistant bZIP transcription factor of soybean and application thereof.

Background

For crops, long-term exposure to various abiotic environments, such as high salinity, cold, waterlogging, drought, and other stresses, severely affects the growth and development of plants that initiate physiological, cellular, and molecular mechanisms to cope with these adverse environmental conditions^[1]. Through molecular genetic and biochemical analysis, a large number of transcription factors responding to stress are separated and identified, and the transcription factors belong to families such as bZIP, WRKY, MYB, bHLH, NAC and the like^[2-3]. bZIP is a large family of transcription factors in higher plants, and it has been reported that members of the bZIP family regulate flower development, seed maturation, resistance to infection by pathogenic bacteria, response to stress, hormone and sugar signaling pathways^[4-5]. In plants, several bZIP genes have been identified that are associated with abiotic stress. In Arabidopsis, AtABF3, AtbZIP24 and AtbZIP1 play a positive regulatory role in abiotic stress in plants^[6-8]. In rice, OsbZIP23, OsbZIP72, OsABF1, OsABF2 and OsbZIP71 can improve the tolerance of rice to abiotic stress such as drought and cold damage under the abiotic stress^[9-13]While OsbZIP52 plays a negative regulation role under cold damage and drought stress^[14]. Soybean contains 131 bZIP gene family members, more than one third of which participate in at least one of the defense responses in ABA, salt, drought and cold stress responses. After Arabidopsis thaliana is transformed by GmbZIP44, GmbZIP62, GmbZIP78 and GmbZIP1, the tolerance of the Arabidopsis thaliana to salt damage, cold damage and drought stress can be improved^[15-16]。

As can be seen from previous studies, bZIPs in plants are involved in a variety of abiotic stresses, including salt damage, cold damage and drought stress, but to date, there have been few reports relating to tolerance to waterlogging stress.

The references are as follows:

[1]FUJITA Y,FUJITA M,SATOH R,et al.AREB1 is a transcription activatorof novel ABRE dependent ABA signaling that enhances drought stress tolerancein Arabidopsis[J].ThePlant Cell,2005,17(12):3470-3488.

[2]WANG W,VINOCUR B,ALTMAN A.Plant responses to drought,salinity andextreme temperatures:towards genetic engineering for stress tolerance[J].Planta,2003,218(1),1-14.

[3]GOLLDACK D,L KING I,YANG O.Plant tolerance to drought andsalinity:stress regulating transcription factors and their functionalsignificance in the cellular transcriptional network[J].Plant Cell Reports,2011,30(8),1383-1391.

[4]JAKOBY M,WEISSHAAR B,DR GE-LASER W,et al.bZIP transcriptionfactors in Arabidopsis[J].Trends Plant Science,2002,7:106–111.

[5]LINDEMOSE S,O’SHEA C,JENSEN M K,et al.Structure,function andnetworks of transcription factors involved in abiotic stress responses[J].International Journal of Molecular Sciences,2013,14(3):5842–5878.

[6]KIM J B,KANG J Y,KIM S Y.Over-expression of a transcription factorregulating ABA-responsive gene expression confers multiple stress tolerance[J].Plant Biotechnology Journal,2004,2(5):459–466.

[7]YANGO,POPOVA O V,S THOFF U,et al.The Arabidopsis basic leucinezipper transcription factor AtbZIP24 regulates complex transcriptionalnetworks involved in abiotic stress resistance[J].Gene,2009,436(1-2):45–55.

[8]SUN X L,LI Y,CAI H,et al.The Arabidopsis AtbZIP1 transcriptionfactor is a positive regulator of plant tolerance to salt,osmotic and droughtstresses[J].Journal of Plant Research,2012,125(3):429–438.

[9]XIANG Y,TANG N,DU H,et al.Characterization of OsbZIP23 as a keyplayer ofthe basic leucine zipper transcription factor family for conferringabscisic acid sensitivity and salinityand drought tolerance in rice[J].PlantPhysiology,2008,148(4):1938–1952.

[10]LIU C T,MAO B G,OU S J,et al.OsbZIP71,a bZIP transcriptionfactor,confers salinity and drought tolerance in rice[J].Plant MolecularBiology,2014a,84(1-2):19–36.

[11]LU G J,GAO C X,ZHENG X N,et al.Identification of OsbZIP72 as apositive regulator of ABA response and drought tolerance in rice[J].Planta,2009,229(3):605–615.

[12]HOSSAIN M A,CHO J I,HAN M,et al.The ABRE-binding bZIPtranscription factor OsABF2 is a positive regulator of abiotic stress and ABAsignaling in rice[J].Journal of Plant Physiology,2010a,167(17):1512–1520.

[13]HOSSAIN M A,LEE Y,CHO J I,et al.The bZIP transcription factorOsABF1 is an ABA responsive element binding factor that enhances abioticstress signaling in rice[J].Plant Molecular Biology,2010b,72(4-5):557–566.

[14]LIU C T,WU Y B,WANG X P.bZIP transcription factor OsbZIP52/RISBZ5:a potential negative regulator of cold and drought stress response inrice[J].Planta,2012,235(6):1157–1169.

[15]LIAO Y,ZOU H,WEI W,et al.Soybean GmbZIP44,GmbZIP62 and GmbZIP78genes function as negative regulator of ABA signaling and confer salt andfreezing tolerance in transgenic Arabidopsis[J].Planta,2008,228(2):225–240.

[16]GAO S Q,CHEN M,XU Z S,et al.The soybean GmbZIP1 transcriptionfactor enhances multiple abiotic stress tolerances in transgenic plants[J].Plant Molecular Biology,2011b,75(6):537–553.

disclosure of Invention

In view of the above, the invention aims to provide a soybean waterlogging-resistant bZIP transcription factor and application thereof, and a novel waterlogging-resistant gene is developed to provide a novel gene fragment for constructing a waterlogging-resistant transgenic plant in subsequent genetic engineering.

The invention provides a waterlogging-resistant bZIP transcription factor Glyma04g04170 of soybean, wherein the nucleotide sequence of the Glyma04g04170 is shown as SEQ ID No. 1.

The invention provides a protein for coding a waterlogging-resistant bZIP transcription factor Glyma04g04170 of soybean, and the amino acid sequence of the protein is shown as SEQ ID No. 2.

The invention provides a primer pair for amplifying waterlogging-resistant bZIP transcription factor Glyma04g04170 of soybean, which comprises Glyma04g04170-F and Glyma04g 04170-R;

the nucleotide sequence of the Glyma04g04170-F is shown as SEQ ID No. 3; the nucleotide sequence of the Glyma04g04170-R is shown as SEQ ID No. 4.

The invention provides the soybean waterlogging-resistant bZIP transcription factor Glyma04g04170, and application of the protein or the primer pair in waterlogging-resistant plant breeding.

The invention provides the soybean waterlogging-resistant bZIP transcription factor Glyma04g04170, and application of the protein or the primer pair in constructing waterlogging-resistant transgenic plants.

The invention provides the soybean waterlogging-resistant bZIP transcription factor Glyma04g04170, and application of the protein or the primer pair in waterlogging resistance of plants.

The soybean waterlogging-resistant bZIP transcription factor Glyma04g04170 provided by the invention is an ABA response binding factor, under soybean waterlogging stress, compared with a control group, the Glyma04g04170 gene belongs to a differential expression gene, meanwhile, the expression quantity of the Glyma04g04170 gene at four time points (3h, 6h, 12h and 24h) shows significant down-regulation expression, RT-qPCR verification is carried out on the Glyma04g04170 gene, the RT-qPCR result is consistent with the trend of RNA-seq, and the high reliability of transcriptome data is proved. The gene continuously responds to waterlogging tolerance stress in a negative control mode.

Drawings

FIG. 1 is a flow chart of the screening of soybean waterlogging tolerant bZIP transcription factor Glyma04g 04170;

FIG. 2 is a Venn diagram of differentially expressed genes screened by flooding soybean seedlings for 3h, 6h, 12h and 24 h;

FIG. 3 is an analysis of the expression level of Glyma04g04170 gene under waterlogging stress at different time points, where the error bars represent the standard error between three biological replicates;

FIG. 4 is the conserved domain of the Glyma04g04170 protein;

FIG. 5 is the results of secondary structure prediction analysis of Glyma04g04170 protein;

FIG. 6 shows the results of predictive analysis of the tertiary structure of Glyma04g04170 protein, in which the position of Leu, the leucine zipper region involved in oligomerization, in the conserved domain of bZIP, is shown in three-dimensional structure, with a leucine at position 7 of every 7 amino acids, located at positions 365, 372 and 379 in the structure, and also showing N-x7-R/K, arginine (R) at position 357 and lysine (K) at position 358, which bind to specific DNA sequences and serve as nuclear localization signals.

Detailed Description

The invention provides a waterlogging-resistant bZIP transcription factor Glyma04g04170 of soybean, wherein the nucleotide sequence of the Glyma04g04170 is shown as SEQ ID No.1 (ATGAATTTCAAGAGCTTTGGAAACGAGGCCGGCGGCGGCGGAGGGAGACAGGCGGGGAACTTCTCGCTGACGCGGCAGCCGTCGGTGTACTCGCTGACGTTCGACGAGTTCATGAACAGCATGGGAGGTTCGGGGAAGGACTTTGGGTCCATGAACATGGACGAGTTGCTGAAGAACATCTGGACCGCGGAGGAGGTTCAGACAATGGCGTCGGCGGGAGTGGCCGCCGATGACGGCGGCGCCGGCGTCAGCCATTTGCAGCGGCAGGGGTCGCTGACGTTGCCGCGGACCCTAAGCCAGAAGACCGTTGATGAGGTTTGGAAGGACATTTCGAAAGACCACGGTGGGCCCAACTTGGCCCAGACGCAGAGGGAGCCCACGCTGGGAGAGGTGACGTTGGAGGAGTTTTTGGTCAGAGCTGGTGTTGTTAGAGAAGATGCCAAACCAAACGAAAGCGTTTTCGTAGATCTGTCTCGCGTTGGGAATAATAGTGGTTTGGGGTTGGGGTTTCAGCAGAGGAACAAGGTTGCTGCTGCTACCGGTTTGATGGGTAACCGGTTGAACAATGATCCGCTGGTGGGTCTTCAGCCTTCTGCTAACTTGCCTTTGAATGTTAATGGGGTGAGAACATCCAATCAGCAGCCACAGATGCAGAGTCCACAGTCTCAGCATCAGCATCAGCATCAGCAACAACAGCAGCAGATATTTCCTAAACAGAGTGCTATGTCTTATGCAGCTGCTCAGATGCCTCAGGGAATGGTGAGGGGTGGGGTTGTGGGGCTTGGTGATCAGGGTTTGAGTGTGCAAGGTGGAGGGATTGGTATGGTTGGGTTGGCACCTGGGTCTGTTCATGTAGCTACTGGCTCTCCTGCTGCTAACCAGCTGTCCTCTGGTGATAGGATTGGGAAGAGCAATGGCGATTCCTCGTCTGTGTCGCCGGTTCCTTATGTCTTTAATGGCAGTCTGCGAGGAAGGAAGAACGGGGGAGCTGTGGAGAAGGTGATTGAGAGGAGGCAGAGAAGGATGATAAAGAATAGAGAGTCAGCTGCCAGGTCGCGGGCTCGCAAACAGGCTTATACCATGGAATTAGAAGCAGAAGTTGCTAAGTTAAAAGAGGAGAACCAAGAACTTCAGAAAAAACAGGCAGAAATTATGGAAATTCAGAAAAATCAAGTTAAGGAAATGATGAATTTGCAACGAGAAGTGAAGAGAAGACGCCTAAGAAGAACACAAACTGGTCCGTGGTAG). The nucleotide sequence of the bZIP transcription factor Glyma04g0417 is a coding sequence, and the length is 1248 bp. Under waterlogging stress, the expression level of the bZIP transcription factor Glyma04g04170 gene in the soybean is reduced, which indicates that the bZIP transcription factor Glyma04g04170 gene participates in the response of the soybean to the waterlogging stress in a negative control mode.

In the invention, the method for screening the waterlogging-resistant bZIP transcription factor Glyma04g04170 of soybean preferably comprises the following steps:

1) carrying out no-top flooding treatment on soybeans, and carrying out transcriptome sequencing by taking soybean root tissues as sequencing materials when the soybeans are flooded for 3 hours, 6 hours, 12 hours and 24 hours respectively;

2) analyzing the obtained transcriptome data, screening and counting differential expression genes of four sampling time points of 3h, 6h, 12h and 24h of flooding treatment to obtain common differential expression genes of 4 time points;

3) and (3) screening the common differential expression genes to obtain a bZIP transcription factor Glyma04g 04170.

In the present invention, the scheme for screening the soybean waterlogging-resistant bZIP transcription factor Glyma04g04170 is shown in FIG. 1. After the bZIP transcription factor Glyma04g04170 is obtained by screening, preferably, carrying out RT-qPCR verification on the Glyma04g04170 gene, wherein the RT-qPCR verification result is consistent with the trend of transcriptome data, which indicates that the transcriptome data is highly credible, and the screened Glyma04g04170 gene is used as a waterlogging tolerance target gene for plants to be used in waterlogging stress.

The invention provides a protein for coding a waterlogging-resistant bZIP transcription factor Glyma04g04170 of soybean, wherein the amino acid sequence of the protein is shown as SEQ ID No.2 (MNFKSFGNEAGGGGGRQAGNFSLTRQPSVYSLTFDEFMNSMGGSGKDFGSMNMDELLKNIWTAEEVQTMASAGVAADDGGAGVSHLQRQGSLTLPRTLSQKTVDEVWKDISKDHGGPNLAQTQREPTLGEVTLEEFLVRAGVVREDAKPNESVFVDLSRVGNNSGLGLGFQQRNKVAAATGLMGNRLNNDPLVGLQPSANLPLNVNGVRTSNQQPQMQSPQSQHQHQHQQQQQQIFPKQSAMSYAAAQMPQGMVRGGVVGLGDQGLSVQGGGIGMVGLAPGSVHVATGSPAANQLSSGDRIGKSNGDSSSVSPVPYVFNGSLRGRKNGGAVEKVIERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENQELQKKQAEIMEIQKNQVKEMMNLQREVKRRRLRRTQTGPW), the length of the protein is 415 amino acids, the conserved domain analysis is carried out, the result shows that the protein contains a bZIP structural domain inside and belongs to a bZIP family member, the secondary structure of the Glyma04g04170 is predicted and analyzed, the result shows that the protein mainly comprises α -helix and irregular coil, the proportions of the protein are respectively 30.94% and 54.68%, 11.51% of extension chain and 2.8% of β -turn angle are also existed in sequence, the protein is predicted in a tertiary structure, the position of a leucine zipper region Leu in the conserved domain of the bZIP structure, which participates in oligomerization, in the three-dimensional structure is displayed, the 7 th position of every 7 amino acids contains a leucine, and the N-x7-R/K structure combined with a specific DNA sequence and plays a role in a nuclear localization signal, and provides a basis for the subsequent research on Glyma04g04170 protein and a target point signal.

The invention provides a primer pair for amplifying waterlogging-resistant bZIP transcription factor Glyma04g04170 of soybean, which comprises Glyma04g04170-F and Glyma04g 04170-R; the nucleotide sequence of the Glyma04g04170-F is shown as SEQ ID No. 3; the nucleotide sequence of the Glyma04g04170-R is shown as SEQ ID No. 4. The primer pair is used for amplifying an RT-qPCR primer of the bZIP transcription factor Glyma04g 04170. When the primer pair is used for the RT-qPCR amplification, the amplification procedure is preferably as follows: 3min at 94 ℃; 30s at 94 ℃; 30s at 58 ℃; 30s at 72 ℃; 35 cycles.

Based on the soybean waterlogging-resistant bZIP transcription factor Glyma04g04170 and the effect of the coded protein thereof in waterlogging tolerance stress, the invention provides the soybean waterlogging-resistant bZIP transcription factor Glyma04g04170, and the application of the protein or the primer pair in waterlogging-resistant plant breeding or construction of waterlogging-resistant transgenic plants.

In the invention, the waterlogging-resistant plant breeding method preferably takes the bZIP transcription factor Glyma04g04170 gene as a breeding molecular target. The method for constructing the waterlogging-tolerant transgenic plant preferably takes the bZIP transcription factor Glyma04g04170 gene as a fragment of an inserted exogenous gene, and other operations in the method are not particularly limited by the invention, and methods for breeding or constructing the transgenic plant which are well known in the field can be adopted. The present invention is not particularly limited to the plants, and is applicable to plants known in the art, particularly to crop plants. Therefore, the invention provides the soybean waterlogging-resistant bZIP transcription factor Glyma04g04170, and application of the protein or the primer pair in waterlogging resistance of plants.

The waterlogging-resistant bZIP transcription factor provided by the present invention and the use thereof are described in detail below with reference to examples, but they should not be construed as limiting the scope of the present invention.

Example 1

1. Transcriptome sequencing

Seedlings of a soybean variety, namely zihuang 34, with good flooding tolerance are used as test materials, top-submerged treatment is carried out, soybean root tissues are taken as sequencing materials, different sampling time points (3, 6, 12 and 24 hours of flooding) are set, and samples are sent for transcriptome sequencing.

Analysis of results

Screening for differentially expressed genes in transcriptome data

Screening out the differential expression genes (Log) of four sampling time points of 3h, 6h, 12h and 24h of flooding treatment by analyzing transcriptome data₂FoldChang≥2；Log₂FoldChang is less than or equal to-2). The results show that: along with the prolonging of the flooding time, the number of the differential expression genes is gradually increased, the number of the differential expression genes in 12h flooding is the largest, and the number of the differential expression genes in 24h flooding is reduced, which is shown in table 1.

TABLE 1 number of genes differentially expressed at different sampling time points

A Venn plot of differentially expressed genes plotted using flooding treatment for four sampling time points (3h, 6h, 12h, and 24h) is shown in FIG. 2. The results show that: the differentially expressed genes at the intersection of the four time points were 3920 (including both up-and down-regulated genes).

2. Screening and identification of bZIP transcription factor Glyma04g04170

For the differentially expressed genes at the intersection of the four sampling time points (3h, 6h, 12h and 24h), one bZIP transcription factor Glyma04g04170 was selected, which was Log compared to treatment at the four sampling time points₂FoldChange is-2.62, -2.24, -2.25, -2.45, respectively. Glyma04g04170 is an ABA response binding factor, and the expression of the Glyma04g04170 gene is reduced, which indicates that the Glyma04g04170 gene participates in the response of soybean to waterlogging stress in a negative control mode.

Example 2

RT-qPCR validation analysis of bZIP transcription factor Glyma04g04170

RT-qPCR primers were designed based on the sequence of Glyma04g 04170. And (3) performing RT-qPCR detection on soybean root tissues as materials at four sampling time points (3h, 6h, 12h and 24h of flooding) and verifying the reliability of transcriptome sequencing data.

The RT-qPCR analysis method is as follows:

RT-qPCR primers were designed using Primer 5.0, and PCR amplification and detection reactions were performed using a Real-Time fluorescent quantitative PCR instrument (MyGoPro Real-Time PCR System, IT-IS Life Science, UK) using cDNA as a template, with ELF1B as an internal reference gene. The amplification procedure was: 3min at 94 ℃; 30s at 94 ℃; 30s at 58 ℃; 30s at 72 ℃; 35 cycles; the required primers are as follows:

q Glyma04g04170-F：TGGCGATTCCTCGTCTGT(SEQ ID No.3)；

q Glyma04g04170-R：TGGTATAAGCCTGTTTGC(SEQ ID No.4)；

q ELF1B-F：GTTGAAAAGCCAGGGGACA(SEQ ID No.5)；

qELF1B-R:TCTTACCCCTTGAGCGTGG(SEQ ID No.6)。

analysis of results

The RT-qPCR result is consistent with the trend of RNA-seq, and proves that the transcriptome data has higher reliability. The expression level of the Glyma04g04170 gene at four time points showed significant down-regulation, indicating that the gene continuously responded to waterlogging stress (FIG. 3).

Example 3

Glyma04g04170 protein conserved domain and advanced structure prediction

The sequence of the Glyma04g04170 protein was submitted to the Conserved Domain Database of NCBI and the Conserved Domain analysis showed that the protein contained a bZIP Domain inside (see FIG. 4), indicating that the Glyma04g04170 gene belongs to the bZIP family.

Example 4

Predictive analysis of Secondary and Tertiary Structure of Glyma04g04170 protein

1) The secondary structure of Glyma04g04170 was predicted using SOMPA (https:// npsa-prabi. ibcp. fr.) the results showed that the protein was predominantly α -helix and random coil, accounting for 30.94% and 54.68%, respectively, with 11.51% elongation and 2.8% β -turn (see FIG. 4).

2) Tertiary structure prediction of Glyma04g04170 protein

The amino acid sequence of the Glyma04g04170 protein is analyzed by SWISS-MODEL, 1jnm.1.C with the consistency of 33.93 percent with the Glyma04g04170 is obtained by online comparison of a protein structure library, and the obtained product is used as a template to carry out three-dimensional homologous modeling and is combined with the analysis result of a Glyma04g04170 conserved domain.

The three-dimensional structure shows the position of Leu of leucine zipper region involved in oligomerization in the conserved domain of bZIP, and the 7 th position of every 7 amino acids contains leucine, and also shows the structure of N-x7-R/K combined with specific DNA sequence and used as nuclear localization signal (see FIG. 5).

According to the invention, the soybean waterlogging-resistant bZIP transcription factor Glyma04g04170 gene is obtained by screening based on the combination of transcriptome sequencing and bioinformatics specificity, belongs to a bZIP family, and is subjected to fluorescent quantitative PCR detection, the result shows that the expression quantity of the Glyma04g04170 gene at four sampling time points is consistent with the transcriptome sequencing trend, and the reliability of transcriptome sequencing data is proved. Analysis of the conserved domain of the Glyma04g04170 protein shows that the protein contains the bZIP conserved domain inside. The tertiary structure of the protein shows the position of a leucine zipper area Leu participating in oligomerization in a conserved structural domain, and simultaneously presents an N-x7-R/K structure which is combined with a specific DNA sequence and plays a role of a nuclear localization signal, thereby providing a basis for the subsequent research of the action target point and the signal path of the gene. Under the condition of waterlogging stress treatment, the expression level of Glyma04g04170 is reduced, which indicates that the expression pattern of the transcription factor responding to the abiotic stress is consistent with the existing report about the expression reduction of waterlogging tolerant genes in the field, and the Glyma04g04170 is involved in the response of plants to the abiotic stress in a negative regulation mode.

The foregoing is only a preferred embodiment of the present invention, and it should be noted that, for those skilled in the art, various modifications and decorations can be made without departing from the principle of the present invention, and these modifications and decorations should also be regarded as the protection scope of the present invention.

Sequence listing

<110> institute of food crops of academy of agricultural sciences of Hainan province

<120> waterlogging-resistant bZIP transcription factor of soybean and application thereof

<160>6

<170>SIPOSequenceListing 1.0

<210>1

<211>1248

<212>DNA

<213> Artificial Sequence (Artificial Sequence)

<400>1

atgaatttca agagctttgg aaacgaggcc ggcggcggcg gagggagaca ggcggggaac 60

ttctcgctga cgcggcagcc gtcggtgtac tcgctgacgt tcgacgagtt catgaacagc 120

atgggaggtt cggggaagga ctttgggtcc atgaacatgg acgagttgct gaagaacatc 180

tggaccgcgg aggaggttca gacaatggcg tcggcgggag tggccgccga tgacggcggc 240

gccggcgtca gccatttgca gcggcagggg tcgctgacgt tgccgcggac cctaagccag 300

aagaccgttg atgaggtttg gaaggacatt tcgaaagacc acggtgggcc caacttggcc 360

cagacgcaga gggagcccac gctgggagag gtgacgttgg aggagttttt ggtcagagct 420

ggtgttgtta gagaagatgc caaaccaaac gaaagcgttt tcgtagatctgtctcgcgtt 480

gggaataata gtggtttggg gttggggttt cagcagagga acaaggttgc tgctgctacc 540

ggtttgatgg gtaaccggtt gaacaatgat ccgctggtgg gtcttcagcc ttctgctaac 600

ttgcctttga atgttaatgg ggtgagaaca tccaatcagc agccacagat gcagagtcca 660

cagtctcagc atcagcatca gcatcagcaa caacagcagc agatatttcc taaacagagt 720

gctatgtctt atgcagctgc tcagatgcct cagggaatgg tgaggggtgg ggttgtgggg 780

cttggtgatc agggtttgag tgtgcaaggt ggagggattg gtatggttgg gttggcacct 840

gggtctgttc atgtagctac tggctctcct gctgctaacc agctgtcctc tggtgatagg 900

attgggaaga gcaatggcga ttcctcgtct gtgtcgccgg ttccttatgt ctttaatggc 960

agtctgcgag gaaggaagaa cgggggagct gtggagaagg tgattgagag gaggcagaga 1020

aggatgataa agaatagaga gtcagctgcc aggtcgcggg ctcgcaaaca ggcttatacc 1080

atggaattag aagcagaagt tgctaagtta aaagaggaga accaagaact tcagaaaaaa 1140

caggcagaaa ttatggaaat tcagaaaaat caagttaagg aaatgatgaa tttgcaacga 1200

gaagtgaaga gaagacgcct aagaagaaca caaactggtc cgtggtag 1248

<210>2

<211>415

<212>PRT

<213> Artificial Sequence (Artificial Sequence)

<400>2

Met Asn Phe Lys Ser Phe Gly Asn Glu Ala Gly Gly Gly Gly Gly Arg

1 5 10 15

Gln Ala Gly Asn PheSer Leu Thr Arg Gln Pro Ser Val Tyr Ser Leu

20 25 30

Thr Phe Asp Glu Phe Met Asn Ser Met Gly Gly Ser Gly Lys Asp Phe

35 40 45

Gly Ser Met Asn Met Asp Glu Leu Leu Lys Asn Ile Trp Thr Ala Glu

50 55 60

Glu Val Gln Thr Met Ala Ser Ala Gly Val Ala Ala Asp Asp Gly Gly

65 70 75 80

Ala Gly Val Ser His Leu Gln Arg Gln Gly Ser Leu Thr Leu Pro Arg

85 90 95

Thr Leu Ser Gln Lys Thr Val Asp Glu Val Trp Lys Asp Ile Ser Lys

100 105 110

Asp His Gly Gly Pro Asn Leu Ala Gln Thr Gln Arg Glu Pro Thr Leu

115 120 125

Gly Glu Val Thr Leu Glu Glu Phe Leu Val Arg Ala Gly Val Val Arg

130 135 140

Glu Asp Ala Lys Pro Asn Glu Ser Val Phe Val Asp Leu Ser Arg Val

145 150 155 160

Gly Asn Asn Ser Gly Leu Gly Leu Gly Phe Gln Gln Arg Asn Lys Val

165 170 175

Ala Ala Ala Thr Gly Leu MetGly Asn Arg Leu Asn Asn Asp Pro Leu

180 185 190

Val Gly Leu Gln Pro Ser Ala Asn Leu Pro Leu Asn Val Asn Gly Val

195 200 205

Arg Thr Ser Asn Gln Gln Pro Gln Met Gln Ser Pro Gln Ser Gln His

210 215 220

Gln His Gln His Gln Gln Gln Gln Gln Gln Ile Phe Pro Lys Gln Ser

225 230 235 240

Ala Met Ser Tyr Ala Ala Ala Gln Met Pro Gln Gly Met Val Arg Gly

245 250 255

Gly Val Val Gly Leu Gly Asp Gln Gly Leu Ser Val Gln Gly Gly Gly

260 265 270

Ile Gly Met Val Gly Leu Ala Pro Gly Ser Val His Val Ala Thr Gly

275 280 285

Ser Pro Ala Ala Asn Gln Leu Ser Ser Gly Asp Arg Ile Gly Lys Ser

290 295 300

Asn Gly Asp Ser Ser Ser Val Ser Pro Val Pro Tyr Val Phe Asn Gly

305 310 315 320

Ser Leu Arg Gly Arg Lys Asn Gly Gly Ala Val Glu Lys Val Ile Glu

325 330 335

Arg Arg Gln Arg Arg Met Ile Lys AsnArg Glu Ser Ala Ala Arg Ser

340 345 350

Arg Ala Arg Lys Gln Ala Tyr Thr Met Glu Leu Glu Ala Glu Val Ala

355 360 365

Lys Leu Lys Glu Glu Asn Gln Glu Leu Gln Lys Lys Gln Ala Glu Ile

370 375 380

Met Glu Ile Gln Lys Asn Gln Val Lys Glu Met Met Asn Leu Gln Arg

385 390 395 400

Glu Val Lys Arg Arg Arg Leu Arg Arg Thr Gln Thr Gly Pro Trp

405 410 415

<210>3

<211>18

<212>DNA

<213> Artificial Sequence (Artificial Sequence)

<400>3

tggcgattcc tcgtctgt 18

<210>4

<211>18

<212>DNA

<213> Artificial Sequence (Artificial Sequence)

<400>4

tggtataagc ctgtttgc 18

<210>5

<211>19

<212>DNA

<213> Artificial Sequence (Artificial Sequence)

<400>5

gttgaaaagc caggggaca 19

<210>6

<211>19

<212>DNA

<213> Artificial Sequence (Artificial Sequence)

<400>6

tcttacccct tgagcgtgg 19

Claims

1. The waterlogging-resistant bZIP transcription factor Glyma04g04170 is characterized in that the nucleotide sequence of the Glyma04g04170 is shown as SEQ ID No. 1.

2. A protein encoding the soybean waterlogging-tolerant bZIP transcription factor Glyma04g04170 as described in claim 1, characterized in that the amino acid sequence of said protein is as shown in SEQ ID No. 2.

3. A primer pair for amplifying the soybean waterlogging-tolerant bZIP transcription factor Glyma04g04170 of claim 1, comprising Glyma04g04170-F and Glyma04g 04170-R;

4. Use of the soybean waterlogging-tolerant bZIP transcription factor Glyma04g04170 as defined in claim 1, the protein as defined in claim 2 or the primer pair as defined in claim 3 for breeding waterlogging-tolerant plants.

5. Use of the soybean waterlogging-tolerant bZIP transcription factor Glyma04g04170 as defined in claim 1, the protein as defined in claim 2 or the primer pair as defined in claim 3 for the construction of waterlogging-tolerant transgenic plants.

6. The use of the soybean waterlogging-tolerant bZIP transcription factor Glyma04g04170 as defined in claim 1, the protein as defined in claim 2 or the primer pair as defined in claim 3 for waterlogging tolerance in plants.