CA3190733A1 - Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders - Google Patents
Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disordersInfo
- Publication number
- CA3190733A1 CA3190733A1 CA3190733A CA3190733A CA3190733A1 CA 3190733 A1 CA3190733 A1 CA 3190733A1 CA 3190733 A CA3190733 A CA 3190733A CA 3190733 A CA3190733 A CA 3190733A CA 3190733 A1 CA3190733 A1 CA 3190733A1
- Authority
- CA
- Canada
- Prior art keywords
- weeks
- fusion protein
- vegf receptor
- receptor fusion
- regimen
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Landscapes
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
63/319,869, filed on March 15, 2022; U.S. provisional patent application no.
63/404,512, filed on September 7, 2022; U.S. provisional patent application no. 63/404,893, filed on September 8, 2022; U.S. provisional patent application no. 63/411,594, filed on September 29, 2022; U.S.
provisional patent application no. 63/412,165, filed on September 30, 2022;
U.S. provisional patent application no. 63/421,298, filed on November 1, 2022; U.S. provisional patent application no. 63/434,920, filed on December 22, 2022; and U.S. provisional patent application no. 63/444,480, filed on February 9, 2023; each of which is herein incorporated by reference in its entirety.
REFERENCE TO A SEQUENCE LISTING
FIELD OF THE INVENTION
BACKGROUND OF THE INVENTION
Vision loss in nAMD results from the abnormal growth and leakage of blood vessels in the macula. In elderly subjects affected by nAMD, vision loss frequently has an even greater impact, as it substantially reduces the visual compensation of functional impairment by other age-related comorbidities, such as arthritis and osteoporosis.
secondary effect of this burden is a lower probability of non-compliance with the prescribed treatment regimen.
SUMMARY OF THE INVENTION
high molecular weight species immediately after manufacture and purification and/or less than or equal to about 6% high molecular weight species after storage for about 24 months at about 2-8 C. In an embodiment of the invention, the aqueous pharmaceutical formulation comprises an aqueous pharmaceutical formulation comprising: at least about 100 mg/ml of a VEGF
receptor fusion protein comprising two polypeptides that each comprises an immunoglobin-like (Ig) domain 2 of VEGFR1, an Ig domain 3 of VEGFR2, and a multimerizing component; about 10-100 mM L-arginine; sucrose; a histidine-based buffer; and a surfactant; wherein the formulation has a pH
of about 5.0 to about 6.8; wherein the VEGF receptor fusion protein has less than about 3.5%
high molecular weight species immediately after manufacture and purification and/or less than or equal to about 6% high molecular weight species after storage for about 24 months at about 2-8 C. In an embodiment of the invention, the method comprises administering a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 (preferably 4) weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 (preferably 12, 16 or 20) weeks after the immediately preceding dose.
of free aflibercept in the plasma of a subject after an intravitreal injection of about 2 mg aflibercept, e.g., increased by more than 1.5 weeks, for example by about 2 weeks-to about 3.5 weeks, comprising intravitreally injecting into an eye of a subject in need thereof, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks after the immediately preceding dose. In an embodiment of the invention, the >8 mg aflibercept is administered in an aqueous pharmaceutical formulation including aflibercept which includes one or more of histidine-based buffer, arginine (e.g., L-arginine, for example, L-arginine HCI), a sugar or polyol such as sucrose and having a pH of about 5.8. In an embodiment of the invention, the aflibercept has less than about 3.5% high molecular weight species immediately after manufacture and purification and/or less than or equal to about 6% high molecular weight species after storage for about 24 months at about 2-8 C; for example, wherein the >8 mg aflibercept is in an aqueous pharmaceutical formulation comprising an aqueous pharmaceutical formulation comprising: at least about 100 mg/ml of a VEGF receptor fusion protein comprising two polypeptides that each comprises an immunoglobin-like (Ig) domain 2 of VEGFR1, an Ig domain 3 of VEGFR2, and a multimerizing component; about 10-100 mM L-arginine;
sucrose; a histidine-based buffer; and a surfactant; wherein the formulation has a pH of about 5.0 to about 6.8; wherein the VEGF receptor fusion protein has less than about 3.5% high molecular weight species immediately after manufacture and purification and/or less than or equal to about 6%
high molecular weight species after storage for about 24 months at about 2-8 C.
Date Recue/Date Received 2023-02-22
receptor fusion protein, preferably aflibercept, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 (preferably 4) weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks after the immediately preceding dose.
receptor fusion protein, preferably aflibercept, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 (preferably 4) weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks after the immediately preceding dose.
receptor fusion protein, preferably aflibercept, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 (preferably 4) weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 16 weeks after the immediately preceding dose.
receptor fusion protein, preferably aflibercept, followed by one or more secondary doses of about 8 mg or more Date Recue/Date Received 2023-02-22 of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 20 weeks after the immediately preceding dose.
(1) the subject has received an initial 2 mg dose of VEGF receptor fusion protein then the method comprises, after 1 month, administering to the subject the initial 8 mg dose of VEGF receptor fusion protein and, 1 month thereafter, the 1st 8 mg secondary dose of VEGF receptor fusion protein; and, 1 month thereafter, the 2nd 8 mg secondary dose of VEGF receptor fusion protein; and then, every 12 or Date Recue/Date Received 2023-02-22 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen; (2) the subject has received an initial 2 mg dose of VEGF receptor fusion protein, then the method comprises, after 1 month, administering to the subject, the first 8 mg secondary dose of VEGF
receptor fusion protein and, 1 month thereafter, the 2nd 8 mg secondary dose of VEGF receptor fusion protein;
and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen; (3) the subject has received an initial 2 mg dose of VEGF receptor fusion protein, then the method comprises, after 1 month, administering to the subject the 2nd 8 mg secondary dose of VEGF
receptor fusion protein and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen; (4) the subject has received an initial 2 mg dose of VEGF receptor fusion protein, then the method comprises, after 1 month, administering to the subject the 1st 8 mg maintenance dose of VEGF receptor fusion protein and all further 8 mg maintenance doses of VEGF receptor fusion protein every 12 or 16 0r20 weeks according to the HDq12 or HDq16 or HDq20 dosing regimen; (5) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF receptor fusion protein after 1 month, then the method comprises, after another 1 month, administering to the subject the initial 8 mg dose of VEGF receptor fusion protein and, 1 month thereafter, the 1st 8 mg secondary dose of VEGF receptor fusion protein; and 1 month thereafter, the 2nd 8 mg secondary dose of VEGF
receptor fusion protein; and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen; (6) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF receptor fusion protein after 1 month, then the method comprises, after another 1 month, administering to the subject a first 8 mg secondary dose of VEGF receptor fusion protein and, 1 month thereafter, the 2nd 8 mg secondary dose of VEGF receptor fusion protein; and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen; (7) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF
receptor fusion protein after 1 month, then the method comprises, after another 1 month, administering to the subject the 2nd 8 mg secondary dose of VEGF receptor fusion protein and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen; (8) the subject has received an Date Recue/Date Received 2023-02-22 initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF
receptor fusion protein after 1 month, then the method comprises, after another 1 month, administering to the subject the 1st 8 mg maintenance dose of VEGF receptor fusion protein and all further 8 mg maintenance doses of VEGF receptor fusion protein every 12 or 16 or 20 weeks according to the HDq12 or HDq16 or HDq20 dosing regimen; (9) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF
receptor fusion protein after 1 month and a 2nd 2 mg secondary dose of VEGF
receptor fusion protein after another 1 month, then the method comprises, after another 1 month, administering to the subject the initial 8 mg dose of VEGF receptor fusion protein and, 1 month thereafter, the 1st 8 mg secondary dose of VEGF receptor fusion protein; and 1 month thereafter, the 2nd 8 mg secondary dose of VEGF receptor fusion protein; and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen; (10) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF
receptor fusion protein after 1 month and a 2nd 2 mg secondary dose of VEGF receptor fusion protein after another 1 month, then the method comprises, after another 1 month, administering to the subject the first 8 mg secondary dose of VEGF receptor fusion protein and, 1 month thereafter, the 2nd 8 mg secondary dose of VEGF receptor fusion protein; and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen; (11) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF
receptor fusion protein after 1 month and a 2nd 2 mg secondary dose of VEGF
receptor fusion protein after another 1 month, then the method comprises, after another 1 month, administering to the subject the 2nd 8 mg secondary dose of VEGF receptor fusion protein and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF
receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen; (12) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF receptor fusion protein after 1 month and a 2nd 2 mg secondary dose of VEGF receptor fusion protein after another 1 month, then the method comprises, after 2 months, administering to the subject the 1st 8 mg maintenance dose of VEGF receptor fusion protein and, all further 8 mg maintenance doses of VEGF receptor fusion protein every 12 or 16 or 20 weeks according to the HDq12 or HDq16 or HDq20 dosing regimen; (13) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF
receptor fusion protein after 1 month and a 2nd 2 mg secondary dose of VEGF receptor fusion protein after Date Recue/Date Received 2023-02-22 another 1 month and a 1st 2 mg maintenance dose of VEGF receptor fusion protein after 8 weeks, then the method comprises, up to 2 months after the last dose of VEGF
receptor fusion protein, administering to the subject the initial 8 mg dose of VEGF receptor fusion protein and 1 month thereafter, the 1st 8 mg secondary dose of VEGF receptor fusion protein;
and 1 month thereafter, the 2nd 8 mg secondary dose of VEGF receptor fusion protein; and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen; (14) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF receptor fusion protein after 1 month and a 2nd 2 mg secondary dose of VEGF receptor fusion protein after another 1 month and 1 or more 2 mg maintenance doses of VEGF receptor fusion protein after 8 weeks, then the method comprises up to 2 months after the last dose of VEGF receptor fusion protein, administering to the subject the first 8 mg secondary dose of VEGF receptor fusion protein and 1 month thereafter, the 2nd 8 mg secondary dose of VEGF
receptor fusion protein; and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen; (15) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF receptor fusion protein after 1 month and a 2nd 2 mg secondary dose of VEGF receptor fusion protein after another 1 month and 1 or more 2 mg maintenance doses of VEGF receptor fusion protein after 8 weeks, then the method comprises up to 2 months after the last dose of VEGF receptor fusion protein, administering to the subject the 2nd 8 mg secondary dose of VEGF receptor fusion protein and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen; (16) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF receptor fusion protein after 1 month and a 2nd 2 mg secondary dose of VEGF receptor fusion protein after another 1 month and 1 or more 2 mg maintenance doses of VEGF receptor fusion protein after 8 weeks, then the method comprises up to 2 months after the last dose of VEGF receptor fusion protein, administering to the subject the 1st 8 mg maintenance dose of VEGF receptor fusion protein and all further 8 mg maintenance doses of VEGF
receptor fusion protein every 12 or 16 or 20 weeks according to the HDq12 or HDq16 or HDq20 dosing regimen; wherein, (i) said HDq12 dosing regimen comprises: a single initial dose of about 8 mg or more of VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is Date Recue/Date Received 2023-02-22 administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks after the immediately preceding dose; (ii) said HDq16 dosing regimen comprises: a single initial dose of about 8 mg or more of VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF
receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 16 weeks after the immediately preceding dose; and(iii) said HDq20 dosing regimen comprises: a single initial dose of about 8 mg or more of VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose;
and wherein each tertiary dose is administered about 20 weeks after the immediately preceding dose¨preferably, wherein the VEGF receptor fusion protein is aflibercept and 2 to 4 weeks is preferably 4 weeks.
receptor fusion protein; and then, every 12 or 16 or 20 weeks thereafter, administering one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen; (b) the subject has received an initial 8 mg dose of VEGF
receptor fusion protein & a 1st 8 mg secondary dose of VEGF receptor fusion protein after 1 month, then the method comprises, after another 1 month, administering to the subject the 2nd 8 mg secondary dose of VEGF receptor fusion protein; and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen; (c) the subject has received an initial 8 mg dose of VEGF receptor fusion protein & a 1st 8 mg secondary dose of VEGF
receptor fusion protein after 1 month & a 2nd 8 mg secondary dose of VEGF receptor fusion protein after another month; then the method comprises, after 12 or 16 or 20 weeks, administering to the subject the 1st 8 mg maintenance dose of VEGF receptor fusion protein and all further 8 mg maintenance doses of VEGF receptor fusion protein every 12 or 16 or 20 weeks according to the HDq12 or HDq16 or HDq20 dosing regimen; or (d) the subject has received an initial 8 mg Date Recue/Date Received 2023-02-22 dose of VEGF receptor fusion protein & a 1st 8 mg secondary dose of VEGF
receptor fusion protein after 1 month & a 2nd 8 mg secondary dose of VEGF receptor fusion protein after another month, then, every 12 or 16 or 20 weeks thereafter, the subject has received one or more 8 mg maintenance doses of VEGF receptor fusion protein; then the method comprises after 12 or 16 or 20 weeks from the last maintenance dose of VEGF receptor fusion protein, administering to the subject one or more 8 mg maintenance doses of VEGF
receptor fusion protein and all further 8 mg maintenance doses of VEGF receptor fusion protein every 12 or 16 or 20 weeks according to the HDq12 or HDq16 or HDq20 dosing regimen; wherein, (i) said HDq12 dosing regimen comprises: a single initial dose of about 8 mg or more of VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF
receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks after the immediately preceding dose; (ii) said HDq16 dosing regimen comprises: a single initial dose of about 8 mg or more of VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose;
and wherein each tertiary dose is administered about 16 weeks after the immediately preceding dose; and (iii) said HDq20 dosing regimen comprises: a single initial dose of about 8 mg or more of VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 20 weeks after the immediately preceding dose--preferably, wherein the VEGF receptor fusion protein is aflibercept and 2 to 4 weeks is preferably 4 weeks.
receptor fusion protein; or evaluating the subject in about 8 or 10 or 12 weeks after said administering and, if, in the judgment of the treating physician dosing every 12 weeks is appropriate, then administering another 8 mg dose of VEGF receptor fusion protein, re-evaluating the subject in about 12 weeks and if in the judgment of the treating physician, dosing every 16 weeks is appropriate, then continuing to dose the subject every 16 weeks with 8 mg VEGF
receptor fusion protein.
receptor fusion protein, preferably aflibercept, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 (preferably 4) weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 or 16 weeks after the immediately preceding dose; further comprising, after receiving one or more of said tertiary doses about 12 or 16 after the immediately preceding dose, lengthening the tertiary dose interval from 12 weeks to 16 weeks;
12 weeks to 20 weeks; or 16 weeks to 20 weeks, after the immediately preceding dose; e.g., wherein said tertiary dose interval is adjusted about 48 or 60 weeks after treatment initiation. In an embodiment of the invention, prior to said lengthening, the subject exhibits (a) <5 letter loss in BCVA; and/or (b) CRT <300 or 320 pm. In an embodiment of the invention, the method further comprises evaluating BVCA and/or CRT in the subject and, if the subject exhibits (a) <5 letter loss in BCVA; and/or (b) CRT <300 or 320 pm, lengthening the tertiary dose interval.
Date Recue/Date Received 2023-02-22
wherein each secondary dose is administered about 2 to 4 (preferably 4) weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 or 16 or 20 weeks after the immediately preceding dose; further comprising, after receiving one or more of said tertiary doses about 12 or 16 or 20 weeks after the immediately preceding dose, shortening the tertiary dose interval from 12 weeks to 8 weeks; 16 weeks to 12 weeks; 16 weeks to 8 weeks, 20 weeks to 8 weeks, 20 weeks to 12 weeks, or 20 weeks to 16 weeks. In an embodiment of the invention, prior to said shortening, the subject exhibits (a) > 10 letter loss in BCVA relative to baseline; and/or (b) > 50 pm increase in CRT relative to baseline. In an embodiment of the invention, the method further comprises evaluating BVCA and/or CRT in the subject and, if the subject exhibits (a) > 10 letter loss in BCVA relative to baseline; and/or (b) > 50 pm increase in CRT relative to baseline, shortening the tertiary dose interval.
(ETDRS), relative to the BCVA observed at about 12 weeks after treatment initiation; (b) a greater than 25 micrometers increase in CRT is observed relative to the CRT
observed at about 12 weeks after treatment initiation; and/or (c) there is a new onset foveal neovascularization or foveal hemorrhage; e.g., at week 16 or week 20 after treatment initiation, then, the interval between tertiary doses is shortened from 12 weeks or 16 weeks to 8 weeks; or if (a) greater than 5 letters are lost in BCVA (ETDRS), relative to the BCVA observed at about 12 weeks after treatment initiation; (b) a greater than 25 micrometers increase in CRT is observed relative to the CRT observed at about 12 weeks after treatment initiation; and/or (c) there is a new onset foveal neovascularization or foveal hemorrhage; e.g., at week 24 after treatment initiation, then, the interval between tertiary doses is shortened from 16 weeks to 12 weeks.
receptor fusion protein at an interval which is lengthened up to 12, 16 or 20 weeks.
Date Recue/Date Received 2023-02-22
and, after said doses, (a) determining if the subject meets at least one criterion for reducing or extending (lengthening) one or more intervals, of 2 weeks, 3 weeks, 4 weeks or 2-4 weeks, between doses of the VEGF receptor fusion protein; and (b) if said determination is made, administering further doses of the VEGF receptor fusion protein at said reduced or extended intervals between doses wherein criteria for reducing the interval include: 1.
BCVA loss >5 letters; 2. >25 micrometers increase in central retinal thickness (CRT); 3.
new foveal hemorrhage; and/or 4. new foveal neovascularization, wherein criteria for extending the interval include: 1. BCVA loss <5 letters, 2. No fluid at the central subfield; 3. No new onset foveal hemorrhage; and/or 4. No fovea! neovascularization. In an embodiment of the invention, criteria for extending the interval include:1. BCVA loss <5 letters from Week 12;2. No fluid at the central subfield on OCT, and3. No new onset foveal hemorrhage or foveal neovascularization; and/or criteria for reducing the interval include both: 1. BCVA loss >5 letters from Week 12, and 2. >25 micrometers increase in central retinal thickness (CRT) from Week 12 or new foveal hemorrhage or new fovea! neovascularization. In an embodiment of the invention, if said criteria are met, said interval is extended to 12, 16 or 20 weeks.
receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 (preferably 4) weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 (e.g., 12, 16 or 20) weeks after the immediately preceding dose.
receptor fusion protein, preferably aflibercept, followed by one or more (e.g., 2, 3 or 4) secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 Date Recue/Date Received 2023-02-22 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 (preferably 4) weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 8 weeks after the immediately preceding dose; or (2) one or more doses of 8 mg or more of VEGF receptor fusion protein about every 4 weeks.
In an embodiment of the invention, the methods herein further comprise a step of evaluating the subject for: ocular or periocular infection; active intraocular inflammation;
and/or hypersensitivity; and excluding the subject treatment or prevention if any one or more if found in the subject.
an invention needle, e.g., one 30-gauge x 1/2-inch injection needle; and a syringe, e.g., one 1-mL
Luer lock syringe having a graduation line marking for 70 microliters of volume; packaged together; then (1) visually inspecting the aqueous formulation in the vial and, if particulates, cloudiness, or discoloration are visible, then using another vial of aqueous formulation containing the VEGF
receptor fusion protein; (2) removing the protective plastic cap from the vial; and (3) cleaning the top of the vial with an alcohol wipe; then using aseptic technique: (4) removing the 18-gauge x 11/2-inch, 5-micron, filter needle and the 1 mL syringe from their packaging;
(5) attaching the filter needle to the syringe by twisting it onto the Luer lock syringe tip;
(6) pushing the filter needle into the center of the vial stopper until the needle is completely inserted into the vial and the tip touches the bottom or a bottom edge of the vial; (7) withdrawing all of the VEGF receptor fusion protein vial contents into the syringe, keeping the vial in an upright position, slightly inclined, while ensuring the bevel of the filter needle is submerged into the liquid; (8) continuing to tilt the vial during withdrawal keeping the bevel of the filter needle submerged in the Date Recue/Date Received 2023-02-22 formulation; (9) drawing the plunger rod sufficiently back when emptying the vial in order to completely empty the filter needle; (10) removing the filter needle from the syringe and disposing of the filter needle; (11) removing the 30-gauge x 1/2-inch injection needle from its packaging and attaching the injection needle to the syringe by firmly twisting the injection needle onto the Luer lock syringe tip; (12) holding the syringe with the needle pointing up, and checking the syringe for bubbles, wherein if there are bubbles, gently tapping the syringe with a finger until the bubbles rise to the top; and (13) slowly depressing the plunger so that the plunger tip aligns with the graduation line that marks 70 microliters on the syringe. In an embodiment of the invention, injection of VEGF receptor fusion protein is performed under controlled aseptic conditions, which comprise surgical hand disinfection and the use of sterile gloves, a sterile drape, and a sterile eyelid speculum (or equivalent) and anesthesia and a topical broad¨
spectrum microbicide are administered prior to the injection.
receptor fusion protein, followed by one or more tertiary doses of about 2 mg of the VEGF
receptor fusion protein; wherein each secondary dose is administered about 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 8 weeks after the immediately preceding dose; wherein the subject is at any phase (initial dose, secondary dose or tertiary dose) of the 2 mg VEGF receptor fusion protein dosing regimen.
2 to 4 weeks is about 4 weeks and one or more secondary doses is 2 secondary doses;
12-20 weeks is about 12 weeks and one or more secondary doses is 2 secondary doses; 12-20 weeks is about 16 weeks and one or more secondary doses is 2 secondary doses; 12-20 weeks is about 20 weeks and one or more secondary doses is 2 secondary doses; 12-20 weeks is about 12-16 weeks and one or more secondary doses is 2 secondary doses; 2 to 4 weeks is about 4 weeks and one or more secondary doses is 2 secondary doses and a VEGF receptor fusion protein is aflibercept; 12-20 weeks is about 12 weeks and one or more secondary doses is 2 secondary doses and a VEGF receptor fusion protein is aflibercept; 12-20 weeks is about 16 weeks and one or more secondary doses is 2 secondary doses and a VEGF receptor fusion protein is aflibercept; 12-20 weeks is about 20 weeks and one or more secondary doses is 2 secondary Date Recue/Date Received 2023-02-22 doses and a VEGF receptor fusion protein is aflibercept; and/or 12-20 weeks is about 12-16 weeks and one or more secondary doses is 2 secondary doses and a VEGF receptor fusion protein is aflibercept.
(i) comprises two polypeptides that comprise (1) a VEGFR1 component comprising amino acids 27 to 129 of SEQ
ID NO: 2; (2) a VEGFR2 component comprising amino acids 130-231 of SEQ ID NO:
2; and (3) a multimerization component comprising amino acids 232-457 of SEQ ID NO: 2;
(ii) comprises two polypeptides that comprise an immunoglobin-like (Ig) domain 2 of VEGFR1, an Ig domain 3 of a VEGFR2, and a multimerizing component; (iii) comprises two polypeptides that comprise an immunoglobin-like (Ig) domain 2 of VEGFR1, an Ig domain 3 of VEGFR2, an Ig domain 4 of VEGFR2 and a multimerizing component; (iv) comprises two VEGFR1R2-FcAC1(a) polypeptides encoded by the nucleic acid sequence of SEQ ID NO: 1; or (v) is selected from the group consisting of: aflibercept and conbercept. In an embodiment of the invention, the VEGF
receptor fusion protein comprises or consists of amino acids 27-457 of the amino acid sequence set forth in SEQ ID NO: 2.
sodium phosphate, 40 mM NaCI, 0.03% polysorbate 20 and 5% sucrose, with a pH of 6.2.
Date Recue/Date Received 2023-02-22
receptor fusion protein is in an aqueous pharmaceutical formulation comprising about 103-126 mg/ml VEGF
receptor fusion protein, histidine-based buffer and arginine, e.g., including about 114.3 mg/ml VEGF receptor fusion protein, histidine-based buffer and arginine.
67 I; 68 I; 69 I; 70 I; 71 I; 72 I; 73 I; 74 I; 75 I; 76 I; 77 I;
78 I; 79 I; 80 I; 81 I; 82 I; 83 I; 84 I; 85 I; 86 I; 87 I; 88 I; 89 I; 90 I; 91 I; 92 I; 93 I; 94 I; 95 I; 96 I; 97 I;
98 I; 99 I; or 100 I; e.g., about 70 + 4 or 5 microliters.
Elimination of intraretinal fluid (IRF) and/or subretinal fluid; Decrease in total lesion choroidal neovascularization (CNV) area;
Loss of or decrease in intraretinal fluid; Loss of or decrease in subretinal fluid; Decrease in central subfield retinal thickness (CST); Increase in vision-related quality of life; Lack of treatment-emergent adverse events (AEs) and/or serious AEs (SAEs); ETDRS
letter score of at least 69 (approximate 20/40 Snellen equivalent); Increase in BCVA as measured by the Early Treatment Diabetic Retinopathy Study (ETDRS) visual acuity chart by >5, >10, >15, or >20 letters, or lack of loss thereof during the course of treatment; Increase in BCVA as averaged over a period of 12 weeks; No intraretinal fluid (IRF) and no subretinal fluid; Decrease in choroidal neovascularization (CNV) size; Decrease in total lesion CNV area from baseline; Loss of IRF and/or SRF; Decrease in central subfield retinal thickness (CST);
Increase in vision-related quality of life as measured by the National Eye Institute Visual Functioning Questionnaire-25 (NEI-VFQ-25); Lack of treatment-emergent adverse events (AEs) and/or Date Recue/Date Received 2023-02-22 serious AEs (SAEs); Efficacy and/or safety, in a subject suffering from nAMD, similar to that of aflibercept which is intravitreally dosed at 2 mg approximately every 4 weeks for the first 3 months, followed by 2 mg approximately once every 8 weeks or once every 2 months wherein efficacy is measured as increase in BCVA and/or reduction in central retinal thickness, and wherein safety is as measured as the incidence of adverse events such as blood pressure increase, intraocular pressure increase, visual impairment, vitreous floaters, vitreous detachment, iris neovascularization and/or vitreous hemorrhage; No detectable anti-drug antibody during receipt of treatment; Improvement in best corrected visual acuity (BVCA) by week 4, week 8, week 12, week 16, week 20, week 24, week 28, week 32, week 36, week 40, week 44, week 48, week 52, week 56 or week 60 from start of treatment (baseline); Increase in BCVA as measured by the Early Treatment Diabetic Retinopathy Study (ETDRS) visual acuity chart or Snellen equivalent by letters, letters, letters, letters, letters or >7 letters;
Improvement in BCVA, by 4 weeks after initiation of treatment, of about 2 or 3 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 3 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; Improvement in BCVA, by 8 weeks after initiation of treatment, of about 5 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 4 or 5 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
Improvement in BCVA, by 12 weeks after initiation of treatment, of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; Improvement in BCVA, by 16 weeks after initiation of treatment, of about 6 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; Improvement in BCVA, by 20 weeks after initiation of treatment, of about 6 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
Improvement in BCVA, by 24 weeks after initiation of treatment, of about 5 or 6 letters (ETDRS
or Snellen equivalent) when on HDq12 regimen; or of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; Improvement in BCVA, by 28 weeks after initiation of treatment, of about 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
Improvement in BCVA, by 32 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; Improvement in BCVA, by 36 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; Improvement in BCVA, by 40 weeks after Date Recue/Date Received 2023-02-22 initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
Improvement in BCVA, by 44 weeks after initiation of treatment, of about 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 5 or 6 letters (ETDRS
or Snellen equivalent) when on HDq16 regimen; Improvement in BCVA, by 48 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
Improvement in BCVA, by 52 weeks after initiation of treatment, of about 7 or 8 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; Improvement in BCVA, by 56 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; Improvement in BCVA, by 60 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; Improvement in BCVA, from about 48 to about 60 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; Improvement in BCVA, by 60 weeks after initiation of treatment, of about 5, 10 or 15 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or the HDq16 regimen; An improvement in BCVA by about week 8,9, 10, 11 or 12 after initiation of treatment which is maintained (within about +1 or +2 ETDRS
letters or Snellen equivalent) thereafter during the treatment regimen; A BCVA
by 4 weeks after initiation of treatment of about 63 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 63 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; A BCVA by 8 weeks after initiation of treatment of about 65 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 65 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; A BCVA by 12 weeks after initiation of treatment of about 66 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; A
BCVA by 16 weeks after initiation of treatment of about 66 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; A BCVA by 20 weeks after initiation of treatment of about 66 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; A BCVA by 24 weeks after initiation of treatment of about 66 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a Date Recue/Date Received 2023-02-22 BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; A BCVA
by 28 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66Ietter5 (ETDRS or Snellen equivalent) when on the HDq16 regimen; A BCVA by 32 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 67 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; A BCVA by 36 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; A BCVA by 40 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; A BCVA by 44 weeks after initiation of treatment of about 68 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; A BCVA
by 48 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; A BCVA by 52 weeks after initiation of treatment of about 67 or 68 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; A BCVA by 56 weeks after initiation of treatment of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; A BCVA by 60 weeks after initiation of treatment of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; A BCVA
between about week 48 and about 60 week after initiation of treatment of about 66 to about 72 letters (ETDRS
or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 to about 70 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; Retina without fluid (total fluid, intraretinal fluid [IRF] and/or subretinal fluid [SRF]) in center subfield; No subretinal pigment epithelium fluid; Lack of fluid leakage on fluorescein angiography (FA);
Decrease in central retinal thickness (CRT) by at least about 100, 125, 130, 135, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149 or 150 micrometers; A change in central retinal thickness, by 4 weeks after initiation of treatment of about -120 or -121 or -122 or -122.4 or -120.2 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -126 or -127 or-126.6 or -126.3 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen; A
change in central retinal thickness, by 8 weeks after initiation of treatment of about -132, -133, -134, -135 Date Recue/Date Received 2023-02-22 or -136 or -136.2 or -132.8 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -139 or -140 or -139.5 or -139.6 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen; A change in central retinal thickness, by 12 weeks after initiation of treatment of about -136, -137, -138, -139, -140 or -141 or -140.9 or -136.6 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -144 or -143 or -143.5 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen A change in central retinal thickness, by 16 weeks after initiation of treatment of about -120 or -121 or -122 or -123 or -124 or -123.4 or -120.1 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -132 or -133 or -132.1 or -133.1 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen; A change in central retinal thickness, by 20 weeks after initiation of treatment of about -110 or-ill or -112 or -113 or -114 or -113.6 or -110.9 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -115 or -116 or -117 or -118 or -115.8 or -117.7 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen; A change in central retinal thickness, by 24 weeks after initiation of treatment of about -134, -135, -136 or -137 or -138 or -137.6 or -134.9 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -105 or -106 or -107 or -108 or -105.3 or -107.8 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen; A change in central retinal thickness, by 28 weeks after initiation of treatment of about -130, -131 or -132 or -133 or -134 or -133.7 or -130.7 micrometers (+
about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -144 or -145 or -146 or -147 or -148 or -144.7 or -147.2 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen; A change in central retinal thickness, by 32 weeks after initiation of treatment of about -118 or -19 or -120 or -121 or -120.4 or -118.1 micrometers (+ about 10,11 0r12 micrometers) when on the HDq12 regimen; or of about -141 or -142 or -143 or -144 or -141.5 or -144 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen;
A change in central retinal thickness, by 36 weeks after initiation of treatment of about -142 or -143 or -144 or -144.2 or -142.2 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -126 or -127, -128 or -129 or -130 or -131 or -126.4 or -130.5 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen; A change in central retinal thickness, by 40 weeks after initiation of treatment of about -131, -132, -133 or -134 or -133.8 or -131.2 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -127, -128 or -127.5 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen; A change in central retinal thickness, by 44 weeks after initiation of treatment of about -120 or -121 or -122 or -123 or -124 or -125 or -124.7 or -120.3 micrometers (+ about 10, 11 or Date Recue/Date Received 2023-02-22 12 micrometers) when on the HDq12 regimen; or of about -143, -144 or -145 or -144.8 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen; A
change in central retinal thickness, by 48 weeks after initiation of treatment of about -142 or -143 or -144 or -144.4 or -142.3 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -143 or -144 or -145 or -146 or -147 or -148 or -143.8 or -147.1 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen; A
change in central retinal thickness, by 52 weeks after initiation of treatment of about -143.2 micrometers (+
about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -139.6 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen; A change in central retinal thickness, by 56 weeks after initiation of treatment of about -136.3 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -137.5 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen; A change in central retinal thickness, by 60 weeks after initiation of treatment of about -151.8 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -148.8 micrometers (+
about 10, 11 or 12 micrometers) when on the HDq16 regimen; A central retinal thickness by week 4 after initiation of treatment of about 248.2 micrometers when on the HDq12 regimen;
or of about 244.1 micrometers when on the HDq16 regimen; A central retinal thickness by week 8 after initiation of treatment of about 234.4 micrometers when on the HDq12 regimen;
or of about 231.2 micrometers when on the HDq16 regimen; A central retinal thickness by week 12 after initiation of treatment of about 229.7 micrometers when on the HDq12 regimen;
or of about 226.7 micrometers when on the HDq16 regimen; A central retinal thickness by week 16 after initiation of treatment of about 247.2 micrometers when on the HDq12 regimen;
or of about 238.6 micrometers when on the HDq16 regimen; A central retinal thickness by week 20 after initiation of treatment of about 257 micrometers when on the HDq12 regimen; or of about 254.9 micrometers when on the HDq16 regimen; A central retinal thickness by week 24 after initiation of treatment of about 233 micrometers when on the HDq12 regimen; or of about 265.4 micrometers when on the HDq16 regimen; A central retinal thickness by week 28 after initiation of treatment of about 236.9 micrometers when on the HDq12 regimen; or of about micrometers when on the HDq16 regimen; A central retinal thickness by week 32 after initiation of treatment of about 250.2 micrometers when on the HDq12 regimen; or of about 229.2 micrometers when on the HDq16 regimen; A central retinal thickness by week 36 after initiation of treatment of about 226.4 micrometers when on the HDq12 regimen; or of about 244.3 micrometers when on the HDq16 regimen; A central retinal thickness by week 40 after initiation of treatment of about 236.8 micrometers when on the HDq12 regimen; or of about 243.7 Date Recue/Date Received 2023-02-22 micrometers when on the HDq16 regimen; A central retinal thickness by week 44 after initiation of treatment of about 245.9 micrometers when on the HDq12 regimen; or of about 227.7 micrometers when on the HDq16 regimen; A central retinal thickness by week 48 after initiation of treatment of about 226.2 micrometers when on the HDq12 regimen; or of about 226.9 micrometers when on the HDq16 regimen; A central retinal thickness by week 52 after initiation of treatment of about 227.4 micrometers when on the HDq12 regimen; or of about 231.1 micrometers when on the HDq16 regimen; A central retinal thickness by week 56 after initiation of treatment of about 234.3 micrometers when on the HDq12 regimen; or of about 233.2 micrometers when on the HDq16 regimen; A central retinal thickness by week 60 after initiation of treatment of about 218.8 micrometers when on the HDq12 regimen; or of about 221.9 micrometers when on the HDq16 regimen; A CRT by about week 4, 5, 6, 7 or 8 after initiation of treatment or a reduction in CRT by week 4, 5, 6, 7 or 8 after initiation of treatment which is maintained (within about +10, +11 or +12 micrometers) thereafter during the treatment regimen;
At about 4 hours after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.0409 (+0.0605) or 0 mg/L (or <0.0156 mg/L); At about 8 hours after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.05 (+3.78), 0.0973 (+0.102) or 0.0672 mg/L; At about day 2 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.11 (+2.21), 0.146 (+0.110) or 0.0903 mg/L;
At about day 3 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.11 (+2.06), 0.137 (+0.0947) or 0.112 mg/L; At about day 5 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.08 (+1.86), 0.0933 (+0.0481) or 0.0854 mg/L; At about day 8 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.07 (+1.75), 0.0794 (+0.0413) or 0.0682 mg/L; At about day 15 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.04 (+1.76), 0.0435 (+0.0199) or 0.0385 mg/L; At about day 22 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.02 (+1.76), 0.0213 (+0.0148) or 0.0232 mg/L; At about day 29 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.00766 (+0.00958) or 0 mg/L (or <0.0156 mg/L); At about 4 hours post-dose after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.00 mg/L; At about 8 hours post-dose after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.00 mg/L; At about day 2 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.06 (+3.50) or 0.124 (+0.186) mg/L; At about day 3 after treatment initiation of HDq12 or HDq16, an adjusted bound Date Recue/Date Received 2023-02-22 aflibercept concentration in plasma of about 0.13 (+2.07) or 0.173 (+0.155) mg/L; At about day 5 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.18 (+1.88) or 0.223 (+0.157) mg/L; At about day 8 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.31 (+1.56) or 0.334 (+0.135) mg/L; At about day 15 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.37 (+1.50) or 0.393 (+0.130) mg/L; At about day 22 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.25 (+3.00) or 0.335 (+0.155) mg/L; At about day 29 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.32 (+1.39) or 0.331 (+0.0953) mg/L; Non-inferior BVCA
compared to that of aflibercept which is intravitreally dosed at 2 mg approximately every 4 weeks for the first 5 injections followed by 2 mg approximately once every 8 weeks or once every 2 months; Ocular and non-ocular safety or death rate, in a subject suffering from DME, similar to that of aflibercept which is intravitreally dosed at 2 mg approximately every 4 weeks for the first 3 or 4 or 5 injections followed by 2 mg approximately once every 8 weeks or once every 2 months; An improvement in best corrected visual acuity by 4, 8, 12, 16, 20, 24, 28, 32, 36, 40,44 0r48 weeks from start of treatment; An increase in best corrected visual acuity, as measured by Early Treatment Diabetic Retinopathy Study (ETDRS) visual acuity chart or Snellen equivalent of 2 letters, 3 letters, 4 letters, 5 letters, 6 letters or > 7 letters by 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 or 60 weeks from start of treatment; A retina without fluid (total fluid, intraretinal fluid [IRF] and/or subretinal fluid [SRF]) in center subfield by 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 or 60 weeks from start of treatment; and/or a decrease in central retinal thickness (CRT) of at least 100, 125, 130, 135, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149 or 150 micrometers by 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 or 60 weeks from start of treatment. In an embodiment of the invention, a dry retina lacks intraretinal fluid and/or subretinal fluid; or dry retina is characterized by no intraretinal fluid (IRF) and no subretinal fluid (SRF) in the eye of the subject. In an embodiment of the invention, dry retina is characterized by no intraretinal fluid (IRF) and no subretinal fluid (SRF) in the eye of the subject, after the subject has received three monthly doses of VEGF receptor fusion protein.
Date Recue/Date Received 2023-02-22
receptor fusion protein,
114.3 mg/mL
VEGF receptor fusion protein, wherein the instruction comprises instruction for the administration of VEGF receptor fusion protein to DME/AMD patients, wherein the instruction comprises instruction that VEGF receptor fusion protein 8 mg treatment is initiated with 1 injection per month (every 4 weeks) for 3 consecutive doses, wherein the instruction comprises instruction that after the initial 3 consecutive doses the injection interval may be extended up to every 16 weeks or every 20 weeks, and wherein the instruction comprises instruction that the treatment interval may be adjusted based on the physician's judgement of visual and/or anatomic outcomes.
BRIEF DESCRIPTION OF THE FIGURES
clinical trial.
clinical trial.
clinical trial.
Week 2q8 HDq12 HDq16 Date Recue/Date Received 2023-02-22 0 0.0 0.0 0.0 4 4.6 2.7 3.2 8 6.3 5 4.8 12 6.6 5.5 5.8 16 6.7 6 6.5 20 7.7 6 6.3 24 7.4 5.9 5.8 28 8.1 7.2 6.3 32 7.6 6.8 7.3 36 8.2 6.7 6.4 40 7.8 6.9 5.7 44 8 7.2 5.9 48 7.6 6.7 6.2 *the present invention includes methods for achieving approximately the indicated improvement in BVCA by the indicated timepoint when receiving the indicated treatment regimen for treating wetAMD.
; and Central retinal thickness through week 48 (Fig. 13B), in PULSAR clinical trial (see data below).
Week 2q8 HDq12 HDq16 0 367.1 370.6 370.7 4 246.6 248.2 244.1 8 235.7 234.4 231.2 12 231 229.7 226.7 16 252 247.2 238.6 20 228.7 257 254.9 24 247.3 233 265.4 28 224.6 236.9 226 32 242.5 250.2 229.2 36 224.1 226.4 244.3 40 240.3 236.8 243.7 44 220.9 245.9 227.7 48 236.3 226.2 226.9 *the present invention includes methods for achieving approximately the indicated central retinal thickness by the indicated timepoint when receiving the indicated treatment regimen for treating wetAMD.
14B) in PULSAR clinical trial.
clinical trial.
clinical trial.
clinical trial.
Date Recue/Date Received 2023-02-22
clinical trial.
letters) out to week 60. Least squares mean change from baseline at week 60 shown.
(micrometers) by visit, MMRM (mixed model for repeated measurements) in the full analysis set (to week 48).
30C) Non-Ocular TEAEs 2% through Week 60, (Fig. 30D) Non-Ocular Serious TEAEs 0.5%
through Week 60, (Fig. 30E) Deaths through Week 60, (Fig. 30F) Mean Change in Systolic Blood Pressure at week 60, and (Fig. 30G) Mean Change in Diastolic Blood Pressure at week 60, for PULSAR.
= intravenous, IVT = intravitreal, K20 = elimination rate constant for free aflibercept, K40 = elimination rate constant for adjusted bound aflibercept, K62 = rate of absorption from subcutaneous injection depot compartment, K70 = elimination rate constant from tissue (platelet) compartment; QE =
inter-compartmental clearance between ocular compartment and central compartment of free aflibercept, QF1 and QF2 = inter-compartmental clearances of free aflibercept, VMK24, KM =
saturable Michaelis-Menten type binding of free aflibercept with VEGF; VMK27, KMK27 =
saturable elimination from plasma compartment to tissue compartment (platelets) CMT 2 and CMT 4 are both representative of the plasma compartment and volumes are assumed to be equal.
in the Dense PK Sub-studies (DPKS, Log-Scaled). LQ = below limit of quantification, DME =
Diabetic Macular Edema, DPKS = dense pharmacokinetic sub-studies, HDq12 = aflibercept 8 mg administered every 12 weeks following 3 initial monthly injections, HDq16 =
aflibercept 8 mg administered every 16 weeks following 3 initial monthly injections, IVT =
intravitreally, LLOQ =
lower limit of quantification, N = number of participants, nAMD = neovascular age-related macular degeneration, SD = standard deviation Adjusted Bound Aflibercept =
0.717*Bound Aflibercept Note: Concentrations below the LLOQ (0.0156 mg/L for Free and 0.0224 mg/L for Adjusted Bound Aflibercept) were set to LLOQ/2. Note: 8 mg HD aflibercept data for the first 28 days (obtained from PULSAR or PHOTON) is a combination of data from participants who received HDq12 or HDq16. One participant in PULSAR with an outlier free aflibercept concentration at day 28 that is greater than 10-fold of the mean concentration is excluded.
Records after fellow-eye treatment are excluded. Data Source: drug concentration data from the week 48 database lock for PULSAR and PHOTON and final lock for CANDELA.
diabetic macular edema, IVT = intravitreally, LLOQ = lower limit of quantitation, nAMD =
neovascular age-related macular degeneration, PK = pharmacokinetic Observed concentrations below the lower limit of quantitation (LLOQ; 0.0156 mg/L for free and 0.0224 mg/L for adjusted bound aflibercept) were set to LLOQ/2. Data source: Drug concentration data from dense PK
sub-study in PHOTON, PULSAR, and CANDELA.
Date Recue/Date Received 2023-02-22
Populations. 2q8 =
aflibercept 2 mg administered every 8 weeks, after 3 initial injections at 4-week intervals, 2q12 =
aflibercept 2 mg administered every 12 weeks, after 3 initial injections at 4-week intervals, DME
= diabetic macular edema, HDq12 = aflibercept 8 mg administered every 12 weeks following 3 initial monthly injections, HDq16 = aflibercept 8 mg administered every 16 weeks following 3 initial monthly injections, IVT = intravitreally, LLOQ = lower limit of quantification, nAMD =
neovascular age-related macular degeneration Observed concentrations below the lower limit of quantitation (LLOQ; 0.0156 mg/L for free and 0.0224 mg/L for adjusted bound aflibercept) were set to LLOQ/2. Data source: Drug concentration data from CANDELA, PHOTON, and PULSAR.
Injection, Stratified by Dosing Regimen in Combined Participants with nAMD and DME. DME =
diabetic macular edema, HD = aflibercept 8 mg, IVT = intravitreal, nAMD =
neurovascular age-related macular degeneration, PI = prediction interval, PK = pharmacokinetics, QE = inter-compartmental clearance between ocular compartment and central compartment of free aflibercept Adjusted LLOQ (0.0624 pg), set as the LLOQ of free aflibercept in plasma (that is, 0.0156 mg/L) times the assumed volume of the study eye compartment in the PK
model (that is, 4 mL). Since the concentrations of (free or bound) aflibercept were not measured in the study eye in the clinical studies included in the Population PK analysis dataset, this target was selected arbitrarily on the basis of the LLOQ in plasma and was used as reference for comparison across dosing regimens and to assess the effect of the effect of HD
aflibercept on QE.
lower limit of quantification, N = number of participants, nAMD = neovascular age-related macular degeneration, PK = pharmacokinetic, SD = standard deviation Adjusted Bound Aflibercept =
0.717*Bound Aflibercept. Note: Concentrations below the LLOQ (0.0156 mg/L for Free and 0.0224 mg/L for Adjusted Bound Aflibercept) were set to LLOQ/2. Note: 8 mg data for the first 28 days (obtained from PULSAR or PHOTON) is a combination of data from participants who Date Recue/Date Received 2023-02-22 received HDq12 or HDq16 Data source: drug concentration from the week 48 lock for PULSAR
and PHOTON and final lock for CANDELA. Records after fellow-eye treatment are excluded.
0.717*Bound Aflibercept. Note: Concentrations below the lower limit of quantification (LLOQ, 0.0156 mg/L for Free and 0.0224 mg/L for Adjusted Bound Aflibercept) were set to LLOQ/2.
Data source: drug concentration from the week 48 lock for PULSAR and final lock for CANDELA. Data from VGFTOD-0702 are included as a reference (the concentration in PK sub-study is subtracted by pre-dose concentration when it is >LLOQ). Records after fellow-eye treatment are excluded.
diabetic macular edema, DPKS = dense pharmacokinetic analysis set, HDq12 =
aflibercept 8 mg administered every 12 weeks following 3 initial monthly injections, HDq16 =
aflibercept 8 mg administered every 16 weeks following 3 initial monthly injections, IVT =
intravitreally, LLOQ =
lower limit of quantification, N = number of participants, nAMD = neovascular age-related macular degeneration, SD = standard deviation Note: Concentrations below the LLOQ (0.0156 mg/L for Free and 0.0224 mg/L for Adjusted Bound Aflibercept) were set to LLOQ/2. Adjusted Bound Aflibercept = 0.717*Bound Aflibercept. Note: 8 mg data for the first 28 days (obtained from PULSAR or PHOTON) is a combination of data from participants who received HDq12 or HDq16. Note: The Concentration is subtracted by baseline concentration if participants took the Aflibercept prior to study drug started within 12 weeks and the baseline concentration is > BLQ.
Data source: drug concentration data from the week 48 lock for PHOTON. Drug concentration data from VGFT-OD-0706 (historical data) are included as a reference. Records after fellow-eye treatment are excluded.
aflibercept 2 mg Date Recue/Date Received 2023-02-22 administered every 8 weeks, after 3 initial injections at 4-week intervals, 2q12 = aflibercept 2 mg administered every 12 weeks, after 3 initial injections at 4-week intervals, DME = diabetic macular edema, HDq12 = aflibercept 8 mg administered every 12 weeks following 3 initial monthly injections, HDq16 = aflibercept 8 mg administered every 16 weeks following 3 initial monthly injections, IVT = intravitreally, LLOQ = lower limit of quantitation, nAMD = neovascular age-related macular degeneration, PK = pharmacokinetics Observed concentrations below the lower limit of quantitation (LLOQ; 0.0156 mg/L for free and 0.0224 mg/L for adjusted bound aflibercept) were set to LLOQ/2. Data from PULSAR and CANDELA
DETAILED DESCRIPTION OF THE INVENTION
injection which extends the maintenance dosing interval past 8 weeks, with at least similar functional and potentially improved anatomic outcomes. The regimen exhibited an unexpectedly high level of durability in subjects which exceeded that which would have been expected simply based on administration of more aflibercept.
¨ statistically significant covariate in the Population PK model discussed herein - and not just an increase in the IVT dose from 2 mg to 8 mg aflibercept. The precise cause of the HD drug product effect is not known but is likely a factor unique to the HDq12 and HDq16 regimens relative to the known 2 mg aflibercept regimens.
aflibercept to be 1.5 weeks compared to 3.50 weeks for 8 mg HD aflibercept. The longer duration of systemic exposure to free aflibercept for the HD aflibercept regimen was attributed to not only a higher administered dose and nonlinear systemic target-mediated elimination, but also to a 34% slower ocular clearance of free aflibercept. The slower ocular clearance of the HD
aflibercept drug product was predicted to provide a 6-week longer duration of efficacy compared to that of 2q8, as the time to achieve the free aflibercept amount in the ocular compartment for the 2q8 regimen at the end of an 8-week dosing interval occurs 6 weeks later for the HD aflibercept drug product. Analyses estimated that the lower ocular clearance for 8 mg aflibercept, attributable to the HD drug product effect, resulted in a 20.6% lower rate of DRM than would have been expected if the HD drug product had the same ocular clearance as 2 mg aflibercept.
(2000) Current Protocols in Protein Science, Vol. 1, John Wiley and Sons, Inc., New York).
Chemical analysis, chemical modification, post-translational modification, production of fusion proteins, glycosylation of proteins are described (see e.g., Coligan etal.
(2000) Current Protocols in Protein Science, Vol. 2, John Wiley and Sons, Inc., New York;
Ausubel, et a/.
(2001) Current Protocols in Molecular Biology, Vol. 3, John Wiley and Sons, Inc., NY, N.Y., pp.
16Ø5-16.22.17; Sigma-Aldrich, Co. (2001) Products for Life Science Research, St. Louis, Mo.;
pp. 45-89; Amersham Pharmacia Biotech (2001) BioDirectory, Piscataway, N.J., pp. 384-391).
Production, purification, and fragmentation of polyclonal and monoclonal antibodies are described (Coligan et a/. (2001) Current Protcols in Immunology, Vol. 1, John Wiley and Sons, Inc., New York; Harlow and Lane (1999) Using Antibodies, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Harlow and Lane, supra). Standard techniques for Date Recue/Date Received 2023-02-22 characterizing ligand/receptor interactions are available (see, e.g., Coligan etal. (2001) Current Protocols in Immunology, Vol. 4, John Wiley, Inc., New York).
Sigma-Aldrich (2003) Catalogue, St. Louis, Mo.).
receptor fusion proteins, lipids, carbohydrates, or other material such as cellular debris and growth medium. An isolated VEGF antagonist or VEGF receptor fusion protein may further be at least partially free of expression system components such as biological molecules from a host cell or of the growth medium thereof. Generally, the term "isolated" is not intended to refer to a complete absence of such biological molecules (e.g., minor or insignificant amounts of impurity may remain) or to an absence of water, buffers, or salts or to components of a pharmaceutical formulation that includes the VEGF antagonists or VEGF receptor fusion proteins.
receptor fusion proteins, lipids, carbohydrates, or other material such as cellular debris and growth medium. An isolated VEGF antagonist or VEGF receptor fusion protein may further be at least partially free of expression system components such as biological molecules from a host cell or of the growth medium thereof. Generally, the term "isolated" is not intended to refer to a complete absence of such biological molecules (e.g., minor or insignificant amounts of impurity may remain) or to an Date Recue/Date Received 2023-02-22 absence of water, buffers, or salts or to components of a pharmaceutical formulation that includes the VEGF antagonists or VEGF receptor fusion proteins.
1. 50 years of age, e.g., 61, 62, 63, 74 or 75;
2. Has active subfoveal CNV secondary to nAMD, e.g., including juxtafoveal lesions that affect the fovea in an eye;
3. Has Best Corrected Visual Acuity (BCVA) Early Treatment Diabetic Retinopathy Study (ETDRS) letter score of about 78 to 24, 73-78, <73, 58, 59, 60, 61 or 62 (Snellen equivalent of 20/40, 20/63, 20/50, 20/32 or 20/320), e.g., due to DME or nAMD;
4. Central retinal thickness of >300 micrometers or >320 micrometers, or about 367, 368, 369, 370, 450, 451, 452, 453, 454 or 455 micrometers; or and/or DME with central involvement in an eye with CRT ._300 micrometers (or ._320 micrometers on Spectralis);
5. lesion area of about 6 or 7 mm2, e.g., wherein the lesion type is occult, predominantly classic or minimally classic;
6. DRSS score of better or equal to Level 43, Level 47 or worse; and/or 7. Type 1 or type 2 diabetes mellitus;
in an eye;
and/or, has or lacks any one or more of the following characteristics:
1. Subretinal hemorrhage in an eye that is 50% of the total lesion area;
2. Intraocular pressure 25 mmHg in an eye;
3. Evidence of infectious blepharitis, keratitis, scleritis, or conjunctivitis in an eye;
4. Any intraocular inflammation and/or ocular infection in an eye;
5. Any history of macular hole of stage 2 and above in an eye;
6. Current iris neovascularization, vitreous hemorrhage, or tractional retinal detachment visible in an eye;
Date Recue/Date Received 2023-02-22 7. Uncontrolled BP (defined as systolic >140 mm Hg or diastolic >90 mm Hg);
8. Variation by more than 10% in the 3 BP measurements;
9. History of cerebrovascular accident/ transient ischemic attack or myocardial infarction/
acute coronary syndrome;
10. Renal failure, dialysis, or history of renal transplant;
11. Known sensitivity to aflibercept;
12. Pregnant or breastfeeding woman;
13. Woman of childbearing potential who are unwilling to practice highly effective contraception;
14. Any intraocular surgery within 12 weeks (84 days); and/or 15. History of corneal transplant or corneal dystrophy in an eye.
2. who has active subfoveal CNV secondary to nAMD;
3. who has Best Corrected Visual Acuity (BCVA) Early Treatment Diabetic Retinopathy Study (ETDRS) letter score of about 78 to 24;
4. has a central retinal thickness of >300 micrometers or >320 micrometers;
5. who has a lesion area of about 6 or 7 mm2;
6. who has a DRSS score of better or equal to Level 43, Level 47 or worse;
and/or 7. who has Type 1 or type 2 diabetes mellitus;
and/or 1. who does not have subretinal hemorrhage in an eye that is 50% of the total lesion area;
2. who does not have an lntraocular pressure 25 mmHg in an eye;
3. for whom there is no evidence of infectious blepharitis, keratitis, scleritis, or conjunctivitis in an eye;
4. who does not have any intraocular inflammation and/or ocular infection in an eye;
5. who does not have any history of macular hole of stage 2 and above in an eye;
6. who does not have current iris neovascularization, vitreous hemorrhage, or tractional retinal detachment visible in an eye;
7. who does not have uncontrolled BP;
8. who does not have a variation, by more than 10%, in 3 BP measurements;
Date Recue/Date Received 2023-02-22 9. who does not have a history of cerebrovascular accident/transient ischemic attack or myocardial infarction/acute coronary syndrome;
10. who does not have renal failure, dialysis, and/or history of renal transplant;
11. who does not have a known sensitivity to aflibercept;
12. who is not pregnant or a breastfeeding woman;
13. who is not a woman of childbearing potential who is unwilling to practice highly effective contraception;
14. who has not had any intraocular surgery within 12 weeks (84 days); and/or 15. does not have a history of corneal transplant or corneal dystrophy in an eye;
comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, preferably aflibercept, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks after the immediately preceding dose.
VEGF Antagonists
antibodies, anti-VEGF receptor antibodies, and VEGF receptor fusion proteins.
receptor, e.g., wherein two of such fusion polypeptides are associated thereby forming a homodimer or other multimer.
Such VEGF receptor fusion proteins may be referred to as a "VEGF-Trap" or "VEGF Trap".
VEGF receptor fusion proteins within the context of the present disclosure that fall within this definition include chimeric polypeptides which comprise two or more immunoglobulin (1g)-like domains of a VEGF receptor such as VEGFR1 (also known as Flt1) and/or VEGFR2 (also known as Flk1 or KDR), and may also contain a multimerizing domain (for example, an Fc domain).
Date Recue/Date Received 2023-02-22
(1) a VEGFR1 component comprising amino acids 27 to 129 of SEQ ID NO:2;
(2) a VEGFR2 component comprising amino acids 130 to 231 of SEQ ID NO:2; and (3) a multimerization component ("FcAC1(a)") comprising amino acids 232 to 457 of SEQ ID
NO:2 (the C-terminal amino acids of SEQ ID NO:2, Le., K458, may or may not be included in the VEGF receptor fusion proteins, see U.S. Patent No. 7,396,664 or 7,354,579, incorporated herein for all purposes). Note that amino acids 1 to 26 of SEQ ID NO:2 are the signal sequence.
atggtcagctactgggacaccggggtcctgctgtgcgcgctgctcagctgtctgcttctcacaggatctagttccgg aagtgataccggtagacctttcgtagagatgtacagtgaaatccccgaaattatacacatgactgaaggaagggagc tcgtcattccctgccgggttacgtcacctaacatcactgttactttaaaaaagtttccacttgacactttgatccct gatggaaaacgcataatctgggacagtagaaagggcttcatcatatcaaatgcaacgtacaaagaaatagggcttct gacctgtgaagcaacagtcaatgggcatttgtataagacaaactatctcacacatcgacaaaccaatacaatcatag atgtggttctgagtccgtctcatggaattgaactatctgttggagaaaagcttgtcttaaattgtacagcaagaact gaactaaatgtggggattgacttcaactgggaatacccttcttcgaagcatcagcataagaaacttgtaaaccgaga cctaaaaacccagtctgggagtgagatgaagaaatttttgagcaccttaactatagatggtgtaacccggagtgacc aaggattgtacacctgtgcagcatccagtgggctgatgaccaagaagaacagcacatttgtcagggtccatgaaaag gacaaaactcacacatgcccaccgtgcccagcacctgaactcctggggggaccgtcagtcttcctcttccccccaaa acccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctg aggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaagacaaagccgcgggaggagcagtacaac agcacgtaccgtgtggtcagcgtcctcaccgtcctgcaccaggactggctgaatggcaaggagtacaagtgcaaggt ctccaacaaagccctcccagcccccatcgagaaaaccatctccaaagccaaagggcagccccgagaaccacaggtgt acaccctgcccccatcccgggatgagctgaccaagaaccaggtcagcctgacctgcctggtcaaaggcttctatccc agcgacatcgccgtggagtgggagagcaatgggcagccggagaacaactacaagaccacgcctcccgtgctggactc cgacggctccttcttcctctacagcaagctcaccgtggacaagagcaggtggcagcaggggaacgtcttctcatgct ccgtgatgcatgaggctctgcacaaccactacacgcagaagagcctctccctgtctccgggtaaatga Date Recue/Date Received 2023-02-22 (SEQ ID NO: 1) MVS YWDTGVLLCALLS CLLLT GS SSGS DTGRPFVEMYSE IPE I IHMTEGRELVI PCRVT S
PNI TVTLKKFPLDTL I PDGKR I IWDSRKGFI I SNATYKEIGLLTCEATVNGHLYKTNYLT
HRQTNT II DVVLS PSHGIELS VGEKLVLNCTARTELNVGIDFNWEYPS SKHQHKKLVNRD
LKTQS GSEMKKFLS TL T I DGVTRSDQGLYTCAASSGLMTKKNS TFVRVHEKDKTHTCPPC
PAPELLGGPSVFLFPPKPKDT LMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKT
KPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAP I EKT I S KAKGQPRE PQVY
TLPPS RDELTKNQVSL TCLVKGFYPS DIAVEWESNGQPENNYKTT PPVLDS DGS FFLYSK
LTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPGK
(SEQ ID NO: 2)
receptor (e.g., VEGFR2) and (4) a multimerizing component (e.g., Fc domain of IgG including the hinge, CH2 and CH3 domains).
= [VEGFR1 Ig domain 2]-[VEGFR2 Ig domain 3]-[MC] (e.g., a homodimer thereof) or = [VEGFR1 Ig domain 2]-[VEGFR2 Ig domain 3]-[VEGFR2 Ig domain 4]-[MC]
(e.g., a homodimer thereof).
binding molecule or anti-VEGF antibody or antigen-binding fragments thereof or biopolymer conjugate thereof (e.g., KSI-301), e.g., = bevacizumab (e.g., at a concentration of about 80-90 or 88 mg/ml), = ranibizumab (e.g., at a concentration of about 20-40 mg/ml, e.g., 21-35, 21 or 35 mg/ml), = an anti-VEGF aptamer such as pegaptanib (e.g., pegaptanib sodium), = a single chain (e.g., VL-VH) anti-VEGF antibody such as brolucizumab (e.g., at a concentration of about 200-400 or 200, 210, 400 or 420 mg/ml), = an anti-VEGF DARPin such as the Abicipar Pegol DARPin (e.g., at a concentration of about 70-140, 70 or 140 mg/ml), or Date Recue/Date Received 2023-02-22 = a bispecific anti-VEGF antibody, e.g., which also binds to ANG2, such as (faricimab) (e.g., at a concentration of about 100-400, 100, 105, 400 or 420 mg/ml).
antibody or antibody fragment or other VEGF binding molecule as discussed herein (e.g., substituted with an anti-VEGF DARPin) at any of the concentrations discussed herein. For example, the present invention includes a formulation having 35 or 80 mg/ml ranibizumab, a buffer, a thermal stabilizer, a viscosity reducing agent and a surfactant.
, Regeneron Pharmaceuticals, Inc.) or conbercept (sold commercially by Chengdu Kanghong Biotechnology Co., Ltd.). See International patent application publication no. W02005/121176 or W02007/112675. The terms "aflibercept" and "conbercept" include biosimilar versions thereof.
A biosimilar version of a reference product (e.g., aflibercept) generally refers to a product comprising the identical amino acid sequence, but includes products which are biosimilar under the U.S. Biologics Price Competition and Innovation Act.
Pharmaceutical Formulations
41 mg/ml; 42 mg/ml; 43 mg/ml; 44 mg/ml; 45 mg/ml; 46 mg/ml; 47 mg/ml; 48 mg/ml; 49 mg/ml; 50mg/m1; 51 mg/ml; 52 mg/ml; 53 mg/ml; 54 mg/ml; 55 mg/ml; 56 mg/ml; 57 mg/ml;
58 mg/ml; 59 mg/ml; 60 mg/ml; 61 mg/ml; 62 mg/ml; 63 mg/ml; 64 mg/ml; 65 mg/ml; 66 mg/ml; 67 mg/ml; 68 mg/ml; 69 mg/ml; 70 mg/ml; 71 mg/ml; 72 mg/ml; 73 mg/ml;
mg/ml; 75 mg/ml; 76 mg/ml; 77 mg/ml; 78 mg/ml; 79 mg/ml; 80 mg/ml; 81 mg/ml;
82mg/m1;
83 mg/ml; 84 mg/ml; 85 mg/ml; 86 mg/ml; 87mg/m1; 88 mg/ml; 89 mg/ml; 90 mg/ml;
mg/ml; 92 mg/ml; 93 mg/ml; 94 mg/ml; 95mg/m1; 96 mg/ml; 97 mg/ml; 98 mg/ml; 99 mg/ml;
100 mg/ml; 101 mg/ml; 102 mg/ml; 103 mg/ml; 104 mg/ml; 105 mg/ml; 106mg/m1;
mg/ml; 108 mg/ml; 109 mg/ml; 110 mg/ml; 111 mg/ml; 112 mg/ml; 113 mg/ml; 113.3 mg/ml;
114 mg/ml; 114.1 mg/ml; 114.2 mg/ml; 114.3 mg/ml; 114.4 mg/ml; 114.5 mg/ml;
114.6 mg/ml, 114.7 mg/ml, 114.8 mg/ml; 114.9 mg/ml; 115 mg/ml; 116 mg/ml; 117 mg/ml; 118 mg/ml; 119 mg/ml; 120 mg/ml; 121 mg/ml; 122 mg/ml; 123 mg/ml; 124 mg/ml; 125 mg/ml; 126 mg/ml;
127mg/m1; 128 mg/ml; 129 mg/ml; 130 mg/ml; 131 mg/ml; 132 mg/ml; 133 mg/ml;
133.3 mg/ml; 133.4 mg/ml, 134 mg/ml; 135 mg/ml; 136 mg/ml; 137 mg/ml; 138 mg/ml; 139 mg/ml;
Date Recue/Date Received 2023-02-22 140 mg/ml; 141 mg/ml; 142 mg/ml; 143 mg/ml; 144 mg/ml; 145 mg/ml; 146 mg/ml;
mg/ml; 148 mg/ml; 149 mg/ml; 150 mg/ml; 151 mg/ml; 152 mg/ml; 153 mg/ml;
154mg/m1;
155 mg/ml; 156 mg/ml; 157mg/m1; 158 mg/ml; 159 mg/ml; 160 mg/ml; 161 mg/ml;
mg/ml; 163 mg/ml; 164 mg/ml; 165 mg/ml; 166 mg/ml; 167 mg/ml; 168 mg/ml; 169 mg/ml;
170 mg/ml; 171 mg/ml; 172 mg/ml; 173 mg/ml; 174 mg/ml; 175 mg/ml; 176 mg/ml;
mg/ml; 178 mg/ml; 179 mg/ml; 180 mg/ml; 181 mg/ml; 182 mg/ml; 183 mg/ml; 184 mg/ml;
185 mg/ml; 186 mg/ml; 187 mg/ml; 188 mg/ml; 189 mg/ml; 190 mg/ml; 191 mg/ml;
mg/ml; 193 mg/ml; 194 mg/ml; 195 mg/ml; 196 mg/ml; 197 mg/ml; 198 mg/ml; 199 mg/ml;
200 mg/ml; 201 mg/ml; 202 mg/ml; 203 mg/ml; 204 mg/ml; 205 mg/ml; 206 mg/ml;
mg/ml; 208 mg/ml; 209 mg/ml; 210 mg/ml; 211 mg/ml; 212 mg/ml; 213 mg/ml; 214 mg/ml;
215 mg/ml; 216 mg/ml; 217 mg/ml; 218 mg/ml; 219 mg/ml; 220 mg/ml; 221 mg/ml;
mg/ml; 223 mg/ml; 224 mg/ml; 225 mg/ml; 226 mg/ml; 227 mg/ml; 228 mg/ml; 229 mg/ml;
230 mg/ml; 231 mg/ml; 232 mg/ml; 233 mg/ml; 234 mg/ml; 235 mg/ml; 236 mg/ml;
237mg/m1; 238 mg/ml; 239 mg/ml; 240 mg/ml; 241 mg/ml; 242 mg/ml; 243 mg/ml;
mg/ml; 245 mg/ml; 246 mg/ml; 247 mg/ml; 248 mg/ml; 249 mg/ml; 250 mg/ml; 251 mg/ml;
252 mg/ml; 253 mg/ml; 254 mg/ml; 255 mg/ml; 256 mg/ml; 257 mg/ml; 258 mg/ml;
mg/ml; 260 mg/ml; 261 mg/ml; 262 mg/ml; 263 mg/ml; 264 mg/ml; 265 mg/ml; 266 mg/ml;
267 mg/ml; 268 mg/ml; 269 mg/ml; 270 mg/ml; 271 mg/ml; 272 mg/ml; 273 mg/ml;
mg/ml; or 275 mg/ml. Other VEGF antagonist concentrations are contemplated herein, as long as the concentration functions in accordance with embodiments herein.
59 I; 60 I; 61 I; 62 I; 63 I; 64 I; 65 I; 66 I; 67 I; 68 I; 69 I;
70 I; 71 I; 72 I; 73 I; 74 I; 75 I; 76 I; 77 I; 78 I; 79 I; 80 I; 81 I; 82 I; 83 I; 84 I; 85 I; 86 I; 87 I; 88 I; 89 I;
90 I; 91 I; 92 I; 93 I; 94 I; 95 I; 96 I; 97 I; 98 I; 99 I; or 100 I.
inhibitors").
Date Recue/Date Received 2023-02-22 Buffers are capable of maintaining pH in the range of from about 5.0 to about 6.8, and more typically, from about 5.8 to about 6.5, and most typically, from about 6.0 to about 6.5. In some cases, the pH of the formulation of the present invention is about 5.0, about 5.1, about 5.2, about 5.3, about 5.4, about 5.5, about 5.6, about 5.7, about 5.8, about 5.9, about 6.0, about 6.1, about 6.2, about 6.3, about 6.4, about 6.5, about 6.6, about 6.7, or about 6.8. Example buffers for inclusion in formulations herein include histidine-based buffers, for example, histidine with histidine hydrochloride or histidine acetate. Buffers for inclusion in formulations herein can alternatively be phosphate-based buffers, for example, comprising sodium phosphate, acetate-based buffers, for example, comprising sodium acetate or acetic acid, or can be citrate-based, for example, comprising sodium citrate or citric acid. It is also recognized that buffers can be a mix of the above, as long as the buffer functions to buffer the formulations in the above-described pH ranges. In some cases, the buffer is from about 5 mM to about 25 mM, or more typically, about 5 mM to about 15 mM. Buffers can be about 5 mM, about 6 mM, about 7 mM, about 8 mM, about 9 mM, about 10 mM, about 11 mM, about 12 mM, about 13 mM, about 14 mM, about 15 mM, about 16 mM, about 17 mM, about 18 mM, about 19 mM, about 20 mM, about 21 mM, about 22 mM, about 23 mM, about 24 mM, or about 25 mM.
receptor fusion protein aggregation, and promote protein solubility. Suitable surfactants herein have been shown to be non-ionic, and can include surfactants that have a polyoxyethylene moiety.
Illustrative surfactants in this category include: polysorbate 20, polysorbate 80, poloxamer 188, polyethylene glycol 3350, and mixtures thereof. Surfactants in the formulations can be present at from about 0.02% to about 0.1% weight per volume (w/v), and more typically, about 0.02% to about 0.04% (w/v). In some cases, the surfactant is about 0.02% (w/v), about 0.03% (w/v), about 0.04% (w/v), about 0.05% (w/v), about 0.06% (w/v), about 0.07% (w/v), about 0.08%
(w/v), about 0.09% (w/v), or about 0.1% (w/v).
(w/v), or about 5% (w/v) to about 8% (w/v). Thermal stabilizers in the formulation can be at a concentration of about 2% (w/v), about 2.5% (w/v), about 3% (w/v), about 4%
(w/v), about 5%
(w/v), about 6% (w/v), about 7% (w/v), about 8% (w/v), about 9% (w/v), about 10% (w/v) or about 20% (w/v).
Viscosity reducing agents for inclusion herein include: sodium chloride, magnesium chloride, D-or L-arginine (e.g., L-arginine monohydrochloride), lysine, or mixtures thereof. When present herein, viscosity reducing agents can be present at from about 10 mM to about 100 mM, and more typically from about 30 mM to about 75 mM, and even more typically from about 40 mM to about 70 mM. In some cases, the viscosity reducing agent is present at about 10 mM, about 15 mM, about 20 mM, about 25 mM, about 30 mM, about 35 mM, about 40 mM, about 45 mM, about 50 mM, about 55 mM, about 60 mM, about 65 mM, about 70 mM, about 75 mM, about 80 mM, about 85 mM, about 90 mM, about 95 mM or about 100 mM.
Typically, high concentration protein solutions require viscosity reducing agents to avoid protein aggregation and higher viscosity, making the formulations difficult for intravitreal injection and reducing the potency of the VEGF receptor fusion protein. As such, embodiments herein include methods of using formulations that have had substantially no, or no added, sodium chloride (NaCI), magnesium chloride (MgCl2), D- or L-arginine (e.g., D- or L- arginine hydrochloride), lysine or other viscosity reducing agent.
Formulation A: 80 mg/ml aflibercept, 10 mM histidine-based buffer, 5 % (w/v) sucrose, 0.03%
(w/v) polysorbate 20, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Formulation B: 80 mg/ml aflibercept, 10 mM phosphate-based buffer, 5 % (w/v) sucrose, 0.03%
(w/v) polysorbate 20, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Formulation C: 80 mg/ml aflibercept, 10 mM citrate-based buffer, 5 % (w/v) sucrose, 0.03%
(w/v) polysorbate 20, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Formulation D: 80 mg/ml aflibercept, 10 mM histidine-based buffer, 5 % (w/v) sucrose, 0.03 %
(w/v) polysorbate 80, and 40 mM sodium chloride, with a pH of 6.2.
Formulation E: 80 mg/ml aflibercept, 10 mM phosphate-based buffer, 5 % (w/v) sucrose, 0.03 % (w/v) polysorbate 80, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Date Recue/Date Received 2023-02-22 Formulation F: 80 mg/ml aflibercept, 10 mM citrate-based buffer, 5 % (w/v) sucrose, 0.03 %
(w/v) polysorbate 80, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Formulation G: 80 mg/ml aflibercept, 10 mM histidine-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 20, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation H: 80 mg/ml aflibercept, 10 mM phosphate-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 20, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation 1: 80 mg/ml aflibercept, 10 mM citrate-based buffer, 8 % (w/v) sucrose, and 0.0 3%
(w/v) polysorbate 20, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation J: 80 mg/ml aflibercept, 10 mM histidine-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 80, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation K: 80 mg/ml aflibercept, 10 mM phosphate-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 80, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation L: 80 mg/ml aflibercept, 10 mM citrate-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 80, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation M: 150 mg/ml aflibercept, 10 mM histidine-based buffer, 5 % (w/v) sucrose, 0.03 %
(w/v) polysorbate 20, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Formulation N: 150 mg/ml aflibercept, 10 mM phosphate-based buffer, 5 % (w/v) sucrose, 0.03 % (w/v) polysorbate 20, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Formulation 0: 150 mg/ml aflibercept, 10 mM citrate-based buffer, 5 % (w/v) sucrose, 0.03 %
(w/v) polysorbate 20, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Formulation P: 150 mg/ml aflibercept, 10 mM histidine-based buffer, 5 % (w/v) sucrose, 0.03%
(w/v) polysorbate 80, and 40 mM sodium chloride, with a pH of 6.2.
Formulation Q: 150 mg/ml aflibercept, 10 mM phosphate-based buffer, 5 % (w/v) sucrose, 0.03 % (w/v) polysorbate 80, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Formulation R: 150 mg/ml aflibercept, 10 mM citrate-based buffer, 5 % (w/v) sucrose, 0.03 %
(w/v) polysorbate 80, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Date Recue/Date Received 2023-02-22 Formulation S: 150 mg/ml aflibercept, 10 mM histidine-based buffer, 8% (w/v) sucrose, and 0.03 % (w/v) polysorbate 20, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation T: 150 mg/ml aflibercept, 10 mM phosphate-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 20, with a pH of 5.8 to 6.2 (e.g., 6.2), and, optionally, specifically excluding a viscosity reducing agent.
Formulation U: 150 mg/ml aflibercept, 10 mM citrate-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 20, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation V: 150 mg/ml aflibercept, 10 mM histidine-based buffer, 8% (w/v) sucrose, and 0.03 % (w/v) polysorbate 80, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation W: 150 mg/ml aflibercept, 10 mM phosphate-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 80, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation X: 150 mg/ml aflibercept, 10 mM citrate-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 80, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation Y: 80 mg/ml conbercept, 10 mM histidine-based buffer, 5 % (w/v) sucrose, 0.03 %
(w/v) polysorbate 20, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Formulation Z: 80 mg/ml conbercept, 10 mM phosphate-based buffer, 5 % (w/v) sucrose, 0.03 % (w/v) polysorbate 20, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Formulation AA: 80 mg/ml conbercept, 10 mM citrate-based buffer, 5 % (w/v) sucrose, 0.03 %
(w/v) polysorbate 20, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Formulation BB: 80 mg/ml conbercept, 10 mM histidine-based buffer, 5 % (w/v) sucrose, 0.03 % (w/v) polysorbate 80, and 40 mM sodium chloride, with a pH of 6.2.
Formulation CC: 80 mg/ml conbercept, 10 mM phosphate-based buffer, 5 % (w/v) sucrose, 0.03 % (w/v) polysorbate 80, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Formulation DD: 80 mg/ml conbercept, 10 mM citrate-based buffer, 5 % (w/v) sucrose, 0.03 %
(w/v) polysorbate 80, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Formulation EE: 80 mg/ml conbercept, 10 mM histidine-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 20, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Date Recue/Date Received 2023-02-22 Formulation FF: 80 mg/ml conbercept, 10 mM phosphate-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 20, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation GG: 80 mg/ml conbercept, 10 mM citrate-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 20, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation HH: 80 mg/ml conbercept, 10 mM histidine-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 80, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation II: 80 mg/ml conbercept, 10 mM phosphate-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 80, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation JJ: 80 mg/ml conbercept, 10 mM citrate-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 80, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation KK: 150 mg/ml conbercept, 10 mM histidine-based buffer, 5 % (w/v) sucrose, 0.03 % (w/v) polysorbate 20, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Formulation LL: 150 mg/ml conbercept, 10 mM phosphate-based buffer, 5 % (w/v) sucrose, 0.03 % (w/v) polysorbate 20, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Formulation MM: 150 mg/ml conbercept, 10 mM citrate-based buffer, 5 % (w/v) sucrose, 0.03 % (w/v) polysorbate 20, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Formulation NN: 150 mg/ml conbercept, 10 mM histidine-based buffer, 5 % (w/v) sucrose, 0.03 % (w/v) polysorbate 80, and 40 mM sodium chloride, with a pH of 6.2.
Formulation 00: 150 mg/ml conbercept, 10 mM phosphate-based buffer, 5 % (w/v) sucrose, 0.03 % (w/v) polysorbate 80, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Formulation PP: 150 mg/ml conbercept, 10 mM citrate-based buffer, 5 % (w/v) sucrose, 0.03 %
(w/v) polysorbate 80, and 40 mM sodium chloride, with a pH of 5.8 to 6.2.
Formulation QQ: 150 mg/ml conbercept, 10 mM histidine-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 20, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation RR: 150 mg/ml conbercept, 10 mM phosphate-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 20, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Date Recue/Date Received 2023-02-22 Formulation SS: 150 mg/ml conbercept, 10 mM citrate-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 20, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation TT: 150 mg/ml conbercept, 10 mM histidine-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 80, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation UU: 150 mg/ml conbercept, 10 mM phosphate-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 80, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation VV: 150 mg/ml conbercept, 10 mM citrate-based buffer, 8 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 80, with a pH of 5.8 to 6.2, and, optionally, specifically excluding a viscosity reducing agent.
Formulation WW: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 10 mM histidine-based buffer, 5 % (w/v) sucrose, 0.03 % (w/v) polysorbate 20, and 50 mM
taurine, with a pH of 5.8.
Formulation XX: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 20 mM histidine-based buffer, 4 % (w/v) proline, 0.03 % (w/v) polysorbate 20, and 50 mM
arginine (e.g., arginine hydrochloride), with a pH of 5.8.
Formulation YY: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 20 mM histidine-based buffer, 2.5 % (w/v) sucrose, 2.0 % (w/v) proline, 0.03 % (w/v) polysorbate 20, and 50 mM
taurine, with a pH of 5.8.
Formulation ZZ: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 10 mM histidine-based buffer, 2.5 % (w/v) sucrose, 2.0 % (w/v) proline, 0.03 % (w/v) polysorbate 20, and 50 mM
arginine (e.g., arginine hydrochloride), with a pH of 5.8.
Formulation AAA: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 20 mM histidine-based buffer, 5 % (w/v) sucrose, 0.03% (w/v) polysorbate 20, and 50 mM PSA, with a pH of 5.8.
Formulation BBB: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 20 mM histidine-based buffer, 2.5 % (w/v) sucrose, 2.0 % (w/v) proline, 0.03 % (w/v) polysorbate 20, and 50 mM
PSA, with a pH of 5.8.
Formulation CCC: 80, 100, 120 or 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 20 mM histidine-based buffer, 5 % (w/v) sucrose, 0.03 % (w/v) polysorbate 20, and 50 mM
arginine (e.g., arginine hydrochloride), with a pH of 5.8.
Formulation DDD: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 10 mM histidine-based buffer, 4 % (w/v) proline, 0.03 % (w/v) polysorbate 20, and 50 mM PSA, with a pH of 5.8.
Date Recue/Date Received 2023-02-22 Formulation EEE: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 20 mM histidine-based buffer, 5 % (w/v) sucrose, and 0.03 % (w/v) polysorbate 20 and, optionally, no thermal stabilizer, with a pH of 5.8.
Formulation FFF: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 10mM sodium phosphate, 5 % (w/v) sucrose and 0.03 % polysorbate 20 with a pH of 6.2.
Formulation GGG: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept);
20 mM histidine, pH 5.8; 5% sucrose; 0.03 % polysorbate 20; 50 mM sodium sulfate Formulation HHH: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept);
20 mM histidine, pH 5.8; 5% sucrose; 0.03 % polysorbate 20; 50 mM sodium thiocyanate Formulation III: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept);
20 mM histidine, pH
5.8; 5 % sucrose, 0.03 % polysorbate 20; 40 mM sodium citrate Formulation JJJ: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept);
20 mM histidine, pH 5.8; 5% Sucrose, 0.03 % polysorbate 20; 50 mM glycine Formulation KKK: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept);
20 mM histidine, pH 5.8; 5 % sucrose, 0.03 % polysorbate 20; 50 mM sodium chloride Formulation LLL: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept);
20 mM histidine, pH 5.8; 5 % sucrose; 0.03 % polysorbate 20; 50 mM lysine Formulation MMM: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept);
20 mM histidine, pH 5.8; 5 % sucrose; 0.03% polysorbate 20; 50 mM sodium aspartate Formulation NNN: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept);
20 mM histidine, pH 5.8; 5 % sucrose; 0.03 % polysorbate 20; 50 mM sodium glutamate Formulation 000: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept);
20 mM histidine, pH 5.8; 5 % sucrose; 0.03% polysorbate 20; 50 mM sodium citrate; 50 mM
arginine (e.g., arginine hydrochloride) Formulation PPP: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept);
20 mM histidine, pH 5.8; 5 % sucrose; 0.03% polysorbate 20; 50 mM glycine; 50 mM arginine (e.g., arginine hydrochloride) Formulation QQQ: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept);
20 mM histidine, pH 5.8; 5 % sucrose; 0.03% polysorbate 20; 50 mM sodium aspartate; 50 mM
arginine (e.g., arginine hydrochloride) Formulation RRR: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept);
20 mM histidine, pH 5.8; 5 % sucrose; 0.03% polysorbate 20; 50 mM sodium glutamate; 50 mM
arginine (e.g., arginine hydrochloride) Date Recue/Date Received 2023-02-22 Formulation SSS: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept);
20 mM His, pH
5.8; 5 % sucrose; 0.03 % polysorbate 20; 10 mM L-arginine (L-arginine hydrochloride) Formulation TTT: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept);
20 mM His, pH
5.8; 5 % sucrose; 0.03 % polysorbate 20; 100 L-arginine (L-arginine hydrochloride) Formulation UUU: 30 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 10% sucrose, 10 mM phosphate, 0.03 % polysorbate 20, pH 6.2 Formulation VVV: 30 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 20 % sucrose, 10 mM phosphate, 0.03 % polysorbate 20, pH 6.2 Formulation VVVVVV: 60 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 10 % sucrose, 10 mM phosphate, 0.03 % polysorbate 20, pH 6.2 Formulation XXX: 60 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 20 % sucrose, 10 mM phosphate, 0.03 % polysorbate 20, pH 6.2 Formulation YYY: 120 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 10% sucrose, 10 mM phosphate, 0.03 % polysorbate 20, pH 6.2 Formulation ZZZ: 120 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 20 % sucrose, 10 mM phosphate, 0.03 % polysorbate 20, pH 6.2 Formulation AAAA: 120 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 10 % sucrose, mM phosphate, 0.03 % polysorbate 20, 50 mM NaCI, pH 6.2 Formulation BBBB: 120 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 20 % sucrose, 10 mM phosphate, 0.03 % polysorbate 20, 50 mM NaCI, pH 6.2 Formulation CCCC: 140 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 10 mM sodium phosphate, 5 % sucrose, 40 mM sodium chloride, 0.03 % PS20, pH 6.2 Formulation DDDD: 80 mg/ml VEGF receptor fusion protein (e.g., aflibercept), 20 mM histidine-based buffer, 5 % (w/v) sucrose, 0.03 % (w/v) polysorbate 20, and 50 mM L-arginine (L-arginine monohydrochloride), with a pH of 5.8.
Formulation EEEE: 120.0 mg/ml VEGF receptor fusion protein (e.g., aflibercept) (e.g., + 12 mg/ml), 20 mM histidine-based buffer (e.g., + 2 mM), 5 % (w/v) sucrose (e.g., + 0.5%), 0.03 %
(w/v) polysorbate 20 (e.g., 0.02-0.04%), and 50 mM L-arginine (L-arginine monohydrochloride) (e.g., + 5 mM), with a pH of 5.8 (e.g., 5.6-6.0 or 5.5-6.1).
Formulation FFFF: 113.3 mg/ml VEGF receptor fusion protein (e.g., aflibercept) (e.g., 102-125 mg/ml), 20 mM histidine-based buffer (e.g., + 2 mM), 5 % (w/v) sucrose (e.g., + 0.5%), 0.03 %
(w/v) polysorbate 20 (e.g., 0.02-0.04%), and 50 mM L-arginine (L-arginine monohydrochloride) (e.g., + 5 mM), with a pH of 5.8 (e.g., 5.6-6.0 or 5.5-6.1).
Date Recue/Date Received 2023-02-22 Formulation GGGG: 114.3 mg/ml VEGF receptor fusion protein (e.g., aflibercept) (e.g., 103-126 mg/ml), 10 mM histidine-based buffer (e.g., + 1 mM), 5 % (w/v) sucrose (e.g., + 0.5%), 0.03 %
(w/v) polysorbate 20 (e.g., 0.02-0.04%), and 50 mM L-arginine (e.g., L-arginine monohydrochloride) (e.g., + 5 mM), with a pH of 5.8 (e.g., 5.6-6.0 or 5.5-6.1).
Formulation HHHH: 100.0 mg/ml VEGF receptor fusion protein (e.g., aflibercept) (e.g., + 10 mg/ml), 20 mM histidine-based buffer (e.g., + 2 mM), 5 % (w/v) sucrose (e.g., + 0.5%), 0.03 %
(w/v) polysorbate 20 (e.g., 0.02-0.04%), and 50 mM L-arginine (L-arginine monohydrochloride) (e.g., + 5 mM), with a pH of 5.8 (e.g., 5.6-6.0 or 5.5-6.1).
Formulation 1111: 133.3 mg/ml VEGF receptor fusion protein (e.g., aflibercept) (e.g., + 13 mg/ml), 20 mM histidine-based buffer (e.g., + 2 mM), 5 % (w/v) sucrose (e.g., + 0.5%), 0.03 % (w/v) polysorbate 20 (e.g., 0.02-0.04%), and 50 mM L-arginine (L-arginine monohydrochloride) (e.g., + 5 mM), with a pH of 5.8 (e.g., 5.6-6.0 or 5.5-6.1).
_ Formulation JJJJ: 150 mg/ml aflibercept (e.g., aflibercept) (e.g., + 15 mg/ml), 10 mM sodium phosphate, 8% (w/v) sucrose (e.g., + 0.8%), 0.03% (w/v) polysorbate 20 (e.g., 0.02-0.04%) and 50 mM L-arginine (L-arginine hydrochloride), pH 6.2 (e.g., 6.0-6.4 or 5.9-6.5).
Formulation KKKK: 114.3 mg/ml VEGF receptor fusion protein (e.g., aflibercept) (e.g., + 14 mg/ml), 20 mM histidine-based buffer (e.g., + 2 mM), 5% (w/v) sucrose (e.g., +
0.5%), 0.03%
(w/v) polysorbate 20 (e.g., 0.02-0.04%), and 50 mM L-arginine (L-arginine monohydrochloride) (e.g., + 5 mM), with a pH of 5.8 (e.g., 5.6-6.0 or 5.5-6.1);
surfactant; wherein the formulation has a pH of about 5.0 to about 6.8 (e.g., 5.8 to 6.5, for example 5.8). Preferably the formulation is suitable for intravitreal administration. Other components that may be included are sodium sulfate, sodium thiocyanate, glycine, NaCI, sodium aspartate and/or sodium glutamate. In an embodiment of the invention, the VEGF receptor fusion protein is at a concentration of: about 100 mg/ml; about 111.5 mg/ml; about 112.0 mg/ml; about 113.3 mg/ml;
about 114.3 mg/ml; about 115.6 mg/ml; about 116.3 mg/ml; about 120 mg/ml;
about 133 mg/ml;
about 140 mg/ml; about 150 mg/ml; about 200 mg/ml; or about 250 mg/ml. The formulation Date Recue/Date Received 2023-02-22 may be characterized by (i) an osmolality of about 299 to about 506 mmol/Kg;
and/or (ii) a viscosity of from about 6-15 cP at 20 C. The surfactant may be a non-ionic surfactant such as polysorbate 20, polysorbate 80, poloxamer 188, polyethylene glycol 3350 or mixtures thereof.
The histidine-based buffer may be at a concentration of about 10 mM to 20 mM.
In an embodiment of the invention, the VEGF receptor fusion protein has less than about 3.5% high molecular weight species immediately after manufacture and purification and/or less than or equal to about 6% high molecular weight species after storage for about 24 months at about 2-8 C.
wherein the formulation has a pH of about 5.0 to about 6.8; wherein the VEGF
receptor fusion protein has less than about 3.5% high molecular weight species immediately after manufacture and purification and/or less than or equal to about 6% high molecular weight species after storage for about 24 months at about 2-8 C.
= > about 100 mg/ml VEGF receptor fusion protein (e.g., aflibercept), histidine-based buffer and L-arginine;
= about 140 mg/ml aflibercept; 20 mM histidine-based buffer; 5% sucrose;
0.03%
polysorbate 20; 10 mM L-arginine; pH 5.8;
= about 150 + 15 mg/ml aflibercept, 10 mM phosphate-based buffer, 8 + 0.8%
(w/v) sucrose, 0.02-0.04% (w/v) polysorbate 20 and 50 mM L-arginine, pH 5.9-6.5;
= about 103-126 mg/ml aflibercept, 10 + 1 mM histidine-based buffer, 5 +
0.5% (w/v) sucrose, 0.02-0.04% (w/v) polysorbate 20, and 50 + 5 mM L-arginine, pH 5.5-6.1;
= about 140 mg/ml aflibercept, 10 mM histidine-based buffer, 2.5 % (w/v) sucrose, 2.0 %
(w/v) proline, 0.03 % (w/v) polysorbate 20 and 50 mM L-arginine, pH 5.8;
= about 114.3 mg/ml aflibercept, 10 mM histidine-based buffer, 5% (w/v) sucrose, 0.03%
(w/v) polysorbate 20 and 50 mM L-arginine, pH 5.8;
= >about 100 mg/ml aflibercept, histidine-based buffer and L-arginine;
= >about 100 mg/ml aflibercept at about pH 5.8, wherein the formulation forms <3% HMW
aggregates after incubation at 5 C for 2 months;
Date Recue/Date Received 2023-02-22 = about 114.3 mg/mL aflibercept; 10 mM ¨ 50 mM histidine-based buffer, sugar, non-ionic surfactant, L-Arginine, pH 5.8;
or = about 114.3 mg/mL aflibercept; 10 mM His/His-HCI-based buffer, 5%
sucrose, 0.03%
polysorbate-20, 50 mM L-Arginine, pH 5.8.
a thermal stabilizer which is a sugar, an amino acid, sucrose, mannitol, sorbitol, trehalose, L-proline, glycine, glycerol, taurine or propane sulfonic acid (e.g., at about 2% (w/v) to about 10%
(w/v), for example, 5% (w/v));
a buffer which is a histidine-based buffer, a phosphate-based buffer, an acetate-based buffer (e.g., at a concentration of about 5-25 mM, e.g., 10 mM or 20 mM); or a citrate-based buffer;
a non-ionic surfactant, such as for example, polyoxyethylene-based, polysorbate 20, polysorbate 80, poloxamer 188 or polyethylene glycol 3350 (e.g., at a concentration of about 0.02% to about 0.1 % (w/v), e.g., 0.03% (w/v)); and a viscosity reducing agent which is NaCI, MgC12, D-arginine, L-arginine or lysine (e.g., at a concentration of about 10-100 mM, e.g., 50 mM), wherein the formulation has a pH of about 5.0 to about 6.8 (e.g., 5.0-6.0 or 5.8).
105 mg/ml; 106 mg/ml; 107 mg/ml; 108 mg/ml; 109 mg/ml; 110 mg/ml; 111 mg/ml;
112 mg/ml;
113 mg/ml; 113.3 mg/ml; 114 mg/ml; 114.1 mg/ml; 114.2 mg/ml; 114.3 mg/ml;
114.4 mg/ml;
114.5 mg/ml; 114.6 mg/ml, 114.7 mg/ml, 114.8 mg/ml; 114.9 mg/ml; 115 mg/ml;
116 mg/ml; 117 mg/ml; 118 mg/ml; 119 mg/ml; 120 mg/ml; 121 mg/ml; 122 mg/ml; 123 mg/ml; 124 mg/ml; 125 mg/ml; 126 mg/ml; 127mg/m1; 128 mg/ml; 129 mg/ml; 130 mg/ml; 131 mg/ml; 132 mg/ml; 133 mg/ml; 133.3 mg/ml; 133.4 mg/ml, 134 mg/ml; 135 mg/ml; 136 mg/ml; 137 mg/ml;
138 mg/ml;
139 mg/ml; 140 mg/ml; 141 mg/ml; 142 mg/ml; 143 mg/ml; 144 mg/ml; 145 mg/ml;
146 mg/ml;
147 mg/ml; 148 mg/ml; 149 mg/ml; 150 mg/ml; 151 mg/ml; 152 mg/ml; 153 mg/ml;
154mg/m1;
155 mg/ml; 156 mg/ml; 157mg/m1; 158 mg/ml; 159 mg/ml; 160 mg/ml; 161 mg/ml;
162 mg/ml;
163 mg/ml; 164 mg/ml; 165 mg/ml; 166 mg/ml; 167 mg/ml; 168 mg/ml; 169 mg/ml;
170 mg/ml;
171 mg/ml; 172 mg/ml; 173 mg/ml; 174 mg/ml; 175 mg/ml; 176 mg/ml; 177 mg/ml;
178 mg/ml;
Date Recue/Date Received 2023-02-22 179 mg/ml; 180 mg/ml; 181 mg/ml; 182 mg/ml; 183 mg/ml; 184 mg/ml; 185 mg/ml;
186 mg/ml;
187 mg/ml; 188 mg/ml; 189 mg/ml; 190 mg/ml; 191 mg/ml; 192 mg/ml; 193 mg/ml;
194 mg/ml;
195 mg/ml; 196 mg/ml; 197 mg/ml; 198 mg/ml; 199 mg/ml; 200 mg/ml; 201 mg/ml;
202 mg/ml;
203 mg/ml; 204 mg/ml; 205 mg/ml; 206 mg/ml; 207 mg/ml; 208 mg/ml; 209 mg/ml;
210 mg/ml;
211 mg/ml; 212 mg/ml; 213 mg/ml; 214 mg/ml; 215 mg/ml; 216 mg/ml; 217 mg/ml;
218 mg/ml;
219 mg/ml; 220 mg/ml; 221 mg/ml; 222 mg/ml; 223 mg/ml; 224 mg/ml; 225 mg/ml;
226 mg/ml;
227 mg/ml; 228 mg/ml; 229 mg/ml; 230 mg/ml; 231 mg/ml; 232 mg/ml; 233 mg/ml;
234 mg/ml;
235 mg/ml; 236 mg/ml; 237mg/m1; 238 mg/ml; 239 mg/ml; 240 mg/ml; 241 mg/ml;
242 mg/ml;
243 mg/ml; 244 mg/ml; 245 mg/ml; 246 mg/ml; 247 mg/ml; 248 mg/ml; 249 mg/ml;
250 mg/ml;
251 mg/ml; 252 mg/ml; 253 mg/ml; 254 mg/ml; 255 mg/ml; 256 mg/ml; 257 mg/ml;
258 mg/ml;
259 mg/ml; 260 mg/ml; 261 mg/ml; 262 mg/ml; 263 mg/ml; 264 mg/ml; 265 mg/ml;
266 mg/ml;
267 mg/ml; 268 mg/ml; 269 mg/ml; 270 mg/ml; 271 mg/ml; 272 mg/ml; 273 mg/ml;
274 mg/ml;
or 275 mg/ml.
a histidine-based buffer; polysorbate 20 or polysorbate 80; and L-arginine, at a pH of about 5.0 to about 6.8; wherein the aflibercept has less than about 3.5% high molecular weight species immediately after manufacture and purification and/or less than or equal to about 6% high molecular weight species after storage for about 24 months at about 2-8 C.
the polysorbate 20 or polysorbate 80 is at a concentration of about 0.02-0.1%
(w/v); and the histidine-based buffer is at a concentration of about 5-25 mM; at a pH of about 5.0 to about 6.8.
Treatment and Administration
receptor fusion protein such as aflibercept) (e.g., about every 2-4 or 3-5 weeks) followed by additional doses every 12-20 weeks, preferably 12-16 weeks, 12 weeks, 16 weeks or 20 weeks.
For example, the present invention provides methods for treating or preventing angiogenic eye disorders, such as neovascular age related macular degeneration (nAMD), by administering, sequentially, one or more (e.g., 3 or 4 or 5) doses of about 8 mg or more of VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept) about every 2-4 or 3-5 weeks, e.g., Date Recue/Date Received 2023-02-22 every month (or about every 28 days, 28 + 5 days or about every 4 weeks), followed by one or more doses of about 8 mg or more VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept) every 12 weeks (or about every 3 months or about every quarter year or about every 84 days) or every 16 weeks (or about every 4 months or about every 1/3 years or about every 112 days) or every 20 weeks. The dosing regimen including the 12 week tertiary dosing interval may be referred to herein as a 12 week dosing regimen or 8q12 or HDq12; the dosing regimen including the 16 week tertiary dosing interval may be referred to herein as a 16 week dosing regimen or 8q16 or HDq16; and the dosing regimen including the 20 week tertiary dosing interval may be referred to herein as a 20 week dosing regimen or 8q20 or HDq20. A dosing regimen including tertiary dosing intervals of between 12 and 20 weeks may be referred to herein as a 12-20 week dosing regimen or 8q12-20 or HDq12-20.
refer to the temporal sequence of administration of the VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept). Thus, the "initial dose" is the dose which is administered at the beginning of the treatment regimen (also referred to as the "baseline dose"); the "secondary doses" are the doses which are administered after the initial dose; and the "tertiary doses"
are the doses which are administered after the secondary doses. The initial, secondary, and tertiary doses may all contain the same amount of VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept), but will generally differ from one another in terms of frequency of administration. In certain embodiments, however, the amount of VEGF antagonist (e.g., a VEGF
receptor fusion protein such as aflibercept) contained in the initial, secondary and/or tertiary doses will vary from one another (e.g., adjusted up or down as appropriate) during the course of treatment.
Thus, a dosing regimen of the present invention may be expressed as follows:
a method for treating an angiogenic eye disorder (e.g., nAMD) in a subject in need thereof including administering to a subject in need thereof:
a single initial dose of about >8 mg (in about 100 I or less, about 75 I or less or about 70 I or less, e.g., about 50 I; 51 I; 52 I; 53 I; 54 I; 55 I; 56 I; 57 I; 58 I; 59 I; 60 I; 61 I; 62 I; 63 I; 64 I; 65 I; 66 I; 67 I; 68 I; 69 I; 70 I; 71 I; 72 I; 73 I; 74 I; 75 I; 76 I; 77 I;
78 I; 79 I; 80 I; 81 I; 82 I; 83 I; 84 I; 85 I; 86 I; 87 I; 88 I;
89 I; 90 I; 91 I; 92 I; 93 Date Recue/Date Received 2023-02-22 I; 94 I; 95 I; 96 I; 97 I; 98 I; 99 I; or 100 I.) of a VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept), followed by one or more (e.g., 2, or 3 or 4, preferably 2) secondary doses of the VEGF
antagonist (e.g., a VEGF receptor fusion protein such as aflibercept), followed by one or more tertiary doses of the VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept);
wherein each secondary dose is administered 2 to 4 weeks (preferably 4 weeks) after the immediately preceding dose; and wherein each tertiary dose is administered at least 12 or 16 or 20 weeks (preferably 12-20, 12-16, 12 or 16 weeks) after the immediately preceding dose.
51 I; 52 I; 53 I; 54 I; 55 I; 56 I; 57 I; 58 I; 59 I; 60 I; 61 I;
62 I; 63 I; 64 I; 65 I; 66 I; 67 I; 68 I; 69 I; 70 I; 71 I; 72 I; 73 I; 74 I; 75 I; 76 I; 77 I; 78 I; 79 I; 80 I; 81 I;
82 I; 83 I; 84 I; 85 I; 86 I; 87 I; 88 I; 89 I; 90 I; 91 I; 92 I;
93 I; 94 I; 95 I; 96 I; 97 I; 98 I; 99 I; or 100 I) of VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept) on a PRN basis.
the current clinical status only has an impact on the duration of the next injection interval.
Date Recue/Date Received 2023-02-22
or less or about 70 ti, I or less, e.g., about 50 til; 51 til; 52 til; 53 til; 54 til; 55 til; 56 til; 57 til; 58 til; 59 til; 60 til; 61 til; 62 til; 63 til; 64 til; 65 til; 66 til; 67 til; 68 til; 69 til; 70 til; 71 til;
72 til; 73 til; 74 til; 75 til; 76 til; 77 til;
78 til; 79 til; 80 til; 81 til; 82 til; 83 til; 84 til; 85 til; 86 til; 87 til; 88 til; 89 til; 90 til; 91 til; 92 til; 93 til; 94 til; 95 til; 96 til; 97 til; 98 til; 99 til; or 100 pi) about once every 4, 5, 6, 7, 8, 12, 16 0r20 weeks;
or a single initial dose (e.g., about >8 mg, for example, in about 100 ti, I or less, about 75 ti, I or less or about 70 ti, I or less, e.g., about 50 til; 51 til; 52 til; 53 til; 54 til;
55 til; 56 til; 57 til; 58 til; 59 til;
60 til; 61 til; 62 til; 63 til; 64 til; 65 til; 66 til; 67 til; 68 til; 69 til; 70 til; 71 til; 72 til; 73 til; 74 til; 75 til; 76 til; 77 til; 78 til; 79 til; 80 til; 81 til; 82 til; 83 til; 84 til;
85 til; 86 til; 87 til; 88 til; 89 til; 90 til;
91 til; 92 til; 93 til; 94 til; 95 til; 96 til; 97 til; 98 til; 99 til; or 100 pi)) of a VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept), followed by one or more (e.g., 2, or 3 or 4, preferably 2 or 4) secondary doses of the VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept), followed by one or more tertiary doses of the VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept);
wherein each secondary dose is administered 2 to 4 (preferably, 4) weeks after the immediately preceding dose; and wherein each tertiary dose is administered at about 4, 5, 6, 7 or 8 (e.g., 8) weeks after the immediately preceding dose or about >8 mg (for example, in about 100 ti, I or less, about 75 ti, I or less or about 70 ti, I or less, e.g., about 50 til; 51 til; 52 til; 53 til; 54 til; 55 til; 56 til; 57 til; 58 til; 59 til; 60 til; 61 til; 62 til; 63 til; 64 til; 65 til; 66 til; 67 til; 68 til; 69 til; 70 til; 71 til; 72 til;
73 til; 74 til; 75 til; 76 til; 77 til; 78 til;
79 til; 80 til; 81 til; 82 til; 83 til; 84 til; 85 til; 86 til; 87 til; 88 til; 89 til; 90 til; 91 til; 92 til; 93 til; 94 til; 95 til; 96 til; 97 til; 98 til; 99 til; or 100 til) of VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept) once every about 4 weeks (q4w);
or Date Recue/Date Received 2023-02-22 less than about 8 doses (e.g., about 5 doses or 6 doses) of about >8 mg (for example, in about 100 I or less, about 75 I or less or about 70 I or less, e.g., about 50 I;
51 I; 52 I; 53 I; 54 I; 55 I; 56 I; 57 I; 58 I; 59 I; 60 I; 61 I; 62 I; 63 I; 64 I; 65 I; 66 I; 67 I; 68 I; 69 I;
70 I; 71 I; 72 I; 73 I; 74 I; 75 I; 76 I; 77 I; 78 I; 79 I; 80 I;
81 I; 82 I; 83 I; 84 I; 85 I; 86 I; 87 I; 88 I; 89 I; 90 I; 91 I; 92 I; 93 I; 94 I; 95 I; 96 I; 97 I; 98 I; 99 I; or 100 I) of a VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept) over the course of about 48 weeks.
days), 3 weeks (+ 5 days) or 4 weeks (+ 5 days).
5 days), about 12 weeks (+ 5 days), about 16 weeks (+ 5 days) or about 20 weeks (+ 5 days).
Date Recue/Date Received 2023-02-22
receptor fusion protein such as aflibercept) is administered to the eye of a subject at a different point in time, e.g., on different days separated by a predetermined interval (e.g., hours, days, weeks or months). The present invention includes methods which comprise sequentially administering to the eye of a subject a single initial dose of a VEGF
antagonist (e.g., a VEGF
receptor fusion protein such as aflibercept), followed by one or more secondary doses of the VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept), followed by one or more tertiary doses of the VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept).
receptor fusion protein such as aflibercept) for treating or preventing an angiogenic eye disorder refers to the amount of VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept) sufficient to alleviate one or more signs and/or symptoms of the disease or condition in the treated subject, whether by inducing the regression or elimination of such signs and/or symptoms or by inhibiting the progression of such signs and/or symptoms. In an embodiment of the invention, an effective or therapeutically effective dose of VEGF
antagonist (e.g., a VEGF
receptor fusion protein such as aflibercept) is about >8 mg every month, for 3 doses, followed by once every 12-20 weeks. In an embodiment of the invention, the alleviation of signs and/or symptoms is achievement, e.g., by 1 year, of a gain of 5, 10 or 15 letters BCVA (relative to baseline) (e.g., >5 letters improvement in a nAMD subject and/or 8-14 letters improvement in a DME patient/subject); achieving a BCVA 69 letters; achieving no fluid at foveal center;
reduction in central retinal thickness (CRT) by about 150 micrometers or more (e.g., below 300 micrometers in an nAMD subject/patient; and/or reduction by at least about 200 micrometers in a DR or RVO patient/subject) or achievement of normal CRT (e.g., about 300 micrometers or less); and/or achievement of no leakage on fluorescein angiography.
= age-related macular degeneration (neovascular (nAMD)), = macular edema (ME), = macular edema following retinal vein occlusion (ME-RVO), = retinal vein occlusion (RVO), = central retinal vein occlusion (CRVO), Date Recue/Date Received 2023-02-22 = branch retinal vein occlusion (BRVO), = diabetic macular edema (DME), = choroidal neovascularization (CNV), = iris neovascularization, = neovascular glaucoma, = post-surgical fibrosis in glaucoma, = proliferative vitreoretinopathy (PVR), = optic disc neovascularization, = corneal neovascularization, = retinal neovascularization, = vitreal neovascularization, = pannus, = polypoidal choroidal vasculopathy (PCV), optionally, wherein the subject also has nAMD, = pterygium, = vascular retinopathy, = diabetic retinopathies (DR) (e.g., non-proliferative diabetic retinopathy (e.g., characterized by a Diabetic Retinopathy Severity Scale (DRSS) level of about 47 or 53) or proliferative diabetic retinopathy; e.g., in a subject that does not suffer from DME), and = Diabetic retinopathy in a subject who has diabetic macular edema (DME).
= Increase in BCVA, e.g., as measured by the Early Treatment Diabetic Retinopathy Study (ETDRS) visual acuity chart (e.g., by week 12, 24, 36, 48, 60 or 96), for example, by >5, >10, >15, or >20 letters, or lack of loss thereof during the course of treatment;
= Increase in BCVA as averaged over a period of 12 weeks, e.g., by week 36 or 48;
= No intraretinal fluid (IRF) and no subretinal fluid (e.g., by week 12, 24, 36, 48, 60 or 96);
= Decrease in choroidal neovascularization (CNV) size (e.g., by week 12, 24, 36, 48, 60 or 96);
= Decrease in total lesion CNV area from baseline (e.g., by week 12, 24, 36, 48, 60 or 96);
= Loss of IRF and/or SRF, e.g., in the center subfield (e.g., by week 12, 24, 36, 48, 60 or 96);
Date Recue/Date Received 2023-02-22 = Decrease in central subfield retinal thickness (CST) (e.g., by week 12, 24, 36, 48, 60 or 96);
= Increase in vision-related quality of life, e.g., as measured by the National Eye Institute Visual Functioning Questionnaire-25 (NEI-VFQ-25) (e.g., by week 12, 24, 36,48, 600r 96);
= Lack of treatment-emergent adverse events (AEs) and/or serious AEs (SAEs), for example, treatment-emergent adverse events occurring anytime within 30 days of any injection) such as blood pressure increase, intraocular pressure increase, visual impairment, vitreous floaters, vitreous detachment, iris neovascularization and/or vitreous hemorrhage (e.g., through week 12, 24, 36, 48, 60 or 96);
= ETDRS letter score of at least 69 (approximate 20/40 Snellen equivalent) (e.g., by week 12, 24, 36, 48, 60 or 96); and/or = Efficacy and/or safety, in a subject suffering from nAMD, similar to that of aflibercept which is intravitreally dosed at 2 mg approximately every 4 weeks for the first 3 months, followed by 2 mg approximately once every 8 weeks or once every 2 months, e.g., wherein efficacy is measured as increase in BCVA and/or reduction in central retinal thickness, e.g., wherein safety is as measured as the incidence of adverse events (treatment-emergent adverse events occurring anytime within 30 days of any injection) such as blood pressure increase, intraocular pressure increase, visual impairment, vitreous floaters, vitreous detachment, iris neovascularization and/or vitreous hemorrhage.
= No detectable anti-drug antibody (e.g., anti-aflibercept) during receipt of treatment;
= Improvement in best corrected visual acuity (BVCA) by week 4, week 8, week 12, week 16, week 20, week 24, week 28, week 32, week 36, week 40, week 44, or week 48 from start of treatment;
= Increase in BCVA, e.g., as measured by the Early Treatment Diabetic Retinopathy Study (ETDRS) visual acuity chart or Snellen equivalent (e.g., by week 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44 or 48 weeks from start of treatment) by letters, letters, Ll. letters, letters, letters or >7 letters;
= Improvement in BCVA, by 4 weeks after initiation of treatment, of about 2 or 3 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 3 letters (ETDRS
or Snellen equivalent) when on HDq16 regimen;
Date Recue/Date Received 2023-02-22 = Improvement in BCVA, by 8 weeks after initiation of treatment, of about 5 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 4 or 5 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 12 weeks after initiation of treatment, of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 16 weeks after initiation of treatment, of about 6 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 20 weeks after initiation of treatment, of about 6 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 letters (ETDRS
or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 24 weeks after initiation of treatment, of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 28 weeks after initiation of treatment, of about 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 letters (ETDRS
or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 32 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 7 letters (ETDRS
or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 36 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 letters (ETDRS
or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 40 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 44 weeks after initiation of treatment, of about 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 48 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 letters (ETDRS
or Snellen equivalent) when on HDq16 regimen;
Date Recue/Date Received 2023-02-22 = Improvement in BCVA, by 52 weeks after initiation of treatment, of about 7 or 8 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 56 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 60 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, from about 48 to about 60 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 60 weeks after initiation of treatment, of about 5, 10 or 15 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or the HDq16 regimen;
= An improvement in BCVA by about week 8, 9, 10, 11 or 12 after initiation of treatment which is maintained (e.g., within about +1 or +2 ETDRS letters or Snellen equivalent) thereafter during the treatment regiment, e.g., to at least week 48.
= A BCVA by 4 weeks after initiation of treatment of about 63 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 63 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 8 weeks after initiation of treatment of about 65 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 65 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by12 weeks after initiation of treatment of about 66 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 16 weeks after initiation of treatment of about 66 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 20 weeks after initiation of treatment of about 66 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
Date Recue/Date Received 2023-02-22 = A BCVA by 24 weeks after initiation of treatment of about 66 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 28 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66Ietter5 (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 32 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 67 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 36 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 40 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 44 weeks after initiation of treatment of about 68 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 48 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 52 weeks after initiation of treatment of about 67 or 68 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 56 weeks after initiation of treatment of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 60 weeks after initiation of treatment of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA between about week 48 and about 60 week after initiation of treatment of about 66 to about 72 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 to about 70 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
Date Recue/Date Received 2023-02-22 = A BCVA of about 59 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 64 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 4 after treatment initiation; in a subject having polypoidal choroidal vasculopathy (PCV) and neovascular age related macular degeneration (nAMD);
= A BCVA of about 63Ietter5 (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 65 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 8 after treatment initiation; in a subject having polypoidal choroidal vasculopathy (PCV) and neovascular age related macular degeneration (nAMD);
= A BCVA of about 63Ietter5 (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 66 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 12 after treatment initiation; in a subject having polypoidal choroidal vasculopathy (PCV) and neovascular age related macular degeneration (nAMD);
= A BCVA of about 64 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 67 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 16 after treatment initiation; in a subject having polypoidal choroidal vasculopathy (PCV) and neovascular age related macular degeneration (nAMD);
= A BCVA of about 64 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 68 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 20 after treatment initiation; in a subject having polypoidal choroidal vasculopathy (PCV) and neovascular age related macular degeneration (nAMD);
Date Recue/Date Received 2023-02-22 = ABCVA of about 64 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 67 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 24 after treatment initiation; in a subject having polypoidal choroidal vasculopathy (PCV) and neovascular age related macular degeneration (nAMD);
= A BCVA of about 65 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 68 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 28 after treatment initiation; in a subject having polypoidal choroidal vasculopathy (PCV) and neovascular age related macular degeneration (nAMD);
= A BCVA of about 64 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 71 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 32 after treatment initiation; in a subject having polypoidal choroidal vasculopathy (PCV) and neovascular age related macular degeneration (nAMD);
= A BCVA of about 64 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 711 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 36 after treatment initiation; in a subject having polypoidal choroidal vasculopathy (PCV) and neovascular age related macular degeneration (nAMD);
= A BCVA of about 65 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 69 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 40 after treatment initiation; in a subject having polypoidal choroidal vasculopathy (PCV) and neovascular age related macular degeneration (nAMD);
= A BCVA of about 65 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 68 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 44 after treatment initiation; in a subject having Date Recue/Date Received 2023-02-22 polypoidal choroidal vasculopathy (PCV) and neovascular age related macular degeneration (nAMD);
= an increase in BCVA of about 3.0 letters (ETDRS) when receiving the HDq12 regimen;
and/or an increase of about 3.0 letters when receiving the HDq16 regimen by about week 4 following treatment initiation in a subject having PCV and nAMD;
= an increase in BCVA of about 6.0 letters (ETDRS) when receiving the HDq12 regimen;
and/or an increase of about 5.0 letters when receiving the HDq16 regimen by about week 8 following treatment initiation in a subject having PCV and nAMD;
= an increase in BCVA of about 7.0 letters (ETDRS) when receiving the HDq12 regimen;
and/or an increase of about 6.0 letters when receiving the HDq16 regimen by about week 12 following treatment initiation in a subject having PCV and nAMD;
= an increase in BCVA of about 7.0 letters (ETDRS) when receiving the HDq12 regimen;
and/or an increase of about 7.0 letters when receiving the HDq16 regimen by about week 16 following treatment initiation in a subject having PCV and nAMD;
= an increase in BCVA of about 7.0 letters (ETDRS) when receiving the HDq12 regimen;
and/or an increase of about 7.0 letters when receiving the HDq16 regimen by about week 20 following treatment initiation in a subject having PCV and nAMD;
= an increase in BCVA of about 7.0 letters (ETDRS) when receiving the HDq12 regimen;
and/or an increase of about 5.0 letters when receiving the HDq16 regimen by about week 24 following treatment initiation in a subject having PCV and nAMD;
= an increase in BCVA of about 9.0 letters (ETDRS) when receiving the HDq12 regimen;
and/or an increase of about 7.0 letters when receiving the HDq16 regimen by about week 28 following treatment initiation in a subject having PCV and nAMD;
= an increase in BCVA of about 8.0 letters (ETDRS) when receiving the HDq12 regimen;
and/or an increase of about 10.0 letters when receiving the HDq16 regimen by about week 32 following treatment initiation in a subject having PCV and nAMD;
= an increase in BCVA of about 8.0 letters (ETDRS) when receiving the HDq12 regimen;
and/or an increase of about 10.0 letters when receiving the HDq16 regimen by about week 36 following treatment initiation in a subject having PCV and nAMD;
= an increase in BCVA of about 9.0 letters (ETDRS) when receiving the HDq12 regimen;
and/or an increase of about 8.0 letters when receiving the HDq16 regimen by about week 40 following treatment initiation in a subject having PCV and nAMD;
Date Recue/Date Received 2023-02-22 = an increase in BCVA of about 9.0 letters (ETDRS) when receiving the HDq12 regimen;
and/or an increase of about 8.0 letters when receiving the HDq16 regimen by about week 44 following treatment initiation in a subject having PCV and nAMD;
= an increase in BCVA of about 9.0 letters (ETDRS) when receiving the HDq12 regimen;
and/or an increase of about 9.0 letters when receiving the HDq16 regimen by about week 48 following treatment initiation in a subject having PCV and nAMD;
= A BCVA of about 65 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 69 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 48 after treatment initiation; in a subject having polypoidal choroidal vasculopathy (PCV) and neovascular age related macular degeneration (nAMD);
= A reduction in total lesion size of about 0.4475 (+2.3) or 0.5 (+2.3) mm2 when receiving the HDq12 regimen or about 0.3923 (+2.6) or 0.4 (+2.6) mm2 when receiving the HDq16 regimen, by about week 12 following treatment initiation;
= A reduction in total lesion size of about 0.3628 (+2.9) or 0.4 (+2.9) mm2 when receiving the HDq12 regimen or about 0.2856 (+3.2) or 0.3 (+3.2) mm2 when receiving the HDq16 regimen, by about week 48 following treatment initiation;
= A reduction in total lesion size of about 0.5199 (+2.8) or 0.6 (+2.8) mm2 when receiving the HDq12 regimen or about 0.3530 (+3.2) or 0.4 (+3.2) mm2 when receiving the HDq16 regimen, by about week 60 following treatment initiation;
= Retina without fluid (total fluid, intraretinal fluid [IRF] and/or subretinal fluid [SRF]) in center subfield (e.g., by about 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 or 60 weeks from start of treatment);
= No subretinal pigment epithelium fluid (e.g., by about 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 or 60 weeks from start of treatment);
= Lack of fluid leakage on fluorescein angiography (FA) (e.g., by about 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 or 60 weeks from start of treatment);
= Decrease in central retinal thickness (CRT), for example, by at least about 100, 125, 130, 135, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149 or 150 micrometers (e.g., by week 4,8, 12, 16, 20, 24, 28, 32, 36, 40, 44 0r48 from start of treatment);
= A change in central retinal thickness, by 4 weeks after initiation of treatment of about -120 or -121 or -122 or -122.4 or -120.2 micrometers when on the HDq12 regimen;
or of about -126 or -127 or-126.6 or -126.3 micrometers when on the HDq16 regimen;
Date Recue/Date Received 2023-02-22 = A change in central retinal thickness, by 8 weeks after initiation of treatment of about -132, -133, -134, -135 or -136 or -136.2 or -132.8 micrometers when on the HDq12 regimen; or of about -139 or -140 or -139.5 or -139.6 micrometers when on the HDq16 regimen;
= A change in central retinal thickness, by 12 weeks after initiation of treatment of about -136, -137, -138, -139, -140 or -141 or -140.9 or -136.6 micrometers when on the HDq12 regimen; or of about -144 or -143 or -143.5 micrometers when on the HDq16 regimen = A change in central retinal thickness, by 16 weeks after initiation of treatment of about -120 or -121 or -122 or -123 or -124 or -123.4 or -120.1 micrometers when on the HDq12 regimen; or of about -132 or -133 or -132.1 or -133.1 micrometers when on the HDq16 regimen;
= A change in central retinal thickness, by 20 weeks after initiation of treatment of about -110 or -111 or -112 or -113 or -114 or -113.6 or -110.9 micrometers when on the HDq12 regimen; or of about -115 or -116 or -117 or -118 or -115.8 or -117.7 micrometers when on the HDq16 regimen;
= A change in central retinal thickness, by 24 weeks after initiation of treatment of about -134, -135, -136 or -137 or -138 or -137.6 or -134.9 micrometers when on the HDq12 regimen; or of about -105 or -106 or -107 or -108 or -105.3 or -107.8 micrometers when on the HDq16 regimen;
= A change in central retinal thickness, by 28 weeks after initiation of treatment of about -130, -131 or -132 or -133 or -134 or -133.7 or -130.7 micrometers when on the HDq12 regimen; or of about -144 or -145 or -146 or -147 or -148 or -144.7 or -147.2 micrometers when on the HDq16 regimen;
= A change in central retinal thickness, by 32 weeks after initiation of treatment of about -118 or -19 or -120 or -121 or -120.4 or -118.1 micrometers when on the HDq12 regimen;
or of about -141 or -142 or -143 or -144 or -141.5 or -144 micrometers when on the HDq16 regimen;
= A change in central retinal thickness, by 36 weeks after initiation of treatment of about -142 or -143 or -144 or -144.2 or -142.2 micrometers when on the HDq12 regimen;
or of about -126 or -127, -128 or -129 or -130 or -131 or -126.4 or -130.5 micrometers when on the HDq16 regimen;
= A change in central retinal thickness, by 40 weeks after initiation of treatment of about -131, -132, -133 or -134 or -133.8 or -131.2 micrometers when on the HDq12 regimen; or of about -127, -128 or -127.5 micrometers when on the HDq16 regimen;
Date Recue/Date Received 2023-02-22 = A change in central retinal thickness, by 44 weeks after initiation of treatment of about -120 or -121 or -122 or -123 or -124 or -125 or -124.7 or -120.3 micrometers when on the HDq12 regimen; or of about -143, -144 or -145 or -144.8 micrometers when on the HDq16 regimen;
= A change in central retinal thickness, by 48 weeks after initiation of treatment of about -142 or -143 or -144 or -144.4 or -142.3 micrometers when on the HDq12 regimen;
or of about -143 or -144 or -145 or -146 or -147 or -148 or -143.8 or -147.1 micrometers when on the HDq16 regimen;
= A central retinal thickness by week 4 after initiation of treatment of about 248.2 micrometers when on the HDq12 regimen; or of about 244.1 micrometers when on the HDq16 regimen (e.g., wherein the initial CRT is about 370 micrometers);
= A central retinal thickness by week 8 after initiation of treatment of about 234.4 micrometers when on the HDq12 regimen; or of about 231.2 micrometers when on the HDq16 regimen (e.g., wherein the initial CRT is about 370 micrometers);
= A central retinal thickness by week 12 after initiation of treatment of about 229.7 micrometers when on the HDq12 regimen; or of about 226.7 micrometers when on the HDq16 regimen (e.g., wherein the initial CRT is about 370 micrometers);
= A central retinal thickness by week 16 after initiation of treatment of about 247.2 micrometers when on the HDq12 regimen; or of about 238.6 micrometers when on the HDq16 regimen (e.g., wherein the initial CRT is about 370 micrometers);
= A central retinal thickness by week 20 after initiation of treatment of about 257 micrometers when on the HDq12 regimen; or of about 254.9 micrometers when on the HDq16 regimen (e.g., wherein the initial CRT is about 370 micrometers);
= A central retinal thickness by week 24 after initiation of treatment of about 233 micrometers when on the HDq12 regimen; or of about 265.4 micrometers when on the HDq16 regimen (e.g., wherein the initial CRT is about 370 micrometers);
= A central retinal thickness by week 28 after initiation of treatment of about 236.9 micrometers when on the HDq12 regimen; or of about 226 micrometers when on the HDq16 regimen (e.g., wherein the initial CRT is about 370 micrometers);
= A central retinal thickness by week 32 after initiation of treatment of about 250.2 micrometers when on the HDq12 regimen; or of about 229.2 micrometers when on the HDq16 regimen (e.g., wherein the initial CRT is about 370 micrometers);
Date Recue/Date Received 2023-02-22 = A central retinal thickness by week 36 after initiation of treatment of about 226.4 micrometers when on the HDq12 regimen; or of about 244.3 micrometers when on the HDq16 regimen (e.g., wherein the initial CRT is about 370 micrometers);
= A central retinal thickness by week 40 after initiation of treatment of about 236.8 micrometers when on the HDq12 regimen; or of about 243.7 micrometers when on the HDq16 regimen (e.g., wherein the initial CRT is about 370 micrometers);
= A central retinal thickness by week 44 after initiation of treatment of about 245.9 micrometers when on the HDq12 regimen; or of about 227.7 micrometers when on the HDq16 regimen (e.g., wherein the initial CRT is about 370 micrometers);
= A central retinal thickness by week 48 after initiation of treatment of about 226 micrometers when on the HDq12 regimen; or of about 226.9 micrometers when on the HDq16 regimen (e.g., wherein the initial CRT is about 370 micrometers);
= A central retinal thickness by week 52 after initiation of treatment of about 227.4 micrometers when on the HDq12 regimen; or of about 231.1 micrometers when on the HDq16 regimen (e.g., wherein the initial CRT is about 370 micrometers);
= A central retinal thickness by week 56 after initiation of treatment of about 234.3 micrometers when on the HDq12 regimen; or of about 233.2 micrometers when on the HDq16 regimen (e.g., wherein the initial CRT is about 370 micrometers);
= A central retinal thickness by week 60 after initiation of treatment of about 218.8 micrometers when on the HDq12 regimen; or of about 221.9 micrometers when on the HDq16 regimen (e.g., wherein the initial CRT is about 370 micrometers);
= A change in central retinal thickness of about -112 or -113 or -112.4 micrometers, between weeks 0 (treatment initiation) and 4 when on the HDq12 regimen;
= A change in central retinal thickness of about -13 or -14 or -13.8 micrometers, between weeks 4 and 8 when on the HDq12 regimen;
= A change in central retinal thickness of about -4 or -5 or -4.7 micrometers, between weeks 8 and 12 when on the HDq12 regimen;
= A change in central retinal thickness of about -24 or -25 micrometers, between weeks 20 and 24 when on the HDq12 regimen;
= A change in central retinal thickness of about -23 or -24 or -23.8 micrometers, between weeks 32 and 36 when on the HDq12 regimen;
= A change in central retinal thickness of about -19 or -20 or -19.7 micrometers, between weeks 44 and 48 when on the HDq12 regimen;
Date Recue/Date Received 2023-02-22 = A change in central retinal thickness of about -126, -127 or -126.6 micrometers, between weeks 0 and 4 when on the HDq16 regimen;
= A change in central retinal thickness of about -12, -13 or -12.9 micrometers, between weeks 4 and 8 when on the HDq16 regimen;
= A change in central retinal thickness of about -4 or -5 or -4.5 micrometers, between weeks 8 and 12 when on the HDq16 regimen;
= A change in central retinal thickness of about -39, -40 or -39.4 micrometers, between weeks 24 and 28 when on the HDq16 regimen;
= A change in central retinal thickness of about 0 or -1 or -0.6 micrometers, between weeks 36 and 40 when on the HDq16 regimen;
= A change in central retinal thickness of about -15 or -16 micrometers, between weeks 40 and 44 when on the HDq16 regimen;
= A change in central retinal thickness of about 0 or -1 or -0.8 micrometers, between weeks 44 and 48 when on the HDq16 regimen;
= A change in central retinal thickness of about -11, -12 or -11.3 micrometers, between weeks 56 and 60 when on the HDq16 regimen;
= A CRT by about week 4, 5, 6, 7 or 8 after initiation of treatment or a reduction in CRT by week 4, 5, 6, 7 or 8 after initiation of treatment which is maintained (e.g., within about +10, +11 or +12 micrometers) thereafter during the treatment regimen, e.g., to at least week 48;
= a change in central retinal thickness (CRT) by about week 4 following treatment initiation of about -130.2 micrometers when receiving the HDq12 regimen;
and/or a change in CRT of about -111.6micrometers when receiving the HDq16 regimen, in a subject having PCV and nAMD;
= a change in central retinal thickness (CRT) by about week 8 following treatment initiation of about -152.5 micrometers when receiving the HDq12 regimen;
and/or a change in CRT of about -134.5micrometers when receiving the HDq16 regimen, in a subject having PCV and nAMD;
= a change in central retinal thickness (CRT) by about week 12 following treatment initiation of about -160.9 micrometers when receiving the HDq12 regimen;
and/or a change in CRT of about -147.7micrometers when receiving the HDq16 regimen, in a subject having PCV and nAMD;
Date Recue/Date Received 2023-02-22 = a change in central retinal thickness (CRT) by about week 16 following treatment initiation of about -150 micrometers when receiving the HDq12 regimen; and/or a change in CRT of about -141.1 micrometers when receiving the HDq16 regimen, in a subject having PCV and nAMD;
= a change in central retinal thickness (CRT) by about week 20 following treatment initiation of about -135.9 micrometers when receiving the HDq12 regimen;
and/or a change in CRT of about -128 micrometers when receiving the HDq16 regimen, in a subject having PCV and nAMD;
= a change in central retinal thickness (CRT) by about week 24 following treatment initiation of about -162.7 micrometers when receiving the HDq12 regimen;
and/or a change in CRT of about -115.7 micrometers when receiving the HDq16 regimen, in a subject having PCV and nAMD;
= a change in central retinal thickness (CRT) by about week 28 following treatment initiation of about -163.4 micrometers when receiving the HDq12 regimen;
and/or a change in CRT of about -147.9 micrometers when receiving the HDq16 regimen, in a subject having PCV and nAMD;
= a change in central retinal thickness (CRT) by about week 32 following treatment initiation of about -148.2 micrometers when receiving the HDq12 regimen;
and/or a change in CRT of about -142.3 micrometers when receiving the HDq16 regimen, in a subject having PCV and nAMD;
= a change in central retinal thickness (CRT) by about week 36 following treatment initiation of about -167.4 micrometers when receiving the HDq12 regimen;
and/or a change in CRT of about -132.6 micrometers when receiving the HDq16 regimen, in a subject having PCV and nAMD;
= a change in central retinal thickness (CRT) by about week 40 following treatment initiation of about -159.2 micrometers when receiving the HDq12 regimen;
and/or a change in CRT of about -121.1 micrometers when receiving the HDq16 regimen, in a subject having PCV and nAMD;
= a change in central retinal thickness (CRT) by about week 44 following treatment initiation of about -146.7 micrometers when receiving the HDq12 regimen;
and/or a change in CRT of about -143.9 micrometers when receiving the HDq16 regimen, in a subject having PCV and nAMD;
= a change in central retinal thickness (CRT) by about week 48 following treatment initiation of about -170.6 micrometers when receiving the HDq12 regimen;
and/or a Date Recue/Date Received 2023-02-22 change in CRT of about -146.1 micrometers when receiving the HDq16 regimen, in a subject having PCV and nAMD;
= a central retinal thickness (CRT) of about 260.2 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers;
and/or a CRT of about) 263.6micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 4 following treatment initiation in a subject having PCV and nAMD;
= a central retinal thickness (CRT) of about 237.9 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers;
and/or a CRT of about) 240.7 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 8 following treatment initiation in a subject having PCV and nAMD;
= a central retinal thickness (CRT) of about 229.5 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers;
and/or a CRT of about) 227.5micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 12 following treatment initiation in a subject having PCV and nAMD;
= a central retinal thickness (CRT) of about 240.4 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers;
and/or a CRT of about) 234.1 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 16 following treatment initiation in a subject having PCV and nAMD;
= a central retinal thickness (CRT) of about 254.5 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers;
and/or a CRT of about) 247.2 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 20 following treatment initiation in a subject having PCV and nAMD;
= a central retinal thickness (CRT) of about 227.7 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers;
and/or a CRT of about) 259.5 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 24 following treatment initiation in a subject having PCV and nAMD;
= a central retinal thickness (CRT) of about 227 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers; and/or a CRT
Date Recue/Date Received 2023-02-22 of about) 227.3 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 28 following treatment initiation in a subject having PCV and nAMD;
= a central retinal thickness (CRT) of about 242.2 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers;
and/or a CRT of about) 232.9 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 32 following treatment initiation in a subject having PCV and nAMD;
= a central retinal thickness (CRT) of about 223 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers; and/or a CRT
of about) 242.6 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 36 following treatment initiation in a subject having PCV and nAMD;
= a central retinal thickness (CRT) of about 231.2 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers;
and/or a CRT of about) 254.1 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 40 following treatment initiation in a subject having PCV and nAMD;
= a central retinal thickness (CRT) of about 243.7 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers;
and/or a CRT of about) 231.3 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 44 following treatment initiation in a subject having PCV and nAMD;
= a central retinal thickness (CRT) of about 219.8 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers;
and/or a CRT of about) 229.1 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 48 following treatment initiation in a subject having PCV and nAMD;
= A reduction in choroidal neovascularization size of about 0.6, 1.5, 1 or 2 mm2 ( 3.7 mm2) by week 12 when receiving the HDq12 regimen (e.g., when the baseline size at treatment initiation is about 5 to 6 mm2);
= A reduction in choroidal neovascularization size of about 2, 3, 4, 3.5 or 2.5 mm2 ( 5 mm2) by week 48 when receiving the HDq12 regimen (e.g., when the baseline size at treatment initiation is about 5 to 6 mm2);
Date Recue/Date Received 2023-02-22 = A reduction in choroidal neovascularization size of about 2, 3, 4, 3.8, 2.8 mm2 ( 5 mm2) by week 60 when receiving the HDq12 regimen (e.g., when the baseline size at treatment initiation is about 5 to 6 mm2);
= A reduction in choroidal neovascularization size of about 1, 2, 0.5 or 1.5 mm2 ( 4.2 mm2) by week 12 when receiving the HDq16 regimen (e.g., when the baseline size at treatment initiation is about 4.5 to 6.5 mm2);
= A reduction in choroidal neovascularization size (mm2) of about 1,2, 1.4 or 3 mm2( 5 mm2) by week 48 when receiving the HDq16 regimen (e.g., when the baseline size at treatment initiation is about 4.5 to 6.5 mm2);
= A reduction in choroidal neovascularization size of about 2, 3, 4 or 3.7 mm2 ( 5.7 mm2) by week 60 when receiving the HDq16 regimen (e.g., when the baseline size at treatment initiation is about 4.5 to 6.5 mm2);
= At baseline has a free aflibercept concentration in plasma of about 0 mg/L (or <0.0156 mg/L);
= At about 4 hours after treatment initiation of HDq12 or HDq16, has a free aflibercept concentration in plasma of about 0.0409 (+0.0605) or 0 mg/L (or <0.0156 mg/L);
= At about 8 hours after treatment initiation of HDq12 or HDq16, has a free aflibercept concentration in plasma of about 0.05 (+3.78), 0.0973 (+0.102) or 0.0672 mg/L;
= At about day 2 after treatment initiation of HDq12 or HDq16, has a free aflibercept concentration in plasma of about 0.11 (+2.21), 0.146 (+0.110) or 0.0903 mg/L;
= At about day 3 after treatment initiation of HDq12 or HDq16, has a free aflibercept concentration in plasma of about 0.11 (+2.06), 0.137 (+0.0947) or 0.112 mg/L;
= At about day 5 after treatment initiation of HDq12 or HDq16, has a free aflibercept concentration in plasma of about 0.08 (+1.86), 0.0933 (+0.0481) or 0.0854 mg/L;
= At about day 8 after treatment initiation of HDq12 or HDq16, has a free aflibercept concentration in plasma of about 0.07 (+1.75), 0.0794 (+0.0413) or 0.0682 mg/L
;
= At about day 15 after treatment initiation of HDq12 or HDq16, has a free aflibercept concentration in plasma of about 0.04 (+1.76), 0.0435 (+0.0199) or 0.0385 mg/L;
= At about day 22 after treatment initiation of HDq12 or HDq16, has a free aflibercept concentration in plasma of about 0.02 (+1.76), 0.0213 (+0.0148) or 0.0232 mg/L;
= At about day 29 after treatment initiation of HDq12 or HDq16, has a free aflibercept concentration in plasma of about 0.00766 (+0.00958) or 0 mg/L (or <0.0156 mg/L);
Date Recue/Date Received 2023-02-22 = At about 4 hours post-dose after treatment initiation of HDq12 or HDq16, has an adjusted bound aflibercept concentration in plasma of about 0.00 mg/L;
= At about 8 hours post-dose after treatment initiation of HDq12 or HDq16, has an adjusted bound aflibercept concentration in plasma of about 0.00 mg/L;
= At about day 2 after treatment initiation of HDq12 or HDq16, has an adjusted bound aflibercept concentration in plasma of about 0.06 (+3.50) or 0.124 (+0.186) mg/L;
= At about day 3 after treatment initiation of HDq12 or HDq16, has an adjusted bound aflibercept concentration in plasma of about 0.13 (+2.07) or 0.173 (+0.155) mg/L;
= At about day 5 after treatment initiation of HDq12 or HDq16, has an adjusted bound aflibercept concentration in plasma of about 0.18 (+1.88) or 0.223 (+0.157) mg/L;
= At about day 8 after treatment initiation of HDq12 or HDq16, has an adjusted bound aflibercept concentration in plasma of about 0.31 (+1.56) or 0.334 (+0.135) mg/L;
= At about day 15 after treatment initiation of HDq12 or HDq16, has an adjusted bound aflibercept concentration in plasma of about 0.37 (+1.50) or 0.393 (+0.130) mg/L;
= At about day 22 after treatment initiation of HDq12 or HDq16, has an adjusted bound aflibercept concentration in plasma of about 0.25 (+3.00) or 0.335 (+0.155) mg/L;
= At about day 29 after treatment initiation of HDq12 or HDq16, has an adjusted bound aflibercept concentration in plasma of about 0.32 (+1.39) or 0.331 (+0.0953) mg/L;
= Non-inferior BVCA compared to that of aflibercept which is intravitreally dosed at 2 mg approximately every 4 weeks for the first 5 injections followed by 2 mg approximately once every 8 weeks or once every 2 months;
= Ocular (e.g., intraocular pressure) and non-ocular safety (e.g., hypertensive events or APTC events) or death rate, in a subject suffering from DME, similar to that of aflibercept which is intravitreally dosed at 2 mg approximately every 4 weeks for the first 3 or 4 or 5 injections followed by 2 mg approximately once every 8 weeks or once every 2 months;
= Efficacy and/or safety, in a subject suffering from nAMD, similar to that of aflibercept which is intravitreally dosed at 2 mg approximately every 4 weeks for the first 3 injections followed by 2 mg approximately once every 8 weeks or once every 2 months, e.g., wherein efficacy is measured as increase in BCVA and/or reduction in central retinal thickness, e.g., wherein safety is as measured as the incidence of adverse events (treatment-emergent adverse events occurring anytime within 30 days of any injection) such as blood pressure increase, intraocular pressure increase, visual impairment, vitreous floaters, vitreous detachment, iris neovascularization and/or vitreous hemorrhage;
Date Recue/Date Received 2023-02-22 = A peak free aflibercept concentration in plasma at about 1, 1.5, 2 or 3 days after initiation of treatment;
= A maximum free aflibercept concentration in plasma of about 0.1, 0.12, 0.13, 0.14 or 0.2 mg/I;
= A plasma half-life of free aflibercept of about 10, 11, 12 or 13 days;
= Peak adjusted bound aflibercept concentration in plasma at about 14 days after initiation of treatment;
= Maximum free aflibercept concentration in plasma of about 0.4 mg/I;
and/or = A plasma half-life of free aflibercept of about 281 days.
[0002] Thus, the present invention provides the following:
= A method for achieving a change in central retinal thickness (CRT) by about week 4 following treatment initiation of about -130.2 micrometers when receiving the HDq12 regimen; and/or a change in CRT of about -111.6 micrometers when receiving the HDq16 regimen; a change in central retinal thickness (CRT) by about week 8 following treatment initiation of about -152.5 micrometers when receiving the HDq12 regimen;
and/or a change in CRT of about -134.5 micrometers when receiving the HDq16 regimen; a change in central retinal thickness (CRT) by about week 12 following treatment initiation of about -160.9 micrometers when receiving the HDq12 regimen;
and/or a change in CRT of about -147.7 micrometers when receiving the HDq16 regimen; a change in central retinal thickness (CRT) by about week 16 following treatment initiation of about -150 micrometers when receiving the HDq12 regimen;
and/or a change in CRT of about -141.1 micrometers when receiving the HDq16 regimen; a change in central retinal thickness (CRT) by about week 20 following treatment initiation of about -135.9 micrometers when receiving the HDq12 regimen;
and/or a change in CRT of about -128 micrometers when receiving the HDq16 regimen;
a change in central retinal thickness (CRT) by about week 24 following treatment initiation of about -162.7 micrometers when receiving the HDq12 regimen;
and/or a change in CRT of about -115.7 micrometers when receiving the HDq16 regimen; a change in central retinal thickness (CRT) by about week 28 following treatment initiation of about -163.4 micrometers when receiving the HDq12 regimen; and/or a change in CRT of about -147.9 micrometers when receiving the HDq16 regimen; a change in central retinal thickness (CRT) by about week 32 following treatment initiation of about -148.2 micrometers when receiving the HDq12 regimen; and/or a change in CRT of about Date Recue/Date Received 2023-02-22 -142.3 micrometers when receiving the HDq16 regimen; a change in central retinal thickness (CRT) by about week 36 following treatment initiation of about -167.4 micrometers when receiving the HDq12 regimen; and/or a change in CRT of about -132.6 micrometers when receiving the HDq16 regimen; a change in central retinal thickness (CRT) by about week 40 following treatment initiation of about -159.2 micrometers when receiving the HDq12 regimen; and/or a change in CRT of about -121.1 micrometers when receiving the HDq16 regimen; a change in central retinal thickness (CRT) by about week 44 following treatment initiation of about -146.7 micrometers when receiving the HDq12 regimen; and/or a change in CRT of about -143.9 micrometers when receiving the HDq16 regimen; a change in central retinal thickness (CRT) by about week 48 following treatment initiation of about -170.6 micrometers when receiving the HDq12 regimen; and/or a change in CRT of about -146.1 micrometers when receiving the HDq16 regimen; a central retinal thickness (CRT) of about 260.2 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers; and/or a CRT of about) 263.6micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 4 following treatment initiation; a central retinal thickness (CRT) of about 237.9 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers; and/or a CRT of about) 240.7 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 8 following treatment initiation; a central retinal thickness (CRT) of about 229.5 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers; and/or a CRT of about) 227.5micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 12 following treatment initiation; a central retinal thickness (CRT) of about 240.4 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers; and/or a CRT of about) 234.1 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 16 following treatment initiation; a central retinal thickness (CRT) of about 254.5 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers; and/or a CRT of about) 247.2 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 20 following treatment initiation; a central retinal thickness (CRT) of about 227.7 micrometers when receiving the HDq12 regimen (e.g., wherein the Date Recue/Date Received 2023-02-22 baseline CRT is about 390.4 micrometers; and/or a CRT of about) 259.5 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 24 following treatment initiation; a central retinal thickness (CRT) of about 227 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers; and/or a CRT of about) 227.3 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 28 following treatment initiation; a central retinal thickness (CRT) of about 242.2 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers; and/or a CRT of about) 232.9 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 32 following treatment initiation; a central retinal thickness (CRT) of about 223 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers; and/or a CRT of about) 242.6 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 36 following treatment initiation; a central retinal thickness (CRT) of about 231.2 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers; and/or a CRT of about) 254.1 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 40 following treatment initiation; a central retinal thickness (CRT) of about 243.7 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers; and/or a CRT of about) 231.3 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 44 following treatment initiation; and/or a central retinal thickness (CRT) of about 219.8 micrometers when receiving the HDq12 regimen (e.g., wherein the baseline CRT is about 390.4 micrometers; and/or a CRT of about) 229.1 micrometers when receiving the HDq16 regimen (e.g., when the baseline CRT is about 375.2 micrometers) by about week 48 following treatment initiation in a subject in need thereof having PCV and nAMD; comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is Date Recue/Date Received 2023-02-22 administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving an increase in BCVA of about 3.0 letters (ETDRS) when receiving the HDq12 regimen; and/or an increase of about 3.0 letters when receiving the HDq16 regimen by about week 4 following treatment initiation; an increase in BCVA of about 6.0 letters (ETDRS) when receiving the HDq12 regimen; and/or an increase of about 5.0 letters when receiving the HDq16 regimen by about week 8 following treatment initiation; an increase in BCVA of about 7.0 letters (ETDRS) when receiving the HDq12 regimen; and/or an increase of about 6.0 letters when receiving the HDq16 regimen by about week 12 following treatment initiation; an increase in BCVA
of about 7.0 letters (ETDRS) when receiving the HDq12 regimen; and/or an increase of about 7.0 letters when receiving the HDq16 regimen by about week 16 following treatment initiation; an increase in BCVA of about 7.0 letters (ETDRS) when receiving the HDq12 regimen; and/or an increase of about 7.0 letters when receiving the HDq16 regimen by about week 20 following treatment initiation; an increase in BCVA of about 7.0 letters (ETDRS) when receiving the HDq12 regimen; and/or an increase of about 5.0 letters when receiving the HDq16 regimen by about week 24 following treatment initiation; an increase in BCVA of about 9.0 letters (ETDRS) when receiving the HDq12 regimen;
and/or an increase of about 7.0 letters when receiving the HDq16 regimen by about week 28 following treatment initiation; an increase in BCVA of about 8.0 letters (ETDRS) when receiving the HDq12 regimen; and/or an increase of about 10.0 letters when receiving the HDq16 regimen by about week 32 following treatment initiation;
an increase in BCVA of about 8.0 letters (ETDRS) when receiving the HDq12 regimen;
and/or an increase of about 10.0 letters when receiving the HDq16 regimen by about week 36 following treatment initiation; an increase in BCVA of about 9.0 letters (ETDRS) when receiving the HDq12 regimen; and/or an increase of about 8.0 letters when receiving the HDq16 regimen by about week 40 following treatment initiation;
an increase in BCVA of about 9.0 letters (ETDRS) when receiving the HDq12 regimen;
and/or an increase of about 8.0 letters when receiving the HDq16 regimen by about week 44 following treatment initiation; an increase in BCVA of about 9.0 or 10 letters (ETDRS) when receiving the HDq12 regimen; and/or an increase of about 9.0 letters when receiving the HDq16 regimen by about week 48 following treatment initiation; in an subject in need thereof having PCV and nAMD comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, Date Recue/Date Received 2023-02-22 followed by one or more secondary doses of about 8 mg or more of the VEGF
receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose;
= A method for achieving a BCVA of about 59 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA
of about 64 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 4 after treatment initiation; a BCVA
of about 63 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 65 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 8 after treatment initiation; a BCVA of about 63 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA
of about 66 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 12 after treatment initiation; a BCVA
of about 64 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 67 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 16 after treatment initiation; a BCVA of about 64 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 68 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 20 after treatment initiation; a BCVA
of about 64 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 67 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 24 after treatment initiation; a BCVA of about 65 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 68 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 28 after treatment initiation; a BCVA
of about 64 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 71 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week Date Recue/Date Received 2023-02-22 32 after treatment initiation; a BCVA of about 64 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 711 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 36 after treatment initiation; a BCVA
of about 65Ietter5 (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA of about 69 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 40 after treatment initiation; a BCVA of about 65Ietter5 (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters);
and/or a BCVA of about 68 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 44 after treatment initiation; and/or a BCVA of about 65 letters (ETDRS) when receiving the HDq12 regimen (e.g., wherein the baseline BCVA is about 57 letters); and/or a BCVA
of about 69 letters (ETDRS) when receiving the HDq16 regimen (e.g., wherein the baseline BCVA is about 60 letters); by about week 48 after treatment initiation; in a subject in need thereof having polypoidal choroidal vasculopathy (PCV) and nAMD;
comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose;
= A method for achieving a reduction in total lesion size of about 0.4475 (+2.3) or 0.5 (+2.3) mm2 when receiving the HDq12 regimen or about 0.3923 (+2.6) or 0.4 (+2.6) mm2 when receiving the HDq16 regimen, by about week 12 following treatment initiation; a reduction in total lesion size of about 0.3628 (+2.9) or 0.4 (+2.9) mm2 when receiving the HDq12 regimen or about 0.2856 (+3.2) or 0.3 (+3.2) mm2 when receiving the HDq16 regimen, by about week 48 following treatment initiation; and/or, a reduction in total lesion size of about 0.5199 (+2.8) or 0.6 (+2.8) mm2 when receiving the HDq12 regimen or about 0.3530 (+3.2) or 0.4 (+3.2) mm2 when receiving the HDq16 regimen, by about week 60 following treatment initiation, in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by Date Recue/Date Received 2023-02-22 one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving an increase in BCVA as measured by the Early Treatment Diabetic Retinopathy Study (ETDRS) visual acuity chart by week 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 or 60 after treatment initiation by >5, >10, >15, or >20 letters in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving no intraretinal fluid (IRF) and no subretinal fluid by week 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 or 60 after treatment initiation;
in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving a decrease in choroidal neovascularization (CNV) size by week 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 or 60 after treatment initiation; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg Date Recue/Date Received 2023-02-22 or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving a decrease in total lesion CNV area from baseline by week 4, 8, 12, 16, 20, 24, 28, 32, 36,40, 44,48, 52, 56 or 60 after treatment initiation;
in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving a loss of IRF and/or SRF in the center subfield by week 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 or 60 after treatment initiation;
in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving a decrease in central subfield retinal thickness (CST) by week 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 or 60 after treatment initiation; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of Date Recue/Date Received 2023-02-22 about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving an increase in vision-related quality of life as measured by the National Eye Institute Visual Functioning Questionnaire-25 (NEI-VFQ-25) by week 4, 8, 12, 16, 20, 24, 28, 32, 36,40, 44, 48, 52, 56 or 60 after treatment initiation; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving an ETDRS letter score of at least 69 (approximate 20/40 Snellen equivalent) of BCVA by week 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44,48, 52, 56 or 60 after treatment initiation; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving an improvement in best corrected visual acuity (BVCA) by week 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 or 60 from start of treatment; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of Date Recue/Date Received 2023-02-22 about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving an increase in BCVA as measured by the Early Treatment Diabetic Retinopathy Study (ETDRS) visual acuity chart or Snellen equivalent by week 4,8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 0r60 weeks from start of treatment by letters, letters, letters, letters, letters or >7 letters;
in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving an improvement in BCVA, by 4 weeks after initiation of treatment, of about 2 or 3 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 3 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving an improvement in BCVA, by 8 weeks after initiation of treatment, of about 5 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 4 or 5 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a Date Recue/Date Received 2023-02-22 VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving an improvement in BCVA, by 12 weeks after initiation of treatment, of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving an improvement in BCVA, by 16 weeks after initiation of treatment, of about 6 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving an improvement in BCVA, by 20 weeks after initiation of treatment, of about 6 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg Date Recue/Date Received 2023-02-22 or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving an improvement in BCVA, by 24 weeks after initiation of treatment, of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving an improvement in BCVA, by 28 weeks after initiation of treatment, of about 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving an improvement in BCVA, by 32 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more Date Recue/Date Received 2023-02-22 tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving an improvement in BCVA, by 36 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving an improvement in BCVA, by 40 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving an improvement in BCVA, by 44 weeks after initiation of treatment, of about 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose Date Recue/Date Received 2023-02-22 is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving an improvement in BCVA, by 48 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving an improvement in BCVA, by 52 weeks after initiation of treatment, of about 7 or 8 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving an improvement in BCVA, by 56 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately Date Recue/Date Received 2023-02-22 preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving an improvement in BCVA, by 60 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving an improvement in BCVA, from about 48 to about 60 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving an improvement in BCVA, by 60 weeks after initiation of treatment, of about 5, 10 or 15 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF
receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is Date Recue/Date Received 2023-02-22 administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving an improvement in BCVA by about week 8, 9, 10, 11 or 12 after initiation of treatment which is maintained within about 1 or 2 ETDRS
letters (or Snellen equivalent) thereafter during the treatment regimen to at least week 48 or 60 in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving a BCVA by 4 weeks after initiation of treatment of about 63 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 63 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a BCVA by 8 weeks after initiation of treatment of about 65 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 65 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein Date Recue/Date Received 2023-02-22 each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a BCVA by12 weeks after initiation of treatment of about 66 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a BCVA by 16 weeks after initiation of treatment of about 66 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a BCVA by 20 weeks after initiation of treatment of about 66 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein Date Recue/Date Received 2023-02-22 each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a BCVA by 24 weeks after initiation of treatment of about 66 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a BCVA by 28 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66Ietter5 (ETDRS or Snellen equivalent) when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a BCVA by 32 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 67 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein Date Recue/Date Received 2023-02-22 each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a BCVA by 36 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a BCVA by 40 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a BCVA by 44 weeks after initiation of treatment of about 68 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein Date Recue/Date Received 2023-02-22 each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a BCVA by 48 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a BCVA by 52 weeks after initiation of treatment of about 67 or 68 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA
of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a BCVA by 56 weeks after initiation of treatment of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA
of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein Date Recue/Date Received 2023-02-22 each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a BCVA by 60 weeks after initiation of treatment of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA
of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a BCVA between about week 48 and about week 60 after initiation of treatment of about 66 to about 72 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 to about 70 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF
receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a retina without fluid (total fluid, intraretinal fluid [IRF] and/or subretinal fluid [SRF]) in center subfield by about 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 or 60 weeks from start of treatment; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF
receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is Date Recue/Date Received 2023-02-22 administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving no subretinal pigment epithelium fluid by about 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 or 60 weeks from start of treatment; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving no fluid leakage on fluorescein angiography (FA) in the retina by about 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 or 60 weeks from start of treatment; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving a decrease in central retinal thickness (CRT) of at least about 100, 125, 130, 135, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149 or 150 micrometers by week 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48 or 60 from start of treatment; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks Date Recue/Date Received 2023-02-22 (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving a change in central retinal thickness, by 4 weeks after initiation of treatment of about -120 or -121 or -122 or -122.4 or -120.2 micrometers when on the HDq12 regimen; or of about -126 or -127 or-126.6 or -126.3 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a change in central retinal thickness, by 8 weeks after initiation of treatment of about -132, -133, -134, -135 or -136 or -136.2 or -132.8 micrometers when on the HDq12 regimen; or of about -139 or -140 or -139.5 or -139.6 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a change in central retinal thickness, by 12 weeks after initiation of treatment of about -136, -137, -138, -139, -140 or -141 or -140.9 or -136.6 micrometers when on the HDq12 regimen; or of about -144 or -143 or -143.5 micrometers when on the HDq16 regimen in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF
receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to Date Recue/Date Received 2023-02-22 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a change in central retinal thickness, by 16 weeks after initiation of treatment of about -120 or -121 or -122 or -123 or -124 or -123.4 or -120.1 micrometers when on the HDq12 regimen; or of about -132 or -133 or -132.1 or -133.1 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF
receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a change in central retinal thickness, by 20 weeks after initiation of treatment of about -110 or -111 or -112 or -113 or -114 or -113.6 or -110.9 micrometers when on the HDq12 regimen; or of about -115 or -116 or -117 or -118 or -115.8 or -117.7 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF
receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF
receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a change in central retinal thickness, by 24 weeks after initiation of treatment of about -134, -135, -136 or -137 or -138 or -137.6 or -134.9 micrometers when on the HDq12 regimen; or of about -105 or -106 or -107 or -108 or -105.3 or -107.8 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF
receptor Date Recue/Date Received 2023-02-22 fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a change in central retinal thickness, by 28 weeks after initiation of treatment of about -130, -131 or -132 or -133 or -134 or -133.7 or -130.7 micrometers when on the HDq12 regimen; or of about -144 or -145 or -146 or -147 or -148 or -144.7 or -147.2 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF
receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a change in central retinal thickness, by 32 weeks after initiation of treatment of about -118 or -19 or -120 or -121 or -120.4 or -118.1 micrometers when on the HDq12 regimen; or of about -141 or -142 or -143 or -144 or -141.5 or -micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF
receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a change in central retinal thickness, by 36 weeks after initiation of treatment of about -142 or -143 or -144 or -144.2 or -142.2 micrometers when on the HDq12 regimen; or of about -126 or -127, -128 or -129 or -130 or -131 or -126.4 or -130.5 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the Date Recue/Date Received 2023-02-22 subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF
receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a change in central retinal thickness, by 40 weeks after initiation of treatment of about -131, -132, -133 or -134 or -133.8 or -131.2 micrometers when on the HDq12 regimen; or of about -127, -128 or -127.5 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a change in central retinal thickness, by 44 weeks after initiation of treatment of about -120 or -121 or -122 or -123 or -124 or -125 or -124.7 or -120.3 micrometers when on the HDq12 regimen; or of about -143, -144 or -145 or -144.8 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF
receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a change in central retinal thickness, by 48 weeks after initiation of treatment of about -142 or -143 or -144 or -144.4 or -142.3 micrometers when on the HDq12 regimen; or of about -143 or -144 or -145 or -146 or -147 or -148 or -143.8 or -147.1 micrometers when on the HDq16 regimen; in a subject in need thereof having an Date Recue/Date Received 2023-02-22 angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF
receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a central retinal thickness by week 4 after initiation of treatment of about 248.2 micrometers when on the HDq12 regimen; or of about 244.1 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a central retinal thickness by week 8 after initiation of treatment of about 234.4 micrometers when on the HDq12 regimen; or of about 231.2 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a central retinal thickness by week 12 after initiation of treatment of about 229.7 micrometers when on the HDq12 regimen; or of about 226.7 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single Date Recue/Date Received 2023-02-22 initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a central retinal thickness by week 16 after initiation of treatment of about 247.2 micrometers when on the HDq12 regimen; or of about 238.6 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a central retinal thickness by week 20 after initiation of treatment of about 257 micrometers when on the HDq12 regimen; or of about 254.9 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a central retinal thickness by week 24 after initiation of treatment of about 233 micrometers when on the HDq12 regimen; or of about 265.4 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or Date Recue/Date Received 2023-02-22 more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a central retinal thickness by week 28 after initiation of treatment of about 236.9 micrometers when on the HDq12 regimen; or of about 226 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a central retinal thickness by week 32 after initiation of treatment of about 250.2 micrometers when on the HDq12 regimen; or of about 229.2 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a central retinal thickness by week 36 after initiation of treatment of about 226.4 micrometers when on the HDq12 regimen; or of about 244.3 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, Date Recue/Date Received 2023-02-22 followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a central retinal thickness by week 40 after initiation of treatment of about 236.8 micrometers when on the HDq12 regimen; or of about 243.7 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a central retinal thickness by week 44 after initiation of treatment of about 245.9 micrometers when on the HDq12 regimen; or of about 227.7 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a central retinal thickness by week 48 after initiation of treatment of about 226 micrometers when on the HDq12 regimen; or of about 226.9 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor Date Recue/Date Received 2023-02-22 fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a central retinal thickness by week 52 after initiation of treatment of about 227.4 micrometers when on the HDq12 regimen; or of about 231.1 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a central retinal thickness by week 56 after initiation of treatment of about 234.3 micrometers when on the HDq12 regimen; or of about 233.2 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a central retinal thickness by week 60 after initiation of treatment of about 218.8 micrometers when on the HDq12 regimen; or of about 221.9 micrometers when on the HDq16 regimen; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after Date Recue/Date Received 2023-02-22 the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a central retinal thickness by about week 4, 5, 6, 7 or 8 after initiation of treatment or a reduction in CRT by week 4, 5, 6, 7 or 8 after initiation of treatment which is maintained (within about 10, 11 or 12 micrometers) thereafter during the treatment regimen to at least week 48; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF
receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving at about 4 hours after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.0409 ( 0.0605) or 0 mg/L
(or <0.0156 mg/L); in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving at about 8 hours after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.05 ( 3.78), 0.0973 ( 0.102) or 0.0672 mg/L; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 Date Recue/Date Received 2023-02-22 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving at about day 2 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.11 ( 2.21), 0.146 ( 0.110) or 0.0903 mg/L; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving at about day 3 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.11 ( 2.06), 0.137 ( 0.0947) or 0.112 mg/L; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving at about day 5 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.08 ( 1.86), 0.0933 ( 0.0481) or 0.0854 mg/L; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving at about day 8 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.07 ( 1.75), 0.0794 ( 0.0413) or Date Recue/Date Received 2023-02-22 0.0682 mg/L ; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving at about day 15 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.04 ( 1.76), 0.0435 ( 0.0199) or 0.0385 mg/L; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving at about day 22 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.02 ( 1.76), 0.0213 ( 0.0148) or 0.0232 mg/L; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving at about day 29 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.00766 ( 0.00958) or 0 mg/L
(or <0.0156 mg/L); in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or Date Recue/Date Received 2023-02-22 more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving at about 4 hours post-dose after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.00 mg/L; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving at about 8 hours post-dose after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.00 mg/L; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving at about day 2 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.06 ( 3.50) or 0.124 ( 0.186) mg/L; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
Date Recue/Date Received 2023-02-22 = A method for achieving at about day 3 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.13 ( 2.07) or 0.173 ( 0.155) mg/L; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving at about day 5 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.18 ( 1.88) or 0.223 ( 0.157) mg/L; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving at about day 8 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.31 ( 1.56) or 0.334 ( 0.135) mg/L; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving at about day 15 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.37 ( 1.50) or 0.393 ( 0.130) mg/L; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose Date Recue/Date Received 2023-02-22 of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving at about day 22 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.25 ( 3.00) or 0.335 ( 0.155) mg/L; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving at about day 29 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.32 ( 1.39) or 0.331 ( 0.0953) mg/L; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
= A method for achieving a non-inferior BVCA compared to that of aflibercept which is intravitreally dosed at 2 mg approximately every 4 weeks for the first 5 injections followed by 2 mg approximately once every 8 weeks or once every 2 months; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the Date Recue/Date Received 2023-02-22 immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving a peak free aflibercept concentration in plasma at about 1, 1.5, 2 or 3 days after initiation of treatment; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20 regimen) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving a maximum free aflibercept concentration in plasma of about 0.1, 0.12, 0.13, 0.14 or 0.2 mg/I; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving a peak adjusted bound aflibercept concentration in plasma at about 14 days after initiation of treatment; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
and Date Recue/Date Received 2023-02-22 = A method for achieving a maximum free aflibercept concentration in plasma of about 0.4 mg/I; in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (HDq12-20) or 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) or 20 weeks (HDq20 regimen) after the immediately preceding dose.
= A method for achieving a change in central retinal thickness of about -112 or -113 or -112.4 micrometers, between weeks 0 (treatment initiation) and 4 when on the HDq12 regimen;
a change in central retinal thickness of about -13 or -14 or -13.8 micrometers, between weeks 4 and 8 when on the HDq12 regimen;
a change in central retinal thickness of about -4 or -5 or -4.7 micrometers, between weeks 8 and 12 when on the HDq12 regimen;
a change in central retinal thickness of about -24 or -25 micrometers, between weeks 20 and 24 when on the HDq12 regimen;
a change in central retinal thickness of about -23 or -24 or -23.8 micrometers, between weeks 32 and 36 when on the HDq12 regimen;
a change in central retinal thickness of about -19 or -20 or -19.7 micrometers, between weeks 44 and 48 when on the HDq12 regimen;
a change in central retinal thickness of about -126, -127 or -126.6 micrometers, between weeks 0 and 4 when on the HDq16 regimen;
a change in central retinal thickness of about -12, -13 or -12.9 micrometers, between weeks 4 and 8 when on the HDq16 regimen;
a change in central retinal thickness of about -4 or -5 or -4.5 micrometers, between weeks 8 and 12 when on the HDq16 regimen;
a change in central retinal thickness of about -39, -40 or -39.4 micrometers, between weeks 24 and 28 when on the HDq16 regimen;
a change in central retinal thickness of about 0 or -1 or -0.6 micrometers, between weeks 36 and 40 when on the HDq16 regimen;
a change in central retinal thickness of about -15 or -16 micrometers, between weeks 40 and 44 when on the HDq16 regimen;
Date Recue/Date Received 2023-02-22 a change in central retinal thickness of about 0 or -1 or -0.8 micrometers, between weeks 44 and 48 when on the HDq16 regimen;
a change in central retinal thickness of about -11, -12 or -11.3 micrometers, between weeks 56 and 60 when on the HDq16 regimen;
in a subject in need thereof having an angiogenic eye disorder (preferably nAMD) comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of aflibercept, followed by one or more secondary doses of about 8 mg or more of the aflibercept, followed by one or more tertiary doses of about 8 mg or more of the aflibercept; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks (HDq12 regimen) or 16 weeks (HDq16 regimen) after the immediately preceding dose.
[000173]In an embodiment of the invention, CRT and/or retinal fluid is as measured on spectral domain optical coherence tomography (SD-OCT). In an embodiment of the invention, any of such achievements are maintained as long as the subject is receiving the treatment regimen.
[000174]The molecular weight adjusted concentration of bound aflibercept (adjusted bound aflibercept) is calculated by multiplying the observed concentrations by 0.717 to account for the target VEGF weight in the complex in plasma in the concentration-time profiles discussed herein.
[000175]In an embodiment of the invention, a subject receiving a treatment for an angiogenic eye disorder, e.g., nAMD, does not experience or is no more likely to experience than a subject receiving Eylea according to the prescribed dosage regimen:
= Ocular serious TEAE (e.g., through week 48 after treatment initiation), for example, cataract subcapsular, retinal detachment, ulcerative keratitis, vitreous haemorrhage or increased intraocular pressure, angle closure glaucoma, cataract, choroidal detachment, retinal detachment, retinal haemorrhage, skin laceration and/or vitreous haemorrhage;
= TEAE intraocular inflammation (e.g., through week 48 after treatment initiation), for example, chorioretinitis, iridocyclitis, iritis, uveitis, vitreal cells and/or vitritis;
= Non-ocular serious TEAEs (e.g., through week 48 after treatment initiation), for example, acute left ventricular failure, acute myocardial infarction, cardiac arrest, coronary artery disease, myocardial infarction, Covid-19 pneumonia, gangrene, pneumonia, hyponatraemia, cerebrovascular accident, acute kidney injury, acute respiratory failure, angina pectoris, chest pain, cellulitis, pneumonia, pyelonephritis Date Recue/Date Received 2023-02-22 acute, urinary tract infection, upper limb fracture, hyponatraemia, osteoarthritis, bladder neoplasm and/or cerebrovascular accident;
= Treatment emergent APTC event (e.g., through week 48 after treatment initiation), for example, non-fatal myocardial infarction, non-fatal stroke and/or vascular death;
= Treatment emergent hypertension events (e.g., through week 48 after treatment initiation), for example, blood pressure increased (diastolic and/or systolic), hypertension, diastolic hypertension, systolic hypertension, hypertensive crisis, hypertensive emergency, hypertensive urgency, labile hypertension and/or white coat hypertension;
= Potentially clinically significant values (e.g., through week 48 after treatment initiation), for example, systolic blood pressure160 mmHg and an increase from baseline of mmHg; and/or diastolic blood pressure 110 mmHg and an increase from baseline of 0 mmHg; and/or = Death (e.g., through week 48 after treatment initiation), for example, due to cardiac arrest, cardio-respiratory arrest, left ventricular failure, myocardial infarction, death, sudden death, covid-19, pneumonia, diabetic metabolic decompensation, endometrial cancer, acute kidney injury, abdominal strangulated hernia, pneumonia aspiration, skull fracture, metastatic neoplasm and/or non-small cell lung cancer [000176]The present invention further includes methods for achieving a pharmacokinetic effect in a subject suffering from nAMD comprising administering to an eye of the subject, at least one dose (e.g., a first dose) of about >8 mg VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept). The pharmacokinetic effect can be one or more set forth below:
= Decreasing ocular clearance of free VEGF antagonist (e.g., a VEGF
receptor fusion protein such as aflibercept) e.g., by about 34% relative to that of a dose of 2 mg of the VEGF
antagonist (e.g., a VEGF receptor fusion protein such as aflibercept);
= 0.2-0.3 (e.g., 0.310 or 0.245) mg/I free VEGF antagonist (e.g., a VEGF
receptor fusion protein such as aflibercept) in the plasma, e.g., within about 1,2 or 3 days of the first dose;
= About 0.38 or 0.5 mg/I adjusted bound VEGF antagonist (e.g., a VEGF
receptor fusion protein such as aflibercept) in the plasma, e.g., within about 14, 15 or 16 days of the first dose;
= Reaches LLOQ of free VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept) (about 15.6 ng/ml) in the plasma by about 3 0r4 weeks of the first dose;
= Reaches LLOQ of free VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept) (about 15.6 ng/ml) in the ocular compartment by about 15 weeks of the first dose;
Date Recue/Date Received 2023-02-22 = Reaches LLOQ of free VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept) (about 15.6 ng/ml) that is about 6 weeks longer than achieved for a 2 mg dose of the antagonist;
= A clearance of the VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept) from the ocular compartment of about 0.41 ml/day;
for example, wherein the subject is administered:
a single initial dose of about 8 mg or more of a VEGF antagonist (e.g., a VEGF
receptor fusion protein such as aflibercept), followed by one or more secondary doses of about 8 mg or more of the VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept), followed by one or more tertiary doses of about 8 mg or more of the VEGF antagonist (e.g., a VEGF receptor fusion protein such as aflibercept); wherein each secondary dose is administered about 2 to 4 weeks (preferably, 4 weeks) after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks (preferably, 12, 16 or 20 weeks) after the immediately preceding dose [000177]In an embodiment of the invention, the method for treating or preventing nAMD, in a subject in need thereof comprises administering >8 mg aflibercept (0.07 mL or 70 microliters) administered by intravitreal injection every 4 weeks (approximately every 28 days +/- 7 days, monthly) for the first three doses, followed by >8 mg aflibercept (0.07 mL) via intravitreal injection once every 8 ¨ 16 weeks (2 ¨4 months, +/- 7 days).
[000178]Some subject may be excluded from administration based, for example, on the existence of certain exclusion criteria. For example, in an embodiment of the invention, the criteria are one or more of ocular infection, periocular infection; active intraocular inflammation;
and/or hypersensitivity, e.g., to aflibercept or any component of a formulation thereof. The method presented herein may include the step of evaluating the subject for such exclusion criteria and excluding the subject from said administration if any one or more if found in the subject; and proceeding with administration if exclusion criteria are not found.
[000179]In an embodiment of the invention, a subject receiving VEGF antagonist (e.g., a VEGF
receptor fusion protein such as aflibercept) is monitored for adverse events (AEs) such as conjunctival hemorrhage, cataract, vitreous detachment, vitreous floaters, corneal epithelium defect and/or increased intraocular pressure. If an AE is found, the AE can be treated in the subject and treatment can either be discontinued or continued.
[000180]The methods of present invention can include preparatory steps that include use of = one single-dose glass vial having a protective plastic cap and a stopper containing an aqueous formulation comprising >8 mg aflibercept in about 70 microliters;
Date Recue/Date Received 2023-02-22 = one 18-gauge x 11/2-inch, 5-micron, filter needle that includes a tip and a bevel;
= one 30-gauge x 1/2-inch injection needle; and = one 1-mL Luer lock syringe having a graduation line marking for 70 microliters of volume;
packaged together (kits including such items form part of the present invention). The steps can include, for example: (1) visually inspecting the aqueous formulation in the vial and, if particulates, cloudiness, or discoloration are visible, then using another vial of aqueous formulation containing the aflibercept; (2) removing the protective plastic cap from the vial; and (3) cleaning the top of the vial with an alcohol wipe; then, using aseptic technique the following steps: (4) removing the 18-gauge x 11A-inch, 5-micron, filter needle and the 1 mL syringe from their packaging; (5) attaching the filter needle to the syringe by twisting it onto the Luer lock syringe tip; (6) pushing the filter needle into the center of the vial stopper until the needle is completely inserted into the vial and the tip touches the bottom or a bottom edge of the vial; (7) withdrawing all of the aflibercept vial contents into the syringe, keeping the vial in an upright position, slightly inclined, while ensuring the bevel of the filter needle is submerged into the liquid; (8) continuing to tilt the vial during withdrawal keeping the bevel of the filter needle submerged in the formulation; (9) drawing the plunger rod sufficiently back when emptying the vial in order to completely empty the filter needle; (10) removing the filter needle from the syringe and disposing of the filter needle; (11) removing the 30-gauge x 1/2-inch injection needle from its packaging and attaching the injection needle to the syringe by firmly twisting the injection needle onto the Luer lock syringe tip; (12) holding the syringe with the needle pointing up, and checking the syringe for bubbles, wherein if there are bubbles, gently tapping the syringe with a finger until the bubbles rise to the top; and (13) slowly depressing the plunger so that the plunger tip aligns with the graduation line that marks 70 microliters on the syringe.
[000181]Preferably injection of aflibercept as performed in methods of the present invention is performed under controlled aseptic conditions, which comprise surgical hand disinfection and the use of sterile gloves, a sterile drape, and a sterile eyelid speculum (or equivalent) and anesthesia and a topical broad¨spectrum microbicide are administered prior to the injection.
Switching [000182]The present invention includes embodiments wherein a subject is initially administered aflibercept manufactured by a first process (a first aflibercept) and then switched to aflibercept manufactured by a different process (e.g., a second aflibercept; e.g., a biosimilar aflibercept); for example, wherein each process is carried out by a different manufacturer.
Date Recue/Date Received 2023-02-22 [000183]Subjects may initially be receiving aflibercept according to a 2q8 dosing regimen comprising administering 3 initial monthly doses followed by one or more maintenance doses every 8 weeks (e.g., Eylea) and then switch to a HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen. The aflibercept administered in the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen may have been manufactured by a different process, e.g., by a different manufacturer.
[000184]In addition, a subject may be receiving a HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen with aflibercept and then switch to aflibercept manufactured by a different process, e.g., by a different manufacturer, while remaining on the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen.
[000185]The present invention encompasses methods for treating an angiogenic eye disorder, preferably nAMD, wherein a subject is switched, from a first aflibercept for use in a HDq12-20 or HDq12 or HDq16 or HDq20 regimen to a second aflibercept for use in a HDq12-20 or HDq12 or HDq16 or HDq20 regimen. The present invention includes embodiments wherein the subject initiates treatment of the second aflibercept HDq12 or HDq16 regimen at any dosing phase-initial, secondary or tertiary/maintenance¨after having received the initial dose, one or more secondary doses or one or more tertiary/maintenance doses of the first aflibercept HDq12-20 or HDq12 or HDq16 or HDq20 regimen. Thus, the present invention includes embodiments wherein, the subject is switched from any phase of the first HDq12-20 or HDq12 or HDq16 or HDq20 regimen into any phase of the second HDq12-20 or HDq12 or HDq16 or HDq20 regimen. Preferably, the subject will pick up receiving the second aflibercept HDq12-20 or HDq12 or HDq16 or HDq20 regimen at the dosing phase that corresponds to where dosing was stopped with the first HDq12-20 or HDq12 or HDq16 or HDq20 regimen, e.g., if a particular secondary dose was due with the first aflibercept therapy, the subject would timely receive the same secondary dose with the second aflibercept and, for example, continue receiving the second aflibercept according to the HDq12-20 or HDq12 or HDq16 or HDq20 regimen as needed thereafter.
[000186]The present invention also encompasses methods for treating an angiogenic eye disorder wherein a subject is switched, from a first aflibercept for use in a 2q8 regimen to a second aflibercept for use in a HDq12-20 or HDq12 or HDq16 or HDq20 regimen.
The present invention includes embodiments wherein the subject initiates treatment of the second aflibercept HDq12-20 or HDq12 or HDq16 or HDq20 regimen at any dosing phase-initial, secondary or tertiary/maintenance¨after having received the initial dose, one or more secondary doses or one or more tertiary/maintenance doses of the first aflibercept 2q8 regimen.
Thus, the present Date Recue/Date Received 2023-02-22 invention includes embodiments wherein, for example, the subject is switched directly to the maintenance phase of the HDq12-20 or HDq12 or HDq16 or HDq20 regimen with second aflibercept after having received the initial and a single secondary dose in the 2q8 regimen with the first aflibercept.
[000187]In an embodiment of the invention, a subject who has received an initial, one or more secondary doses and/or one or more tertiary doses of 2 mg aflibercept (e.g., Eylea) therapy (e.g., 2q8) according to the prescribed dosing regimen may receive an >8 mg dose of aflibercept, undergo an evaluation by a treating physician in about 8 or 10 or 12 weeks and, if, in the judgment of a treating physician, dosing every 12 weeks or every 16 weeks or every 20 weeks is appropriate (e.g., there is no undue loss in BCVA and/or increase in CRT), then continuing to dose the subject every 12-20 or 12 weeks or 16 weeks or 20 weeks with >8 mg aflibercept.
[000188]The present invention includes methods for treating or preventing an angiogenic eye disorder, preferably, nAMD, in a subject in need thereof, by administering to said subject >8 mg aflibercept, wherein:
= the subject has received an initial >8 mg dose of aflibercept; then the method comprises after 1 month administering to the subject the first >8 mg secondary dose of aflibercept and 1 month thereafter, administering the 2nd >8 mg secondary dose of aflibercept; and then, every 12-20 or 12 or 16 or 20 weeks thereafter, administering one or more >8 mg maintenance doses of aflibercept according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen;
or = the subject has received an initial >8 mg dose of aflibercept & a 1st >8 mg secondary dose of aflibercept after 1 month, then the method comprises, after another 1 month, administering to the subject the 2nd >8 mg secondary dose of aflibercept; and then, every 12-20 or 12 or 16 or 20 weeks thereafter, one or more >8 mg maintenance doses of aflibercept according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen;
or = the subject has received an initial >8 mg dose of aflibercept & a 1st >8 mg secondary dose of aflibercept after 1 month & a 2nd >8 mg secondary dose of aflibercept after another month; then the method comprises, after 12-20 or 12 or 16 or 20 weeks, administering to the subject the 1st >8 mg maintenance dose of aflibercept and all further >8 mg maintenance doses of aflibercept every 12-20 or 12 or 16 or 20 weeks according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen;
Date Recue/Date Received 2023-02-22 or = the subject has received an initial >8 mg dose of aflibercept & a 1st >8 mg secondary dose of aflibercept after 1 month & a 2nd >8 mg secondary dose of aflibercept after another month, then, every 12-20 or 12 or 16 or 20 weeks thereafter, the subject has received one or more >8 mg maintenance doses of aflibercept; then the method comprises after 12-20 or 12 or 16 or 20 weeks from the last maintenance dose of aflibercept, administering to the subject one or more >8 mg maintenance doses of aflibercept and all further >8 mg maintenance doses of aflibercept every 12-20 or 12 or 16 or 20 weeks according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen.
[000189]Subjects may switch from a reference 2 mg aflibercept dosing regimen to a particular step in the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen. For example, a subject may receive only the initial 2mg dose of reference, and then, skipping the initial and secondary doses of the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen, begin receiving the HDq12-20 or HDq12 or HDq16 or HDq20 maintenance doses. The present invention includes methods for treating or preventing an angiogenic eye disorder, preferably nAMD, in a subject in need thereof, by administering to said subject about >8 mg aflibercept, wherein:
(1) the subject has received an initial 2 mg dose of aflibercept then the method comprises, after 1 month, administering to the subject the initial >8 mg dose of aflibercept and, 1 month thereafter, the 1st >8 mg secondary dose of aflibercept; and, 1 month thereafter, the 2nd >8 mg secondary dose of aflibercept; and then, every 12-20 or 12 or 16 or 20 weeks thereafter, one or more >8 mg maintenance doses of aflibercept according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen;
(2) the subject has received an initial 2 mg dose of aflibercept, then the method comprises, after 1 month, administering to the subject, the first >8 mg secondary dose of aflibercept and, 1 month thereafter, the 2nd >8 mg secondary dose of aflibercept; and then, every 12-20 or 12 or 16 or 20 weeks thereafter, one or more >8 mg maintenance doses of aflibercept according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen;
(3) the subject has received an initial 2 mg dose of aflibercept, then the method comprises, after 1 month, administering to the subject the 2nd >8 mg secondary dose of aflibercept and then, every 12-20 or 12 or 16 or 20 weeks thereafter, one or more >8 mg maintenance doses of aflibercept according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen;
Date Recue/Date Received 2023-02-22 (4) the subject has received an initial 2 mg dose of aflibercept, then the method comprises, after 1 month, administering to the subject the 1st >8 mg maintenance dose of aflibercept and all further >8 mg maintenance doses of aflibercept every 12-20 or 12 or 16 or 20 weeks according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen;
(5) the subject has received an initial 2 mg dose of aflibercept and a 1st 2 mg secondary dose of aflibercept after 1 month, then the method comprises, after another 1 month, administering to the subject the initial >8 mg dose of aflibercept and, 1 month thereafter, the 1st >8 mg secondary dose of aflibercept; and 1 month thereafter, the 2nd >8 mg secondary dose of aflibercept; and then, every 12-20 or 12 or 16 or 20 weeks thereafter, one or more >8 mg maintenance doses of aflibercept according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen;
(6) the subject has received an initial 2 mg dose of aflibercept and a 1st 2 mg secondary dose of aflibercept after 1 month, then the method comprises, after another 1 month, administering to the subject a first >8 mg secondary dose of aflibercept and, 1 month thereafter, the 2nd >8 mg secondary dose of aflibercept; and then, every 12-20 or 12 or 16 or 20 weeks thereafter, one or more >8 mg maintenance doses of aflibercept according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen;
(7) the subject has received an initial 2 mg dose of aflibercept and a 1st 2 mg secondary dose of aflibercept after 1 month, then the method comprises, after another 1 month, administering to the subject the 2nd >8 mg secondary dose of aflibercept and then, every 12-20 or 12 or 16 or 20 weeks thereafter, one or more >8 mg maintenance doses of aflibercept according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen;
(8) the subject has received an initial 2 mg dose of aflibercept and a 1st 2 mg secondary dose of aflibercept after 1 month, then the method comprises, after another 1 month, administering to the subject the 1st >8 mg maintenance dose of aflibercept and all further >8 mg maintenance doses of aflibercept every 12-20 or 12 or 16 or 20 weeks according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen;
(9) the subject has received an initial 2 mg dose of aflibercept and a 1st 2 mg secondary dose of aflibercept after 1 month and a 2nd 2 mg secondary dose of aflibercept after another 1 month, then the method comprises, after another 1 month, administering to the subject the initial >8 mg dose of aflibercept and, 1 month thereafter, the 1st >8 mg secondary dose of aflibercept; and 1 month thereafter, the 2nd >8 mg secondary dose of aflibercept; and then, every 12-20 or 12 or 16 or 20 weeks thereafter, one or more >8 mg maintenance doses of aflibercept according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen;
Date Recue/Date Received 2023-02-22 (10) the subject has received an initial 2 mg dose of aflibercept and a 1st 2 mg secondary dose of aflibercept after 1 month and a 2nd 2 mg secondary dose of aflibercept after another 1 month, then the method comprises, after another 1 month, administering to the subject the first >8 mg secondary dose of aflibercept and, 1 month thereafter, the 2nd >8 mg secondary dose of aflibercept; and then, every 12-20 or 12 or 16 or 20 weeks thereafter, one or more >8 mg maintenance doses of aflibercept according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen;
(11) the subject has received an initial 2 mg dose of aflibercept and a 1st 2 mg secondary dose of aflibercept after 1 month and a 2nd 2 mg secondary dose of aflibercept after another 1 month, then the method comprises, after another 1 month, administering to the subject the 2nd >8 mg secondary dose of aflibercept and then, every 12-20 or 12 or 16 or 20 weeks thereafter, one or more >8 mg maintenance doses of aflibercept according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen;
(12) the subject has received an initial 2 mg dose of aflibercept and a 1st 2 mg secondary dose of aflibercept after 1 month and a 2nd 2 mg secondary dose of aflibercept after another 1 month, then the method comprises, after 2 months, administering to the subject the 1st >8 mg maintenance dose of aflibercept and, all further >8 mg maintenance doses of aflibercept every 12-20 or 12 or 16 or 20 weeks according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen;
(13) the subject has received an initial 2 mg dose of aflibercept and a 1st 2 mg secondary dose of aflibercept after 1 month and a 2nd 2 mg secondary dose of aflibercept after another 1 month and a 1st 2 mg maintenance dose of aflibercept after 8 weeks, then the method comprises, up to 2 months after the last dose of aflibercept, administering to the subject the initial >8 mg dose of aflibercept and 1 month thereafter, the 1st >8 mg secondary dose of aflibercept; and 1 month thereafter, the 2nd >8 mg secondary dose of aflibercept; and then, every 12-20 or 12 or 16 or 20 weeks thereafter, one or more >8 mg maintenance doses of aflibercept according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen;
(14) the subject has received an initial 2 mg dose of aflibercept and a 1st 2 mg secondary dose of aflibercept after 1 month and a 2nd 2 mg secondary dose of aflibercept after another 1 month and 1 or more 2 mg maintenance doses of aflibercept after 8 weeks, then the method comprises up to 2 months after the last dose of aflibercept, administering to the subject the first >8 mg secondary dose of aflibercept and 1 month thereafter, the 2nd >8 mg secondary dose of aflibercept; and then, every 12-20 or 12 or 16 or 20 weeks thereafter, Date Recue/Date Received 2023-02-22 one or more >8 mg maintenance doses of aflibercept according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen;
(15) the subject has received an initial 2 mg dose of aflibercept and a 1st 2 mg secondary dose of aflibercept after 1 month and a 2nd 2 mg secondary dose of aflibercept after another 1 month and 1 or more 2 mg maintenance doses of aflibercept after 8 weeks, then the method comprises up to 2 months after the last dose of aflibercept, administering to the subject the 2nd >8 mg secondary dose of aflibercept and then, every 12-20 or 12 or 16 or 20 weeks thereafter, one or more >8 mg maintenance doses of aflibercept according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen;
(16) the subject has received an initial 2 mg dose of aflibercept and a 1st 2 mg secondary dose of aflibercept after 1 month and a 2nd 2 mg secondary dose of aflibercept after another 1 month and 1 or more 2 mg maintenance doses of aflibercept after 8 weeks, then the method comprises up to 2 months after the last dose of aflibercept, administering to the subject the 1st >8 mg maintenance dose of aflibercept and all further >8 mg maintenance doses of aflibercept every 12-20 or 12 or 16 or 20 weeks according to the HDq12-20 or HDq12 or HDq16 or HDq20 dosing regimen.
Precision Dose Drug Delivery [000190]The present invention provides methods as set forth herein wherein a VEGF
antagonist (e.g., aflibercept) is delivered with a high amount of precision, e.g., with a drug delivery device (DDD) (e.g., with a 0.5 mL volume), whether pre-filled or capable of being filled from a vial, and delivering a volume of between 70 and 100 microliter with an average volume of about 81 or 82 or 81-82 microliters, e.g., with a standard deviation of about 4 or 5 or 4-5 microliters (e.g., about 4.5 or 4.46 microliters) or less. In an embodiment of the invention, the DDD is a syringe, e.g., with a 30 gauge, 1/2 inch needle.
[000191]One means for ensuring precision of a dose to be delivered with a device, such as a syringe, is by employing a syringe wherein the dose volume is device-determined. If the dose volume is device-determined, the device is designed only to deliver a single volume (e.g., 87 microliters) or a single volume with a limited amount of acceptable error (+ 4-5 microliters).
Thus, if used properly, the user cannot deliver the wrong dose (e.g., cannot deliver more than the intended volume from the device).
[000192]The present invention includes embodiments wherein, a precise dosage of about 8 mg or more is a dose of about 9, 9.3, 9.33, 9.7, 9.8, 9.9, 9.7-9.9 mg or more +
about 0.5, or + about 0.51 mg is delivered to a subject's eye. The volume in which a dose is delivered can be, for Date Recue/Date Received 2023-02-22 example, about 70, 81, 82, 81.7, 85, 86, 87, 85-87 microliters + about 4, 4.45, 4.5, or 5 microliters. Doses may be delivered with a dose delivery device (DDD) which is a syringe.
[000193]Highly precise doses of VEGF antagonist (e.g., aflibercept) may be delivered, for example, in a volume that is device-determined (wherein the device is a syringe), by a method that includes the steps: (a) priming the syringe (e.g., a pre-filled syringe), thereby removing air from the syringe and, thus avoiding injection of air into the eye, by advancing the plunger rod by a predetermined distance into the syringe body until advancement of the plunger rod is resisted by a stop; (b) rotating the plunger rod about a longitudinal axis; and (c) actuating the plunger rod to dispense a predetermined (device-determined) volume (e.g., about 70, 81, 82, 81.7, 85, 86, 87, 85-87 microliters, + about 4, 4.45, 4.5, or 5 microliters) of the formulation.
[000194]In an embodiment of the invention, the drug delivery device (DDD), comprises:
= a barrel including a longitudinal axis, a proximal end region, and a distal end region, the proximal end region including an opening, wherein the barrel is configured to receive a drug therein;
= a plunger rod disposed at least partially inside the barrel and protruding from the opening, wherein the plunger rod includes a rack having a plurality of teeth;
and = a pinion having a plurality of teeth configured to engage with the plurality of teeth of the rack, wherein rotation of the pinion against the rack moves at least a part of the plunger rod along the longitudinal axis of the barrel; for example, which further comprises a shaft affixed to the pinion, wherein rotation of the shaft rotates the pinion against the rack which may include a knob affixed to the shaft. In an embodiment of the invention, the DDD further includes a magnifier disposed on the distal end region of the barrel. In an embodiment of the invention, the DDD
further includes a stopper inside the barrel, wherein the stopper is affixed to a distal end of the plunger rod. In an embodiment of the invention, the DDD further includes a circular ratchet disposed coaxially with the pinion, wherein the circular ratchet has a diameter smaller than a diameter of the pinion; a spring-loaded pawl disposed on an internal circumference of the pinion, wherein the pawl is configured to engage the ratchet; and a shaft affixed to the ratchet, wherein rotation of the shaft in one direction causes rotation of the pinion, and rotation of the shaft in a second direction does not cause rotation of the pinion for example wherein the ratchet is disposed inside the pinion. In an embodiment of the invention, the pinion includes a plurality of teeth having a first height, and a stopper tooth having a second height greater than the first height, for example, wherein the second height of the stopper tooth prevents the pinion from engaging the plurality of teeth of the rack, and/or wherein the second height of the stopper tooth Date Recue/Date Received 2023-02-22 is configured to contact one of the plunger rod and the rack to stop rotation of the pinion. In an embodiment of the invention, the plunger rod includes an inner column and an outer lumen, and wherein the rack is disposed on the inner column, e.g., wherein rotation of the pinion against the rack moves the inner column of the plunger rod independently of the outer lumen, and/or further including a shaft removably affixed to the pinion, wherein the shaft prevents movement of the outer lumen of the plunger rod relative to the barrel, and wherein removal of the shaft allows for movement of the outer lumen of the plunger rod relative to the barrel. In an embodiment of the invention, the plunger rod further includes a body and a flange, the flange extending partially along a longitudinal length of the body and having a width greater than a width of the body;
wherein the barrel further comprises a plunger lock, the plunger lock including a through hole configured to allow the flange to pass through the second plunger lock in a specific orientation.
[000195]In an embodiment of the invention, the drug delivery device (DDD), comprises:
= a barrel including a longitudinal axis, a proximal end region, a distal end region, and an interior, the proximal end region including an opening and the interior including a threaded region; and = a plunger rod disposed at least partially inside the barrel and protruding from the opening, the plunger rod including a threaded region configured to engage the threaded region of the barrel interior, wherein rotation of the plunger rod about the longitudinal axis of the drug delivery device moves the plunger rod along the longitudinal axis. In an embodiment of the invention, the plunger rod further includes a tab protruding from the plunger rod in a first direction and located proximally from the threaded region of the plunger rod, and wherein the threaded region in the interior of the barrel further includes a slot sized and configured to allow for the tab to pass through the threaded region in the interior of the barrel, e.g., wherein the slot includes a first segment parallel to the longitudinal axis of the drug delivery device and a second segment perpendicular to the longitudinal axis of the drug delivery device - the slot may include a third segment parallel to the longitudinal axis of the drug delivery device, wherein the second segment is in between the first segment and the third segment. In an embodiment of the invention, the tab is a first tab, and wherein the plunger rod further includes a second tab protruding from the plunger rod in a second direction opposite to the first direction, and wherein the threaded region in the interior of the barrel further includes a second slot sized and configured to allow for the second tab to pass through the threaded region in the interior of the barrel.
[000196]In an embodiment of the invention, the drug delivery device, includes:
Date Recue/Date Received 2023-02-22 = a barrel having a proximal end region, a distal end region, an opening in the proximal end region, an interior, and a threaded region in the interior;
= a sleeve disposed partly inside the barrel and protruding from the opening in the proximal end region of the barrel, the sleeve including a threaded region engaged with the threaded region of the barrel interior;
= a plunger rod disposed at least partially inside the sleeve; and = a stopper inside the barrel and located distally from the sleeve, the stopper connected to a distal end of the plunger rod, wherein rotation of the sleeve in a first direction around a longitudinal axis of the drug delivery device moves the sleeve towards the distal end region of the barrel. In an embodiment of the invention, rotation of the sleeve in the first direction moves the stopper towards the distal end region of the barrel. In an embodiment of the invention; the sleeve includes an inner passage, and the stopper has a diameter larger than a diameter of the inner passage;
and/or the sleeve includes a tab disposed on an exterior of the sleeve, the tab located proximally from the threaded region of the barrel interior, and wherein the tab stops movement of the sleeve towards the distal end region of the barrel, e.g., wherein the tab is configured to stop movement of the sleeve towards the distal end region of the barrel after the drug delivery device has been primed or wherein the tab is a first tab, and wherein the sleeve further includes a second tab disposed on an exterior of the sleeve, the second tab located distally from the threaded region of the barrel interior, wherein the second tab stops movement of the sleeve towards the proximal end region of the barrel.
[000197]In an embodiment of the invention, the drug delivery device, comprises:
= a barrel including a proximal end region and a distal end region, the proximal end region including an opening;
= a plunger rod including a body and a flange, the flange extending partially along a longitudinal length of the body and having a width greater than a width of the body, the plunger rod disposed at least partially inside the barrel and protruding from the opening;
= a first plunger lock disposed on the barrel, the first plunger lock configured to block the flange from entering the barrel; and = a second plunger lock disposed in the barrel, the second plunger lock including a through hole configured to allow the flange to pass through the second plunger lock in a specific orientation.
[000198]For example, in an embodiment of the invention, the first plunger lock is removable and/or frangible. In an embodiment of the invention, a distance between the first plunger lock Date Recue/Date Received 2023-02-22 and the second plunger lock is equivalent to the distance that the stopper must travel to prime the drug delivery device; and/or the plunger rod is rotatable around a longitudinal axis of the drug delivery device.
[000199]Substances from such a DDD (e.g., a formulation including aflibercept as described herein), having a plunger rod and a barrel, may be dispensed as follows:
= advancing the plunger rod by a predetermined distance into the barrel until advancement of the plunger rod is resisted by a stop;
= deactivating the stop; and = actuating the plunger rod (e.g., which includes a flange, wherein the stop includes a lock that prevents the flange from entering the barrel; or which includes a flange, wherein the stop comprises a lock that prevents the flange from entering the barrel) to deliver the substance.
Advancing the plunger rod may include the step of rotating a pinion against a rack disposed on the plunger rod, e.g., wherein the stop comprises a shaft removably affixed to the pinion, and wherein deactivating the stop comprises removing the shaft from the pinion.
Deactivating the stop may include the step of rotating the plunger rod. In an embodiment of the invention, deactivating the stop includes the step of removing the lock and/or breaking the lock.
[000200]In an embodiment of the invention, the drug delivery device, includes:
= a barrel including a longitudinal axis, a proximal end region, and a distal end region, the proximal end region including an opening and a rack disposed on the interior of the barrel, the rack having a plurality of teeth, wherein the barrel is configured to receive a drug therein;
= a plunger rod disposed at least partially inside the barrel and protruding from the opening, wherein the plunger rod includes a rack having a plurality of teeth;
a pinion having a plurality of teeth configured to engage with the plurality of teeth of the plunger rod rack; and = an inner plunger coupled to the pinion by a rod, wherein rotation of the pinion against the plunger rod rack results in movement of the inner plunger along the longitudinal axis of the barrel;
for example, wherein the teeth of the pinion are further configured to engage with the plurality of teeth of the rack disposed on the barrel. In an embodiment of the invention, the pinion is a first pinion, and further includes: a second pinion disposed coaxially with the first pinion, the second pinion having a diameter smaller than a diameter of the first pinion and a plurality of teeth configured to engage with the plurality of the teeth of the rack disposed on the barrel, wherein rotation of the first pinion results in rotation of the second pinion against the rack disposed on the barrel and in movement of the inner plunger along the longitudinal axis of the barrel.
[000201]See International patent application publication no. W02019/118588.
Date Recue/Date Received 2023-02-22 [000202]In an embodiment of the invention, the drug delivery device (DDD), includes:
= a body;
= a plunger rod disposed partially inside the body;
= a protrusion extending from the plunger rod; and = a blocking component coupled to a proximal end portion of the body, wherein the blocking component is a flange piece, wherein, when the protrusion is in a first position relative to the blocking component, the blocking component restricts distal movement of the plunger rod to a first stopping point, and when the protrusion is in a second position relative to the blocking component, the blocking component restricts distal movement of the plunger rod to a second stopping point. In an embodiment of the invention, the DDD further includes: a stopper disposed in the body, wherein distal movement of the plunger rod distally moves the stopper; and a drug substance disposed in the body in between the stopper and a distal end of the body, wherein distal movement of the plunger rod to the first stopping point primes the drug delivery device, and distal movement of the plunger rod to the second stopping point dispenses a predetermined volume of the drug substance from a distal end of the device.
[000203]In an embodiment of the invention, moving the protrusion from the first position to the second position includes twisting the plunger rod relative to the blocking component. In an embodiment of the invention, the DDD further includes: a cavity in a proximal side of the blocking component, the cavity sized and configured to receive a portion of the protrusion, wherein when the protrusion is in the second position relative to the blocking component, the protrusion is positioned proximally from the cavity, such that distal movement of the plunger rod moves the protrusion into the cavity; e.g., wherein the cavity is a first cavity, and further includes: a second cavity in a proximal side of the blocking component, the second cavity sized and configured to receive a portion of the protrusion, wherein the first and second cavity are located on opposite sides of a central longitudinal axis of the drug delivery device. In an embodiment of the invention, the plunger rod passes through an opening in the blocking component. In an embodiment of the invention the DDD further includes an actuation portion at a proximal end portion of the plunger rod, wherein the protrusion extends from the actuation portion, e.g., wherein the actuation portion includes a generally cylindrical shape having a diameter greater than a width of the remainder of the plunger rod, wherein the protrusion extends from a side of the generally cylindrical shape, and wherein the actuation portion further comprises: a thumb pad on a proximal end of the actuation portion; and a ring on an exterior surface on the side of the generally cylindrical shape; e.g., further including a proximal collar on Date Recue/Date Received 2023-02-22 the blocking component, wherein the actuation portion partially fits inside the proximal collar;
e.g., wherein the plunger rod further includes a pair of extensions protruding distally from the actuation portion and the blocking component (e.g., which includes one or more indents formed along a bottom wall of the blocking component; and wherein a portion of each extension is configured to be received by the one or more indents upon distal movement of the plunger rod relative to the blocking component to allow distal movement of the plunger rod to the second stopping point; or, which includes one or more indents formed along a bottom wall of the blocking component; and wherein a portion of each extension is configured to be received by the one or more indents upon distal movement of the plunger rod relative to the blocking component to allow distal movement of the plunger rod to the second stopping point; or, which includes a pair of internal grooves formed along a sidewall of the blocking component; and wherein a portion of each extension is configured to be received by at least one of the pair of internal grooves upon rotation of the plunger rod relative to the blocking component to expand the extensions radially-outward from a compressed state to a relaxed state) includes a pair of openings; and wherein a portion of each extension is configured to be received by one of the pair of openings in the first stopping point. In an embodiment of the invention, the protrusion is a first protrusion, and further includes a second protrusion extending from the plunger rod in a direction opposite to the first protrusion. In an embodiment of the invention, the blocking component is slidably coupled to the body and includes a third cavity and a pair of ribs that extend into the third cavity, wherein the body includes a top flange and the pair of ribs are configured to engage the top flange received in the third cavity; wherein the pair of internal ribs are configured to apply a distally-directed force onto the top flange. In an embodiment of the invention, the blocking component is slidably coupled to the body and includes a pair of movable tabs that are configured to engage the body; and the pair of movable tabs are laterally deflectable upon receiving the body in the blocking component and are configured to apply a radially-inward directed force onto the body. In an embodiment of the invention, the blocking component further includes a pair of finger flanges, and each of the finger flanges includes a textured surface having a predefined pattern that increases a grip of the blocking component.
[000204]In an embodiment of the invention, the drug delivery device (DDD), includes:
= a body;
= a plunger rod having a distal end contacting a stopper inside the body, and a proximal end including an actuation portion with a thumb pad;
= a plurality of protrusions extending from the actuation portion; and Date Recue/Date Received 2023-02-22 = a blocking component disposed on the body, the blocking component including a proximal collar having a plurality of slots, wherein, when the protrusions and the slots are in a first configuration relative to one another, the blocking component restricts distal movement of the plunger rod to a first stopping point, and when the protrusions and the slots are in a second configuration, the blocking component restricts distal movement of the plunger rod to a second stopping point, wherein, in the second configuration, the slots are configured to receive the protrusions upon distal movement of the plunger rod. In an embodiment of the invention, the protrusions and the slots are movable from the first configuration to the second configuration by rotation of the actuation portion about a longitudinal axis in relation to the blocking component, and wherein when the protrusions and the slots are in the second configuration, the protrusions and the slots are not movable to the first configuration; and/or a difference between the first stopping point and the second stopping point is equivalent to a distance that the stopper must travel to expel a predetermined volume of a drug product from a distal end of the body, and wherein the plunger rod is prevented from moving from the second stopping point to the first stopping point; and/or the plurality of protrusions includes two protrusions disposed symmetrically about the actuation portion; and/or the blocking component further comprises a pair of finger flanges; and/or the drug delivery device is a pre-filled syringe;
and/or the drug delivery device is changeable: (a) from a pre-use state to a primed state, by longitudinally moving the plunger rod (e.g., wherein the plunger rod includes a neck disposed distally from the actuation portion, wherein the neck interfaces with an opening in the blocking component to prevent proximal movement of the plunger rod, for example, wherein the neck further interfaces with the opening in the blocking component to prevent movement of the drug delivery device from the delivery state to the primed state) until the plunger rod reaches the first stopping point; (b) from the primed state to a delivery state by rotating the plunger rod in relation to the blocking component until the protrusions and the blocking component are in the second configuration; and (c) from a delivery state to a used state by longitudinally moving the plunger rod until the plunger reaches the second stopping point, wherein the drug delivery device is not changeable from the used state to the delivery state, from the delivery state to the primed state, or from the primed state to the pre-use state. In an embodiment of the invention, when the plunger rod is at the second stopping point, the stopper does not contact a distal end of the body.
[000205]In an embodiment of the invention, a drug delivery device, includes:
= a body;
Date Recue/Date Received 2023-02-22 = a plunger rod, including:
= a distal portion contacting a stopper inside the body;
= a proximal end including a generally cylindrical actuation portion disposed outside of the body; and = two protrusions extending from opposite sides of the actuation portion in a symmetrical configuration; and = a blocking component coupled to the body, the blocking component including: a collar configured to accept a distal part of the actuation portion; and two cavities in the collar having proximally-facing openings, wherein each cavity is configured to accept a distal portion of one of the two protrusions;
wherein the plunger rod is longitudinally movable and rotatable about a longitudinal axis relative to the blocking component, and wherein, when the drug delivery device is in a pre-use state, the protrusions and the cavity openings are not longitudinally aligned, and when the drug delivery device is in a delivery state, the protrusions and the cavity openings are longitudinally aligned. In an embodiment of the invention, the blocking component further includes a finger flange, and further includes a ribbed surface on a side of the actuation portion. In an embodiment of the invention, the plunger rod further includes: two extensions protruding distally from the actuation portion; and a plurality of openings in the collar of the blocking component, wherein a portion of each extension is configured to be received by one of the plurality of openings upon distal movement of the plunger rod relative to the blocking component.
[000206]In an embodiment of the invention, a drug delivery device includes:
= a body;
= a stopper disposed inside the body;
= a sleeve having a proximal end and a distal end, the distal end being disposed inside the body, proximally from the stopper; and = a plunger rod disposed at least partially inside the sleeve;
wherein, when the stopper is in a ready position, distal advancement of one of (a) only the sleeve, (b) only the plunger rod, or (c) both the sleeve and the plunger rod together, relative to the body advances the stopper to a primed position, and wherein, when the stopper is in the primed position, distal advancement of another of (a) only the sleeve, (b) only the plunger rod, or (c) both the sleeve and the plunger rod together, relative to the body advances the stopper to a dose completion position. For example, in an embodiment of the invention, a DDD further includes a removable blocking component (e.g., wherein the blocking component is a clip Date Recue/Date Received 2023-02-22 removably secured around at least a portion of the sleeve) disposed between a proximal portion of the sleeve and a proximal end of the body, the blocking component obstructing distal advancement of the sleeve relative to the body, wherein distal advancement of the sleeve relative to the body after removal of the blocking component advances the stopper to the primed position. In an embodiment of the invention, the DDD further includes a removable locking component (e.g., a pin, a tab, or a bar) that couples the plunger rod to the sleeve, wherein distal advancement of both the sleeve and the plunger rod together relative to the body advances the stopper to the primed position, wherein distal advancement of only the plunger rod relative to the body after removal of the locking component advances the stopper to the dose completion position. In an embodiment of the invention, in the dose completion position, a proximal end of the plunger rod abuts against a distal end of the sleeve, such that the plunger rod is prevented from advancing distally any further relative to the body. In an embodiment of the invention, the DDD further includes a protrusion disposed on the plunger rod; and an inner protrusion disposed on an interior wall of the sleeve distally to the protrusion of the plunger rod, wherein distal advancement of only the plunger rod relative to the body advances the stopper to the primed position and causes the protrusion of the plunger rod to contact the inner protrusion of the sleeve, and wherein distal advancement of both the plunger rod and the sleeve relative to the body, after the protrusion of the plunger rod has contacted the inner protrusion of the sleeve, advances the stopper to the dose completion position. In an embodiment of the invention, the sleeve includes a finger flange. In an embodiment of the invention, the DDD
further includes a stop disposed at a proximal end of the body, the stop sized to block distal advancement of the sleeve or the plunger rod once the stopper is in the completion position.
[000207]In an embodiment of the invention, a drug delivery device, includes:
= a body;
= a plunger rod having a distal portion disposed inside the body and a proximal portion disposed outside a proximal end of the body, the proximal portion having a width greater than a width of the distal portion; and = an obstruction that, in an obstructing position relative to the plunger rod, prevents distal advancement of the plunger rod from a primed position to a dose completion position, wherein displacement of the obstruction from the obstructing position permits distal advancement of the plunger rod to the dose completion position, for example, further including a collar affixed to a proximal end portion of the body, the collar surrounding the proximal portion of the plunger rod; and a collar projection extending radially inward from the collar, wherein the proximal portion of the plunger rod includes a channel into which the collar projection protrudes, Date Recue/Date Received 2023-02-22 the channel including a circumferential path and an axial dose completion path, wherein the obstruction comprises the collar projection, which, when disposed in the circumferential path of the channel, prevents distal advancement of the plunger rod to the dose completion position, and wherein displacement of the obstruction from the obstructing position comprises twisting the plunger rod about a longitudinal axis to align the collar projection with the axial dose completion path. For example, in an embodiment of the invention, the channel further includes an axial priming path offset from the axial dose completion path, and connected to the axial dose completion path by the circumferential path, and distal movement of the plunger rod such that the collar projection travels on the axial priming path advances the plunger rod to the primed position. In an embodiment of the invention, the DDD further includes a finger flange. In an embodiment of the invention, the proximal portion of the plunger rod includes a projection extending radially outward, and the drug delivery device further includes: a rotatable alignment component disposed in between the proximal portion of the plunger rod and the body, the alignment component including a channel, the channel sized and configured to accommodate the plunger rod projection, wherein the obstruction comprises a wall of the channel that blocks a distal axial path of the plunger rod projection when the plunger rod is in the primed position, and wherein displacement of the obstruction from the obstructing position comprises rotating the alignment component to remove the wall of the channel from the distal axial path of the plunger rod projection, e.g., further including a finger flange coupled to a proximal end portion of the body, wherein the rotatable alignment component is disposed between the finger flange and the proximal portion of the plunger rod. In an embodiment of the invention, the DDD further includes a flange piece disposed at the proximal end of the body, wherein the obstruction includes a removable cap that, when in the obstructing position relative to the plunger rod, is disposed partially in between the proximal portion of the plunger rod and the flange piece. In an embodiment of the invention, removal of the cap allows the proximal portion of the plunger rod to advance to a dose completion position, wherein, in the dose completion position, the proximal portion of the plunger rod contacts the flange piece. In an embodiment of the invention, the removable cap covers the proximal portion of the plunger rod when in the obstructing position.
In an embodiment of the invention, the DDD further includes a collar disposed between the proximal end of the body and the proximal portion of the plunger rod, the collar defining an opening sized to accommodate the proximal portion of the plunger rod upon distal advancement of the plunger rod beyond a primed position; wherein the obstruction comprises a tab protruding radially outward from the proximal portion of the plunger rod, the tab preventing the proximal portion of the plunger rod from fitting into the opening of the collar, and wherein a depth of the Date Recue/Date Received 2023-02-22 collar opening coincides with a distance the plunger rod must travel to advance distally to the dose completion position, e.g., wherein displacement of the obstruction from the obstructing position comprises either removing the tab or compressing the tab into a side of the proximal portion of the plunger rod; and/or wherein the tab is a first tab, and wherein the obstruction further comprises a second tab protruding radially outward from the proximal portion of the plunger rod in a direction opposite the protruding direction of the first tab;
and/or wherein the obstruction comprises a tab that, when in the obstructing position, is disposed between the body and the proximal portion of the plunger rod, and wherein the plunger rod includes a geometry disposed proximally from the tab, wherein the geometry cannot advance distally past the tab when the tab is in the obstructing position. For example, displacement of the obstruction may include removing the tab from the drug delivery device by pulling the tab. In an embodiment of the invention, the DDD further includes a flange piece, wherein a portion of the tab is disposed inside a cavity of the flange piece. In an embodiment of the invention, displacement of the obstruction comprises removing the tab from the drug delivery device by breaking the tab. In an embodiment of the invention, the obstruction includes a flange piece that, in the obstructing position, is disposed proximally from the proximal end of the body, between the proximal portion of the plunger rod and the body, and is spaced from the proximal end of the body by a removable blocking component, and wherein displacement of the obstruction from the obstructing position comprises: removing the blocking component; and shifting the flange piece distally towards the proximal end of the body. In an embodiment of the invention, the plunger rod includes a projection extending radially outward, wherein the obstruction includes a lever having an end that, in the obstructing position, is located distally from the projection and blocks distal movement of the projection and thereby distal movement of the plunger rod, and wherein displacement of the obstruction from the obstructing position comprises actuating the lever to remove the end of the lever from its location distal from the projection. In an embodiment of the invention, distal advancement of the plunger rod beyond the dose completion position is prevented by contact between the proximal portion of the plunger rod and a portion of a flange piece coupled to the body.
[000208]In an embodiment of the invention, the drug delivery device, includes:
= a body;
= a sleeve affixed to the body, the sleeve including a proximal end, a distal end, and an opening disposed in a circumferential wall of the sleeve;
= a plunger rod passing through the sleeve, the plunger rod including a distal end portion disposed inside the body, and a radially-extending protrusion;
Date Recue/Date Received 2023-02-22 wherein the plunger rod may be distally advanced into the body from a ready position to a primed position, wherein, in the primed position, the protrusion of the plunger rod is disposed inside the opening, and further distal advancement of the plunger rod is resisted by contact between the protrusion and a wall of the opening, and wherein pressure may be exerted on the protrusion to overcome the resistance to further distal advancement of the plunger rod. In an embodiment of the invention, the opening in the sleeve is a second opening, and the sleeve further includes a first opening disposed in the circumferential wall of the sleeve proximally from the second opening, and a third opening disposed in the circumferential wall of the sleeve distally from the second opening, wherein, in the ready position, the protrusion of the plunger rod is disposed in the first opening, and further distal advancement of the plunger rod is resisted by contact between the protrusion and a wall of the first opening, and wherein, after further distal advancement of the plunger rod past the primed position, the protrusion of the plunger rod is disposed in the third opening, and further distal advancement of the plunger rod is prevented.
In an embodiment of the invention, the radially-extending protrusion is a first protrusion, and wherein the plunger rod further includes a second radially-extending protrusion opposite the first protrusion, and wherein squeezing the first and second protrusions towards one another while applying axial pressure in the distal direction on the plunger rod overcomes the resistance to further distal advancement of the plunger rod. In an embodiment of the invention, the protrusion includes a distally-tapering profile to aid in distal advancement of the plunger rod.
[000209]In an embodiment of the invention, a drug delivery device, includes:
= a body;
= a plunger rod including a distal end portion disposed inside the body and a rotatable element; and = a sleeve affixed to the body, the sleeve including a proximal opening into which the plunger rod may be advanced, wherein rotating the rotatable element causes distal advancement of the plunger rod to a primed position, and wherein once the plunger rod is in the primed position, further rotation of the rotatable element is resisted. In an embodiment of the invention, the DDD
further includes a collar disposed at a proximal end of the body, an interior of the collar including a proximal threaded portion forming a proximal helical path, wherein the rotatable element comprises a proximal portion of the plunger rod including a protrusion, wherein the proximal portion of the plunger rod may be rotated about a longitudinal axis to cause the protrusion to travel distally along the proximal helical path, and wherein once the protrusion reaches the end of the proximal threaded portion of the collar, the plunger rod is in the primed position, e.g., wherein Date Recue/Date Received 2023-02-22 once the plunger rod is in the primed position, the plunger rod may be depressed axially into the body to distally advance the plunger rod to a dose completion position; and/or wherein the interior of the collar further includes a distal threaded portion, wherein threads of the distal threaded portion form a distal helical path offset from, and opposite to, the proximal helical path, wherein alignment of the protrusion with the distal helical path places the plunger rod in the primed position, and wherein rotation of the proximal portion of the plunger rod to cause the protrusion to travel distally along the distal helical path causes distal advancement of the plunger rod to a dose completion position.
[000210]A substance may be dispensed using such a DDD having a plunger rod and a body, may be done by a method including:
(a) advancing the plunger rod by a predetermined distance into the body until advancement of the plunger rod is resisted by a stop;
(b) rotating the plunger rod about a longitudinal axis; and (c) actuating the plunger rod to dispense a predetermined volume of the substance, wherein none of steps (a), (b), and (c) are reversible. In an embodiment of the invention, the DDD further includes a flange piece having a collar, and advancing the plunger rod and actuating the plunger rod comprise pressing an actuation portion of the plunger rod into the collar of the flange piece; for example, wherein the plunger rod comprises a protrusion, and wherein the collar of the flange piece abuts against the protrusion to resist advancement of the plunger rod. For example, in an embodiment of the invention, wherein rotating the plunger rod comprises twisting an actuation portion of the plunger rod relative to the flange piece, until a protrusion on the plunger rod becomes longitudinally aligned with a cavity in the collar of the flange piece, which may further include advancing the protrusion into the cavity until the protrusion abuts a distal side of the cavity, wherein the predetermined volume of the substance is dispensed when the protrusion abuts the distal side of the cavity.
[0003] See International patent application publication no. W02020/247686.
Date Recue/Date Received 2023-02-22 EXAMPLES
Example 1: Randomized, Double-Masked, Active-Controlled, Phase 3 Study of the Efficacy and Safety of High Dose Aflibercept in Patients with Neovascular Age-Related Macular Degeneration (PULSAR) [000212]This phase 3, multi-center, randomized, double-masked, active-controlled study investigates the efficacy, safety, and tolerability of IVT administration of aflibercept 8 mg (HD) versus aflibercept 2 mg in participants with treatment-naïve nAMD.
[000213]The study consists of a screening/baseline period, a treatment period with duration of 92 weeks, and an end of study visit at Week 96. No study intervention will be administered at the end of study visit at Week 96.
[000214]Approximately 960 eligible participants with nAMD are randomly assigned to receive IVT injections of HD or 2 mg in a 1:1:1 ratio to 3 parallel treatment groups:
= 2q8: aflibercept 2 mg administered every 8 weeks, after 3 initial injections at 4-week intervals.
= HDq12: aflibercept 8 mg administered every 12 weeks, after 3 initial injections at 4-week intervals.
= HDq16: aflibercept 8 mg administered every 16 weeks, after 3 initial injections at 4-week intervals.
See Figure 1, Figure 3 and Figure 25.
[000215]Participants are stratified based on baseline BCVA and geographical region, to ensure balanced distribution of the treatment groups within each stratum. Only one eye can be treated within the study. Sham procedures are done on visits when an active injection is not planned.
No sham procedures will be done at the non-treatment visit at Week 12. At all subsequent visits, all participants will receive either active study treatment injection or sham procedure (for masking purposes), depending on their assigned treatment schedule and eligibility for dose regimen modification.
[000216]Safety will be assessed by ophthalmic examinations, vital signs (including heart rate, blood pressure and temperature), electrocardiogram (ECG), AEs, and laboratory assessments.
All AEs reported in this study will be coded using the currently available version of the Medical Dictionary for Regulatory Activities (MedDRAO).
[000217]In all participants, blood samples for measurement of drug concentrations (for PK) will be obtained prior to the first treatment and at pre-specified time points throughout the course of Date Recue/Date Received 2023-02-22 the study. In addition, a deoxyribonucleic acid (DNA) blood sample will be collected from those who sign the informed consent form (ICF) for the optional genomic sub-study.
[000218]The study also includes a PK sub-study, with dense PK blood sampling for systemic drug concentrations and PK assessments for approximately 12 Japanese participants from Japan sites and 12 non-Asian participants from Europe or US sites (distributed across all 3 treatment groups). All participants in the PK sub-study will participate in the main study for 96 weeks but will have extra visits. Blood pressure and heart rate measurements will also be taken in these participants at the same timepoints as for the PK sampling.
[000219]It is expected that these studies will demonstrate that the HDq12 dosing regimen is at least non-inferior to 2q8 regarding the mean change in BCVA from baseline to Week 48 using a non-inferiority margin of 4 letters; and that the HDq16 dosing regimen is at least non-inferior to 2q8 regarding the mean change in BCVA from baseline to Week 48 using a non-inferiority margin of 4 letters.
Dosing Schedule (Figure 3) [000220]The dosing schedule is set forth below in Table 1-1.
Table 1-1. Dosing Schedule Da y1 VVk4 VVk8 VVIc12 VVIc16 VVk20 VVk24 VVk28 VVk32 VVk36 VVk40 VVk44 VVk48 2q8 X X X X 0 X 0 X 0 X 0 X
HDq12 X X X o (a) X (a) o o X (c) o o X (c) o HDq16 X X X 0(b) 0(b) X (b) o 0 o X (c) o VVk52 W56 VVk60 VVk64 VVk68 VVk72 VVk76 VVk80 VVk84 VVk88 VVk92 VVk96 2q8 0 X 0 X 0 X 0 X 0 X
HDq12 o X (d) o o X (d) o o X (d) o o X (d) HDq16 o X (d) o 0 o X (d) o 0 o X (d) o " Key 2 Endpoint at week 16 and 60 "" 10 Endpoint at week 48 For masking purposes, DRM assessments will be performed in all participants at all visits (through the IXRS) starting from Week 16.
a HDq12 group: If DRM criteria are met, participants will continue on q8 rescue regimen.
b HDq16 group: If DRM criteria are met at Week 16 or 20, participant will continue on q8 rescue regimen. If DRM
criteria are met at Week 24, participant will continue on q12 regimen.
c For participants remaining on a dosing interval of q12 or q16 weeks after Week 24, if DRM criteria are met at an active injection visit, the next dosing interval will be reduced by 4 weeks (to a minimum of q8).
d From Week 52, all participants in HD groups will be eligible for dose interval shortening (to a minimum of q8) or extension (by 4-week increments) according to pre-specified DRM criteria. If DRM criteria are met at an active injection visit, the next dosing interval will be changed by 4 weeks.
This table does not reflect all available dosing options, once a participant's dose regimen is shortened or extended.
Date Regue/Date Received 2023-02-22 X=active injection, o=sham procedure 2q8=aflibercept 2 mg administered every 8 weeks, after 3 initial injections at 4-week intervals, HDq12=high dose aflibercept 8 mg administered every 12 weeks, after 3 initial injections at 4-week intervals, HDq16=high dose aflibercept 8 mg administered every 16 weeks, after 3 initial injections at 4-week intervals, 1 =primary, 2 =secondary, DRM=dose regimen modification, HD=high dose, q8=every 8 weeks, q12=every 12 weeks, q16=every 16 weeks, Wk=Week Primary Endpoints [000221]The primary endpoint is:
= Change from baseline in BCVA measured by the Early Treatment Diabetic Retinopathy Study (ETDRS) letter score at Week 48 Secondary Endpoints [000222]The key secondary efficacy endpoints are:
= Change from baseline in BCVA measured by the ETDRS letter score at Week = Proportion of participants with no intraretinal fluid (IRF) and no subretinal fluid (SRF) in central subfield at Week 16 [000223]The additional secondary efficacy endpoints are:
= Proportion of participants gaining at least 15 letters in BCVA from baseline at Week 48 = Proportion of participants achieving an ETDRS letter score of at least 69 (approximate 20/40 Snellen equivalent) at Week 48 = Change in choroidal neovascularization (CNV) size from baseline to Week = Change in total lesion area from baseline to Week 48 = Proportion of participants with no IRF and no SRF in the center subfield at Week 48 = Change from baseline in central subfield retinal thickness (CST) at Week = Change from baseline in National Eye Institute Visual Functioning Questionnaire-25 (NEI-VFQ-25) total score at Week 48 Exploratory Endpoints [000224]The exploratory endpoints are:
= Change from baseline in BCVA measured by the ETDRS letter score at Week = Change from baseline in BCVA averaged over the period from Week 36 to Week 48 and from Week 48 to Week 60 = Proportion of participants gaining at least 15 letters in BCVA from baseline at Week 60 and Week 96 Date Regue/Date Received 2023-02-22 = Proportion of participants achieving an ETDRS letter score of at least 69 (approximate 20/40 Snellen equivalent) at Week 60 and Week 96 = Proportions of participants gaining and losing at least 5 or at least 10 letters in BCVA from baseline at Week 48, Week 60, and Week 96 = Proportion of participants losing at least 15 letters in BCVA from baseline at Week 48, Week 60, and Week 96 = Change in CNV size from baseline to Week 60 and Week 96 = Change in total lesion area from baseline to Week 60 and Week 96 = Change from baseline in CST at Week 60 and Week 96 = Proportion of participants with no IRF and no SRF in the center subfield at Week 96 = Proportion of participants without retinal fluid (total fluid, IRF, and/or SRF) and subretinal pigment epithelium fluid in center subfield at Week 48, Week 60, and Week 96 = Time to fluid-free retina over 48 weeks, 60 weeks, and 96 weeks (total fluid, IRF, and/or SRF in the center subfield) = Proportion of participants with sustained fluid-free retina over 48 weeks, 60 weeks, and 96 weeks (total fluid, IRF, and/or SRF in the center subfield) = Change from baseline in BCVA at each visit in relation to fluid outcomes = Change from baseline in NEI-VFQ-25 total score at Week 60 and Week 96 Number of Patients Planned [000225]The study will enroll approximately 960 eligible participants with nAMD that will be randomly assigned to receive IVT injections of 8 mg or 2 mg in a 1:1:1 ratio in three parallel treatment groups.
Study Population [000226]The study population consists of treatment-naïve patients with nAMD.
Inclusion Criteria (Figure 2) [000227]Participants are eligible to be included in the study only if all of the following criteria apply at both screening and baseline:
1. At least 50 years of age at the time of signing the informed consent.
2. Active subfoveal CNV secondary to nAMD, including juxtafoveal lesions that affect the fovea as assessed in the study eye.
Date Recue/Date Received 2023-02-22 3. Total area of CNV (including both classic and occult components) must comprise greater than 50% of the total lesion area in the study eye.
4. BCVA ETDRS letter score of 78 to 24 (corresponding to a Snellen equivalent of approximately 20/32 to 20/320) in the study eye.
5. Decrease in BCVA determined to be primarily the result of nAMD in the study eye.
6. Presence of IRF and/or SRF affecting the central subfield of the study eye on OCT. The central subfield is defined as a circle with diameter 1 mm, centered on the fovea.
7. Male or female.
8. Contraceptive use by men or women should be consistent with local regulations regarding the methods of contraception for those participating in clinical studies.
a. Male participants: Men who are sexually active with partners of childbearing potential must agree to use highly effective contraception prior to the initial dose/start of the first treatment, during the study, and for at least 3 months after the last administration of study intervention.
b. Female participants: Women of childbearing potential (WOCBP) must practice highly effective contraception prior to the initial dose/start of the first treatment, during the study, and for at least 3 months after the last administration of study intervention. Refer to Section 10.5 for definitions of WOCBP. Pregnancy testing and contraception are not required for women not considered WOCBP.
9. Capable of giving signed informed consent as described in Section 10.1.3, which includes compliance with the requirements and restrictions listed in the ICF and in this protocol.
Exclusion Criteria (Figure 2) [000228]Participants are excluded from the study if any of the following criteria apply at either screening or baseline:
Medical Conditions ¨ Per Eye 1. Causes of CNV other than nAMD in the study eye.
2. Prior or concomitant conditions in the study eye:
a. Subretinal hemorrhage that is at least 50% of the total lesion area, or if the blood under the fovea is 1 or more disc areas in size in the study eye.
b. Scar or fibrosis making up more than 50% of the total lesion in the study eye.
c. Scar, fibrosis, or atrophy involving the central subfield in the study eye.
d. Presence of retinal pigment epithelial tears or rips involving the central subfield in the study eye.
Date Recue/Date Received 2023-02-22 e. Total lesion size >12 disc areas (30.5 mm2, including blood, scars, and neovascularization) as assessed by FA in the study eye.
f. Uncontrolled glaucoma (defined as lap >25 mmHg despite treatment with anti-glaucoma medication) in the study eye.
g. History of idiopathic or autoimmune uveitis in the study eye.
h. Vitreomacular traction or epiretinal membrane in the study eye evident on biomicroscopy or OCT that is thought to affect central vision.
i. Any history of macular hole of stage 2 and above in the study eye.
j. Structural damage to the center of the macula in the study eye that is likely to preclude improvement in BCVA following the resolution of retinal fluid including but not limited to, atrophy of the retinal pigment epithelium, subretinal fibrosis or scar or significant macular ischemia.
k. History of, or likely future need of, filtration or tube shunt surgery on the study eye.
I. Aphakia, or pseudophakia with absence of posterior capsule (unless it occurred as a result of a yttrium-aluminum-garnet [YAG] posterior capsulotomy performed more than 4 weeks (28 days) before screening), in the study eye.
m. Myopia of a spherical equivalent of at least 8 diopters in the study eye prior to any refractive or cataract surgery.
n. Significant media opacities, including cataract, that interfere with BCVA
assessment, fundus photography or OCT imaging in the study eye.
o. History of corneal transplant or corneal dystrophy in the study eye.
p. History of irregular astigmatism or amblyopia with chronic limitation of BCVA in the study eye.
Medical Conditions ¨ Per Participant 3. Prior or concomitant conditions:
a. History or clinical evidence of diabetic retinopathy, diabetic macular edema, or any retinal vascular disease other than nAMD in either eye.
b. Evidence of extraocular or periocular infection or inflammation (including infectious blepharitis, keratitis, scleritis, or conjunctivitis) in either eye at the time of screening/randomization.
c. Any intraocular inflammation/infection in either eye within 12 weeks (84 days) of the screening visit.
d. Only 1 functional eye, even if that eye was otherwise eligible for the study (e.g., BCVA of counting fingers or less in the eye with worse vision).
e. Ocular conditions with poorer prognosis in the fellow eye.
Date Recue/Date Received 2023-02-22 4. Uncontrolled blood pressure (defined as systolic >160 mmHg or diastolic >95 mmHg).
Participants may be treated with up to 3 agents known to have anti-hypertensive effects for arterial hypertension to achieve adequate blood pressure control. This limit applies to drugs that could be used to treat hypertension even if their primary indication in the participant was not for blood pressure control. Any recent changes in medications known to affect blood pressure need to be stable for 12 weeks prior to screening.
5. History of cerebrovascular accident or myocardial infarction within 24 weeks (168 days) before the screening visit.
6. Renal failure requiring dialysis, or renal transplant at screening or potentially during the study.
7. Allergy or hypersensitivity to any of the compounds/excipients in the study interventions formulations.
8. Presence of any contraindications indicated in the locally approved label for aflibercept.
9. History of other disease, metabolic dysfunction, physical examination finding, or clinical laboratory finding giving reasonable suspicion of a disease or condition that contraindicates the use of an investigational drug, might affect interpretation of the results of the study, or renders the participant at high risk for treatment complications.
10. Members of the clinical site study team and/or his/her immediate family, unless prior approval granted by the sponsor.
11. Pregnant or breastfeeding women.
Prior Therapy 12. Any prior or concomitant ocular (in the study eye) or systemic treatment (with an investigational or approved, anti-VEGF or other agent) or surgery for nAMD, except dietary supplements or vitamins.
13. Prior treatment of the study eye with any of the following drugs (any route of ophthalmic administration) or procedures before baseline visit (Day 1):
a. Anti-angiogenic drugs at any time including investigational therapy (e.g., with anti-angiopoietin/anti-VEGF bispecific monoclonal antibodies).
b. Long-acting steroids, within 16 weeks (112 days) before the screening visit, or any treatment with IVT implant, gene therapy, or cell therapy at any time.
c. Ocriplasmin (Jetreae) at any time.
d. Vitreoretinal surgery and/or including scleral buckling at any time.
e. Any other intraocular surgery within 90 days before the screening visit.
f. Panretinal laser photocoagulation or macular laser photocoagulation within 90 days before the screening visit.
Date Recue/Date Received 2023-02-22 g. YAG capsulotomy in the study eye within 30 days before the screening visit.
14. Prior treatment of the fellow eye with any of the following:
a. Investigational therapy (e.g., with anti-angiopoietin/anti-VEGF bispecific monoclonal antibodies) within 180 days before the screening visit.
b. IVT implant, gene therapy, or cell therapy at any time.
Prior treatment in the fellow eye with approved anti-VEGF therapy is allowed.
Prior treatment in the fellow eye with bevacizumab (although not approved but a component of standard of care in some countries) is also allowed.
15. Participation in other clinical trials requiring administration of investigational treatments (other than vitamins and minerals) at the time of screening, or within 30 days or 5 half-lives of administration of the previous study intervention, whichever is longer.
Additional Exclusion Criteria for the Dense PK Sub-study [000229]Participants who meet any of the following criteria will be not be eligible for the Dense PK Sub-study:
1. Prior treatment with IVT aflibercept in the fellow eye within 12 weeks (84 days) before the screening visit.
2. Active CNV in the fellow eye requiring anti-VEGF treatment at the time of screening visit.
3. Other IVT anti-VEGF treatment (ranibizumab, bevacizumab, brolucizumab, conbercept, pegaptanib sodium) in the fellow eye within 4 weeks (28 days) before the screening visit.
4. Systolic blood pressure >140 mmHg or diastolic blood pressure >90 mmHg.
5. Known cardiac arrhythmia, based on medical history and/or outcome of ECG at screening.
6. Variation by more than 10% in the 3 pre-randomization blood pressure measures recorded at the screening visits and at randomization 7. Participants who, in the opinion of the investigator, are unlikely to have stable blood pressure over the course of the study (e.g., due to known or suspected non-compliance with medication).
Investigational and Reference Treatments [000230]The HD will be provided as a liquid formulation in a vial. The target concentration of aflibercept is 114.3 mg/mL. The dose will be delivered in an injection volume of 70 pl. ThelAl will be provided as a liquid formulation in a vial. The target concentration of aflibercept is 40 mg/mL. The dose will be delivered in an injection volume of 50 pl.
Study Assessments and Procedures Date Recue/Date Received 2023-02-22 [000231]Study procedures and their timing are summarized in the following tables.
Table 1-2. Schedule of Activities ¨ Year 1 Visit 1 2 3 4 5 6 7 8 9 10 11 Screening Baseline Week 4 8 12 Day -21 to -I 1 29 57 60-64 85 113 b Window (day). +5 +5 +5 +5 +5 +5 +5 +5 +5 +5 +5 +5 Administrative:
Informed Consent (IC F) X
Dense PK Substudy ICIF X
Genomic Substudy ICF X
FBR ICFe X
Inclusion/Exclusion Eligibility X Xf Medical History X
Demographics X
Concomitant Medications X X X X X X X X X X X
X X X X
Randomization X
Study Intervention,:
Stucl,i.lmen,ention ,:active o: sham; X X X X X X X
X X X X X
DRM AssessmeMi X X X X XXXX
X
Ocular Efficacy and Safety (bilateral unless indicated):
BCVA (ETDRS) and Refraction X X X X X X X X X
X X X X X
X X X X X X X X X
Slit Lamp Examination, X X X X X X X X X X
X X X X
Indirect Ophtnalmosc.opyi X X X X X X X X X X
X X X X
FA, FP X X X X X
SD-OCT X X X X X
X X X X X X X X X
ICGAn X X
OCT-A. X X X X X
Visit 1 2 Screening Baseline Week 4 8 12 Day -2/ to -1 1 29 57 60-64 85 Window (day)- +5 +5 b +5 +5 +5 +5 +5 +5 +5 +5 +5 +5 Nonocular Safety:
Physical Examination X
Vital 3 , i 3P X X X X X'. X X X X X X
X X X X
ECG X X
Adverse Events X X X X X X X X X X X
X X X X
Laboratory Testing,:
Hematology X X
Blood Chemistry X X
X X X X X
X X X X X X X X X
Pregnancy Test (WOCBP), Serum urine LVI -e Ur e Urine Urine 11 Urine Urine Urine Urine LJ e Urine Urine Urinalysis. UPCR X X
Pharmacokinetics and Other Sampling:
PK Samples tSpai ser X X X X X X
PK Samples (Dense) See Tablle 1-3 Anti-drug Antibody Serum Sample X
X
Genomic DNA Sample (optional) X
BCVA=best corrected visual acuity, DNA=deoxyribonucleic acid, DRM = dose regimen modification, ECG=electrocardiogram, ETDRS=Early Treatment Diabetic Retinopathy Study, FA=fluorescein angiography, FBR=future biomedical research, FP=fundus photography, ICF=informed consent form, ICGA=indocyanine green angiography, lOP=Intraocular pressure, NEI-VFQ-25=National Eye Institute Visual Functioning Questionnaire-25, OCT-A=optical coherence tomography angiography, PK=pharmacokinetics, SD-OCT=spectral domain optical coherence tomography, UPCR=urine protein:creatinine ratio, WOCBP=women of childbearing potential Date Regue/Date Received 2023-02-22 Table 1-3. Schedule of Activities ¨ Year 2 Visit 16 17 18 19 20 21 22 23 24 25 EOS
or ED
Week 52 56 60 64 68 72 76 80 84 88 Day 365 393 421 449 477 505 533 561 Window (day). 5 5 5 +5 +5 +5 5 5 5 5 +5 +5 Administrative:
Concomitant mecncotions I X I X I X I X X X I
Study Interventiong:
_Study Intervention (active or soam, X X X X X X X X
X X X
DRM AssessmenP X X X X X X X X
Ocular Efficacy and Safety (bilateral unless indicated):
BCVA (ETDRS) and refraction X X X X X X X X X X
X X
lOPI X X X X X X X X X X X X
Slit lamp examination' X X X X X X X X X X X
X
Indirect ophthalrnoscopyi X X X X X X X X X X
X X
FA, FP. X X
SD-OCT. X X X X X X X X X X X X
ICON' X
OCT-A. X X
' " Nonocular Safety: p Physical examination X
Vital signsP X X X X X X X X X X X X
ECG X
Adverse events X X X X X X X X _ X X X X
Laboratory Testing:
Hematology X
Blood Chemistry X
Pregnancy Test (women of X X X X X X X X X X
X X
childbearing potential), urine urine urine urine urine urine urine urine urine urine urine urine Urinalysis, UIPCR X
Anti-drug Antibody Serum Sampleo X
BCVA=best corrected visual acuity, DNA=deoxyribonucleic acid, DRM=dose regimen modification, ECG=electrocardiogram, ED=Early Discontinuation, EOS=End of Study, ETDRS=Early Treatment Diabetic Retinopathy Study, FA=fluorescein angiography, FP=fundus photography, ICF=informed consent form, ICGA=indocyanine green angiography, lOP=Intraocular pressure, NEI-VFQ-25=National Eye Institute Visual Functioning Questionnaire-25, OCT-A=optical coherence tomography angiography, PK=pharmacokinetics, SD-OCT=spectral domain optical coherence tomography, UPCR=urine protein:creatinine ratio, WOCBP=women of childbearing potential [000232]Footnotes for the Schedule of Activities Tables a Visit schedules may deviate by up to 5 days. Set schedule visits (except Visit 5) use baseline for the calculation. The procedures required at each visit have to be complete within 3 days, i.e., split visits are allowed. Additionally, all procedures have to be complete within the 5-day window. Slit lamp (anterior segment), lOP measurement, and indirect ophthalmoscopy are recommended to take place on the same day as the IVT injection (see Section 8.1.1 for details).
b Visit 5 must be within 3 to 7 days after the Week 8 injection. This visit uses the date of Visit 4 for calculation.
c Dense PK sampling will be performed in a subgroup including participants at Japanese and non-Asian sites. The Dense PK Sub-study ICF should be presented and signed at the screening visit. Refer to Table 1-3. Participants in the Dense PK Sub-study have extra visits but otherwise participate in the main study with a 96 week duration.
Date Regue/Date Received 2023-02-22 d The optional genomic sub-study ICF should be presented to participants at the screening visit and may be signed at any subsequent visit at which the participant chooses to participate after screening. The genomic DNA blood sample should be collected on Day 1/baseline (pre-injection) or at any time during the study, only from participants who consent to participate in the genomic sub-study. Participants from China will not be enrolled in this optional sub-study.
e The optional FBR ICF should be presented to participants and signed at the screening visit.
No additional blood sample is required ¨ remaining blood samples (from e.g., PK or anti-drug antibody [ADA] sampling) may be used.
f Inclusion/exclusion criteria will be evaluated at screening and baseline to confirm subject's eligibility. The investigator is responsible for confirming that any changes between screening and baseline do not affect the participant's eligibility.
g Refer to Section 10.7 for study intervention injection guidelines. Following study intervention injection or sham procedure, participants will be observed for at least 30 minutes.
h For masking purposes, assessments for dose regimen modification (DRM) or potential shortening to the rescue regimen (8 mg q8) will be performed in all participants at all visits starting from Week 16. Actual DRMs will be implemented. (See Figure 3, Figure 4 and Figure 25) i NEI-VFQ-25 to be administered in a quiet room by a masked study-related person trained to administer this type of questionnaire, preferably before other visit procedures are performed.
j lOP will be measured at all study visits (bilateral). On days when study intervention is administered, 10P should be measured pre-injection (bilaterally) and approximately 30 minutes after administration of study intervention (study eye only). 10P will be measured using Goldman applanation tonometry, rebound tonometry Icare, or Tonopen and the same method of measurement must be used in each participant throughout the study.
k Slit lamp examination will be performed bilaterally.
I Indirect ophthalmoscopy will be performed bilaterally at all visits. On days when study intervention is administered, it should also be performed immediately after administration of study intervention (study eye only).
m The same SD-OCT/FA/FP imaging system used at screening and Day 1 must be used at all follow-up visits in each participant. Images will be taken in both eyes before dosing (active or sham injection).
n Optional at all sites that have the relevant equipment. ICGA will be used to diagnose and characterize the polypoidal choroidal vascularization (PCV) subtype of nAMD.
If ICGA cannot be performed at screening visit, it may be done at baseline visit.
Date Recue/Date Received 2023-02-22 o OCT-A is optional at all sites that have the relevant equipment. If OCT-A
cannot be performed at screening visit, it may be done at baseline visit.
p Vital signs (temperature, blood pressure, heart rate) should be measured per the procedure outlined in the study manual. At Visit 5, only blood pressure and heart rate are required. Vital signs should be measured prior to injection and any blood sampling. When possible, timing of all blood pressure assessments should be within 2 hours of clock time of dosing on Day 1.
Measurements will be taken pre-dose (active or sham injection).
q All samples collected for laboratory assessments should be obtained prior to administration of fluorescein and/or indocyanine green, and prior to administration of study intervention.
r For women of childbearing potential, a negative serum pregnancy test at screening is required for eligibility. A negative urine pregnancy test is required before any treatment (including rescue regimen) is administered at subsequent visits.
s Sparse PK sampling will be performed in all participants (optional for participants in China).
Any PK sampling will be done prior to dosing if scheduled at the sampling time point.
t Anti-drug antibody sample collection is optional for participants in China.
Table 1-4. Schedule of Activities ¨ Dense PK Sub-Study Visit Dose Assessment Day Assessment Time (h) PK
Sample Heart Rate and Blood Pressure' Screening 2 -21 to -1 2h X
Pre-dose c X (pre-injection) X
Visit 2 X 1 4 X
(Baseline) .13c X
2 219c X X
3 2h' X X
219c X X
8 2h' X X
2hc X X
22 2h' X X
PK=pharmacokinetics Participants enrolled in the Dense PK Sub-study will also have blood pressure and heart rate assessed at each visit within the sub-study.
Participants enrolled in the Dense PK Sub-study will also have blood pressure and heart rate assessed at each visit within the sub-study.
a Timing of all blood pressure assessments must be within 2 hours of the clock time of dosing on Day 1. Blood pressure assessments for participants in the Dense PK Sub-study will be taken prior to blood sample collection using automated office blood pressure (AOBP) measurement with the Omron Model HEM
907XL (or comparable).
Measures will be recorded in the electronic case report form (eCRF). Detailed instructions can be found in the study manual.
b Additional blood pressure assessment between screening and baseline, to confirm eligibility for participants in the Dense PK Sub-study. Screening 2 may occur on the same day as the screening visit.
Date Regue/Date Received 2023-02-22 c On Day 1, the 4 hour and 8 hour PK sampling is to be within 30 minutes and 2 hours, respectively, of the scheduled time. For subsequent days, PK sampling is to be performed within 2 hours of the clock time of dosing on Day 1.
Ophthalmic and General Examinations [000233]In this section, all ophthalmic examinations are described, irrespective of whether they are used for efficacy or safety assessments. All ophthalmic examinations are to be conducted pre-injection in both eyes and post-injection in the study eye only, unless indicated otherwise. At any visit, ophthalmic examinations not stipulated by this protocol may take place outside of this protocol at the discretion of the investigator.
[000234]Best Corrected Visual Acuity (BCVA) - Visual function will be assessed using the ETDRS protocol (2) starting at 4 meters. Refraction is to be done at each visit. Visual acuity examiners must be certified to ensure consistent measurement of BCVA. Any certified and trained study personnel may perform this assessment (including but not limited to ophthalmologist, optometrist, or technician) and must remain masked to treatment assignment.
For each participant, the same examiner must perform all assessments whenever possible.
BCVA should be done before any other ocular procedures are performed.
[000235]intraocu/ar Pressure (10P) - lOP will be measured using Goldman applanation tonometry, rebound tonometry Icare, or Tonopen and the same method of measurement must be used in each participant throughout the study. At all visits, 10P should be measured bilaterally by the masked investigator (or designee). On days when study intervention is administered, 10P should also be measured approximately 30 minutes after administration of study intervention (study eye only) by the unmasked investigator (or designee). If multiple post-injection measurements are performed, the final measurement before the participant leaves should be documented in the eCRF. Any injection-related increase in 10P (and treatment) should be documented in a masked fashion.
[000236] Slit Lamp Examination - The slit lamp examination will be performed according to local medical practice and applicable medical standards at the site. Participants' anterior eye structure and ocular adnexa will be examined bilaterally (pre-dose on visits with active injection) at each study visit using a slit lamp.
[000237]Indirect Ophthalmoscopy - Indirect ophthalmoscopy will be performed according to local medical practice and applicable medical standards at the site.
Participants' posterior pole and peripheral retina will be examined by indirect ophthalmoscopy at each study visit pre-dose Date Regue/Date Received 2023-02-22 (bilateral) by the masked investigator and post-dose (study eye). Post-dose evaluation must be performed immediately after injection.
[000238]Fundus Photography (FP) and Fluorescein Angiography (FA) -The anatomical state of the retinal vasculature of the study eye will be evaluated by FP and FA. The treating investigator may perform additional FA/FP at other times during the study based on his/her medical judgment and standard of care. Photographers must be masked to treatment assignment and must be certified by the reading center to ensure consistency and quality in image acquisition.
FP and FA images will be read by the investigator for individual treatment decisions and sent to an independent reading center where images will be read by masked readers. The participants' eligibility to participate in the study in terms of FA will be confirmed by the central reading center before randomization. The same FA/FP imaging system used at screening and Day 1 must be used at all subsequent visits in each participant. Images will be taken in both eyes before dosing (active or sham injection).
[000239] Spectral Domain Optical Coherence Tomography (SD-OCT) -Retinal and lesion characteristics will be evaluated using SD-OCT. For all visits where the SD-OCT procedure is scheduled, images will be captured and read by the technician and investigator for individual treatment decisions and sent to an independent reading center. The participants' eligibility to take part in the study in terms of SD-OCT will be confirmed by the central reading center before randomization. The same SD-OCT imaging system used at screening and Day 1 must be used at all follow-up visits in each participant. Images will be taken in both eyes before dosing (active or sham injection).
[000240]Thdocyanine Green Angiography (ICGA) - ICGA will be optional, performed at sites with the appropriate equipment. ICGA will be used to diagnose and characterize the PCV
subtype of nAMD. The same imaging modality used at screening must be used at all follow-up visits in each participant. Images will be taken in both eyes before dosing (active or sham injection).
[000241] Optical Coherence Tomography Angiography (OCT-A) - Optical coherence tomography angiography (OCT-A) will be optional, performed at sites with the relevant equipment. The same imaging modality used at screening must be used at all follow-up visits in each participant. Images will be taken in both eyes before dosing (active or sham injection).
[0002421 National Eye Institute Visual Functioning Questionnaire-25 (NEI-VFQ-25) - Vision-related quality of life (QoL) will be assessed using the NEI-VFQ-25 questionnaire (3) in the interviewer-administered format. It is a reliable and valid 25-item version of the 51-item NEI-VFQ.
Date Recue/Date Received 2023-02-22 Treatment group descriptions [000243]2q8: Aflibercept 2 mg administered every 8 weeks, after 3 initial injections at 4-week intervals.
[000244]HDq12: High dose aflibercept 8 mg administered every 12 weeks, after 3 initial injections at 4-week intervals.
[000245]HDq16: High dose aflibercept 8 mg administered every 16 weeks, after 3 initial injections at 4-week intervals.
[000246]All HD: Pooled high dose aflibercept 8 mg administered every 12 weeks or every 16 weeks, after 3 initial injections at 4-week intervals.
Results at Week 48 [000247]The overall patient disposition at week 48 (Figure 5), baseline demographics (Figure 6), and baseline characteristics of the study eye (Figure 7) are provided.
[000248]Patients in the HDq16 group received fewer doses than those in the HDq12 group who received fewer doses than those in the 2q8 group. (Figure 8).
Visual Outcomes [000249]After 48 weeks of study duration, patients receiving the 8 mg doses of aflibercept (HD
doses) showed a mean change in best corrected visual acuity (BCVA) of +6.7 letters (by ETDRS) for those receiving the 8 mg dose every 12 weeks, and +6.2 letters (by ETDRS) for those receiving the 8 mg dose every 16 weeks (Figure 9) whereas patients in the 2q8 group achieved an improvement in BCVA of 7.6 letters. See Table 1-5.
Date Recue/Date Received 2023-02-22 Table 1-5. Change From Baseline in BCVA Measured by the ETDRS Letter Score at Week 48 and Week 60 in the Study Eye, MMRM (Full Analysis Set) 2q8 HDq12 HDq16 N = 336 N = 335 N = 338 Week 48 (primary endpoint) Baseline mean (a) 58.9 59.9 60.0 Number of subjects with Week 48 data 285 299 289 Arithmetic mean (SD) change from baseline (a) 7.6 (12.2) 6.7 (12.6) 6.2 (11.7) LS mean (SE) change from baseline 7.03 (0.74) 6.06 (0.77) 5.89 (0.72) DF 622.1 647.7 Contrast (b) HDq12 - 2q8 HDq16 - 2q8 t-value 3.14 3.07 p-value of one-sided test for non-inferiority at a 0.0009 0.0011 margin of 4 letters Estimate for Contrast and two-sided 95% Cl (c) -0.97 (-2.87,0.92) -1.14 (-2.97,0.69) Week 60 (key secondary endpoint) Baseline mean (a) 58.9 59.9 60.0 Number of subjects with Week 60 data 268 283 282 Arithmetic mean (SD) change from baseline (a) 7.8 (12.6) 6.6 (13.6) 6.6 (11.7) LS mean (SE) change from baseline 7.23 (0.68) 6.37 (0.74) 6.31 (0.66) DF 896.3 928.7 Contrast (b) HDq12 - 2q8 HDq16 - 2q8 t-value 3.61 3.81 p-value of one-sided test for non-inferiority at a 0.0002 <0.0001 margin of 4 letters Estimate for Contrast and two-sided 95% Cl (c) -0.86 (-2.57,0.84) -0.92 (-2.51,0.66) BCVA = best corrected visual acuity, Cl = Confidence interval, DF = Degrees of freedom, ETDRS = Early Treatment Diabetic Retinopathy Study, LS = Least Square, SAP =
statistical analysis plan, SD = Standard deviation, SE = Standard error A mixed model for repeated measurements (MMRM) was used with baseline BCVA
measurement as a covariate, treatment group, visit and the stratification variables (geographic region [Japan vs. Rest of World]; baseline BCVA [< 60 vs. 60]) as fixed factors, and terms for the interaction between baseline BCVA and visit and the interaction between treatment and visit.
A Kenward-Roger approximation was used for the denominator degrees of freedom.
In order to model the within-subject error the following covariance structure was used:
unstructured (for Week 48) and Toeplitz with heterogeneity (for Week 60).
Intercurrent events (ICE) were handled according to primary estimand strategy for continuous endpoints.
(a): Based on observed assessments.
(b): The contrast also includes the interaction term for treatment x visit (c): Estimate based on the MMRM model, was computed for the differences of HDq12 minus 2q8 and HDq16 minus 2q8, respectively, with two-sided 95% Cls.
Date Regue/Date Received 2023-02-22 Durability [000250]Patients in the HD groups exhibited excellent durability. 79% of patients in the HDq12 group and 77% of patients in the HDq16 group and 83% of combined patients in the HDq12 and HDq16 groups 12 weeks) were maintained in these groups through week 48 of the study (Figure 10).
Retinal Fluid [000251]The percentage of patients without retinal fluid center (no retinal fluid in the IRF and SRF) at week 16 was 62% for patients receiving the 8 mg dose every 12 weeks, and 65% for patients receiving the 8 mg dose every 16 weeks (Figure 11).
[000252]The percentage of patients without retinal fluid center subfield at week 48 was 71% for patients receiving the 8 mg dose every 12 weeks, and 67% for patients receiving the 8 mg dose every 16 weeks (Figure 12). See Table 1-6.
Table 1-6. Proportion of Participants with No IRF and No SRF in the Central Subfield at Week 48, LOCF (Full Analysis Set) 2q8 HDq12 HDq16 N = 336 N = 335 N = 338 Subjects who had no IRF and no SRF, 199/335 (59.4%) 236/332(71.1%) 223/334(66.8%) Num/Den (%) Contrast HDq12 - 2q8 HDq16 - 2q8 Difference (a) % (two-sided 95% Cl) 11.725 (4.527, 18.923) 7.451 (0.142, 14.760) CMH test (b) p-value 0.0015 0.0458 BCVA = best corrected visual acuity, Cl = Confidence interval, CMH = Cochran-Mantel-Haenszel, IRF = Intraretinal fluid, LOCF = Last observation carried forward, Num/Den =
numerator/denominator, SAP = statistical analysis plan, SRF = Subretinal fluid LOCF method for the last available observed value prior to ICE were carried forward to impute missing data.
Intercurrent events (ICE) were handled according to primary estimand strategy for binary endpoints.
(a) Difference is HD groups minus 2q8 and CI was calculated using Mantel-Haenszel weighting scheme adjusted by geographical region and baseline BCVA (< 60 vs. 60) and is displayed with two-sided 95% Cls as described in SAP Section 6.2.3.1.2.
(b) Nominal p-value for the two-sided Cochran-Mantel-Haenszel (CMH) test.
Date Regue/Date Received 2023-02-22 Retinal Thickness [000253]Anatomical improvements were also demonstrated for patients receiving the 8 mg doses of aflibercept at week 48. The central retinal thickness (CRT) of patients receiving the 8 mg doses of aflibercept showed a mean change of -142 pm for those receiving the 8 mg dose every 12 weeks, and a mean change of -147 pm for those receiving the 8 mg dose every 16 weeks (Figure 13A). The central retinal thickness of patients in each dosage group through 48 weeks is set forth in Figure 13B. See also Table 1-7.
Table 1-7. Change from Baseline in CST (pm) at Week 48, MMRM (full analysis set) 2q8 HDq12 HDq16 N = 336 N = 335 N = 338 LS mean (SE) change from baseline -136.25 (4.24) -147.37 (4.01) -146.76 (3.76) Arithmetic mean (SD) change from -126.3 (124.3) -141.9 (120.1) -147.1 (131.2) baseline (a) Baseline mean (a) 367.1 370.3 370.7 Number of subjects with Week 48 data 273 289 282 DF 626.1 608.6 Contrast (b) HDq12-2q8 HDq16-2q8 t-value -2.20 -2.15 P-value(c) 0.0283 0.0321 Estimate for Contrast and two- -11.12 (-21.06,-1.18) -10.51 (-20.12,-0.90) sided 95% Cl (d) BCVA = best corrected visual acuity, Cl = confidence interval, CST = central subfield retinal thickness, DF = degrees of freedom, LS = least square, SAP = statistical analysis plan, SD =
standard deviation, SE = standard error A mixed model for repeated measurements (MMRM) was used with baseline CST as a covariate, treatment group, visit and the stratification variables (geographic region [Japan vs.
Rest of World]; baseline BCVA [<60 vs. 60]) as fixed factors, and terms for the interaction between baseline CST and visit and the interaction between treatment and visit.
A Kenward-Roger approximation was used for the denominator degrees of freedom.
In order to model the within-subject error the following covariance structure was used:
unstructured.
Intercurrent events (ICE) were handled according to primary estimand strategy for continuous endpoints.
(a) Based on observed assessments.
(b) The contrast also includes the interaction term for treatment x visit.
(c) P-value for the two-sided test.
(d) Estimate based on the MMRM model, was computed for the differences of HDq12 minus 2q8 and HDq16 minus 2q8, respectively with two-sided 95% Cls.
Date Regue/Date Received 2023-02-22 Patient Reported Outcomes [000254]The mean values of the NEI-VFQ-25 total score at baseline were similar across the 3 treatment groups, ranging from 76.4 to 77.8. Mean increases from baseline were observed in all groups at Week 48, which were numerically lower in the HD groups than in the 2q8 group.
The estimated contrasts (95% Cls) for the 2-sided tests using the MMRM in the FAS were small and not clinically meaningful for both comparisons, HDq12 vs. 2q8 and HDq16 vs. 2q8.
[000255]The corresponding analysis using an ANCOVA with LOCF in the FAS
provided mean changes from baseline to Week 48 and estimated contrasts (95% Cls) for the 2-sided tests between the HD groups and the 2q8 group that were similar to those based on MMRM and thus also not clinically meaningful. See Table 1-8.
Table 1-8. Change from Baseline in NEI-VFQ-25 Total Score at Week 48, MMRM
(Full Analysis Set) 2q8 HDq12 HDq16 N = 336 N = 335 N = 338 Baseline mean (a) 77.8 76.4 77.7 Number of subjects with Week 48 data 266 285 266 Arithmetic mean (SD) change from baseline (a) 4.6 (11.0) 4.1 (10.4) 3.4 (10.8) LS mean (SE) change from baseline 4.22 (0.70) 3.50 (0.70) 3.35 (0.72) DF 571.7 540.3 Contrast (b) HDq12-2q8 HDq16-2q8 t-value -0.88 -1.02 P-value (c) 0.3817 0.3070 Estimate for Contrast and two-sided 95% Cl (d) -0.72 (-2.35,0.90) -0.87 (-2.55,0.80) Cl = Confidence interval, DF = Degrees of freedom, LS = Least Square, NEI-VFQ-25 = National Eye Institute Visual Functioning Questionnaire-25, SAP = statistical analysis plan, SD =
Standard deviation, SE = Standard error A mixed model for repeated measurements (MMRM) was used with baseline total lesion area as a covariate, treatment group, visit and the stratification variables (geographic region [Japan vs. Rest of World]; baseline BCVA [< 60 vs. 60]) as fixed factors, and terms for the interaction between baseline NEI-VFQ-25 total score and visit and the interaction between treatment and visit.
A Kenward-Roger approximation was used for the denominator degrees of freedom.
In order to model the within-subject error the following covariance structure was used:
unstructured.
Intercurrent events (ICE) were handled according to primary estimand strategy for continuous endpoints as described in Table 9-12 in Section 9.5 of the SAP.
(a) Based on observed assessments.
Date Regue/Date Received 2023-02-22 (b) The contrast also includes the interaction term for treatment x visit (at Week 48, for details on the population-level summary see SAP Section 6.2.2.1).
(c) Nominal p-value for the two-sided test.
(d) Estimate based on the MMRM model, was computed for the differences of HDq12 minus 2q8 and HDq16 minus 2q8, respectively with two-sided 95% Cls.
Total Lesion Area [000256]The mean total lesion area at baseline was similar across the 3 treatment groups, ranging from 6.4 to 6.9 mm2. Mean changes from baseline at Week 48 showed mean decreases in the HD groups but a mean increase in the 2q8 group. The estimated contrasts (95% Cl) for the 2 sided test, using the MMRM in the FAS, of -0.55 (-1.04, -0.06) mm2 for HDq12 vs. 2q8 and and of -0.44 (-0.94,0.06) mm2 for HDq16 vs. 2q8 were numerically in favor of HD treatment (Table 1-8A).
[000257]The corresponding analysis using an ANCOVA with LOCF in the FAS
provided mean changes from baseline to Week 48 and estimated contrasts (95% Cls) for the 2-sided tests between the HD groups and the 2q8 group that were numerically also in favor of HD treatment and thus consistent with the results from the analysis using MMRM.
Table 1-8A. Change in total lesion area (mm2) from baseline to Week 48, MMRM
(full analysis set) 2q8 HDq12 HDq16 N = 336 N = 335 N = 338 Baseline mean (a) 6.9 6.4 6.9 Number of subjects with Week 48 data 277 285 273 Arithmetic mean (SD) change from baseline (a) 0.1 (3.6) -0.4 (2.9) -0.2 (3.1) LS mean (SE) change from baseline 0.09 (0.22) -0.46 (0.19) -0.35 (0.20) DF 631.4 640.4 Contrast (b) HDq12-2q8 HDq16-2q8 t-value -2.19 -1.71 P-value (c) 0.0287 0.0870 Estimate for Contrast and two-sided 95% Cl (d) -0.55 (-1.04,-0.06) -0.44 (-0.94,0.06) BCVA = best corrected visual acuity, Cl = Confidence interval, DF = Degrees of freedom, LS =
Least Square, SAP = statistical analysis plan, SD = Standard deviation, SE =
Standard error A mixed model for repeated measurements (MMRM) was used with baseline total lesion area as a covariate, treatment group, visit and the stratification variables (geographic region [Japan vs. Rest of World]; baseline BCVA [< 60 vs. 60]) as fixed factors, and terms for the interaction between baseline total lesion area and visit and the interaction between treatment and visit.
Date Regue/Date Received 2023-02-22 A Kenward-Roger approximation was used for the denominator degrees of freedom.
In order to model the within-subject error the following covariance structure was used:
unstructured.
Intercurrent events (ICE) were handled according to primary estimand strategy for continuous endpoints (a) Based on observed assessments.
(b) The contrast also includes the interaction term for treatment x visit (c) Nominal p-value for the two-sided test.
(d) Estimate based on the MMRM model, was computed for the differences of HDq12 minus 2q8 and HDq16 minus 2q8, respectively with two-sided 95% Cls.
Safety [000258]Ocular and non-ocular safety for patients receiving the 8 mg doses of aflibercept was similar to that of patients receiving aflibercept intravitreally dosed at 2 mg approximately every 4 weeks for the first 5 injections followed by 2 mg approximately once every 8 weeks or once every 2 months.
[000259]Both the 2 mg and 8 mg doses were generally well tolerated. The most frequent ocular AEs (Figure 14B) and ocular serious treatment-emergent adverse events (TEAEs) through week 48 (Figure 14A), treatment emergent intraocular inflammation (Figure 15), intraocular pressure (Figure 16 and Figure 17), non-ocular serious TEAEs (Figure 18), treatment emergent anti-platelet trialists' collaboration (APTC) events (Figure 19), treatment emergent hypertension events (Figure 20), potentially clinically significant values (PCSVs) for blood pressure (Figure 21) mean systolic blood pressure (Figure 22), and mean diastolic blood pressure (Figure 23) were comparable in each treatment group.
Summary [000260]At 48 weeks, PULSAR met the primary endpoints of non-inferiority of aflibercept 8 mg to EYLEA, with BCVA improvements from baseline demonstrated across dosing groups (all p=<0.003). The EYLEA outcomes in wet AMD were consistent with previous clinical trial experience. In the every 16-week dosing regimen groups, 77% of wet AMD
patients in PULSAR maintained this dosing interval with an average of 5 injections in the first year. In the every 12-week dosing regimen groups, 79% of wet AMD patients in PULSAR
maintained this dosing interval with an average of 6 injections in the first year. In a pooled analysis of aflibercept 8 mg dosing groups, 83% of wet AMD patients in PULSAR maintained 12-week Date Recue/Date Received 2023-02-22 dosing or longer. These data demonstrated that a remarkably high percentage of patients can be maintained on 12- and 16-week dosing intervals.
[000261]Key efficacy findings at 48 weeks are set forth in Table 1-9.
Table 1-9. Key 48 Week Efficacy Findings High-dose aflibercept High-dose aflibercept EYLEA
12-week regimen 16-week regimen 8-week regimen PULSAR (wet AMD) n=335 n=338 n=336 Mean BCVA
improvement, primary 6.7 letters 6.2 letters 7.6 letters endpoint Non-inferiority p-value 0.0009 0.0011 N/A
Absolute BCVA 66.9 letters 66.3 letters 66.5 letters Patients maintained 79% 77% N/A
on dosing interval Patients with no fluid in the central subfield 63%
52%
at 16 weeks, key (one-sided superiority p=0.0002) secondary endpoint DRSS: diabetic retinopathy severity scale; N/A: not applicable [000262]Mean changes from BL in BCVA at Week 48 were numerically larger in patients with lower BL BCVA (54 letters), and smaller in those with higher BL BCVA (74 letters), as anticipated. Within the BL subgroups, mean changes and absolute BCVA letter scores at Week 48 were similar in the HDq12, HDq16 and 2q8 treatment groups. Mean increases from BL in BCVA with HDq12, HDq16 and 2q8 were also similar, with overlapping Cis, in patients with BL
central subfield retinal thickness (CRT) <400 pm and 400 pm, again resulting in similar absolute BCVA letter scores at Week 48 irrespective of treatment group. The same trends were also observed in the subgroup of patients with minimally classic, occult, and predominantly classic disease. Data will also be presented for additional patient subgroups, including by race.
In patients with nAMD, BCVA gains from baseline at Week 48 were seen in all subgroups based on baseline BCVA, CRT, and lesion type, with comparable BCVA letter scores at Week 48 achieved with aflibercept 8 mg and 2 mg. See Table 1-10.
Date Recue/Date Received 2023-02-22 Table 1-10. Week 48 Mean Change in BCVA Letter Scores According to BL BCVA, CRT or Lesion Type.
Mean SD Mean 195% CI:] Ma-a 11 SD
rQ a bsolute BL BC.: A ,A,1k4E change from EL
absolute Wk48 BCV4 Baseline BCVA s.54 3q3.2 97 416 93 +10.217.2, 13.2) 52.8 16.5 Sci1Ã 99 44.301-8.1 +7.113.9, 103) 51 4+16 5 2q8 106, 4L4 92 +11_1 18.2, 14.0) 52.4 165 Baseline BCVA 55-73 &i12 196 65.0 5.7 +5.1 13A, 6.9) 701 13.0 &l1a 191 64.3 5.3 +6114.7, 7.5) 70.4 10.4 201 181 643 11 +6_9 15.3, 8.4) 71.6 11.5 Baseline BCVA 04 q12 42 75.9 15 +151-14 43) 77.4 10.4 q16 48 716 15 +2.9 104 4:9) 785 7.6 2q8 49 75.6 1.5 +2_310.2,4.4) 77.9 7.9 Baseline CRT <400 gm 8q12 228 6.3,.4 11.6 +4_613.1, 6.2) 681 155 8q16, 226 6,54 10.9 +6_314.9, 7:6) 69.7 12_9 2q8 2311 62.9 11.6 +6.2144 7.7) 69.2 15.1 Baseline CRT 2400 pm q12 107 52.2 117 +9.416.4, 123) 616 173 NHL 110 53 CI+12 4 +5.212 5, &E) 58 1+17 9 2q8 104 49.9 143 +10317.7, 12.9) 60.2 16.7 Minimally classic CNV
q12 56 57.9 119 +2.6 1-2.1 7.4) 605 203 q16 68 563 11.7 +5.9 12.5,9.4) 62.2 15.9 2q8 61 54.4 117 +6.412.6, 10.2) 60.8 17.0 Occult onEy CNV
8q12 197 62 9 12.5 +5:3 13.8, 6.9) 68 3+15 2 NHL 186 6 &7 1L3 +5.1 13.7, 6.5) 68 8+14 1 201 192 65,6+11 8 +7 215.7, &6) 70 8+13 7 PredominantIV clasik CM/
q12 71 535 12.8 +10.417.2, 13.6) 63.9 153 q16 67 5113 125 +6.61111, 101) 60.2 18.4 201 71 5,0 9+15 0 +9.2 15.9, 125) 60 1+17 9 EICVA, hest connected visual acuity; E31..,, baseline, ON'il, chernedla4 nedwascullarizaticr; CET, central sulatieAdi retool thickness; Wk, komek [000263]The safety of high-dose (HD) aflibercept was similar to EYLEA and consistent with the safety profile of EYLEA. There were no new safety signals for high-dose aflibercept and EYLEA, and no cases of retinal vasculitis, occlusive retinitis or endophthalmitis. Comparing pooled data for the 12- and 16-week high-dose aflibercept groups to the EYLEA
groups, the following rates were observed:
= Serious ocular adverse events (AE): 1.6% versus 0.6% in PULSAR
= lntraocular inflammation: 0.7% versus 0.6% in PULSAR
= Patients meeting intraocular pressure criteria: 1.3% versus 2.1% in PULSAR
= Serious non-ocular AEs: 9.8% versus 13.7% in PULSAR
Results at Week 60 [000264]There were 1395 enrolled participants at 251 sites in 27 countries countries/regions (Europe, North America, Latin America, Australia, and Asia Pacific), of whom 383 participants did not complete screening; one participant was randomized in error although he/she did not Date Recue/Date Received 2023-02-22 complete screening and had withdrawn consent. Therefore, this participant was not considered as randomized in the Week 48 datasets and thus 1011 participants at 223 sites were randomized.
Disposition of Subjects [000265]With the exception of 2 participants who did not receive any study treatment, all other randomized participants were included in the FAS and the SAF (N=1009). Of these, 937 participants completed study treatment phase through Week 48 and 925 participants through Week 60. At the time of the last participant last Week 48 and last Week 60 visits, 66 and 80 participants, respectively, did not complete study treatment, with no notable differences between the treatment groups with regard to the reasons for premature discontinuation.
For 6 and 4 participants it was unknown as to whether they had completed study treatment through Week 48 and Week 60, respectively. See Table 1-11.
Date Recue/Date Received 2023-02-22 Table 1-11. Disposition in Overall Study: Week 60 (all enrolled participants) Number of subjects 2q8 HDq12 HDq16 All HD Total Enrolled, n 1395 Randomized, n (%) 337 (100%) 336 (100%) 338 (100%) 674 (100%) 1011(100%) Treated, n (%) 336 (99.7%) 335 (99.7%) 338 (100%) 673 (99.9%) 1009 (99.8%) Completed study until Week 60, n (%) 305(90.5%) 310(92.3%) 308(91.1%) 618(91.7%) 923(91.3%) Unknown if completed study until Week 60, 3 (0.9%) 3 (0.9%) 1 (0.3%) 4 (0.6%) 7 (0.7%) n(%) Did not complete study until Week 60, n (%) 29 (8.6%) 23 (6.8%) 29 (8.6%) 52 (7.7%) 81(8.0%) Primary reason b Adverse event 6(1.8%) 2(0.6%) 5(1.5%) 7(1.0%) 13 (1.3%) Physician decision 1 (0.3%) 4 (1.2%) 1 (0.3%) 5 (0.7%) 6 (0.6%) Non-compliance with study treatment 0 0 0 0 0 Pregnancy 0 0 0 0 0 Protocol deviation 0 1 (0.3%) 1 (0.3%) 2 (0.3%) 2 (0.2%) Lost to follow-up 1 (0.3%) 1 (0.3%) 2 (0.6%) 3 (0.4%) 4 (0.4%) Study terminated by sponsor 0 0 0 0 0 Lack of efficacy 2(0.6%) 0 0 0 2(0.2%) Technical problems 0 0 0 0 0 Logistical problems 0 0 0 0 0 VVithdrawal by subject 6(1.8%) 8(2.4%) 14(4.1%) 22(3.3%) 28 (2.8%) VVish for pregnancy 0 0 0 0 0 Death 5(1.5%) 3(0.9%) 2(0.6%) 5(0.7%) 10(1.0%) Other 6(1.8%) 2(0.6%) 2(0.6%) 4(0.6%) 10(1.0%) COVI D-19 pandemic 2 (0.6%) 2 (0.6%) 2 (0.6%) 4 (0.6%) 6(0.6%) Subject decision: COVI D-19 2 (0.6%) 2 (0.6%) 2 (0.6%) 4 (0.6%) 6(0.6%) pandemic related Physician decision: COVID-19 0 0 0 0 0 pandemic related Logistical reason: COVID-19 0 0 0 0 0 pandemic related Other: COVID-19 pandemic related 0 0 0 0 0 COVID-19 = Coronavirus Disease 2019.
a. 7 participants who had missing Week 60 information (i.e., they neither discontinued during Week 60 time frame, nor had Week 60 visit performed or marked as not done) were summarized as Unknown if completed study until Week 60.
b. For some participants the reason for premature discontinuation of study was inconsistently reported.
Definition of completed study until Week 60 = did not answer NO to the question "Did the subject complete the study?" on the "End of study" form prior to Week 60 visit.
Number of subjects enrolled is the number of subjects who signed informed consent.
See Definition of terms for treatment group description.
Protocol Deviations [000266]The frequency of participants with important protocol deviations was similar across the treatment groups (Table 1-12). In addition, there were several minor deviations regarding eligibility criteria that were also reported.
[000267]Overall, the frequency of participants with important protocol deviations associated with the COVID-19 pandemic was low and similar across the treatment groups.
Table 1-12. Number of Participants with Important Protocol Deviations (all randomized participants) 2q8 HDq12 HDq16 All HD Total Protocol deviation category N = 337 N = 336 N = 338 N = 674 N = 1011 (100%) (100%) (100%) (100%) (100%) Date Regue/Date Received 2023-02-22 Subjects with any important deviation, n (%) 119 (35.3%)113 (33.6%)113 (33.4%)226 (33.5%)345 (34.1%) Excluded concomitant medication treatment 1 (0.3%) 1 (0.3%) 1 (0.3%) 2 (0.3%) 3 (0.3%) Subject received any standard or 1 (0.3%) 1 (0.3%) 1 (0.3%) 2 (0.3%) 3 (0.3%) investigational agents for treatment of their nAMD in the study eye other than IVT
aflibercept as specified in this protocol Inclusion/exclusion criteria not met but subject 8 (2.4%) 9 (2.7%) 11(3.3%) 20 (3.0%) 28 (2.8%) entered treatment a Exclusion Criteria: Subject has subretinal 0 1 (0.3%) 0 1 (0.1%) 1 (0.1%) hemorrhage that is at least 50% of the total lesion area. or if the blood under the fovea is 1 or more disc areas in size in the study eye Exclusion Criteria: Subject has a history or 1(0.3%) 1 (0.3%) 0 1 (0.1%) 2 (0.2%) clinical evidence of diabetic retinopathy.
diabetic macular edema. or any retinal vascular disease other than nAMD in either eye.
Exclusion Criteria: Subject has known cardiac 1(0.3%) 1 (0.3%) 0 1 (0.1%) 2 (0.2%) arrhythmia. based on medical history and/or outcome of ECG at screening. (Dense PK Sub-study) Exclusion Criteria: Subject has uncontrolled 5(1.5%) 6(1.8%) 9(2.7%) 15(2.2%) 20(2.0%) blood pressure (defined as systolic >160 mmHg or diastolic >95 mmHg).
Inclusion Criteria: Subject does not have BCVA 1(0.3%) 0 0 0 1 (0.1%) ETDRS letter score of 78 to 24 at Baseline (corresponding to a Snellen equivalent of approximately 20/32 to 20/320) in the study eye (Left Eye).
Inclusion Criteria: Subject does not have BCVA 0 0 1 (0.3%) 1 (0.1%) 1 (0.1%) ETDRS letter score of 78 to 24 at Baseline (corresponding to a Snellen equivalent of approximately 20/32 to 20/320) in the study eye (Right Eye).
Inclusion Criteria: The patient does not have 0 0 1(0.3%) 1(0.1%) 1(0.1%) evidence of IRE and/or SRF affecting the central subfield of the study eye on OCT
Informed consent 22 (6.5%) 20 (6.0%) 17 (5.0%) 37 (5.5%) 59 (5.8%) Informed consent process not followed 0 0 1(0.3%) 1(0.1%) 1(0.1%) properly The Informed Consent is incomplete. The 21(6.2%) 20 (6.0%) 16 (4.7%) 36 (5.3%) 57 (5.6%) subjects signature/sign date are missing or partially signed or incorrect etc.
The subject signed the ICE after starting 1(0.3%) 0 0 0 1 (0.1%) his/her participation on the study (The ICE date is after the assessment date).
Other protocol deviations b 13(3.9%) 14(4.2%) 11(3.3%) 25(3.7%) 38(3.8%) Procedure deviations b 37(11.0%) 55 (16.4%) 48(14.2%) 103 (15.3%)140 (13.8%) Time schedule deviations b' 23 (6.8%) 20(6.0%) 28 (8.3%) 48 (7.1%) 71(7.0%) Treatment deviations 42 (12.5%) 20 (6.0%) 19 (5.6%) 39 (5.8%) 81(8.0%) Expired study drug administered to patient 8 (2.4%) 0 0 0 8 (0.8%) Incorrect study drug kit administered to patient 0 1 (0.3%) 4 (1.2%) 5 (0.7%) 5 (0.5%) Patient was randomized to the wrong stratum 1(0.3%) 1 (0.3%) 0 1 (0.1%) 2 (0.2%) Received wrong dose treatment (highdose 19 (5.6%) 12 (3.6%) 13 (3.8%) 25 (3.7%) 44 (4.4%) instead of low dose or vice versa; sham injection instead of active injection or vice versa) Study drug not administrated for reason other 16 (4.7%) 6 (1.8%) 3 (0.9%) 9 (1.3%) 25 (2.5%) than documented medical issue.
Subject was given incorrect study treatment 0 1 (0.3%) 2 (0.6%) 3 (0.4%) 3 (0.3%) Date Regue/Date Received 2023-02-22 BCVA = best corrected visual acuity, ECG = electrocardiogram, ETDRS = Early Treatment Diabetic Retinopathy Study, ICF =
informed consent form, IRF = intraretinal fluid, nAMD = neovascular (wet) age-related macular degeneration, IVT = intravitreal, OCT
= optical coherence tomography, PK = pharmacokinetics, PPS = per protocol set, SRF = subretinal fluid Subjects could have more than one protocol deviation but are only counted once within each deviation category.
a. There was 1 additional important protocol deviation in 1 participant who met an exclusion criterion but was reported late and was thus not part of the Week 48 database and not included in the analyses for Week 48 and Week 60.
b. Subcategories are provided in source table.
c. There were 2 protocol deviations related to "time schedule deviations" for missing Visit 15, which were not included in the analyses for Week 48 and Week 60.
See Definition of terms for treatment group description.
Visual Outcomes [000268]For the primary analysis of the primary efficacy variable, an MMRM was used with baseline BCVA measurement as a covariate and treatment group, visit, and the stratification variables as fixed factors as well as terms for the interaction between baseline BCVA and visit and for the interaction between treatment and visit. A key secondary endpoint (as per the EP-SAP) was the change from baseline in BCVA (as measured by ETDRS letter score) at Week 60.
The results of these analyses are presented in Table 1-13. See also Figure 26.
[000269]The analysis of the key secondary efficacy variable at Week 60 (Change from baseline in BCVA measured by the ETDRS letter score) resulted in LSmean changes from baseline to Week 60 (Le., estimated, adjusted mean changes) of 7.23, 6.37 and 6.31 letters for the 2q8, HDq12 and HDq16 groups, respectively (Table 1-13).
[000270]The estimated difference in LSmeans changes from baseline to Week 60 in BCVA (with corresponding 95% Cl) of HDq12 vs. 2q8 was -0.86 (-2.57, 0.84) letters and of HDq16 vs. 2q8 was -0.92 (-2.51, 0.66) letters. The p-values for the non-inferiority test at a margin of 4 letters were 0.0002 (related to H20) for HDq12 vs. 2q8, and <0.0001 (related to H40) for HDq16 vs.
2q8; p-values for a superiority test were 0.8393 (related to H70) for HDq12 vs. 2q8 and of 0.8731 (related to H90) for HDq16 vs. 2q8.
[000271]The arithmetic mean (SD) changes from baseline in BCVA to Week 60 (Le., observed, unadjusted mean changes) were 7.8 (12.6), 6.6 (13.6), and 6.6 (11.7) letters for the 268, 283, and 282 participants with Week 60 data, i.e., excluding data after an ICE as handled by the hypothetical strategy, in the 2q8, HDq12, and HDq16 groups, respectively.
[000272]The mean as well as the LSmean increases in BCVA over time were similar across all groups through Week 60 with minor numerical differences not being considered of clinical relevance.
Date Recue/Date Received 2023-02-22 Table 1-13. Change From Baseline in BCVA Measured by the ETDRS Letter Score at Week 48 and Week 60 in the Study Eye, MMRM (Full Analysis Set) 2q8 HDq12 HDq16 N = 336 N = 335 N = 338 Week 48 (primary endpoint) Baseline mean (a) 58.9 59.9 60.0 Number of subjects with Week 48 data 285 299 289 Arithmetic mean (SD) change from baseline (a) 7.6 (12.2) 6.7 (12.6) 6.2 (11.7) LS mean (SE) change from baseline 7.03 (0.74) 6.06 (0.77) 5.89 (0.72) DF 622.1 647.7 Contrast (b) HDq12 - 2q8 HDq16 - 2q8 t-value 3.14 3.07 p-value of one-sided test for non-inferiority at a 0.0009 0.0011 margin of 4 letters Estimate for Contrast and two-sided 95% Cl (c) -0.97 (-2.87,0.92) -1.14 (-2.97,0.69) Week 60 (key secondary endpoint) Baseline mean (a) 58.9 59.9 60.0 Number of subjects with Week 60 data 268 283 282 Arithmetic mean (SD) change from baseline (a) 7.8 (12.6) 6.6 (13.6) 6.6 (11.7) LS mean (SE) change from baseline 7.23 (0.68) 6.37 (0.74) 6.31 (0.66) DF 896.3 928.7 Contrast (b) HDq12 - 2q8 HDq16 - 2q8 t-value 3.61 3.81 p-value of one-sided test for non-inferiority at a 0.0002 <0.0001 margin of 4 letters Estimate for Contrast and two-sided 95% Cl (c) -0.86 (-2.57,0.84) -0.92 (-2.51,0.66) BCVA = best corrected visual acuity, Cl = Confidence interval, OF = Degrees of freedom, ETDRS = Early Treatment Diabetic Retinopathy Study, LS = Least Square, SAP = statistical analysis plan, SD =
Standard deviation, SE = Standard error A mixed model for repeated measurements (MMRM) was used with baseline BCVA
measurement as a covariate, treatment group, visit and the stratification variables (geographic region [Japan vs. Rest of World]; baseline BCVA [< 60 vs. a 60]) as fixed factors, and terms for the interaction between baseline BCVA and visit and the interaction between treatment and visit.
A Kenward-Roger approximation was used for the denominator degrees of freedom.
In order to model the within-subject error the following covariance structure was used: unstructured (for Week 48) and Toeplitz with heterogeneity (for Week 60).
Intercurrent events (ICE) were handled according to primary estimand strategy for continuous endpoints as described in Table 9-12 in Section 9.5 of the SAP.
(a): Based on observed assessments.
(b): The contrast also includes the interaction term for treatment x visit (at Week 48 or Week 60, for details on the population-level summary see SAP Section 6.2.2.1).
(c): Estimate based on the MMRM model, was computed for the differences of HDq12 minus 2q8 and HDq16 minus 2q8, respectively, with two-sided 95% Cls.
[000273]Mean (SD) values in BCVA were similar among treatment groups in the FAS at baseline across all treatment groups. The observed mean (SD) changes from baseline in BCVA
averaged over the period from Week 36 to Week 48 and from Week 48 to Week 60 were similar to those for the primary endpoint (Table 1-14). Similar mean changes from baseline averaged over the period from Week 36 to Week 48 and from Week 48 to Week 60 were also observed using LOCF in the FAS.
Date Regue/Date Received 2023-02-22 Table 1-14. Summary Statistics for Averaged BCVA in ETDRS Letter Score, OC
Prior to ICE (Full Analysis Set) Averaged value for period Change from baseline Mean Min, Min, Treatment Visit! Period n (SD) Median Max n Mean (SD) Median Max 2q8 Baseline 336 58.94 62.00 24.00, /
(N = 336) (14.02) 78.00 Average BCVA over the period 299 66.88 72.25 10.50, 299 7.78 8.25 -44.75, from Week 36 to Week 48 (15.59) 92.00 (11.42) 47.50 Average BCVA over the period 300 66.93 72.25 10.50, 300 7.88 8.25 -44.75, from Week 48 to Week 60 (15.60) 92.00 (11.53) 47.50 HDq12 Baseline 335 59.85 62.00 24.00, /
(N = 335) (13.37) 78.00 Average BCVA over the period 313 66.87 71.50 13.25, 313 6.85 6.25 -58.75, from Week 36 to Week 48 (15.02) 91.00 (11.58) 46.25 Average BCVA over the period 313 66.87 71.50 13.25, 313 6.85 6.25 -58.75, from Week 48 to Week 60 (15.02) 91.00 (11.58) 46.25 HDq16 Baseline 338 60.04 61.00 24.00, /
(N = 338) (12.38) 78.00 Average BCVA over the period 308 66.21 69.75 6.75, 308 6.21 6.75 -43.25, from Week 36 to Week 48 (14.85) 94.00 (11.14) 39.50 Average BCVA over the period 308 66.20 69.75 6.75, 308 6.20 6.75 -43.25, from Week 48 to Week 60 (14.85) 94.00 (11.15) 39.50 BCVA = best corrected visual acuity, ETDRS = Early Treatment Diabetic Retinopathy Study, Max = maximum, Min = minimum, SAP
= statistical analysis plan, SD = standard deviation OC (observed cases) prior to ICE: observations after an intercurrent event (ICE) defined for the primary estimand Intercurrent events (ICE) were handled according to primary estimand strategy for continuous endpoints [000274]Overall, the proportions of participants gaining or losing at least 5 or 10 letters in BCVA
from baseline at Week 48 were similar between the treatment groups, with minor numerical differences in favor of the 2q8 group, as can be seen from Table 1-15.
[000275]The proportion of participants gaining at least 10 letters or at least 5 letters in BCVA
from baseline at Week 48 were numerically higher in the 2q8 group than in the HDq12 and HDq16 treatment groups, based on LOCF in the FAS. In contrast, the proportion of participants who showed any gain (>0 letters) in BCVA from baseline was similar in the HDq16 and 2q8 groups and lower in the HDq12 group. Similar results for the proportions of participants gaining at least 10 letters, at least 5 letters, or any gain (>0 letters) in BCVA from baseline were observed at Week 60. See Figure 31.
[000276]The numerical differences in the proportion of participants who lost at least 5 or 10 letters between the treatment groups were generally small, with the lowest proportions observed in the 2q8 group at Week 48 as well as at Week 60.
[000277]The results of the analysis for the same endpoint using OC prior to ICE at Week 48 and at Week 60 were in line with those based on LOCF in the FAS.
Date Regue/Date Received 2023-02-22 [000278]The proportion of participants who lost at least 15 letters in BCVA
from baseline was <
6.0% at Week 48 and < 7.0% at Week 60 in all 3 treatment groups, based on LOCF
in the FAS, with only small numerical differences between the groups as can be seen in Table 1-15.
[000279]The analysis of the same endpoint using OC prior to ICE in the FAS
provided proportions of participants who lost at least 15 letters in BCVA from baseline at Week 48 of 4.2%, 4.3% and 4.8% in the 2q8, HDq12, and HDq16 group, respectively. Similar proportions of 4.1%, 6.0% and 4.3% in the 2q8, HDq12, and HDq16 group, respectively, were observed at Week 60. This was largely in line with the results based on LOCF in the FAS.
Table 1-15. Proportion of Participants who Gained or Lost at Least 5, 10 or 15 Letters in BCVA from Baseline at Week 48 and Week 60, LOCF (Full Analysis Set) Subjects with response category, Num/Den (%) Response category Treatment Week 48 Week 60 Gained 15 letters 2q8 (N = 336) 74/335 (22.1%) 78/335 (23.3%) HDq12 (N = 335) 69/334 (20.7%) 79/334 (23.7%) HDq16 (N = 338) 73/337 (21.7%) 78/337 (23.1%) Gained 10 letters 2q8 (N = 336) 142/335 (42.4%) 143/335 (42.7%) HDq12 (N = 335) 130/334 (38.9%) 137/334 (41.0%) HDq16 (N = 338) 130/337 (38.6%) 126/337 (37.4%) Gained 5 letters 2q8 (N = 336) 213/335 (63.6%) 216/335 (64.5%) HDq12 (N = 335) 186/334 (55.7%) 191/334 (57.2%) HDq16 (N = 338) 196/337 (58.2%) 204/337 (60.5%) Gained > 0 letters (any gain) 2q8 (N = 336) 255/335(76.1%) 266/335 (79.4%) HDq12 (N = 335) 240/334(71.9%) 233/334(69.8%) HDq16 (N = 338) 258/337 (76.6%) 253/337 (75.1%) Lost 5 letters 2q8 (N = 336) 37/335 (11.0%) 35/335(10.4%) HDq12 (N = 335) 44/334 (13.2%) 45/334 (13.5%) HDq16 (N = 338) 48/337 (14.2%) 50/337 (14.8%) Lost 10 letters 2q8 (N = 336) 21/335 (6.3%) 26/335 (7.8%) HDq12 (N = 335) 27/334(8.1%) 30/334(9.0%) HDq16 (N = 338) 31/337 (9.2%) 30/337 (8.9%) Lost 15 letters 2q8 (N = 336) 14/335 (4.2%) 14/335 (4.2%) HDq12 (N = 335) 18/334 (5.4%) 22/334 (6.6%) HDq16 (N = 338) 18/337 (5.3%) 17/337 (5.0%) BCVA = best corrected visual acuity, Num/Den = numerator/denominator, SAP =
statistical analysis plan LOCF (last observation carried forward): last available observed value prior to ICE was used to impute missing data.
Intercurrent events (ICE) were handled according to sensitivity estimand strategy for continuous endpoints.
BCVA >69 [000280]The proportions of participants achieving an ETDRS letter score of at least 69 (approximate 20/40 Snellen equivalent) at Week 48 using LOCF in the FAS were similar across the 3 treatment groups; the small numerical differences between the treatment groups were not clinically meaningful (Error! Reference source not found.). The proportions and between-treatment differences obtained for the corresponding analysis based on OC
prior to ICE were consistent with the results using LOCF.
numerator/denominator, SAP = statistical analysis plan; LOCF method for the last available observed value prior to ICE was carried forward to impute missing data;
Intercurrent events (ICE) were handled according to primary estimand strategy for continuous endpoints. (a) Difference is HD groups minus 2q8 and CI was calculated using Mantel-Haenszel weighting scheme adjusted by geographical region and baseline BCVA (< 60 vs. 60) and is displayed with two-sided 95% Cls. (b) Nominal p-value for the two-sided Cochran-Mantel-Haenszel (CMH) test.
Retinal Fluid [000281]Summary statistics for the proportion of participants with no IRF and no SRF in central subfield at baseline, Week 16, Week 48, and Week 60, using LOCF for the FAS, are presented in Table 1-16. As can be seen from this table, the proportions of participants with no retinal fluid were >50% at both Week 16 and Week 48 and numerically higher at Week 48 than at Week 16 in all 3 treatment groups and the pooled HD groups. At Week 60, the proportions of participants with no retinal fluid were >70% and similar in all 3 treatment groups and the pooled HD groups.
[000282]The proportions of participants achieving an ETDRS letter score of at least 69 increased from values of 29.5 (2q8), 34.0%) (HDq12), and 28.4% (HDq16) at baseline to values >50% at Week 8 (2q8), Week 12 (HDq12), or Week 16 (HDq16) and remained >50%
with similar values in all 3 treatment groups at Week 48 (54.3% to 57.9%) and at Week 60 (54.6% to 58.2%). See Figure 32.
N = 336 N = 335 N = 338 N = 673 Visit Fluid status Num/Den(%) Num/Den(%) Num/Den(%) Num/Den(%) Baseline Dry a 13/336 (3.9%) 8/335 (2.4%) 9/336 (2.7%) 17/671 (2.5%) Not Dry b 323/336(96.1%) 327/335 (97.6%) 327/336 (97.3%) 654/671 (97.5%) Missing or undetermined 0 0 2 2 Week 16 Dry a 173/335(51.6%) 205/333 (61.6%) 217/334 (65.0%) 422/667(63.3%) Not Dry b 162/335 (48.4%) 128/333 (38.4%) 117/334 (35.0%) 245/667 (36.7%) Missing or undetermined 1 2 4 6 Week 48 Dry a 199/335(59.4%) 236/332 (71.1%) 223/334(66.8%) 459/666(68.9%) Not Dry b 136/335(40.6%) 96/332(28.9%) 111/334(33.2%) 207/666(31.1%) Missing or undetermined 1 3 4 7 Week 60 Dry a 249/334 (74.6%) 247/331 (74.6%) 242/335 (72.2%) 489/666 (73.4%) Not Dry b 85/334 (25.4%) 84/331 (25.4%) 93/335 (27.8%) 177/666 (26.6%) Missing or undetermined 2 4 3 7 ICE = intercurrent events, IRF = intraretinal fluid, LOCF = last observation carried forward, Num/Den = numerator/denominator, SAP
= statistical analysis plan, SRF = subretinal fluid LOCF method for the last available observed value prior to ICE was carried forward to impute missing data.
Intercurrent events (ICE) were handled according to primary estimand strategy for binary endpoints a. Dry = defined as no IRF nor SRF detected b. Not dry = defined as IRF and/or SRF detected [000283]The proportion of participants without subRPE fluid in central subfield at Week 48 using LOCF in the FAS increased to values > 90% in both HD treatment groups and 86.2% in the 2q8 group. At Week 60, the proportion of participants without subRPE fluid in central subfield increased to values >90% in all treatment groups.
[000284]The proportion of participants with both no subRPE fluid and no retinal fluid (no IRF
and no SRF) in central subfield increased from approximately 2% in each treatment group at baseline to proportions > 60% in both HD treatment groups and of 54.6% in the 2q8 group at Week 48. At Week 60, the proportion of participants with both no subRPE fluid and no retinal fluid in central subfield increased further to values of approximately 69% to 71% in all treatment groups.
[000285]There were no clinically meaningful pair-wise differences between the HD treatment groups and the 2q8 group in the median time to fluid-free retina (no IRF and no SRF), median time to IRF-free retina, or median time to SRF-free retina over 48 weeks in the FAS.
[000286]There were also no clinically meaningful pair-wise differences between the HD
treatment groups and the 2q8 group in the median time to fluid-free retina (no IRF and no SRF), median time to IRF-free retina, or median time to SRF-free retina over 60 weeks in the FAS.
[000287]There were no clinically meaningful pair-wise differences between the HD treatment groups and the 2q8 group in the median time to sustained fluid-free retina (no IRF and no SRF), median time to IRF-free retina, or median time to SRF-free retina over 48 weeks in the FAS.
treatment groups and the 2q8 group in the median time to sustained fluid-free retina (no IRF
and no SRF), median time to IRF-free retina, or median time to SRF-free retina over 60 weeks in the FAS. See Table 1-17.
Table 1-17. Proportion of Participants without Retinal Fluid and Subretinal Pigment Epithelium Fluid in Central Subfield by Visit, LOCF (Full Analysis Set) 2q8 HDq12 HDq16 N = 336 N = 335 N = 338 Visit Fluid status Num/Den(%) Num/Den(%) Num/Den(%) Baseline No SubRPE fluid 237/335 (70.7%) 225/334 (67.4%) 236/336 (70.2%) Dry 7/335(2.1%) 5/334(1.5%) 6/336(1.8%) Not dry (IRF and/or SRF) 230/335 (68.7%) 220/334 (65.9%) 230/336 (68.5%) Both I RF and SRF missing or 0/335 0/334 0/336 undetermined SubRPE fluid present 98/335 (29.3%) 109/334 (32.6%) 100/336 (29.8%) Dry 6/335 (1.8%) 3/334 (0.9%) 3/336 (0.9%) Not dry (IRF and/or SRF) 92/335 (27.5%) 106/334 (31.7%) 97/336 (28.9%) Both I RF and SRF missing or 0/335 0/334 0/336 undetermined SubRPE missing or undetermined 1 1 2 Week 48 No SubRPE fluid 281/326 (86.2%) 298/325 (91.7%) 308/330 (93.3%) Dry 178/326 (54.6%) 216/325 (66.5%) 207/330 (62.7%) Not dry (IRF and/or SRF) 103/326 (31.6%) 82/325(25.2%) 100/330(30.3%) Both I RF and SRF missing or 0/326 0/325 0/330 undetermined SubRPE fluid present 45/326 (13.8%) 27/325(8.3%) 22/330(6.7%) Dry 17/326 (5.2%) 16/325 (4.9%) 14/330 (4.2%) Not dry (IRF and/or SRF) 28/326(8.6%) 11/325(3.4%) 8/330(2.4%) Both I RF and SRF missing or 0/326 0/325 0/330 undetermined SubRPE missing or undetermined 10 10 8 Week 60 No SubRPE fluid 296/326 (90.8%) 305/328 (93.0%) 309/331 (93.4%) Dry 226/326 (69.3%) 232/328 (70.7%) 228/331 (68.9%) Not dry (IRF and/or SRF) 70/326 (21.5%) 72/328 (22.0%) 81/331 (24.5%) Both IRF and SRF missing or 0/326 0/328 0/331 undetermined SubRPE fluid present 30/326 (9.2%) 23/328 (7.0%) 22/331 (6.6%) Dry 18/326 (5.5%) 12/328 (3.7%) 13/331 (3.9%) Not dry (IRF and/or SRF) 12/326(3.7%) 11/328 (3.4%) 9/331 (2.7%) Both IRF and SRF missing or 0/326 0/328 0/331 undetermined SubRPE missing or undetermined 10 7 7 IRF = Intraretinal fluid, LOCF = Last observation carried forward, Num/Den =
numerator/denominator, SAP = statistical analysis plan, SRF = Subretinal fluid, subRPE = subretinal pigment epithelium fluid LOCF: last available observed value prior to ICE was used to impute missing data.
Intercurrent events (ICE) were handled according to primary estimand strategy for binary endpoints Dry = defined as no IRF nor SRF in central subfield detected; Not dry =
defined as IRF and/or SRF in central subfield detected.
Fluid Leakage [000289]The proportion of participants without leakage on FA increased in all groups over time reaching values of >40% in the HDq16 and the 2q8 groups and >60% in the HDq12 group at Week 48. At Week 60, the proportion of participants without leakage on FA
increased further,
Table 1-18. Proportion of Participants without Leakage on FA by Visit, LOCF
(Full Analysis Set) Visit Leakage status 2q8 HDq12 HDq16 N=336 N=335 N=338 Num/Den(%) Num/Den(%) Num/Den(%) Baseline No leakage 0/336 0/335 1/337 (0.3%) Any leakage 336/336 (100%) 335/335 (100%) 336/337 (99.7%) Undetermined 0 0 1 Week 12 No leakage 61/308 (19.8%) 70/305 (23.0%) 67/307 (21.8%) Any leakage 247/308 (80.2%) 235/305 (77.0%) 240/307 (78.2%) Undetermined 9 8 7 Week 48 No leakage 136/322 (42.2%) 193/319 (60.5%) 140/319(43.9%) Any leakage 186/322 (57.8%) 126/319 (39.5%) 179/319(56.1%) Undetermined 8 9 8 Week 60 No leakage 178/320(55.6%) 195/318 (61.3%) 169/316(53.5%) Any leakage 142/320(44.4%) 123/318 (38.7%) 147/316(46.5%) Undetermined 10 10 10 ICE = Intercurrent events, FA = fluorescein angiography, LOCF = Last observation carried forward, Num/Den =
numerator/denominator, SAP = statistical analysis plan LOCF: last available observed value prior to ICE was used to impute missing data.
ICE were handled according to primary estimand strategy for binary endpoints.
Choroidal Neovascularization [000290]Summary statistics for the CNV size at baseline, Week 12, Week 48, and Week 60 based on OC (observed case) prior to ICE (intercurrent event) in the FAS (full analysis set), are presented in Table 1-19.
[000291]The mean (SD) CNV size at baseline ranged from 5.9768 (4.8306) mm2 to 6.5459 (5.5315) mm2 across the 3 treatment groups. Numerical mean and median decreases from baseline were observed in all 3 treatment groups at Week 12, Week 48, and Week 60. At Week 60, the mean (SD) decreases in CNV size from baseline were of similar extent in all 3 treatment groups ranging from -3.6610 (5.6624) mm2 to -3.8795 (5.4295) mm2.
Prior to ICE (Full Analysis Set) Value at visit Change from baseline Mean Mean Treatment Visit n (SD) Median Min, Max n (SD) Median Min, Max 2q8 Baseline 336 6.3593 4.9970 0.148, (N = 336) (5.0394) 24.129 Week 12 314 5.2107 3.7455 0.000, 314 -1.1702 -0.4930 -22.149, (5.4069) 29.362 (3.4604) 11.671 Week 48 280 4.1366 1.6195 0.000, 280 -2.3934 -1.3125 -24.129, (5.5680) 27.675 (5.2421) 16.636 Week 60 250 2.7613 0.0000 0.000, 250 -3.8795 -2.5440 -24.129, (4.5855) 24.233 (5.4295) 12.664 HDq12 Baseline 335 5.9768 4.8990 0.115, (N = 335) (4.8306) 30.023 Week 12 312 4.3936 3.0690 0.000, 312 -1.4886 -0.5530 -21.998, (4.6561) 30.212 (3.6500) 11.890 Week 48 287 2.4733 0.0000 0.000, 287 -3.5530 -2.5760 -21.998, (4.6964) 27.034 (5.0074) 15.501 Week 60 249 2.1483 0.0000 0.000, 249 -3.8080 -2.7740 -21.998, (4.2820) 26.051 (4.9944) 12.783 HDq16 Baseline 337 6.5459 4.6980 0.000, (N = 338) (5.5315) 28.650 Week 12 313 4.8923 3.3660 0.000, 313 -1.5729 -0.4950 -25.133, (5.1756) 27.081 (4.2200) 16.628 Week 48 279 3.5367 0.7110 0.000, 279 -2.9790 -1.4060 -25.354, (5.1716) 28.936 (5.3189) 15.869 Week 60 258 2.6576 0.0000 0.000, 258 -3.6610 -2.1700 -26.231, (4.7255) 30.991 (5.6624) 16.769 Max = maximum, Min = minimum, SAP = statistical analysis plan, SD = standard deviation OC (observed cases) prior to ICE: observations after an intercurrent event (ICE) defined for the primary estimand excluded Intercurrent events (ICE) were handled according to primary estimand strategy for continuous Total Lesion Area [000292]Summary statistics for the total lesion area at baseline, Week 12, Week 48, and Week 60 based on OC (observed case) prior to ICE (intercurrent event) in the FAS
(full analysis set), are presented in Table 1-20. The mean (SD) total lesion area at baseline ranged from 6.3820 (5.0664) mm2 to 6.8814 (5.6514) mm2 across the 3 treatment groups.
[000293]Numerical mean and median decreases in total lesion area from baseline were observed in all 3 treatment groups from Week 12 to Week 60, except for a numerical mean increase in the 2q8 group at Week 48. At Week 60, the mean (SD) decreases in total lesion area from baseline were of similar extent in all 3 treatment groups ranging from -0.3095 (3.1708) mm2 to -0.5199 (2.8399) mm2.
[000294] Central retinal thickness (micrometers) over time (observed values-censoring data post ICE) through week 60 are shown in Figure 29A; Mean changes from baseline in CST (pm) by visit through Week 60, based on OC prior to ICE in the FAS, are graphically displayed in post-hoc Figure 29 (B); the LSmean (95% Cls) changes from baseline in CST (pm) by visit through Week 48, based on MMRM in the FAS, are graphically displayed in post-hoc Figure 29 (C).
Patient-Reported Outcomes [000295]The mean NEI-VFQ-25 (National Eye Institute Visual Functioning Questionnaire-25) total score at baseline was similar across the 3 treatment groups, ranging from 76.36 to 77.81.
The mean changes from baseline in NEI-VFQ-25 total score overtime, based on OC
prior to ICE, were all mean increases, which were numerically lower in the HD groups than in the 2q8 group at Week 24, Week 48, and Week 60. The mean (SD) increases from baseline at Week 60, which ranged from 3.65 (12.08) in the HDq12 group to 5.10 (11.38) in the 2q8 group,
Pharmacokinetic evaluation [000296]The PKS was used for the descriptive statistics of the general (sparse) PK assessment and included 934 (92.4%) participants in total and 641 (63.4%) participants with unilateral treatment. A subset of the PKS was used for the analysis of the PK sub-study (DPKS) with dense sampling and included 19 (1.9%) participants with unilateral treatment assessed after the first administration of aflibercept up to Week 48. Data for the PK sub-study were analyzed using non-compartmental analysis (NCA).
Atlibercept¨ concentration versus time data [000297]Summary of free aflibercept concentrations for participants in the DPKS are presented by treatment in Table 1-21. After initial IVT administration of 2 mg or 8 mg (HDq12 pooled with HDq16) aflibercept, the concentration-time profiles of free aflibercept were characterized by an initial phase of increasing concentrations reflecting initial absorption from the ocular space and initial distribution into the systemic circulation from the ocular space into systemic circulation followed by a mono-exponential elimination phase.
[000298]For participants with unilateral treatment up to Week 48 enrolled in the dense PK sub-study and receiving 2 mg aflibercept (N = 6), plasma concentrations of free aflibercept were detectable in 4 participants on Day 8 but in only 1 single participant on Day 15 with values only twice the LLOQ. For the 8 mg aflibercept treatment (N = 13), free aflibercept concentrations were detectable in 38% the participants (N = 5) at the end of dense PK
sampling on Day 29 (Table 1-21). Most of the participants in the 2q8 DPKS had concentrations of free aflibercept <
0.04 mg/L on Day 2 which corresponds to the expected maximum concentration.
However, there was 1 participant in the DPKS (2q8) with implausibly high concentrations (up to 15 times higher than the rest of the participants in this group). These high values in a single participant influence the arithmetic mean considerably. These values appeared pharmacokinetically implausible but were left in this data presentation, since an analytical artifact was not proven.
Therefore, the median was more meaningful and was used for comparison, although arithmetic means remained the general base for data presentation.
Sub-Study (DPKS) Free aflibercept Treatment Time n total n ? LLOQ
Geom. Mean Arithm. Mean Median SD SD
2q8 (N = 6) Day 1, Pre-dose 4 0 N.0 0.00 (0.00) 0.00 2q8 (N =6) Day 1,4 Hours 6 3 N.0 0.0182(0.0210) 0.0127 Post-dose 2q8 (N = 6) Day 1, 8 Hours 5 4 0.03 (3.31) 0.0549 (0.0742) 0.0282 Post-dose 2q8 (N = 6) Day 2 6 6 0.04 (2.68) 0.0734 (0.105) 0.0357 2q8 (N = 6) Day 3 6 6 0.04 (2.49) 0.0622 (0.0835) 0.0320 2q8 (N = 6) Day 5 6 5 0.03 (2.67) 0.0451 (0.0580) 0.0283 2q8 (N = 6) Day 8 5 4 0.02 (1.66) 0.0187 (0.0110) 0.0212 2q8 (N = 6) Day 15 5 1 N.0 0.00624 (0.0140) 0.00 2q8 (N = 6) Day 22 5 0 N.0 0.00 (0.00) 0.00 2q8 (N = 6) Day 29 5 1 N.0 0.00330 (0.00738) 0.00 HDq12 +HDq16 Day 1, Pre-dose 12 0 N.0 0.00 (0.00) 0.00 (N = 13) HDq12 +HDq16 Day 1,4 Hours 13 6 N.0 0.0409 (0.0605) 0.00 (N = 13) Post-dose HDq12 +HDq16 Day 1,8 Hours 12 9 0.05 (3.78) 0.0973 (0.102) 0.0672 (N = 13) Post-dose HDq12 +HDq16 Day 2 12 12 0.11 (2.21) 0.146(0.110) 0.0903 (N = 13) HDq12 +HDq16 Day 3 12 12 0.11 (2.06) 0.137(0.0947) 0.112 (N = 13) HDq12 +HDq16 Day 5 11 11 0.08 (1.86) 0.0933 (0.0481) 0.0854 (N = 13) HDq12 +HDq16 Day 8 13 13 0.07 (1.75) 0.0794 (0.0413) 0.0682 (N = 13) HDq12 +HDq16 Day 15 13 12 0.04 (1.76) 0.0435 (0.0199) 0.0385 (N = 13) HDq12 +HDq16 Day 22 11 9 0.02(1.76) 0.0213(0.0148) 0.0232 (N = 13) HDq12 +HDq16 Day 29 12 5 N.0 0.00766(0.00958) 0.00 (N = 13) Arithm. = arithmetic, DPKS = dense pharmacokinetic analysis set, LLOQ = lower level of quantification, geom. = geometric, N =
Number of participants with unilateral treatment up to Week 48, n = Number of observations, nAMD = neovascular (wet) age-related macular degeneration, PK = pharmacokinetic, SD = standard deviation N.C: not calculated (less than 2/3 of values per time point are a LLOQ for geometric mean calculation).
Values below LLOQ (0.0156 mg/L ) were substituted by 1/2 LLOQ for the calculation of geometric statistics and 0 for arithmetic statistics and median.
Minimum and Maximum have been rounded to 4 decimal places.
[000299]Summaries of PK parameters for free aflibercept for participants in the DPKS are presented by treatment in Table 1-22 for non-Japanese (rest of world) participants and in Table 1-23 for Japanese participants.
[000300]After the initial monthly aflibercept dose of 2 mg (2q8) or 8 mg (HDq12 pooled with HDq16) in non-Japanese participants, free aflibercept median time to peak concentration (tmax) was 1.05 and 1.93 days for the 2 mg and 8 mg aflibercept treatments, respectively. As the IVT
dose of aflibercept increased from 2 mg to 8 mg (4-fold ratio), the median peak concentration
[000301]Following the third initial monthly IVT dose of aflibercept, based on the ratio of aflibercept concentration at Week 12 to Week 4 (CWeek12/CWeek4), the accumulation ratio of free aflibercept was 1.17 for HDq12 + HDq16 (Table 1-22). The accumulation ratio of free aflibercept could not be determined for 2q8 since all aflibercept concentration values at Week 12 were below LLOQ.
[000302]In general, concentrations of free aflibercept as well as PK
parameters (C., AUCiast) in a single Japanese participant (in the HDq12 + HDq16 group) were in the same range of values seen in non-Japanese participants after administration of 8 mg aflibercept. (Table 1-22, Table 1-23).
Arithm. Median Min, Max region mean (SD) Mean (%) mean (SD) CV
(%) 95% CI
Rest of the Cmax (mg/L) 2q8 6 0.0469 0.02, 116 0.0758 136 0.0357 0.0223, World (N = 6) (2.51) 0.12 (0.103) 0.286 HDq12+1-Mq16 11 0.115 0.06, 74.8 0.137 55.0 0.111 0.0288, (N= 11) (1.95) 0.22 (0.0755) 0.231 Cmax/Dose 2q8 6 0.0235 0.01, 116 0.0379 136 0.0179 0.0112, (mg/L/mg) (N = 6) (2.51) 0.06 (0.0517) 0.143 HDq12+1-Mq16 11 0.0144 0.01, 74.8 0.0171 55.0 0.0139 0.0036, (N= 11) (1.95) 0.03 (0.00943) 0.0289 Clast (mg/L) 2q8 6 0.0202 0.02, 11.5 0.0203 11.1 0.0202 0.0165, (N = 6) (1.12) 0.02 (0.00226) 0.0235 HDq12+1-Mq16 11 0.0217 0.02, 37.6 0.0233 48.7 0.0183 0.0164, (N= 11) (1.44) 0.03 (0.0113) 0.0549 Ctrough (mg/L) 2q8 5 0.0165 NE NE 0.00330 224 0.00 0.00, Day 29 (N = 6) (NE) (0.00738) 0.0165 HDq12+1-Mq16 10 0.0186 0.02, 13.3 0.00750 131 0.00 0.00, (N= 11) (1.14) 0.02 (0.00980) 0.0226 AUClast (day*mg/L) 2q8 6 0.188 0.06, 167 0.362 149 0.18 0.0532, (N = 6) (3.17) 0.60 (0.538) 1.45 HDq12+1-Mq16 11 1.12 0.56, 78.0 1.28 37.1 1.31 0.156, (N= 11) (1.99) 2.23 (0.476) 1.85 AUCinf (day*mg/L) 2q8 0 (N = 6) HDq12+1-Mq16 7 1.73 1.46, 17.2 1.749 15.4 1.83 1.22, (N= 11) (1.19) 2.05 (0.26879) 1.98 AUCinf/Dose 2q8 0 (day*mg/L/mg) (N = 6) HDq12+1-Mq16 7 0.216 0.18, 17.2 0.219 15.4 0.229 0.153, (N= 11) (1.19) 0.26 (0.0336) 1.98 AUC(0-28d) Norm 2q8 3 0.0059 0.00, 96.9 0.00753 87.1 0.00413 0.0034, by WT (N = 6) (2.26) 0.01 (0.00656) 0.0151 (day*mg/L/kg) HDq12+1-Mq16 9 0.0172 0.01, 27.9 0.0177 24.9 0.0161 0.0098, (N= 11) (1.32) 0.02 (0.00441) 0.0232 Accumulation Ratio 2q8 1 NE NE NE 0.00 NE 0.00 0.00, (Cweek12/CWeek4) (N = 6) (NE) (NE) 0.00 HDq12+1-Mq16 4 1.16 1.05, 10.2 1.165 10.1 1.17 1.04, (N= 11) (1.11) 1.29 (0.118) 1.28 t1/2 (day) 2q8 2 5.93 5.72, 3.71 5.94 3.71 5.94 5.78, (N = 6) (1.04) 6.16 (0.220) 6.09 HDq12+1-Mq16 9 10.3 5.30, 74.7 13.3 98.6 10.6 5.21, (N= 11) (1.95) 20.1 (13.1) 47.3 tmax (day) 2q8 6 1.05 0.333, (N = 6) 1.95 HDq12+1-Mq16 11 1.93 0.333, (N = 11) 4.03 tlast (day) 2q8 6 6.98 2.00, (N = 6) 26.9 HDq12+1-Mq16 11 21.1 7.05, (N = 11) 28.1 Arithm. = arithmetic, AUCmf = Area under the curve from time zero to infinity, AUCIõt = Area under the curve to the last quantifiable concentration, Cl = confidence interval, Clast = Last concentration, Cmõ = Maximum concentration, Ctrough = trough concentration, CV
= coefficient of variation, geom. = geometric, DPKS = dense pharmacokinetic analysis set, LLOQ
= Lower level of quantification, Max = Maximum, Min = Minimum, N = Number of participants with unilateral treatment up to Week 48, n = Number of observations, NE = Not Evaluable, PK =
time to maximum concentration, WT = weight. For Clast, values below LLOQ were substituted by 1/2 LLOQ for the calculation of geometric statistics and 0 for arithmetic statistics.
Table 1-23. Summary Statistics of Free Aflibercept Pharmacokinetic Parameters in Plasma in Participants with Unilateral Treatment from Pooled Region: Japan -Dense PK
Sub-Study (DPKS) Pooled PK parameter (unit)Treatment n Geom. Geom. Geom. CV Arithm.
Arthm. Median Min, Max region mean (SD) Mean (%) mean (SD) CV (%) 95% CI
Japan Cmax (mg/L) 2q8 0 (N = 0) HDq12+11Dq16 1 0.393 NE NE 0.393 NE
0.39300 0.393, (N = 2) (NE) (NE) 0.393 Cmax/Dose 2q8 0 (mg/L/mg) (N = 0) HDq12+11Dq16 1 0.0491 NE NE
0.0491 NE 0.0491 0.0491, (N =2) (NE) (NE) 0.0491 Clast (mg/L) 2q8 0 (N = 0) HDq12+11Dq16 1 0.0169 NE NE
0.0169 NE 0.01690 0.0169, (N =2) (NE) (NE) 0.0169 Ctrough (mg/L) 2q8 0 (N = 0) HDq12+11Dq16 1 0.0169 NE NE
0.0169 NE 0.01690 0.0169, (N =2) (NE) (NE) 0.0169 AUClast (day*mg/L) 2q8 0 (N = 0) HDq12+11Dq16 1 3.51 NE NE 3.51 NE 3.51 3.51, (N = 2) (NE) (NE) 3.51 AUCinf (day*mg/L) 2q8 0 (N = 0) HDq12+11Dq16 1 3.66 NE NE 3.66 NE 3.66 3.66, (N = 2) (NE) (NE) 3.66 AUCinf/Dose 2q8 0 (day*mg/L/mg) (N = 0) HDq12+11Dq16 1 0.457 NE NE 0.457 NE
0.457 0.457, (N = 2) (NE) (NE) 0.457 AUC(0-28d) Norm 2q8 0 by WT (N = 0) (day*mg/L/kg) HDq12+11Dq16 1 0.0807 NE NE
0.0807 NE 0.0807 0.0807, (N = 2) (NE) (NE) 0.0807 Accumulation Ratio 2q8 0 (Cweek12/CWeek4) (N - 0) HDq12+11Dq16 1 1.37 NE NE 1.37 NE 1.37 1.37, (N = 2) (NE) (NE) 1.37 t1/2 (day) 2q8 0 (N = 0) HDq12+11Dq16 1 6.03 NE NE 6.03 NE 6.03 6.03, (N = 2) (NE) (NE) 6.03 tmax (day) 2q8 0 (N = 0) HDq12+11Dq16 1 1.02 1.02, (N = 1) 1.02 tlast (day) 2q8 0 (N = 0) HDq12+11Dq16 1 27.9 27.9, (N = 1) 27.9 Arithm. = arithmetic, AUCinf = Area under the curve from time zero to infinity, AUCIõt = Area under the curve to the last quantifiable concentration, Cl = confidence interval, Ciõt = Last
= coefficient of variation, geom. = geometric, DPKS = dense pharmacokinetic analysis set, geom.
= geometric, LLOQ = lower level of quantification, Max = maximum, Min = minimum, N = Number of participants with unilateral treatment up to Week 48, n = Number of observations, NE = Not Evaluable, PK = pharmacokinetic, SD = standard deviation, t112 = half-life, t -last = time to last concentration, tmax = time to maximum concentration, WT = weight. For Clast, values below LLOQ
were substituted by 1/2 LLOQ for the calculation of geometric statistics and 0 for arithmetic statistics.
[000303]Summary of adjusted bound aflibercept concentrations for participants in the DPKS
are presented by treatment in Table 1-24. After the initial IVT administration of aflibercept of 2 mg or 8 mg (HDq12 pooled with HDq16), the concentration-time profiles of adjusted bound aflibercept were characterized by a slower attainment of peak concentration compared to free aflibercept. Following attainment of Cmax, a slight decrease of the concentration-time profiles was observed until the end of the dosing interval of 4 weeks for both dose groups. For unilaterally treated participants enrolled in the dense PK sub-study who received 2 mg aflibercept (N = 6), concentrations of adjusted bound aflibercept were detectable in almost all participants until the end of the dense PK sampling. For the 8 mg aflibercept treatment (N=13), adjusted bound aflibercept concentrations were detectable in almost all participants until the end of the dense PK sampling at Day 29 (Table 1-24).
2q8 (N = 6) Day 1, Pre-dose 4 0 N.0 0.00 (0.00) 2q8 (N = 6) Day 1, 4 Hours Post-dose 6 0 N.0 0.00 (0.00) 2q8 (N = 6) Day 1, 8 Hours Post-dose 5 0 N.0 0.00 (0.00) 2q8 (N = 6) Day 2 6 4 0.02 (1.91) 0.0249 (0.0216) 2q8 (N = 6) Day 3 6 6 0.06 (1.57) 0.0638 (0.0343) 2q8 (N = 6) Day 5 6 6 0.10 (1.52) 0.104 (0.0518) 2q8 (N = 6) Day 8 5 5 0.16 (1.55) 0.179 (0.0990) 2q8 (N = 6) Day 15 5 5 0.16 (1.65) 0.181 (0.108) 2q8 (N = 6) Day 22 5 5 0.16 (1.53) 0.169 (0.0773) 2q8 (N = 6) Day 29 5 5 0.12 (1.90) 0.149 (0.124) HDq12 +HDq16 Day 1, Pre-dose 12 0 N.0 0.00 (0.00) (N = 13) HDq12 +HDq16 Day 1,4 Hours Post-dose 13 0 N.0 0.00 (0.00) (N = 13) HDq12 +HDq16 Day 1,8 Hours Post-dose 12 0 N.0 0.00 (0.00) (N = 13) HDq12 +HDq16 Day 2 12 10 0.06 (3.50) 0.124 (0.186) (N = 13) HDq12 +HDq16 Day 3 12 12 0.13(2.07) 0.173(0.155) (N = 13) HDq12 +HDq16 Day 5 11 11 0.18 (1.88) 0.223 (0.157) (N = 13) HDq12 +HDq16 Day 8 13 13 0.31 (1.56) 0.334(0.135) (N = 13) HDq12 +HDq16 Day 15 13 13 0.37 (1.50) 0.393 (0.130) (N = 13) HDq12 +HDq16 Day 22 11 10 0.25(3.00) 0.335(0.155) (N = 13) HDq12 +HDq16 Day 29 12 12 0.32 (1.39) 0.331 (0.0953) (N = 13) Arithm. = arithmetic, DPKS = dense pharmacokinetic analysis set, geom. =
geometric, LLOQ =
Lower level of quantification, N = Number of participants with unilateral treatment up to Week 48, n = Number of observations, PK = pharmacokinetic, SD = standard deviation N.C.: not calculated (less than 2/3 of values per time point are LLOQ for geometric mean calculation). Values below LLOQ (0.022442 mg/L) were substituted by 1/2 LLOQ
for the calculation of geometric statistics and 0 for arithmetic statistics and median.
[000304]Summaries of PK parameters for adjusted bound aflibercept for participants in the DPKS are presented by treatment in Table 1-25 for non-Japanese participants and in Table 1-26 for Japanese participants.
[000305]After the initial monthly aflibercept dose of 2 mg (2q8) or 8 mg (HDq12 pooled with HDq16), adjusted bound aflibercept median tma, was 14 days for the 2 mg and 8 mg aflibercept treatments. As the IVT dose of aflibercept increased from 2 mg to 8 mg (4-fold dose), the mean
[000306]Following the third initial monthly IVT dose of aflibercept, based on the ratio of aflibercept concentration at Week 12 to Week 4 (C Weekl 2/C Week4) , the accumulation ratio of adjusted bound aflibercept was 1.83 and 1.72 for 2q8, and HDq12+HDq16, respectively (Table 1-25).
[000307]In general, concentrations of adjusted bound aflibercept as well as PK
parameters (Cmõ, AUCiast) in the 2 Japanese participants (one each in the HDq12 + HDq16 groups, with only one of them providing data for PK parameters) were in the same range of values seen in non-Japanese participants after administration of 8 mg aflibercept.
Arthm. Median Min, Max region mean (SD) Mean (%) mean (SD) CV
(%) 95% CI
Rest of the Cmax (mg/L) 2q8 6 0.164 0.11, 44.9 0.179 53.0 0.158 0.108, World (N = 6) (1.54) 0.25 (0.0950) 0.368 HDq12+1-Mq16 11 0.415 0.28, 42.6 0.441 31.3 0.424 0.143, (N= 11) (1.50) 0.62 (0.138) 0.611 Cmax/Dose 2q8 6 0.0821 0.05, 44.9 0.0897 53.0 0.0789 0.0541, (mg/L/mg) (N = 6) (1.54) 0.13 (0.0475) 0.184 HDq12+1-Mq16 11 0.0519 0.03, 42.6 0.0552 31.3 0.0531 0.0178, (N= 11) (1.50) 0.08 (0.0173) 0.0764 Clast (mg/L) 2q8 6 0.120 0.07, 63.1 0.142 78.5 0.106 0.0739, (N = 6) (1.78) 0.21 (0.112) 0.368 HDq12+1-Mq16 11 0.325 0.23, 34.8 0.341 28.4 -- 0.338 -- 0.143, (N= 11) (1.40) 0.46 (0.0966) 0.512 Ctrough (mg/L) 2q8 5 0.122 0.06, 71.8 0.149 82.7 0.105 0.0739, Day 29 (N = 6) (1.90) 0.23 (0.124) 0.368 HDq12+1-Mq16 10 0.317 0.22, 35.4 0.332 29.3 0.336 0.143, (N= 11) (1.41) 0.45 (0.0970) 0.512 AUClast (day*mg/L) 2q8 6 3.42 2.06, 54.2 3.84 57.6 3.34 1.77, (N = 6) (1.66) 5.68 (2.21) 8.08 HDq12+1-Mq16 11 7.98 5.43, 39.8 8.45 31.3 8.00 3.12, (N = 11) (1.47) 11.7 (2.64) 12.3 AUCinf (day*mg/L) 2q8 0 (N = 6) HDq12+1-Mq16 0 (N = 11) AUCinf/Dose 2q8 0 (day*mg/L/mg) (N = 6) HDq12+1-Mq16 0 (N = 11) AUC(0-28d) Norm 2q8 2 0.0379 0.03, 17.9 0.0382 17.6 0.0382 0.0334, by WT (N = 6) (1.19) 0.05 (0.00673) 0.0429 (day*mg/L/kg) HDq12+1-Mq16 5 0.118 0.08, 46.2 0.127 40.3 0.140 0.069, (N = 11) (1.55) 0.18 (0.0514) 0.190 Accumulation Ratio 2q8 5 1.68 1.04, 51.6 1.83 41.8 1.66 0.790, (Cweek12/CWeek4) (N = 6) (1.63) 2.74 (0.766) 2.75 HDq12+1-Mq16 10 1.59 1.04, 44.2 1.72 45.0 1.58 0.707, (N= 11) (1.53) 2.42 (0.774) 3.55 t1/2 (day) 2q8 1 25.3 NE NE 25.3 NE 25.3 25.3, (N = 6) (NE) (NE) 25.3 HDq12+1-Mq16 1 281 NE NE 281 NE 281 281, (N = 11) (NE) (NE) 281 tmax (day) 2q8 (N = 6) 6 14.0 7.05, 21.0 HDq12+1-Mq16 11 14.1 1.03, (N = 11) 28.1 tlast (day) 2q8 (N = 6) 6 28.0 21.0, 29.2 HDq12+1-Mq16 11 27.9 21.0, (N = 11) 32.0 Arithm. = arithmetic, AUCmf = Area under the curve from time zero to infinity, AUCIõt = Area under the curve to the last quantifiable concentration, Cl = confidence interval, Ciõt = Last concentration, Cmõ = Maximum concentration, Ctrough = trough concentration, CV
= coefficient of variation, geom. = geometric, DPKS = dense pharmacokinetic analysis set, LLOQ
= Lower level of quantification, Max = maximum, Min = minimum, N = Number of participants with unilateral treatment up to Week 48, n = Number of observations, NE = Not Evaluable, PK =
time to maximum concentration, WT = weight. For Clast, values below LLOQ were substituted by 1/2 LLOQ for the calculation of geometric statistics and 0 for arithmetic statistics.
Table 1-26. Summary Statistics of Adjusted Bound Aflibercept Pharrnacokinetic Parameters in Plasma in Participants with Unilateral Treatment for Pooled Region: Japan ¨ Dense PK Sub-Study (DPKS) Pooled PK parameter Treatment n Geom. Geom. Geom. Arithm. Arthm. Median Min, Max region (unit) mean Mean CV (%) mean (SD) CV (%) (SD) 95% CI
Japan Cmax (mg/L) 2q8 (N = 0) 0 HDq12+HDq16 1 0.567 NE NE 0.567 NE 0.567 0.567, (N = 2) (NE) (NE) 0.567 Cmax/Dose 2q8 (N = 0) 0 (mg/L/mg) HDq12+HDq16 1 0.0709 NE NE 0.0709 NE 0.0709 0.0709, (N =2) (NE) (NE) 0.0709 Clast (mg/L) 2q8 (N = 0) 0 HDq12+HDq16 1 0.412 NE NE 0.412 NE 0.412 0.412, (N = 2) (NE) (NE) 0.412 Ctrough (mg/L) 2q8 (N = 0) 0 Day 29 HDq12+HDq16 1 0.412 NE NE 0.412 NE 0.412 0.412, (N = 2) (NE) (NE) 0.412 AUClast 2q8 (N =0) 0 (day*mg/L) HDq12+HDq16 1 11.7 NE NE 11.7 NE
11.7 11.7, (N = 2) (NE) (NE) 11.7 AUCinf 2q8 (N =0) 0 (day*mg/L) HDq12+HDq16 0 (N =2) AUCinf/Dose 2q8 (N =0) 0 (day*mg/L/mg) HDq12+HDq16 0 (N =2) AUC(0-28d) 2q8 (N =0) 0 Norm by WT HDq12+HDq16 0 (day*mg/L/kg) (N =2) Accumulation 2q8 (N =0) 0 Ratio HDq12+HDq16 1 1.47 NE NE 1.47 NE
1.47 1.47, (CWeek12/CWeek4) (N =2) (NE) (NE) 1.47 t1/2 (day) 2q8 (N = 0) 0 HDq12+HDq16 0 (N =2) tmax (day) 2q8 (N = 0) 0 HDq12+HDq16 1 14.0 14.0 (N = 2) 14.0 tlast (day) 2q8 (N =0) 0 HDq12+HDq16 1 27.9 27.9 (N = 2) 27.9 Arithm. = arithmetic, AUCinf = Area under the curve from time zero to infinity, AUCiast = Area under the curve to the last quantifiable concentration, Cl = confidence interval, Ciõt = Last
= coefficient of variation, geom. = geometric, DPKS = dense pharmacokinetic analysis set, LLOQ
= Lower level of quantification, Max = Maximum, Min = Minimum, N = Number of participants with unilateral treatment up to Week 48, n = Number of observations, NE = Not Evaluable, PK =
pharmacokinetic, SD = standard deviation, t112 = half-life, t -last = time to last concentration, tmax =
time to maximum concentration, WT = weight. For Clast, values below LLOQ were substituted by 1/2 LLOQ for the calculation of geometric statistics and 0 for arithmetic statistics.
[000308]Table 1-27 shows an overview of sampling time points for the sparse sampling in the three different dosing groups. Table 1-28 summarizes the plasma concentration-time data for free aflibercept in participants with unilateral treatment (sparse PK
sampling, PKS) after IVT
administration of aflibercept in the 2q8, HDq12, and HDq16 regimens, respectively.
Concentrations of free aflibercept in plasma were, on average, higher for the HDq12 and HDq16 treatment groups than the 2q8 treatment group. Mean free aflibercept concentrations increased from baseline to Visit 5 (60-64 days after first administration). Thereafter, mean concentrations of free aflibercept declined in all three dose groups. In the 2q8 treatment group mean concentrations of free aflibercept declined to values close to or below LLOQ
in almost all participants 4 weeks after treatment, in the HD groups 8 weeks after treatment (Week 28 for HDq12, Week 48 for HDq16) (Table 1-28).
Table 1-27. Overview of Sampling Time Points for the Different Dosing Groups (PKS) Sampling time point 2q8 HDq12 HDq16 Baseline Prior to first administration Week 4 4 weeks after first administration Visit 5 4-7 days after third monthly administration Week 12 4 weeks after third montly administration Week 28 4 weeks after Week 24 8 weeks after Week 20 4 weeks after Week 24 administration administration administration Week 48 4 weeks after Week 40 4 weeks after Week 44 8 weeks after Week 40 administration administration administration [000309]Comparison of mean concentrations of free aflibercept at Visit 5 which could be considered a time point around an expected Cmõ rather than a trough value, showed that concentrations increased about 6-fold as the IVT dose of aflibercept increased from 2 mg to 8 mg (4-fold dose).
[000310]Exploratory analysis of subgroups with respect to age, BMI, medical history of renal impairment (as determined by creatinine clearance), medial history of hepatic impairment, ethnicity (Latino/Hispanic vs not Latino/Hispanic), race (White vs. Asian), and treatment
Table 1-28. Summary of Concentration of Free Aflibercept (mg/L) In Plasma by Time and Treatment in Participants with Unilateral Treatment and without DRMs Upto Week General PK (PKS) Free aflibercept Time Treatment n total n LLOQ Geom. Mean SD Arithm.
Mean SD
Baseline (Visit 2) 2q8 (N = 240) 230 3 N.0 0.00032 (0.00302) HDq12 (N = 205) 191 0 N.0 0.00 (0.00) HDq16 (N = 196) 181 0 N.0 0.00 (0.00) Week 4 (Visit 3) 2q8 (N = 240) 222 4 N.0 0.00044 (0.00369) HDq12 (N = 205) 194 122 N.0 0.0172(0.0157) HDq16 (N = 196) 184 119 N.0 0.0174(0.0166) Visit 5 2q8 (N = 240) 203 169 0.02 (1.81) 0.0257 (0.0163) HDq12 (N = 205) 178 175 0.13 (1.97) 0.157 (0.101) HDq16 (N = 196) 165 161 0.13 (2.03) 0.152 (0.0825) Week 12 (Visit 6) 2q8 (N = 240) 219 11 N.0 0.00134(0.00657) HDq12 (N = 205) 192 155 0.02 (1.99) 0.0282 (0.0227) HDq16 (N = 196) 188 149 0.02 (2.02) 0.0293 (0.0225) Week 28 (Visit 10) 2q8 (N = 240) 198 4 N.0 0.00069 (0.00609) HDq12 (N = 205) 185 6 N.0 0.00089 (0.00528) HDq16 (N = 196) 177 101 N.0 0.0156 (0.0164) Week 48 (Visit 15) 2q8 (N = 240) 195 1 N.0 0.00070 (0.00981) HDq12 (N = 205) 176 86 N.0 0.0137 (0.0179) HDq16 (N = 196) 159 4 N.0 0.00059 (0.00382) Arithm. = arithmetic, DRM = dose regimen modification, geom. = geometric, LLOQ
= Lower level of quantification, N = Number of participants with unilateral treatment and without DRMs up to Week 48, n = Number of observations, PKS = pharmacokinetic analysis set, SD =
standard deviation; N.C.: not calculated (less than 2/3 of values per time point are LLOQ for geometric mean calculation). Values below LLOQ (0.0156 mg/L) were substituted by 1/2 LLOQ
for the calculation of geometric statistics and 0 for arithmetic statistics and median.
[000311]Table 1-29 summarizes the plasma concentration-time data for adjusted bound aflibercept in all participants (sparse PK sampling, PKS) after IVT
administration of aflibercept in the 2q8, HDq12, and HDq16 regimens, respectively. Concentrations of adjusted bound aflibercept in plasma were, on average, higher for the HDq12 and HDq16 treatment groups than the 2q8 treatment group. Mean adjusted bound aflibercept concentrations increased from baseline to Visit 5 (60-64 days after first administration). Thereafter, a slight decrease of the concentration-time profiles was observed until the end of the observation period (Week 48).
[000312]Evaluation of mean concentrations of adjusted bound aflibercept at Visit 5 which could be considered a time point around an expected Cmax rather than a trough value, showed that
[000313]Exploratory analysis of subgroups with respect to age, BMI, medical history of renal impairment (as determined by creatinine clearance), medial history of hepatic impairment, ethnicity (Latino/Hispanic vs not Latino/Hispanic), race (White vs. Asian), and treatment-emergent antibody status did not reveal any meaningful differences for adjusted bound aflibercept concentrations.
Table 1-29. Summary of Concentration of Adjusted Bound Aflibercept (mg/L) in Plasma by Time and Treatment in Participants with Unilateral Treatment and Without DRMs Upto Week 48- General PK (PKS) Time Treatment n total n LLOQ Geom. Mean SD Arithm.
Mean SD
Baseline (Visit 2) 2q8 (N = 240) 230 7 N.0 0.0108(0.0911) HDq12 (N = 205) 191 1 N.0 0.00029 (0.00402) HDq16 (N = 196) 181 2 N.0 0.00079 (0.00915) Week 4 (Visit 3) 2q8 (N = 240) 222 218 0.11 (1.67) 0.130(0.0836) HDq12 (N = 205) 194 193 0.34 (1.64) 0.375 (0.132) HDq16 (N = 196) 184 183 0.33 (1.72) 0.364 (0.143) Visit 5 2q8 (N = 240) 203 201 0.24 (1.59) 0.255 (0.0924) HDq12 (N = 205) 178 176 0.64 (1.76) 0.708 (0.248) HDq16 (N = 196) 165 164 0.64 (1.64) 0.694 (0.229) Week 12 (Visit 6) 2q8 (N = 240) 219 217 0.18 (1.72) 0.207 (0.120) HDq12 (N = 205) 192 192 0.57 (1.46) 0.613 (0.216) HDq16 (N = 196) 188 187 0.56 (1.64) 0.612 (0.223) Week 28 (Visit 10) 2q8 (N = 240) 198 197 0.15 (1.61) 0.169 (0.109) HDq12 (N = 205) 185 183 0.19 (1.83) 0.222 (0.120) HDq16 (N = 196) 177 172 0.33 (2.06) 0.377 (0.149) Week 48 (Visit 15) 2q8 (N = 240) 195 180 0.06 (2.05) 0.0787 (0.0706) HDq12 (N = 205) 176 168 0.30 (2.38) 0.375 (0.177) HDq16 (N = 196) 159 157 0.18 (1.86) 0.211 (0.109) Arithm. = arithmetic, DRM = dose regimen modification, geom. = geometric, LLOQ
= Lower level of quantification, N = Number of participants with unilateral treatment and without DRMs up to Week 48, n = Number of observations, PKS = pharmacokinetic analysis set, SD =
standard deviation; N.C.: not calculated (less than 2/3 of values per time point are LLOQ for geometric mean calculation). Values below LLOQ (0.022442 mg/L) were substituted by 1/2 LLOQ for the calculation of geometric statistics and 0 for arithmetic statistics and median.
Pharmacokinetics-population PK (popPK) [000314]The pharmacokinetic (PK) data set forth above summarize the observed systemic concentration-time profiles and associated PK parameters for free and adjusted bound aflibercept for each individual study. The analyses utilized to estimate the PK parameters in each individual study were performed by non-compartmental analysis. While the individual
[000315]A population PK (popPK) analysis that utilized free and adjusted bound concentration in plasma data from the HD clinical studies, as well as 13 prior studies:
DME population = VGFT-0D-0307: A double-blind, randomised, dose-escalating study evaluating safety, tolerability and bio-effect after intravenous (IV) administration of VEGF Trap in subjects with DME. Subjects were planned to receive 4 IV infusions of VEGF
Trap, once every 2 weeks (day 1, day 15, day 29, and day 43), at dose levels of 0.3 mg/kg, 1 mg/kg, or 3 mg/kg, or placebo. However, dosing was stopped before the planned sequential dose escalation when dose-limiting toxicities (grade 2 proteinuria in a single subject and grade 4 treatment-related malignant hypertension in a single subject) were observed in another phase 1 dose-escalation study in subjects with AMD (VGFT-OD-0305). The dose limiting toxicities observed in study VGFT-OD-0305 occurred at the 3 mg/kg IV dose. Therefore, only the lowest dose (0.3 mg/kg) of study drug was investigated. Nine subjects were randomised and treated (3 placebo, 6 VEGF Trap 0.3 mg/kg). Concentrations of free and bound VEGF Trap were determined at selected time intervals following dose administration (screening, day l[pre-dose], day 8, day 15, day 29, day 43, day 57, day 71, day 85, and day 133 [3 months post-last dose]);
= VGFT-0D-0512: An open-label, proof-of-concept study evaluating safety, tolerability and bio-effect of VEGF Trap IVT administration in subjects with DME. Five (5) subjects with DME were enrolled. Subjects received a single IVT injection of 4 mg VEGF Trap into the study eye. During the first 6 weeks after the injection, vital signs as well as ocular and systemic adverse events (AEs) were recorded. Blood samples for analysis of free and bound VEGF Trap concentrations in plasma were collected at screening, day 1 (pre-dose), day 3, day 8, day 15, day 29, day 43 and day following the single IVT administration;
(VI VI D-DME)-ClinicalTrials.gov Identifier NCT01331681;
AMD population = VGFT-OD-0305: A double-masked, placebo controlled, sequential group, dose escalating, (0.3 mg/kg, 1 mg/kg, 3 mg/kg, 5 mg/kg, 7 mg/kg, and 10 mg/kg) study of safety and bioeffect. The study included subjects with a diagnosis of visual impairment associated with neovascular AMD. Subjects were required to have visual loss due to subfoveal choroidal neovascularization (CNV) secondary to AMD, be 50 years of age or older, with no history of Type I or Type II diabetes, without significant cardiac, liver or kidney disease, or congestive heart failure (CHF); and without confounding ophthalmic issues. The study treatments were: 1. VEGF Trap 0.3 mg/kg. 2. VEGF Trap 1 mg/kg, and 3. VEGF Trap 3 mg/kg;
= VGFT-OD-0306: An open label, long term safety and tolerability extension study of intravenous VEGF Trap in subjects with neovascular AMD who had been included in Study VEGF-OD-0305. The study treatments were VEGF Trap at the same dose level the subjects had been treated with in Study VEGF-OD-0305: either 0.3 mg/kg or 1 mg/kg, by intravenous administration every 2 weeks. Placebo patients from Study VGFT-OD-0305 were assigned to VEGF Trap at the dose level at which they were enrolled in Study VGFT-OD-0305. The efficacy outcome measures were:
Visual acuity (ETDRS), Retinal thickness (OCT), Funduscopic examination, Fundus photography, and FA. The safety outcome measures were: AEs, Clinical laboratory tests, and Ophthalmic exam. Treatment duration was for up to 106 days. There were seven subjects: four subjects treated with 0.3 mg/kg, 3 subjects treated with 1 mg/kg. There were five females, two males and the age range was 68 to 84 years.
Six of the seven subjects had a slight reduction in ERT in the study eye and six of seven subjects had slight reductions in macular volume in the study eye;
= VGFT-OD-0502 Part A: Safety and Tolerability Study of Intravitreal VEGF-Trap Administration in Patients With Neovascular AMD-ClinicalTrials.gov Identifier:
NCT00320775;
= VGFT-OD-0603: Safety and Tolerability of Intravitreal VEGF Trap Formulations in Subjects With Neovacular AMD-ClinicalTrials.gov Identifier: NCT00383370;
= VGFT-0D-0702.PK (PK sub-study of VGFT-OD-0702): Randomized, Single-Masked, Long-Term, Safety and Tolerability Study of VEGF Trap-Eye in AMD-ClinicalTrials.gov Identifier: NCT00527423; and = 311523 (VIEW2): A multicentre, double masked, randomised, active controlled, parallel group, non-inferiority efficacy and safety study. The study was almost identical in design to Study VGFT-OD-0605/14393 (VIEW 1). The submission contained the report of the first 52 weeks of the study. The study was conducted at 186 centres in 26 countries.
The inclusion criteria, exclusion criteria and study treatments were identical to Study VGFT-OD-0605/14393 (VIEW 1). The efficacy outcome measures were the same, except for the additional outcome measure: change in scores of the EQ-5D
questionnaire from screening at Week 52;
Oncology population = VGFT-ST-0103, (also known as TED6113): VEGF Trap in Treating Patients With Relapsed or Refractory Solid Tumors or Non-Hodgkin's Lymphoma-ClinicalTrials.gov Identifier: NCT00036946;
Healthy participant population = PDY6655: A Phase I, single centre, randomised, single dose, crossover, pharmacokinetic (PK) study in healthy volunteers to compare the pharmacokinetics and pharmacodynamic (PD) of intravenous and subcutaneous administration of aflibercept. The study included 40 healthy male subjects aged 18 to 45 years.
The study treatments were: aflibercept 2.0 mg/kg as an intravenous infusion over 1 hour, and as a subcutaneous injection. The aflibercept was presented as 4 mL of 25 mg/mL solution. The treatments were administered as single doses followed by 6 week observation period. The treatment periods were separated by 1 to 2 weeks.
The PK outcome measures were: Cmax, AUC, apparent volume of distribution at steady state (Vss), clearance and half life (t1/2). The PD outcome measures were:
systolic blood pressure, diastolic blood pressure, heart rate, mean arterial pressure, plasma renin activity, angiotensin I, aldosterone, and free endogenous VEGF.
The
The mean (90% Cl) ratio for AUC, subcutaneous/ intravenous, was 0.51 (0.46 to 0.56) [(range)], and = PDY6656: A single centre, Phase I, randomised, double blind, placebo controlled, sequential ascending dose study of intravenous aflibercept. The study included healthy male subjects 18 to 45 years of age; non-smoker; 18 body mass index (BMI) 28 kg/m2; with normal vital signs and no symptomatic hypotension. The study treatments were aflibercept 1 mg/kg, 2 mg/kg and 4 mg/kg, and placebo.
There were three cohorts of 16 subjects: twelve treated with aflibercept and four treated with placebo. The treatments were administered as a single dose by intravenous infusion over 1 hour. The pharmacodynamic outcome measures were:
systolic blood pressure (SBP), diastolic blood pressure (DBP), mean arterial pressure (MAP), plasma active renin, aldosterone and angiotensin I; markers of endothelium dysfunction (plasma endothelin-1, E-selectin, cyclic guanosine 3'5' monophosphate (cGMP), and urine nitrites/nitrates); renal function; and VEGF.
The safety outcome measures were: AEs and laboratory tests. The study included 48 subjects: 12 treated with 1 mg/kg, 12 with 2 mg/kg, 12 with 4 mg/kg and 12 with placebo. The age range was 21 to 45 years. For free aflibercept mean (CV%) Cmõ
was 18.2 (18) pg/mL for the 1 mg/kg dose, 39.7 (27) pg/mL for the 2 mg/kg dose and 78.6 (15) pg/mL for the 4 mg/kg dose; and mean (CV%) AUC was 64.8 (20) pg.day/mL for the 1 mg/kg dose, 180 (20) for the 2 mg/kg dose and 419 (21) for the 4 mg/kg dose. Bound aflibercept concentrations were not dose dependent and the proportion of bound aflibercept decreased with increasing dose. However, Cmõ
and AUC for total aflibercept were dose proportional [(range)]; (See Australian Public Assessment Report for Aflibercept, AusPAR Eylea Aflibercept Bayer Australia Ltd;
FDA, Center for Drug Evaluation and Research, Approval Package for:
APPLICATION NUMBER: 1253870rig15048, Eylea, March 25, 2015) of aflibercept 2 mg in the DME and nAMD populations, healthy participants, and participants with oncology diseases after intravenous (IV), subcutaneous (SC), or intravitreal (IVT) administration was performed to: characterize the concentration-time profiles of free and adjusted bound aflibercept in plasma; estimate population and individual PK
parameters of aflibercept in patients with nAMD and DME; investigate the effects of relevant covariates which may explain variability in aflibercept PK
parameters; and derive post-hoc estimates of individual exposure metrics in the nAMD and DME
patients from the final popPK model that formed the basis for pharmacokinetic/pharmacodynamic (PK/PD) analyses.
[000316]A key finding from this popPK analysis is that clearance of free aflibercept from the ocular compartment (ocular clearance) is 34.3% slower for HD aflibercept than for 2 mg IVT
aflibercept, and is attributed to an "HD aflibercept drug product effect".
[000317]The consequences of the slower ocular clearance for HD (8 mg) aflibercept, as identified in the popPK analysis, were further evaluated via popPK model-based simulations to predict the time-course of free aflibercept in the eye (ocular compartment) under different dosing scenarios, and via exposure-response analyses to assess whether popPK
estimates of ocular clearance are predictive of the time required for dose regimen modification (DRM).
[000318]Choice of Dose and Dosing Regimen. PK simulations using a 1-compartment ocular model showed that an 8 mg IVT dose of aflibercept may provide up to 20 days longer duration of pharmacological effect than a 2 mg IVT dose of aflibercept. However, observed clinical data from the phase 2 CANDELA and phase 3 (PULSAR, PHOTON) studies indicate a longer than expected duration of pharmacological effect for HD aflibercept than that based on PK
predictions.
[000319]Initiation of the HD aflibercept clinical program was based on the continuing need for patients with proliferative neovascular eye disease who are currently being treated with, or indicated for, anti-VEGF therapy to have treatment options with less frequent IVT dosing without inferior efficacy. Given the well-characterized and favorable risk/benefit profile of 2 mg aflibercept, a higher dose of aflibercept able to extend the treatment interval was proposed. A
[000320]Efficacy data from the phase 3 PULSAR study in the nAMD population confirmed that the HDq12 and HDq16 regimens provide durable efficacy over the 48-week treatment period, as both regimens met the primary endpoint for efficacy of non-inferior change from baseline in BCVA at week 48 compared to 2q8. A majority of participants randomized to HDq12 or HDq16 maintained their 12-week (79%) and 16-week (77%) dosing intervals, without the need for DRM, through 48 weeks.
[000321]Results from the phase 2/3 PHOTON study also confirmed efficacy of the HDq12 and HDq16 regimens in participants with DME and DR as both met the primary endpoint for efficacy of noninferior change from baseline in BCVA at week 48 compared to 2q8, with a majority of participants maintaining their HDq12 (91%) and HDq16 (89%) regimens, without the need for DRM, through the end of the 48-week treatment period.
[000322]As the vast majority of participants enrolled in the PHOTON study had underlying DR, they were also assessed for efficacy endpoints associated with the improvement of their underlying retinopathy. The HDq12 regimen met the key secondary efficacy endpoint of noninferiority for the proportion of participants with a 2-step improvement in DRSS score compared to 2q8 at the prespecified margin of 15%. Additionally, noninferiority was demonstrated using the FDA recommended 10% margin. Non-inferiority was not established for HDq16 at the 15% margin. The HDq16 group had more participants with mild to moderate disease than both the HDq12 and the 2q8 group, which may have contributed to these findings.
[000323]Regarding safety, similar ocular and systemic safety profiles for HDq12 and HDq16 compared to 2q8 aflibercept were observed in all 3 studies, with no new safety signals identified for HD aflibercept.
[000324]Population PK Analysis. The PK of free and adjusted bound aflibercept following IV, SC, or IVT administration was adequately described by a 3-compartment population PK model with the binding of free aflibercept from the central compartment to VEGF
described by Michaelis-Menten kinetics. An additional tissue compartment that could represent platelets (Sobolewska et a/., Human Platelets Take up Anti-VEGF Agents. J Ophthalmol 2021;
2021:8811672) was added where the rate of elimination from the central compartment of free aflibercept to the platelet compartment was dependent on the number of platelets that were able
Residual variability was modeled separately for free and adjusted bound aflibercept using an additive + proportional error model. Estimated bioavailability for free aflibercept was 71.9%
following IVT administration (Table 1-30). Parameter estimates for the final Population PK
model are presented in Table 1-30.
Table 1-30. Population Pharmacokinetic Parameter Estimates for the Final Model for Aflibercept Parameter Estimate C.I.95 RSE CV
% %
K20 (1/day) [run431 Estimate] 0.0807 0.0438 -0.136 29.5 -V2 V4 (L) [run431 Estimate] 4.99 4.71 -5.25 2.79 -V3 (L) [run431 Estimate] 1.08 0.816- 1.58 17 -QF1 (L/day) [run431 Estimate] 0.849 0.435 - 1.33 29.2 -V8 (L) [run431 Estimate] 1.18 0.281 - 0.541 16.8 -QF2 (L/day) [run431 Estimate] 0.0763 0.147 - 0.186 5.93 -KM (mg/L) [run431 Estimate] 0.411 0.293 - 0.442 10.5 -VMK24 (mg/day/L) [run431 Estimate] 0.167 0.482 - 0.593 K40 (1/day) [run463 Estimate] 0.035 Fl & F5 0.719 0.706 - 0.731 QE (L/day) 0.000624 0. 3.97 -0.000674 K62 (1/day) [run431 Estimate] 0.368 0.0165 - 0.0632 35.3 -F6 [run431 Estimate] 0.536 0.00584 - 0.149 99 -VMK27 (mg/day/L) [run431 Estimate] 0.031 4.17 -340 159 -K70 (1/day) [run431 Estimate] 0.0265 0.632 -2.84 39.8 -KMK27 (mg) [run431 Estimate] 42.7 0.0481 -0.12 23.7 -TWGT V2+V4 [run431 Estimate] 0.872 0.55 - 1.22 19.3 -TWGT V3 [run431 Estimate] 1.08 -0.00762--2.45 51.3 -TWGT V8 [run431 Estimate] 1.16 -2.97--6.58 135 -TWGT K20 [run431 Estimate] -0.192 -1.28- 0.819 234 -TWGT K40 [run463 Estimate] -0.153 HD QE 0.657 0.607 - 0.712 4.08 -AGE QE -1.53 -1.76---1.3 7.68 -TALB K40 [run463 Estimate] -0.767 IIV K20 [run431 Estimate] 0.207 -0.0147 -0.508 54.1 IIV covariance(K20, V2 & V4) [run431 Estimate] -0.0727 -0.136 --0.0183 38.9 -IIV V2 & V4 [run431 Estimate] 0.0618 0.0198 - 0.105 34.7 25.3 IIV VMK24 [run431 Estimate] 0.305 -0.083 -0.67 65.4 59.8 IIV K40 [run463 Estimate] 0.0452 -21.5 IIV QE 0.297 0.257 - 0.336 6.86 58.8 IIV K62 [run431 Estimate] 0.852 0.124- 1.45 43
SD PROP LLOQ 0.0313 (Free,IV+SC) [run463 0.403 Estimate]
SD ADD LLOQ 0.0156 (Free) 0.00779 0.00624 - 0.00973 11.4 -SD PROP LLOQ 0.0156 (Free) 0.433 0.418 - 0.448 1.72 -SD ADD LLOQ 0.0315 (Adj.Bound) 0.0216 0.0177 - 0.0264 10.2 -SD PROP LLOQ 0.0315 (Adj.Bound) 0.159 0.12 - 0.197 12.4 -SD ADD LLOQ 0.0224 (AdjBound) 0.0291 0.0202 - 0.0419 18.8 -SD PROP LLOQ 0.0224 (Adj.Bound) 0.214 0.194 - 0.234 4.83 ADD = additive, age = baseline age, C.I.95 = 95% confidence intervals, CV =
coefficient of variation, Fl and F5 = bioavailability of intravitreal injections in ocular compartments, F6 =
bioavailability of subcutaneous injections, HD = high dose (8 mg IVT cohorts), IIV = inter-participant variability, IV = intravenous, K20 = elimination rate of free aflibercept, K40 =
elimination rate constant for adjusted bound aflibercept, K62 = rate of absorption from subcutaneous injection dosing compartment, K70 = elimination rate from tissue (platelet) compartment, KM = concentration of free aflibercept at half of maximum binding capacity with VEGF; KMK27 = concentration of free aflibercept at half of maximum binding capacity to platelets, LLOQ = lower limit of quantification, PROP = proportional, QE =
inter-compartmental clearance between ocular compartment and central compartment of free aflibercept, QF1 and QF2 = inter-compartmental clearances of free aflibercept, RSE /o =
percent relative standard error, SC = subcutaneous, TALB = time varying albumin, TWGT =
time varying body weight, V2 = central volume of free aflibercept in plasma, V3 and V8 =
peripheral volumes of free aflibercept in tissues, V4 = central volume of adjusted bound aflibercept in plasma, VMK24 = maximum binding rate of free aflibercept to VEGF, VMK27 = maximum binding rate of aflibercept to platelets Estimates of fixed-effect parameters are presented in the natural scale; IIV are reported as variances around the log of the parameters or the logit of F6. Residual errors of IV and SC data not presented in the table for LLOQ=0.0156 (0- additive=0.00786, 0-proportional= 0.357) and LLOQ=0.0315 (0-additive=0.0206, 0-proportional=0.167) were fixed in the final model to estimates from run463. C.I.95 and % RS E /o for run431 were calculated from bootstrap. ii-shrinkage: riK20=
54.2%, riV2,V4= 15.2%, riVMK24= 42.2%, riK40= 39.1%, TOE= 31.6%, iK62= le-10%, riF6= 17.7%.
[000325]Concentrations of free and bound aflibercept in plasma were measured using validated enzyme-linked immunosorbent assay (ELISA) methods. The assay for bound aflibercept is calibrated using the VEGF:aflibercept standards, and the results are reported for bound aflibercept as weight per volume (e.g., ng/mL or mg/L) of the VEGF:aflibercept complex.
Therefore, to account for the difference in molecular weight and normalize the relative concentrations between free and bound aflibercept, the concentration of the bound aflibercept complex is adjusted by multiplying the bound aflibercept concentration by 0.717. This is to account for the presence of VEGF in the bound complex and report the complex in terms of
[000326]The concentration of bound aflibercept was normalized to determine the amount of aflibercept present in the bound aflibercept complex. The bound aflibercept complex consisted of 71.7% aflibercept and 28.3% human VEGF165 based on the molecular weight of each component. Therefore, the concentration of the bound aflibercept complex was multiplied by 0.717 to yield the concentration of adjusted bound aflibercept (Equation 1).
Total aflibercept was calculated by summing the plasma concentrations of free and adjusted bound aflibercept (Equation 2).
Equation 1: Adjusted bound aflibercept (mg/L) = Bound aflibercept (mg/L) x 0.717 Equation 2: Total aflibercept (mg/L) = Sum of adjusted bound aflibercept (mg/L) + free aflibercept (mg/L) [000327]Time-varying body weight was a predictor of the central volumes for free and adjusted bound aflibercept (V2=V4), the peripheral volumes of free aflibercept in tissues (V3, and V8), and elimination rate of free aflibercept (K20) and adjusted bound aflibercept (K40). The effect of time-varying albumin was also a predictor of elimination rate of adjusted bound aflibercept (K40). Age and the effect of HD aflibercept group (8 mg dose) versus aflibercept groups (doses 4 mg) were predictors of clearance from the ocular compartment (QE). The clearance from the ocular compartment slowed with age, with an estimated exponent in the relationship of -1.53, resulting in clearance from the ocular compartment being approximately 25%
slower for an 86 year-old (95th percentile of age in the analysis population) participant than a 71 year-old (median age in analysis population) participant.
[000328]Following IVT administration, HD aflibercept (8 mg dose) was estimated to have 34.3%
slower clearance from the ocular compartment compared to the lower IVT
aflibercept doses (4 mg), which resulted in a longer duration of exposure to free aflibercept in the ocular compartment for the high dose group. The slower ocular clearance (QE) and longer duration of free aflibercept ocular exposure for HD aflibercept are attributed to an "HD
aflibercept drug product effect". The precise source of this effect is uncertain; however, it was identified as a statistically significant covariant in the popPK analysis. The source of the effect (potentially a formulation characteristic, viscosity, an excipient or a process involved in the elimination of free aflibercept that is specifically related to a higher dose) is currently unknown.
backwards stepwise model selection process identified a preliminary model retaining STUDYID, CRTBL, and ocular clearance. The preliminary model contained a statistically insignificant effect for the CANDELA study versus the PULSAR study, both of which were in AMD
participants. A more parsimonious model was investigated by estimating a difference between indications. A model testing the substitution of IND for STUDYID proved to be similar in Akaike's Information Criterion (within 2 points). The predicted ocular clearance for HD
aflibercept from the Population PK model is slower than that for 2 mg IVT
aflibercept and is attributable to an HD drug product effect. The final TTDRM model translates this difference in ocular clearance to a 25.9% higher rate of DRM for a hypothetical 8 mg drug product having the same ocular clearance as the 2 mg dose. Conversely, the rate of DRM due to the HD drug product effect is 20.6% lower than would have been expected if the HD product had the same ocular clearance as 2 mg aflibercept.
[000330]The need for DRM is determined by the clinician objective measurements obtained during an office visit, at which time a participant's dosing regimen can be shortened due to suboptimal efficacy. The hypothesis is that faster transit of aflibercept from the eye into the systemic circulation leads to earlier depletion of the drug from the ocular space and therefore a more rapid loss of efficacy. While there may be other factors affecting efficacy, such as disease progression, comorbidities, or variability in response, this analysis shows a correlation between an independently determined PK parameter (ocular clearance) that describes the transit of aflibercept from the eye and a reduction in efficacy as indicated by an earlier retreatment (DRM) than anticipated based on clinical assessment via BCVA and CRT.
[000331]For those participants requiring a DRM, Cox proportional hazard modeling was performed to evaluate factors that may contribute to the need for a reduction in the dosing interval. The results of these analyses estimate a 260% higher rate for DRMs for participants with nAMD compared to participants with DME and DR. After accounting for indication (nAMD
or DME and DR), ocular clearance of free aflibercept and baseline CRT were identified as significant covariates. Within an indication (nAMD or DME and DR), for participants with the same ocular clearance of free aflibercept, a 52.8% higher rate of DRM is predicted for
Similarly, for participants with the same baseline CRT, a 32.9% higher rate of DRM is predicted for participants at the 75th vs 25th percentile of ocular clearance of free aflibercept. The results of these analyses also estimate that the lower ocular clearance for 8 mg aflibercept, attributable to an HD drug product effect results in a 20.6% lower rate of DRM than would have been expected if the HD drug product had the same ocular clearance as 2 mg aflibercept.
[000332]Comparison of Pharmacokinetics Across Studies in Participants with Neovascular Age-Related Macular Degeneration or Diabetic Macular Edema. In the clinical development of HD aflibercept for treatment of AMD and DME, a dosage regimen of 8 mg IVT (3 initial monthly doses followed by q12w or q16w IVT dosing) was evaluated and compared to an aflibercept 2 mg IVT dosage regimen (3 or 5 initial monthly doses followed by q8w or q12w IVT dosing) in the clinical studies CANDELA, PULSAR, and PHOTON. This allowed for a direct comparison of the systemic exposures of free and adjusted bound aflibercept across the 3 studies. CANDELA and PULSAR studies included participants with nAMD while PHOTON study included participants with DME.
[000333]Following single IVT administration of aflibercept 2 mg or HD
aflibercept, the concentration-time profiles of free and adjusted bound aflibercept in plasma in participants who underwent dense sample collection for systemic drug concentrations (dense PK
sub-study) after the initial dosing of aflibercept 2 mg or HD aflibercept, respectively, were consistent between the 3 studies in participants with nAMD or DME (Figure 34). Notably, there was one excluded participant in the PULSAR dense-sampling PK sub-study that had free aflibercept concentrations over time that were approximately 10-fold higher than the mean concentration-time profiles in that study.
[000334]The consistency of the concentration-time profiles for free and adjusted bound aflibercept between the nAMD and DME populations is further supported by Population PK
analysis (Figure 35). Population PK estimated post-hoc concentration-time profiles and PK
parameters for combined nAMD and DME populations following single IVT
administration of 2 mg aflibercept or HD aflibercept are provided in Figure 35 and in Table 1-31 and Table 1-32.
Table 1-31. Summary of Post-hoc Simulated Pharmacokinetic Parameters for Free Aflibercept in Plasma after Single Dose IVT Administration in the Combined nAMD
and DME Population Treated Only in the Study Eye and Without Study Eye Dosing Modifications in the Dense PK Sub-studies (DPKS) Aflibercept HD Aflibercept
(N = 31) (N = 50) PK Parameters Unit Mean (SD) Median Mean (SD) Median AUCo-28 mg x day/L 0.282 (0.189) 0.238 2.55 (2.31) 2 Cmax mg/L 0.0394 (0.0391) 0.0251 0.304 (0.267) 0.222 Ctrough,28 mg/L < LLOQ (0) < LLOQ <
LLOQ (0.00853) < LLOQ
tmax day 2.26 (0.783) 2.16 2.8 (1.08) 2.89 AUC = area under the concentration-time curve, Cmõ = maximum (peak) concentration for a 28-day interval following dosing, Ctrough = trough concentration, DME =
diabetic macular edema, DPKS = dense pharmacokinetic sub-studies, IVT = intravitreally, LLOQ =
lower limit of quantitation, n = number of participants, nAMD = neovascular age-related macular degeneration, PK = pharmacokinetics, SD = Standard deviation, tmax = median time to peak concentration; Note: Participants who had fellow eye treatment before day 28 are excluded.
Table 1-32. Summary of Post-hoc Simulated Pharmacokinetic Parameters for Adjusted Bound Aflibercept in Plasma after Single Dose IVT administration in the Combined nAMD and DME Population Treated only in the Study Eye and Without Study Eye Dosing Modifications in the Dense PK Sub-studies (DPKS) Aflibercept HD Aflibercept 2 mg IVT 8 mg IVT
(N = 31) (N = 50) PK Parameters Unit Mean (SD) Median Mean (SD) Median AUC mg x 3.07(1.31) 3.05 10.8 (6.14) 9.03 day/L
Cmax mg/L 0.142 (0.0616) 0.139 0.507 (0.282) 0.434 Ctrough,28 mg/L 0.105 (0.0393) 0.0994 0.386 (0.21) 0.338 tmax day 14.8 (5.65) 13.7 15.5 (5.22) 15.8 AUC = area under the concentration-time curve, Cmax = maximum (peak) concentration for a 28-day interval following dosing, Ctrough = trough concentration, DME =
diabetic macular edema, DPKS = dense pharmacokinetic sub-studies, IVT = intravitreally, nAMD =
neovascular age-related macular degeneration, PK = pharmacokinetics , SD =
standard deviation, tmax = median time to peak concentration; Note: Participants who had fellow eye treatment before day 28 are excluded. Ctrough,28 is the concentration of drug in plasma at the end of the 28-day dosing interval; AUC0_28 is the area under the plasma concentration time curve from time zero to 28 days after dosing [000335]The corresponding observed and Population PK estimated post-hoc concentration-time profiles and PK parameters for participants with nAMD or DME are provided in Figure 38, Figure 39, Figure 40, Table 1-33 and Table 1-34.
Table 1-33. Summary of Simulated Pharmacokinetic Parameters for Free Aflibercept in Plasma after Single Dose IVT Administration in Participants with nAMD or DME
PK
Unit N Mean (SD) Median N Mean (SD) Median Parameters nAMD participants AUCO-28 mg x day/L 0.302 (0.223) 0.258 2.77 (2.77) 1.95 Cmax mg/L 21 29 0.0419 (0.0439) 0.0258 0.306 (0.302) 0.172 Ctrough,28 mg/L <LLOQ (0) <LLOQ <LLOQ (0.0094) <LLOQ
tmax day 2.19 (0.606) 2.16 2.97 (1.08) 3.05 DME participants AUCo-28 mg x day/L 0.238 (0.0732) 0.236 2.25 (1.45) 2.17 Cmax mg/L 10 21 0.0343 (0.0275) 0.0212 0.302 (0.216) 0.265 Ctrough,28 mg/L <LLOQ (0) <LLOQ <LLOQ (0.00732) <LLOQ
tmax day 2.41 (1.09) 2.23 2.56 (1.06) 2.36 AUC = area under the concentration-time curve, Cmax = maximum (peak) concentration for a 28-day interval following dosing, Ctrough = trough concentration, DME =
diabetic macular edema, DPKS = dense pharmacokinetic sub-studies, IVT = intravitreally, LLOQ =
lower limit of quantitation, n = number of participants, nAMD = neovascular age-related macular degeneration, PK = pharmacokinetic, SD = Standard deviation, tmax = median time to peak concentration. Note: Participants who had fellow eye treatment before day 28 are excluded.
Table 1-34. Summary of Simulated Pharmacokinetic Parameters for Adjusted Bound Aflibercept in Plasma after Single Dose IVT administration in Participants with nAMD
or DME Treated Only in the Study Eye and Without Study Eye Dosing Modifications in the Dense PK Sub-studies (DPKS) Adjusted Bound Aflibercept 2 mg IVT 8 mg IVT
PK Unit N Mean Median N Mean (SD) Median Parameters (SD) nAMD participants mg x 3.35(1.44) 3.16 11.8 (7.17) 11 day/L
mg/L
21 0.155 (0.0686) 0.144 29 0.558 (0.329) 0.51 Cmax Ctrough,28 mg/L 0.113 (0.0418) 0.113 0.439 (0.23) 0.415 tmax day 14.4 (4.89) 13.1 16.9 (5.26) 17.2 DME participants mg x AUCO-28 d 2.46 (0.726) 2.43 9.33 (4.06) 8.39 ay/L
Cmax Ing/L 10 0.115 (0.0317) 0.117 21 0.438 (0.187) 0.4 Ctrough,28 mg/L 0.088 (0.0281) 0.09 0.314 (0.156) 0.25 tmax day 15.6 (7.21) 15.4 13.7 (4.65) 12.9
diabetic macular edema, DPKS = dense pharmacokinetic sub-studies, IVT = intravitreally, LLOQ =
lower limit of quantitation, n = number of participants, nAMD = neovascular age-related macular degeneration, SD = standard deviation, tmax = median time to peak concentration; Note:
Participants who had fellow eye treatment before day 28 are excluded.
[000336]Following single IVT administration of 2 mg aflibercept or HD
aflibercept, the concentration-time profiles of free aflibercept are characterized by an initial phase of increasing concentrations, as the drug moved from the ocular space into systemic circulation, followed by a mono-exponential elimination phase. The concentration time profiles of adjusted bound aflibercept in plasma are characterized by a slower attainment of Cmõ compared to free aflibercept. Following attainment of Cmõ, a sustained plateau of the concentration-time profiles was observed until approximately the end of the first dosing interval (Figure 34, Figure 35).
[000337]For participants who underwent dense blood sample collection for systemic drug concentrations across the CANDELA, PULSAR, and PHOTON studies, after the initial dosing of 2 mg IVT aflibercept (n = 34), observed concentrations of free aflibercept were detectable in 15 (44.1%) participants by week 1 and in 3 (8.8%) participants by week 2. For participants who underwent dense blood sample collection for systemic drug concentrations after the initial dosing of 8 mg IVT aflibercept (n = 54), observed concentrations of free aflibercept were detectable in 46 (85.2%) participants by week 1 and in 44 (77.8%) participants by week 2.
[000338]The observed and Population PK simulated free and adjusted bound aflibercept concentrations in plasma for up to 48 weeks are presented for the combined nAMD and DME
population (Figure 36), and the nAMD (Figure 41) and DME (Figure 42) populations. Based on the Population PK analysis, the median time for free aflibercept concentrations to reach LLOQ
following HDq12 or HDq16 was more than double (3.50 weeks versus 1.5 weeks) the median time needed to reach LLOQ following aflibercept 2q8 (Table 1-35).
Table 1-35. Summary of Model-Predicted Time to LLOQ of Free Aflibercept in Plasma Following IVT for Participants With nAMD and DME, Combined Regimen Mean (SD) Week Median (90% PI) Week 2q8 1.58 (0.712) 1.5 (0.524, 2.82) HDq12 3.81 (1.61) 3.51 (1.83, 6.81) HDq16 3.79 (1.58) 3.50 (1.83, 6.73) Model-predicted time = time after a single IVT dose of the 2q8, HDq12 or HDq16 regimens.
2q8 = aflibercept 2 mg administered every 8 weeks, after 3 initial injections at 4-week
lower limit of quantification, nAMD = neovascular age related macular degeneration, PI =
prediction interval, SD = standard deviation [000339]The longer duration of systemic exposure to free aflibercept following HDq12 and HDq16 compared to the 2 mg aflibercept is attributed to not only a higher administered dose and nonlinear systemic target-mediated elimination, but also to a 34% slower ocular clearance of free aflibercept. The slower ocular clearance of free aflibercept for HD
aflibercept is attributed to a HD drug product effect which was identified as a statistically significant covariate in the Population PK model.
[000340]Ocular Elimination. Based on the Population PK analysis, HD
aflibercept was estimated to have a 34% slower clearance from the ocular compartment compared to the lower IVT doses of aflibercept 4 mg doses). The median time for the amount of free aflibercept to reach the adjusted LLOQ [the adjusted LLOQ imputes the LLOQ of free aflibercept in from the assay in plasma (that is, 0.0156 mg/L) times the assumed volume of the study eye compartment in the PK model (that is, 4 mL)] in the ocular compartment was estimated using Population PK
simulation analyses, after a single 2 mg or 8 mg IVT dose. In the combined nAMD and DME
population, the median time for the amount of free aflibercept to reach the adjusted LLOQ in the ocular compartment increased from 8.71 weeks after a 2 mg IVT dose to 15 weeks after an 8 mg IVT dose (Le., the duration of free aflibercept ocular exposure following HD drug product is extended by approximately 6 weeks relative to 2 mg drug product). The slower ocular clearance and longer duration of free aflibercept ocular exposure for HD
aflibercept are attributed to an HD aflibercept drug product effect. Assuming no HD
aflibercept drug product effect (Le., that the 8 mg IVT dose has the same ocular clearance as the 2 mg IVT dose), the Population PK simulated median time for the amount of free aflibercept to reach the adjusted LLOQ in the ocular compartment was only 10 weeks for 8 mg aflibercept, which is only 1.3 weeks longer than that for 2 mg aflibercept (Figure 37).
[000341]As the PULSAR and PHOTON studies were designed to assess non-inferiority of the HDq12 and HDq16 regimens versus the 2q8 regimen, it was of interest to estimate how long it takes for the amount of free aflibercept in the ocular compartment for the HDq12 and HDq16 regimens to reach the same amount of free aflibercept remaining in the ocular compartment for the 2q8 regimen at the end of an 8-week dosing interval (2q8 target). Using Population PK
simulation analyses in the combined nAMD and DME population, the median time for HDq12
[000342]High-Dose Aflibercept Drug Product. The totality of the composition of the HD drug product used to deliver the 8 mg dose is different from that for the 2 mg aflibercept IVT dose.
Based on Population PK analysis, the HD aflibercept drug product is a statistically significant predictor of ocular clearance of free aflibercept that results in a slower ocular clearance for the HD aflibercept versus 2 mg aflibercept when administered by the IVT route.
(Table 1-36). The slower ocular clearance and higher molar dose for the HD aflibercept drug product results in a longer duration of ocular exposure to free aflibercept compared to the 2 mg IVT dose.
Correspondingly, a slower ocular clearance for the HD aflibercept drug product contributes in part to a longer duration of systemic exposure to free aflibercept for HD
aflibercept versus the 2 mg IVT dose. The slower ocular clearance for HD aflibercept versus 2 mg aflibercept may be attributed to differences in formulation and/or dose between these two drug products. These results were further confirmed by a sensitivity analysis conducted in the final model.
Table 1-36. Comparison of Clearance from the Ocular Compartment (QE) (Mean [95%
Cl]) of Aflibercept for HD Aflibercept and 2 mg Aflibercept Dose Group Clearance from the Ocular Compartment (QE) k =
QE/0.004 Mean Mean (95% CI) (95% CI (day-t) (mL/day) 2 mg Aflibercept 0.624 0.156 (0.577 - 0.674) (0.144 - 0.169) HD 8 mg Aflibercept 0.41 0.102 (0.367 - 0.458) (0.0916 - 0.115) QE = inter-compartmental clearance between ocular compartment and central compartment of free aflibercept, 95% CI of parameters are provided.
[000343]Pharmacokinetic Conclusions. The concentration time profiles of free and adjusted bound aflibercept in plasma after the initial dose of HD aflibercept by IVT
administration were consistent between all studies in participants with nAMD or DME. Population PK
analysis confirmed no relevant differences in PK between the nAMD and DME populations, and therefore all subsequent analyses are presented for the combined nAMD and DME
population.
model. The slower ocular clearance of the HD aflibercept drug product is predicted to provide a 6-week longer duration of efficacy compared to 2q8, as the time to achieve the free aflibercept amount in the ocular compartment for the 2q8 regimen at the end of an 8-week dosing interval occurs 6 weeks later for the HD aflibercept drug product. Consistent with these predictions, the HDq12 and HDq16 regimens demonstrated noninferiority to the 2q8 regimen in the PHOTON
(for DME only) and PULSAR studies.
[000345]Following single IVT doses of 2 mg aflibercept and HD aflibercept, systemic exposures of free aflibercept (AUC0_28 and Cmax) increase in a greater than dose-proportional manner (approximately 9.0-fold and 7.7-fold) while for adjusted bound aflibercept AUC0_28 and Cmax in plasma increase in a less than dose proportional manner (approximately 3.5-fold for both), demonstrating nonlinear PK of free and adjusted bound aflibercept.
Bioavailability of free aflibercept following IVT administration is estimated to be approximately 72%, and the total volume of distribution of free aflibercept after IV administration is estimated to be approximately 7 L.
[000346]Following 3 initial monthly HD aflibercept doses, the mean accumulation ratio of free and adjusted bound aflibercept in plasma based on AUC was 1.16 and 2.28 in the combined DME and nAMD population. After week 12, no further accumulation of either free or adjusted bound aflibercept in plasma occurs during the maintenance phase for HD
aflibercept as the dosing interval increases from every 4 weeks to every 12 weeks or 16 weeks.
[000347]Amongst the covariates evaluated in the Population PK analysis, body weight was the covariate with the greatest impact on systemic exposures to free and adjusted bound aflibercept. For participants in the lowest quintile of body weight (38.1 kg to 64.5 kg), the predicted impact on systemic exposures (Cmax and AUCtau) was modest, with 27%
to 39%
higher exposures to free aflibercept and 25% to 27% higher exposures to adjusted bound
No dosage adjustments of HD aflibercept are warranted based on the assessed covariates.
[000348]Mild to severe renal impairment also had a small impact on free aflibercept systemic exposures, as the increase in free aflibercept Cm,, and AUCtau in these participants was less than approximately 28% compared to participants with normal renal function.
Adjusted bound aflibercept systemic exposures in participants with mild to severe renal impairment ranged from 13% to 39% higher compared to participants with normal renal function. Here too, the perceived impact of renal impairment is best explained by the associated decrease in body weight with increasing renal impairment. Mild hepatic impairment had no effect on systemic exposures to free and adjusted bound aflibercept. No dosage adjustments of aflibercept are warranted for these populations.
[000349]Model-Based Exposure-Response Analysis for Proportion of Participants Requiring Dose Regimen Modification. For those participants requiring DRM, Cox proportional hazard modeling was performed to evaluate factors that may contribute to the need for a reduction in the dosing interval. The results of these analyses estimate a 260% higher rate of DRM for participants with nAMD compared to participants with DME and DR. After accounting for indication (nAMD or DME and DR), ocular clearance of free aflibercept and baseline CRT were identified as significant covariates. Within an indication (nAMD or DME and DR), for participants with the same ocular clearance of free aflibercept, a 52.8%
higher rate of DRM is predicted for participants at the 75th vs 25th percentile of baseline CRT.
Similarly, for participants with the same baseline CRT, a 32.9% higher rate of DRM is predicted for participants at the 75th vs 25th percentile of ocular clearance of free aflibercept, corresponding to those participants who are predicted to have the lowest aflibercept concentration in the eye.
These results are shown in Table 1-37. The outcomes of these analyses also estimate that the lower ocular clearance for HD aflibercept, attributable to a HD drug product effect, results in a 20.6% lower rate of DRM than would have been expected if the HD drug product had the same ocular clearance as 2 mg aflibercept.
Table 1-37. Hazard Ratio Contrasts for Time to DRM Model Effect Hazard Ratio
diabetic macular edema, DRM = dose regimen modification, QE = ocular clearance [000350]Dose-Response and Exposure-Response Conclusions. As the IVT dose increased from 2 mg of aflibercept to 8 mg of HD aflibercept, no further increase in PD
effect (decrease in CRT) was observed 4 weeks after each initial q4w dose through 12 weeks, in either the nAMD
or DME population. Despite 2 mg of aflibercept and 8 mg of HD aflibercept having similar PD
effect during the initial q4w dosing period, the 8 mg HD aflibercept dose provided a longer duration of pharmacological effect in the maintenance phase compared to 2 mg aflibercept. In nAMD participants, the small fluctuations in CRT or CST during a maintenance dosing interval attenuated over time for all dosing regimens, with only minor numerical differences observed between treatment groups. For DME participants, a greater reduction in CRT was observed from weeks 16 to 20 for 2q8 compared to both HD aflibercept regimens (HDq12 and HDq16).
This is attributable to a difference in the number of doses administered during this time period, with the 2q8 regimen receiving 2 additional initial q4w doses at weeks 12 and 16 compared to the HD aflibercept regimens which received their last initial q4w dose at week 8. These differences in CRT did not translate into any meaningful difference in mean BCVA response.
The fluctuations in CRT response over the course of a maintenance dosing interval attenuated over time for all dosing regimens. For participants with nAMD or DME, the HDq12 and HDq16 regimens provided rapid and durable response in CRT and BCVA over 48 weeks of treatment, with the majority of participants maintaining their randomized HDq12 (79%
nAMD; 91% DME) and HDq16 (77% nAMD; 89% DME) treatment regimens, without the need for DRM.
Ocular clearance of free aflibercept and baseline CRT were identified as significant covariates contributing to the need for DRM. Higher ocular clearance of free aflibercept and higher baseline CRT (indicative of more severe disease) were associated with an increased rate of DRM. The slower ocular clearance for HD aflibercept, attributable to a HD drug product effect, is estimated to result in a 20.6% lower rate of DRM compared to HD aflibercept if the same ocular clearance was observed as the 2 mg aflibercept.
[000351]Overall Conclusions. Consistent with the known target-mediated kinetic properties exhibited at low plasma concentrations of aflibercept, free and adjusted bound aflibercept after
aflibercept, after which the concentrations are sustained or slightly decrease until the end of the dosing interval.
[000352]Analyses of PK by cross-study comparison and Population PK analyses suggested similar systemic PK in the nAMD and DME populations. Following IVT
administration, Population PK methods estimate the bioavailability of free aflibercept at 72%, a median tmax of 2.89 days, and mean Cmax of 0.304 mg/L for the 8 mg dose of HD aflibercept. As the aflibercept IVT dose increased from 2 mg to 8 mg and the treatment changes from 2 mg aflibercept to 8 mg HD aflibercept, free aflibercept mean AUC0_28 and Cmax increased greater than dose-proportionally (approximately 9.0-fold and 7.7-fold) while adjusted bound AUC0_28 and Cmax increased less than dose proportionally (approximately 3.5-fold for both), consistent with the known target-mediated related nonlinear PK of free and adjusted bound aflibercept. Free aflibercept after IV administration has a low total volume of distribution of 7 L, indicating distribution largely in the vascular compartment. Following 3 initial monthly HD aflibercept doses, the mean accumulation ratio of free and adjusted bound aflibercept in plasma based on AUC is 1.16 and 2.28. After week 12, no further accumulation of either free or adjusted bound aflibercept in plasma occurs during the maintenance phase for HD aflibercept as the dosing interval increases from every 4 weeks to every 12 weeks or 16 weeks.
[000353]The Population PK predicted median time for free aflibercept concentrations in plasma to reach LLOQ following 2 mg IVT aflibercept is 1.5 weeks compared to 3.50 weeks for HD
aflibercept. The longer duration of systemic exposure to free aflibercept for HD aflibercept is attributed to not only a higher administered dose and nonlinear systemic target-mediated elimination, but also to a 34% slower ocular clearance of free aflibercept.
The slower ocular clearance of free aflibercept for HD aflibercept is attributed to a HD drug product effect which was identified as a statistically significant covariate in the Population PK
model. The slower ocular clearance of the HD aflibercept drug product is predicted to provide a 6-week longer duration of efficacy compared to 2q8, as the time to achieve the free aflibercept amount in the ocular compartment for the 2q8 regimen at the end of an 8-week dosing interval occurs 6 weeks later for the HD aflibercept drug product. Consistent with these predictions, the HDq12 and
and PULSAR
studies.
[000354]Body weight was the covariate with the greatest impact on systemic exposures to free and adjusted bound aflibercept. For participants in the lowest quintile of body weight (38.1 to 64.5 kg), the predicted impact on free aflibercept Cmax and AUC was modest, with 27% to 39%
higher exposures and 25% to 27% higher for adjusted bound aflibercept when compared the reference body weight range (73.5 to 83.5 kg). The effects of other covariates (age, albumin, disease population. and race, which included evaluation of Japanese race) on systemic exposures (Cmax, AUCtau) to free and adjusted bound aflibercept were small (<25% increase in exposure for covariate subgroups relative to the reference group). No dosage adjustments of aflibercept are warranted based on the above findings.
[000355]No formal studies were conducted in special populations (e.g., participants with renal or hepatic impairment) because like most therapeutic proteins, the large molecular weight of aflibercept (approximately 115 kDa) is expected to preclude elimination via the kidney, and its metabolism is expected to be limited to proteolytic catabolism to small peptides and individual amino acids. Mild to severe renal impairment had a small impact on free aflibercept systemic exposures, as the increase in free aflibercept Cm,, and AUCtau in these participants was less than approximately 28% compared to participants with normal renal function.
Adjusted bound aflibercept systemic exposures in participants with mild to severe renal impairment ranged from 13% to 39% higher compared to participants with normal renal function. The perceived impact of renal impairment is best explained by the associated decrease in body weight with increasing renal impairment. Mild hepatic impairment had no effect on systemic exposures to free and adjusted bound aflibercept. No dosage adjustments of aflibercept are warranted in these populations.
[000356]Dose-response analyses of CRT performed in the CANDELA, PULSAR, and PHOTON
studies indicated no further increase in PD effect for 2 mg aflibercept and HD
aflibercept IVT 4 weeks after each initial q4W dose through 12 weeks. Despite the 2 mg aflibercept and HD
aflibercept having similar PD effect during the initial q4w dosing period, the HD aflibercept drug product provided a longer duration (up to 16 weeks) of pharmacological effect in the maintenance phase than the 2 mg dose (up to 8 weeks).
[000357]For participants with nAMD or DME, the HDq12 and HDq16 regimens provided rapid and durable response in CRT and BCVA over 48 weeks of treatment, with the majority of participants maintaining their randomized HDq12 (79% nAMD; 91% DME) and HDq16 (77%
nAMD; 89% DME) treatment regimens, without the need for DRM.
(indicative of more severe disease) were associated with an increased rate of DRM. For HD
aflibercept, the slower ocular clearance and longer duration of ocular exposure to free aflibercept, attributable to the HD drug product effect, have been identified in an exposure-response analysis to result in a reduction of DRM of 20.6%.
[000359]Immunogenicity of HD aflibercept administered IVT was low across all treatment groups for both nAMD and DME participants. During the 48-week treatment with aflibercept administered IVT, the incidence of ADA in the combined 8 mg HD aflibercept treatment group was 2.7% (25/937 participants with nAMD or DME). None of the TE ADA positive samples were found to be positive in the NAb assay. Based on the lack of impact of ADA on concentrations of aflibercept in plasma, no effect on efficacy is anticipated. Positive responses in the ADA assays were not associated with significant AEs.
[000360]Overall, the clinical pharmacology data support the proposed aflibercept dosing regimens of 8 mg every 8 to 16 weeks after 3 initial monthly doses for the treatment of adults with nAMD, DME, or DR.
Immunogenicity [000361]Samples for antidrug antibody (ADA) examinations were taken at baseline and subsequently at Weeks 48 (and Week 96 ¨ to come). The samples were assayed using a validated, electrochemiluminescence bridging assay to detect the presence of ADA.
[000362]Out of the 833 participants in the ADA analysis set (AAS), a total of 43 participants had positive samples in the ADA assay (including baseline); 11 participants in the 2q8 group, 19 participants in the HDq12 group, and 13 participants in the HDq16 group (Table 1-38).
[000363]A total of 24 participants participating in this study exhibited a treatment-emergent ADA response; 4 participants in the 2q8 group, 11 participants in the HDq12 group, and 9 participants in the HDq16 group. The incidence of treatment-emergent immunogenicity in the 2q8, HDq12 and HDq16 groups was approximately 1.5%, 3.9%, and 3.2%, respectively. No treatment-boosted ADA response were observed. In each of the groups, the titers were low (<1000). None of the samples that were positive in the ADA assay demonstrated neutralizing activity (Table 1-38).
[000364]Overall, the low level of immunogenicity was not considered clinically relevant.
[000365]In participants with treatment emergent ADA, one participant in the HDq12 group had an AE of mild iritis which was not considered to be related to study treatment by the investigator.
N = 273 N = 283 N = 277 N =
(100%) (100%) (100%) (100%) Week 48 Total ADA subjects, n (%) 273 (100%) 283 (100%) 277 (100%) 560 (100%) Negative (a) 262 (96.0%) 263 (92.9%) 263 (94.9%) 526 (93.9%) Pre-existing immunoreactivity (b) 7 (2.6%) 8 (2.8%) 4 (1.4%) 12 (2.1%) Treatment-boosted (c) 0 0 0 0 Treatment-emergent positive (d) 4 (1.5%) 11(3.9%) 9(3.2%) 20(3.6%) Missing 0 1 (0.4%) 1(0.4%) 2 (0.4%) Titer Low (< 1000) 4 11 9 20 Moderate (1000-10000) 0 0 0 0 High (> 10000) 0 0 0 0 Number of subjects treatment-emergent 0 0 0 0 NAb ADA positive ADA = anti-drug antibody, NAb = neutralizing antibody (a) ADA Negative: negative response in the ADA assay at all time points and those that exhibited a pre-existing response, as defined in (b), regardless of any missing samples.
(b) Pre-existing immunoreactivity: either a positive response in the ADA assay at baseline with all post first dose ADA results negative OR a positive response at baseline with all post first dose ADA
responses less than 4-fold of baseline titer levels.
(c) Treatment-boosted ADA response: positive response post first dose that is greater than or equal to 4-fold over baseline titer level, when baseline results were positive.
(d) Treatment-emergent positive: ADA positive response post first dose when baseline results were negative or missing.
Treatment Exposure [000366]The results of the exploratory endpoints, proportions of participants with a q16 or longer treatment interval through Week 48 and Week 60 in the HDq16 group, with a q12 or longer interval through Week 48 and Week 60 in the HDq12 and HDq16 groups, and with a q12 or q16 or longer treatment interval as the last treatment interval at Week 48 and Week 60 in the HDq12 and HDq16 groups, respectively, in the SAF, are presented Table 1-39. In addition, the proportions of participants with q20 treatment interval as the last treatment interval at Week 60 in the HDq16 group and the proportion of participants who shortened treatment intervals in the HDq12 and HDq16 groups are presented in this table.
[000367]Overall, the target treatment intervals of either q12 or q16 were maintained in more than 3 quarters of all participants in the HD groups through Week 48 and in approximately 3 quarters of all participants in the HD groups through Week 60. See Figure 27.
[000368]The mean number of injections through week 60 in the 2q8, HDq12 and HDq16 groups is set forth in Figure 28.
(100%) N= 316 (100%) N= 312(100%) N= 628(100%) Subjects with q12 or longer dosing interval (b), n (%) 251 (79.4%) 272 (87.2%) 523 (83.3%) Subjects with q16 dosing interval (c), n (%) 239 (76.6%) Subjects with q12 or longer dosing interval as the last 251 (79.4%) 271 (86.9%) 522 (83.1%) intended dosing interval (d), n (%) Subjects with q16 dosing interval as the last intended dosing 239 (76.6%) interval (d), n (%) Subjects shortened to q8 dosing interval at Week 16, n (%) I 17 (5.4%) 10 (3.2%) 27 (4.3%) Subjects shortened to q8 dosing interval at Week 20, n (%) 25 (7.9%) 21(6.7%) 46 (7.3%) Subjects shortened anytime, n (%) 65 (20.6%) 73 (23.4%) 138 (22.0%) Subjects shortened to q8 dosing interval anytime, n (%) 65 (20.6%) 40 (12.8%) 105 (16.7%) Subjects shortened to q12 dosing interval anytime, n (%) 33 (10.6%) Week 60 (e) 2q8 N305 HDq12 HDq16 All HD
(100%) N= 311 (100%) N= 309 (100%) N = 620 (100%) Subjects maintained with q12 or longer dosing interval (f), n 242 (77.8%) 264 (85.4%) 506 (81.6%) (%) Subjects maintained with q16 or longer dosing interval (g), n 229 (74.1%) (%) Subjects with q12 or longer dosing interval as the last I 263 (84.6%) 278 (90.0%) 541 (87.3%) intended dosing interval (h), n (%) Subjects with q16 or longer dosing interval as the last 134(43.1%) 239(77.3%) 373 (60.2%) intended dosing interval (h), n (%) Subjects with q20 dosing interval as the last intended dosing 119 (38.5%) interval (h), n (%) Subjects shortened to q8 dosing interval at Week 16, n (%) 17 (5.5%) 10 (3.2%) 27 (4.4%) Subjects shortened to q8 dosing interval at Week 20, n (%) 25 (8.0%) 20 (6.5%) 45 (7.3%) Subjects shortened anytime, n (%) I 69 (22.2%) 80 (25.9%) 149 (24.0%) Subjects shortened to q8 dosing interval anytime, n (%) 69 (22.2%) 45 (14.6%) 114 (18.4%) Subjects shortened to q12 dosing interval anytime (without 35 (11.3%) shortening to q8), n (%) Subjects never extended dosing interval, n (%) (i) I 159(51.1%) 174(56.3%) 333 (53.7%) Subjects extended dosing interval anytime, n (%) (j) 152 (48.9%) 135 (43.7%) 287 (46.3%) DRM = dose regimen modification / indicates categories that do not apply.
a Study interventions given at Week 48 or beyond are not included in this table.
b All subjects on q12 or q16 interval for whom it was not planned to have their interval shortened to q8 interval [according to DRM
criteria until Week 44] prior to Week 48.
c All subjects on q16 interval for whom it was not planned to have their interval shortened to q12 or q8 interval [according to DRM
criteria until Week 44] prior to Week 48.
d Based on DRM criteria assessed at the last visit on or before Week 48.
e Study interventions given at Week 60 or beyond are not included in this table.
f All subjects on q12 or q16 interval for whom it was not planned to have their interval shortened to q8 interval [according to DRM
criteria until Week 56] prior to Week 60.
g All subjects on q16 interval for whom it was not planned to have their interval shortened to q12 or q8 interval [according to DRM
criteria until Week 56] prior to Week 60.
h Based on DRM criteria assessed at the last visit on or before Week 60.
i All subjects on q12 or q16 interval for whom it was not planned to have their interval extended [according to DRM criteria until Week 56] prior to Week 60.
Polypoidal Choroidal Vasculopathy (PCV):
[000369]Overall, 1,009 patients were randomized and treated, and the primary endpoint was met with aflibercept 8 mg (p=0.0009 and p=0.0011 for HDq12 and HDq16, respectively) vs 2q8.
population.
[0004] In patients with PCV, aflibercept 8 mg provides similar improvements in BCVA at Week 48 compared to 2q8, with an extended injection interval, and comparable safety profile.
Conclusions [000371]This is an ongoing Phase 3, multi-center, randomized, double-masked, active-controlled study investigating the efficacy, safety, and tolerability of IVT
administration of HD
aflibercept versus aflibercept 2 mg in participants with treatment-naïve nAMD.
The present Week 60 data set describes the results of a pre-planned analysis of the Week 60 data for the primary and the key secondary endpoints, and of additional secondary efficacy, PK, and safety endpoints. Study participants, the masked study team, central reading center, and Steering Committee members are remaining masked until the end of the study.
[000372]A total of 1011 participants recruited at 223 sites in 27 countries/regions (Europe, North America, Latin America, Australia, and Asia Pacific) were randomized in nearly equal numbers to 1 of the 3 treatment groups, of whom 1009 participants received at least one IVT
injection. All of these treated participants were included in the safety analysis (SAF).
Compliance with the treatment schedule was high in all groups with a mean treatment compliance through Week 60 of >97% in all groups. The analysis of efficacy was based on the data of the FAS (n=1009), which was identical to the SAF, and the PPS (per protocol set) (n=970 in Week 48 analysis, n=969 in Week 60 analysis), which showed group sizes of 95% in all treatment groups. The analysis of general PK assessments was based on the data of the PKS (n=934), and the analysis of the Dense PK study on the data of the DPKS
(n=23).
Overall, the 3 treatment groups were well balanced with regard to demographic and disease characteristics. Minor numerical imbalances in some comparisons were considered not to be of relevance for the evaluation of the study objectives.
[000374]The primary endpoint, change from baseline in BCVA measured by the ETDRS letter score at Week 48, and the key secondary endpoints, change from baseline in BCVA measured by the ETDRS letter score at Week 60 and proportion of participants with no IRF and no SRF in central subfield at Week 16, were assessed together using a hierarchical testing procedure.
[000375]The primary analysis endpoint was met: treatment with HDq12 and HDq16 demonstrated non-inferiority to 2q8 using the margin of 4 letters, with LSmean changes from baseline in BCVA from baseline to Week 48 of 6.06 letters (HDq12) and 5.89 letters (HDq16), respectively, versus 7.03 letters in the 2q8 group. Treatment differences in LSmeans (95% Cl) were -0.97 (-2.87, 0.92) letters and -1.14 (-2.97, 0.69) letters for HDq12 and HDq16, respectively, compared to 2q8. The corresponding key secondary endpoint at Week 60 was also met: treatment with HDq12 and HDq16 demonstrated non-inferiority to 2q8 using the margin of 4 letters, with LSmean changes from baseline in BCVA from baseline to Week 60 of 6.37 letters (HDq12) and 6.31 letters (HDq16), respectively, versus 7.23 letters in the 2q8 group. Treatment differences in LSmeans (95% Cl) were -0.86 (-2.57, 0.84) letters and -0.92 (-2.51, 0.66) letters for HDq12 and HDq16, respectively, compared to 2q8. The robustness of these results for the primary endpoint and the corresponding key secondary endpoint was supported by supplementary analyses in the PPS as well as by sensitivity analyses in the FAS.
[000376]The non-inferiority in the mean change in BCVA at Week 48 and Week 60 were achieved in participants treated at extended intervals in the HD groups compared to the 2q8 group. Moreover, 79.4% and 84.6% of completers in the HDq12 group and 76.6%
and 77.3% of completers in the HDq16 group maintained their randomized treatment interval through Week 48 and Week 60, respectively. This resulted in numerically lower mean numbers of active injections through Week 60 of 6.9 in the HDq12 group and 6.0 in the HDq16 group compared to 8.5 in the 2q8 group. Overall, 82% of participants in the pooled HD groups were able to be maintained on a dosing interval of 12 weeks or longer with HD aflibercept treatment through Week 60 and, thus, the remaining proportion of 18% of HD participants did require shortening of the dosing interval to every 8 weeks.
and no SRF in central subfield at Week 16, superiority in the pooled HD groups versus the comparator 2q8 was demonstrated. This analysis showed that no retinal fluid status (no IRF
and no SRF) at Week 16 was reached in 63.3% of the participants in the pooled HD groups compared with 51.6% in the 2q8 group. This resulted in a difference (95% Cl) between the pooled HD groups and the 2q8 group of 11.73% (5.26%, 18.20%) with an associated p-value for the one-sided test for superiority of 0.0002.
[000378]The subsequent test for superiority in the primary endpoint of HDq12 vs. 2q8 treatment was not statistically significant (p = 0.8437) so that the hierarchical testing strategy was stopped at this point.
[000379]Subgroup analyses for the primary and key secondary endpoints, which were performed on a descriptive level by age, sex, geographic region, ethnicity, race, baseline BCVA
letters, and baseline PCV, did not show clinically meaningful differences between the subgroup population and the total population.
[000380]Descriptive analyses of the additional secondary endpoints at Week 48, change in CNV size from baseline, change in total lesion area from baseline, change from baseline in CST, and proportion of participants with no IRF and no SRF in the center subfield, provided differences between the treatment groups that were in favor of HD vs. 2q8 treatment.
[000381]The estimated contrasts for change in CNV size from baseline at Week 48 suggested greater reductions of -1.22 mm2 in the HDq12 group and of -0.48 mm2 in the HDq16 group in comparison with 2q8 treatment. The corresponding estimated contrasts for change in total lesion area from baseline to Week 48 were -0.55 mm2 and -0.44 mm2, respectively. The corresponding contrasts for change from baseline in CST at Week 48 were -11.12 pm and 10.51 pm, respectively, while the mean decreases in CST over time were similar across all groups. Moreover, the proportion of participants with no IRF and no SRF in the center subfield was 11.725% higher in the HDq12 and 7.451% higher in the HDq16 groups in comparison with 2q8 treatment.
[000382]The descriptive analyses of the other additional secondary endpoints evaluated at Week 48, proportion of participants who gained at least 15 letters in BCVA
from baseline, proportion of participants achieving an ETDRS letter score of at least 69 (approximate 20/40 Snellen equivalent), and change from baseline in NEI-VFQ-25 total score, provided similar results in the HD groups and the 2q8 group.
[000383]The mean number of active injections in the SAF population was 8.5, 6.9 and 6.0 in the 2q8, HDq12 and HDq16 treatment groups, respectively. For the 925 participants in the SAF
[000384]The safety profile of the HD treatments was similar to that of the comparator treatment (2 mg). The overall rates of ocular and non-ocular TEAEs and SAEs reported through Week 60 were similar among the treatment groups. Most of the reported TEAEs were evaluated as mild and resolved within the observation period with no need to permanently discontinue the study drug. Ocular TEAEs in the study eye that resulted in discontinuation of the study drug affected few participants: 8 (1.2%) participants in the pooled HD groups and 2 (0.6%) participants in the 2q8 group. Similarly, non-ocular TEAEs resulted in discontinuation of the study drug in 3 (0.4%) participants in the pooled HD groups and 6 (1.8%) participants in the 2q8 group.
[000385]A total of 10 deaths were reported during the study through Week 60, 5 (0.7%) in the pooled HD groups and 5(1.5%) in the 2q8 group. None of these deaths were considered related to the study drug, to fellow-eye treatment, the injection procedure, or protocol-required procedures and were consistent with concurrent medical conditions and the complications of these conditions associated with an older population.
[000386]No dose-response relationship in the incidence or the types of TEAEs was apparent between participants in the HD groups and the 2q8 group. The results of the subgroup analyses of the TEAEs were similar to those in the entire study population and did not suggest medically relevant differences between the treatment groups.
[000387]The analyses of laboratory data, vital signs, and ECG data (including QT interval) did not show any remarkable mean changes over time within the HD groups and the 2q8 group or differences between the groups.
[000388]No clinically meaningful trends in mean or median changes from baseline to pre-dose KW in the study eye were observed in any treatment group through Week 60. The proportion of participants meeting pre-defined KW criteria was generally low (< 10%) and similar across the treatment groups. Other technical ophthalmologic examinations (slit lamp) did also not point to any noticeable trends towards differences among the treatment groups or relevant changes within treatment groups from baseline through Week 60.
[000389]After the initial aflibercept dose of 2 mg (2q8) or 8 mg (HDq12 pooled with HDq16) aflibercept in the dense PK group, the concentration-time profiles of free aflibercept were
[000390]As the IVT dose of aflibercept increased from 2 mg to 8 mg (4-fold dose), the median Cm. and AUCIõt for free aflibercept increased in a slightly less than dose-proportional manner (about 3-fold) for Cmax and a greater than dose-proportional manner for AUCIõt (about 7-fold).
This larger increase in AUCIõt is unexpected and difficult to explain based on dose alone but it is consistent with known nonlinear target-mediated kinetics of aflibercept.
Mean Cmax and AUCiast for adjusted bound aflibercept increased in a less than dose proportional manner (approximately 2- to 2.5-fold) which is also consistent with the known nonlinear kinetics of aflibercept.
[000391]There was no accumulation seen after the 2 mg dose which is consistent with historical data. Accumulation of free aflibercept for the 8-mg treatments was 1.17. For adjusted bound aflibercept, accumulation ranged from 1.83 to 1.72 for the 2 mg and 8 mg treatments, respectively.
[000392]In general, PK in Japanese participants were in the same range as seen in non-Japanese participants. However, this should be interpreted with caution as concentrations and PK parameter were based on single participants.
[000393]In the general (sparse) PK assessment of mainly trough concentrations (except Visit 5 which was 4-8 days after the third administration), IVT administration of mean free aflibercept concentrations increased from baseline to Visit 5 (60-64 days after first administration).
Thereafter, mean concentrations of free aflibercept declined in all three dose groups. In the 2q8 treatment group mean concentrations of free aflibercept decline to values close to or below LLOQ in almost all participants 4 weeks after treatment, in the HD groups 8 weeks after treatment (Week 28 for HDq12, Week 48 for HDq16). Comparison of mean concentrations of free aflibercept at Visit 5 showed that concentrations increased about 6-fold as the IVT dose of aflibercept increased from 2 mg to 8 mg (4-fold dose).
[000394]Mean adjusted bound aflibercept concentrations increased from baseline to Visit 5.
Following attainment of Cmax, a slight decrease of the concentration-time profiles was observed until approximately the end of the observation period for both dose groups.
Comparison of
*****
[000395]All references cited herein are incorporated by reference to the same extent as if each individual publication, database entry (e.g., Genbank sequences or GenelD
entries), patent application, or patent, was specifically and individually indicated to be incorporated by reference. This statement of incorporation by reference is intended by Applicants to relate to each and every individual publication, database entry (e.g., Genbank sequences or Genel D
entries), patent application, or patent, each of which is clearly identified in even if such citation is not immediately adjacent to a dedicated statement of incorporation by reference. The inclusion of dedicated statements of incorporation by reference, if any, within the specification does not in any way weaken this general statement of incorporation by reference. Citation of the references herein is not intended as an admission that the reference is pertinent prior art, nor does it constitute any admission as to the contents or date of these publications or documents.
Claims (93)
and the time for free aflibercept to reach the lower limit of quantitation (LLOQ) in the plasma of the subject after said intravitreal injection of aflibercept is about 3.5 weeks.
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks after the immediately preceding dose.
_
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks after the immediately preceding dose.
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks after the immediately preceding dose.
of free aflibercept in the plasma of a subject after an intravitreal injection of about 2 mg aflibercept.
Date Recue/Date Received 2023-02-22
high molecular weight species immediately after manufacture and purification and/or less than or equal to about 6% high molecular weight species after storage for about 24 months at about 2-8 C.
wherein the VEGF
receptor fusion protein has less than about 3.5% high molecular weight species immediately after manufacture and purification and/or less than or equal to about 6% high molecular weight species after storage for about 24 months at about 2-8 C.
Date Recue/Date Received 2023-02-22 comprising administering to an eye of the subject, one or more doses of about 8 mg or more of VEGF receptor fusion protein once every 12, 13, 14, 15, 16, 17, 18, 19 or 20 or 12-20 or 12-16 or 16-20 weeks.
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks after the immediately preceding dose.
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks after the immediately preceding dose.
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 16 weeks after the immediately preceding dose.
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 20 weeks after the immediately preceding dose.
receptor fusion protein (0.07 mL) via intravitreal injection once every 12 weeks (2 ¨ 4 months, +/- 7 days).
receptor fusion protein (0.07 mL) via intravitreal injection once every 16 weeks (2 ¨ 4 months, +/- 7 days).
receptor fusion protein (0.07 mL) via intravitreal injection once every 20 weeks (+/- 7 days).
(1) the subject has received an initial 2 mg dose of VEGF receptor fusion protein then the method comprises, after 1 month, administering to the subject the initial 8 mg dose of VEGF
receptor fusion protein and, 1 month thereafter, the 1st 8 mg secondary dose of VEGF receptor fusion protein; and, 1 month thereafter, the 2nd 8 mg secondary dose of VEGF
receptor fusion protein; and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen;
(2) the subject has received an initial 2 mg dose of VEGF receptor fusion protein, then the method comprises, after 1 month, administering to the subject, the first 8 mg secondary dose of VEGF receptor fusion protein and, 1 month thereafter, the 2nd 8 mg secondary dose of VEGF
receptor fusion protein; and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen;
(3) the subject has received an initial 2 mg dose of VEGF receptor fusion protein, then the method comprises, after 1 month, administering to the subject the 2nd 8 mg secondary dose of VEGF receptor fusion protein and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen;
(4) the subject has received an initial 2 mg dose of VEGF receptor fusion protein, then the method comprises, after 1 month, administering to the subject the 1st 8 mg maintenance dose of VEGF receptor fusion protein and all further 8 mg maintenance doses of VEGF
receptor fusion protein every 12 or 16 or 20 weeks according to the HDq12 or HDq16 or HDq20 dosing regimen;
Date Recue/Date Received 2023-02-22 (5) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF receptor fusion protein after 1 month, then the method comprises, after another 1 month, administering to the subject the initial 8 mg dose of VEGF receptor fusion protein and, 1 month thereafter, the 1st 8 mg secondary dose of VEGF receptor fusion protein;
and 1 month thereafter, the 2nd 8 mg secondary dose of VEGF receptor fusion protein; and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen;
(6) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF receptor fusion protein after 1 month, then the method comprises, after another 1 month, administering to the subject a first 8 mg secondary dose of VEGF
receptor fusion protein and, 1 month thereafter, the 2nd 8 mg secondary dose of VEGF receptor fusion protein; and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen;
(7) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF receptor fusion protein after 1 month, then the method comprises, after another 1 month, administering to the subject the 2nd 8 mg secondary dose of VEGF
receptor fusion protein and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen;
(8) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF receptor fusion protein after 1 month, then the method comprises, after another 1 month, administering to the subject the 1st 8 mg maintenance dose of VEGF
receptor fusion protein and all further 8 mg maintenance doses of VEGF
receptor fusion protein every 12 or 16 or 20 weeks according to the HDq12 or HDq16 or HDq20 dosing regimen;
(9) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF receptor fusion protein after 1 month and a 2nd 2 mg secondary dose of VEGF receptor fusion protein after another 1 month, then the method comprises, after another 1 month, administering to the subject the initial 8 mg dose of VEGF
receptor fusion protein and, 1 month thereafter, the 1st 8 mg secondary dose of VEGF receptor fusion protein;
and 1 month thereafter, the 2nd 8 mg secondary dose of VEGF receptor fusion protein; and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen;
Date Recue/Date Received 2023-02-22 (10) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF receptor fusion protein after 1 month and a 2nd 2 mg secondary dose of VEGF receptor fusion protein after another 1 month, then the method comprises, after another 1 month, administering to the subject the first 8 mg secondary dose of VEGF receptor fusion protein and, 1 month thereafter, the 2nd 8 mg secondary dose of VEGF
receptor fusion protein; and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen;
(11) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF receptor fusion protein after 1 month and a 2nd 2 mg secondary dose of VEGF receptor fusion protein after another 1 month, then the method comprises, after another 1 month, administering to the subject the 2nd 8 mg secondary dose of VEGF receptor fusion protein and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen;
(12) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF receptor fusion protein after 1 month and a 2nd 2 mg secondary dose of VEGF receptor fusion protein after another 1 month, then the method comprises, after 2 months, administering to the subject the 1st 8 mg maintenance dose of VEGF
receptor fusion protein and, all further 8 mg maintenance doses of VEGF receptor fusion protein every 12 or 16 or 20 weeks according to the HDq12 or HDq16 or HDq20 dosing regimen;
(13) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF receptor fusion protein after 1 month and a 2nd 2 mg secondary dose of VEGF receptor fusion protein after another 1 month and a 1st 2 mg maintenance dose of VEGF receptor fusion protein after 8 weeks, then the method comprises, up to 2 months after the last dose of VEGF receptor fusion protein, administering to the subject the initial 8 mg dose of VEGF receptor fusion protein and 1 month thereafter, the 1st 8 mg secondary dose of VEGF
receptor fusion protein; and 1 month thereafter, the 2nd 8 mg secondary dose of VEGF receptor fusion protein; and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen;
(14) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF receptor fusion protein after 1 month and a 2nd 2 mg secondary dose of VEGF receptor fusion protein after another 1 month and 1 or more 2 mg maintenance doses of VEGF receptor fusion protein after 8 weeks, then the method comprises up to 2 Date Recue/Date Received 2023-02-22 months after the last dose of VEGF receptor fusion protein, administering to the subject the first 8 mg secondary dose of VEGF receptor fusion protein and 1 month thereafter, the 2nd 8 mg secondary dose of VEGF receptor fusion protein; and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen;
(15) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF receptor fusion protein after 1 month and a 2nd 2 mg secondary dose of VEGF receptor fusion protein after another 1 month and 1 or more 2 mg maintenance doses of VEGF receptor fusion protein after 8 weeks, then the method comprises up to 2 months after the last dose of VEGF receptor fusion protein, administering to the subject the 2nd 8 mg secondary dose of VEGF receptor fusion protein and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen;
(16) the subject has received an initial 2 mg dose of VEGF receptor fusion protein and a 1st 2 mg secondary dose of VEGF receptor fusion protein after 1 month and a 2nd 2 mg secondary dose of VEGF receptor fusion protein after another 1 month and 1 or more 2 mg maintenance doses of VEGF receptor fusion protein after 8 weeks, then the method comprises up to 2 months after the last dose of VEGF receptor fusion protein, administering to the subject the 1st 8 mg maintenance dose of VEGF receptor fusion protein and all further 8 mg maintenance doses of VEGF receptor fusion protein every 12 or 16 or 20 weeks according to the HDq12 or HDq16 or HDq20 dosing regimen;
wherein, (i) said HDq12 dosing regimen comprises:
a single initial dose of about 8 mg or more of VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks after the immediately preceding dose;
(ii) said HDq16 dosing regimen comprises:
a single initial dose of about 8 mg or more of VEGF receptor fusion protein, followed by Date Recue/Date Received 2023-02-22 one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 16 weeks after the immediately preceding dose;
and (iii) said HDq20 dosing regimen comprises:
a single initial dose of about 8 mg or more of VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 20 weeks after the immediately preceding dose.
(a) the subject has received an initial 8 mg dose of VEGF receptor fusion protein; then the method comprises after 1 month administering to the subject the first 8 mg secondary dose of VEGF receptor fusion protein and 1 month thereafter, administering the 2nd 8 mg secondary dose of VEGF receptor fusion protein; and then, every 12 or 16 or 20 weeks thereafter, administering one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen;
(b) the subject has received an initial 8 mg dose of VEGF receptor fusion protein & a 1st 8 mg secondary dose of VEGF receptor fusion protein after 1 month, then the method comprises, after another 1 month, administering to the subject the 2nd 8 mg secondary dose of VEGF
receptor fusion protein; and then, every 12 or 16 or 20 weeks thereafter, one or more 8 mg maintenance doses of VEGF receptor fusion protein according to the HDq12 or HDq16 or HDq20 dosing regimen;
(c) the subject has received an initial 8 mg dose of VEGF receptor fusion protein & a 1st 8 mg secondary dose of VEGF receptor fusion protein after 1 month & a 2nd 8 mg secondary dose of Date Recue/Date Received 2023-02-22 VEGF receptor fusion protein after another month; then the method comprises, after 12 or 16 or 20 weeks, administering to the subject the 1st 8 mg maintenance dose of VEGF
receptor fusion protein and all further 8 mg maintenance doses of VEGF receptor fusion protein every 12 or 16 or 20 weeks according to the HDq12 or HDq16 or HDq20 dosing regimen;
or (d) the subject has received an initial 8 mg dose of VEGF receptor fusion protein & a 1st 8 mg secondary dose of VEGF receptor fusion protein after 1 month & a 2nd 8 mg secondary dose of VEGF receptor fusion protein after another month, then, every 12 or 16 or 20 weeks thereafter, the subject has received one or more 8 mg maintenance doses of VEGF receptor fusion protein;
then the method comprises after 12 or 16 or 20 weeks from the last maintenance dose of VEGF
receptor fusion protein, administering to the subject one or more 8 mg maintenance doses of VEGF receptor fusion protein and all further 8 mg maintenance doses of VEGF
receptor fusion protein every 12 or 16 or 20 weeks according to the HDq12 or HDq16 or HDq20 dosing regimen;
wherein, (i) said HDq12 dosing regimen comprises:
a single initial dose of about 8 mg or more of VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 weeks after the immediately preceding dose;
(ii) said HDq16 dosing regimen comprises:
a single initial dose of about 8 mg or more of VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 16 weeks after the immediately preceding dose;
and Date Recue/Date Received 2023-02-22 (iii) said HDq20 dosing regimen comprises:
a single initial dose of about 8 mg or more of VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 20 weeks after the immediately preceding dose.
receptor fusion protein; or evaluating the subject in about 8 or 10 or 12 weeks after said administering and, if, in the judgment of the treating physician dosing every 12 weeks is appropriate, then administering another 8 mg dose of VEGF receptor fusion protein, re-evaluating the subject in about 12 weeks and if in the judgment of the treating physician, dosing every 16 weeks is appropriate, then continuing to dose the subject every 16 weeks with 8 mg VEGF receptor fusion protein.
Date Recue/Date Received 2023-02-22 a single initial dose of about 2 mg of VEGF receptor fusion protein, followed by 2 secondary doses of about 2 mg of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 2 mg of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 8 weeks after the immediately preceding dose.
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 or 16 weeks after the immediately preceding dose;
further comprising, after receiving one or more of said tertiary doses about 12 or 16 after the immediately preceding dose, lengthening the tertiary dose interval from = 12 weeks to 16 weeks;
= 12 weeks to 20 weeks; or = 16 weeks to 20 weeks, after the immediately preceding dose.
and/or CRT in the subject and, if the subject exhibits Date Recue/Date Received 2023-02-22 (a) <5 letter loss in BCVA; and/or (b) CRT <300 or 320 pm.
lengthening the tertiary dose interval.
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12 or 16 or 20 weeks after the immediately preceding dose;
further comprising, after receiving one or more of said tertiary doses about 12 or 16 or 20 weeks after the immediately preceding dose, shortening the tertiary dose interval from = 12 weeks to 8 weeks;
= 16 weeks to 12 weeks;
= 16 weeks to 8 weeks, = 20 weeks to 8 weeks, = 20 weeks to 12 weeks, or = 20 weeks to 16 weeks.
and/or CRT in the subject and, if the subject exhibits (a) > 10 letter loss in BCVA relative to baseline; and/or (b) > 50 pm increase in CRT relative to baseline, shortening the tertiary dose interval.
observed at about 12 weeks after treatment initiation;
(b) a greater than 25 micrometers increase in CRT is observed relative to the CRT observed at about 12 weeks after treatment initiation; and/or (c) there is a new onset foveal neovascularization or foveal hemorrhage;
at week 16 or week 20 after treatment initiation, then, the interval between tertiary doses is shortened from 12 weeks or 16 weeks to 8 weeks; or (a) greater than 5 letters are lost in BCVA (ETDRS), relative to the BCVA
observed at about 12 weeks after treatment initiation;
(b) a greater than 25 micrometers increase in CRT is observed relative to the CRT observed at about 12 weeks after treatment initiation; and/or (c) there is a new onset foveal neovascularization or foveal hemorrhage;
at week 24 after treatment initiation then, the interval between tertiary doses is shortened from 16 weeks to 12 weeks.
receptor fusion protein at said reduced or lengthening intervals between doses wherein criteria for reducing the interval include:
Date Recue/Date Received 2023-02-22 1. BCVA loss >5 letters;
2. >25 micrometers increase in central retinal thickness (CRT);
3. new foveal hemorrhage; and/or 4. new foveal neovascularization.
wherein criteria for lengthening the interval include:
1. BCVA loss <5 letters, 2. No fluid at the central subfield;
3. No new onset foveal hemorrhage; and/or 4. No fovea! neovascularization
1. BCVA loss <5 letters from Week 12;
2. No fluid at the central subfield on OCT, and 3. No new onset foveal hemorrhage or foveal neovascularization and/or wherein criteria for reducing the interval include both:
1. BCVA loss >5 letters from Week 12, and 2. >25 micrometers increase in central retinal thickness (CRT) from Week 12 or new foveal hemorrhage or new fovea! neovascularization.
The method of any one of claims 1-48 for treating or preventing neovascular age-related macular degeneration (nAMD), in a subject in need thereof that has been pre-treated with one or more 2 mg doses of VEGF receptor fusion protein, comprising administering to an eye of the subject, a single initial dose of about 8 mg or more of a VEGF receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-20 weeks after the immediately preceding dose.
Date Recue/Date Received 2023-02-22
receptor fusion protein; wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 8 weeks after the immediately preceding dose; or (2) one or more doses of 8 mg or more of VEGF receptor fusion protein about every 4 weeks.
active intraocular inflammation; and/or hypersensitivity;
is excluded from treatment or prevention.
ocular or periocular infection;
active intraocular inflammation; and/or hypersensitivity;
and excluding the subject treatment or prevention if any one or more if found in the subject.
= one 18-gauge x 11/2-inch, 5-micron, filter needle that includes a bevel;
= one 30-gauge x 1/2-inch injection needle; and = one 1-mL Luer lock syringe having a graduation marking for 70 microliters of volume packaged together; then (1) visually inspecting the aqueous formulation in which the VEGF receptor fusion protein is provided and, if particulates, cloudiness, or discoloration are visible, then using another vial of aqueous formulation;
(2) removing the protective plastic cap from the vial; and (3) Clean the top of the vial with an alcohol wipe; then using aseptic technique:
(4) removing the 18-gauge x 11/2-inch, 5-micron, filter needle and the 1 mL
syringe from their packaging (5) attaching the filter needle to the syringe by twisting it onto the Luer lock syringe tip (6) Pushing the filter needle into the center of the vial stopper until the needle is completely inserted into the vial and the tip touches the bottom or a bottom edge of the vial;
(7) Withdrawing all of the VEGF receptor fusion protein vial contents into the syringe, keeping the vial in an upright position, slightly inclined, while ensuring the bevel of the filter needle is submerged into the liquid;
(8) Continuing to tilt the vial during withdrawal keeping the bevel of the filter needle submerged in the formulation;
(9) Drawing the plunger rod sufficiently back when emptying the vial in order to completely empty the filter needle;
(10) Removing the filter needle from the syringe and disposing of the filter needle;
(11) Removing the 30-gauge x 1/2-inch injection needle from its packaging and attaching the injection needle to the syringe by firmly twisting the injection needle onto the Luer lock syringe tip;
(12) Holding the syringe with the needle pointing up, and checking the syringe for bubbles, wherein if there are bubbles, gently taping the syringe with a finger until the bubbles rise to the top; and (13) Slowly depressing the plunger so that the plunger tip aligns with the line that marks 70 microliters on the syringe.
Date Recue/Date Received 2023-02-22
receptor fusion protein and injection of VEGF receptor fusion protein is performed under controlled aseptic conditions, which comprise surgical hand disinfection and the use of sterile gloves, a sterile drape, and a sterile eyelid speculum (or equivalent) and anesthesia and a topical broad¨
spectrum microbicide are administered prior to the injection.
a single initial dose of about 2 mg of VEGF receptor fusion protein, followed by 2 secondary doses of about 2 mg of the VEGF receptor fusion protein, followed by one or more tertiary doses of about 2 mg of the VEGF receptor fusion protein; wherein each secondary dose is administered about 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 8 weeks after the immediately preceding dose;
wherein the subject is at any phase (initial dose, secondary dose or tertiary dose) of the 2 mg VEGF receptor fusion protein dosing regimen.
- 2 to 4 weeks is about 4 weeks;
- 12-20 weeks is about 12 weeks;
- 12-20 weeks is about 16 weeks;
- 12-20 weeks is about 20 weeks;
- 12-20 weeks is about 12-16 weeks;
- 8-16 weeks is about 12 weeks;
- 8-16 weeks is about 16 weeks;
- 8-16 weeks is about 12-16 weeks;
- 2 to 4 weeks is about 4 weeks and one or more secondary doses is 2 secondary doses;
- 12-20 weeks is about 12 weeks and one or more secondary doses is 2 secondary doses;
- 12-20 weeks is about 16 weeks and one or more secondary doses is 2 secondary doses;
- 12-20 weeks is about 20 weeks and one or more secondary doses is 2 secondary doses;
- 12-20 weeks is about 12-16 weeks and one or more secondary doses is 2 secondary doses;
- 2 to 4 weeks is about 4 weeks and one or more secondary doses is 2 secondary doses and a VEGF receptor fusion protein is aflibercept;
Date Recue/Date Received 2023-02-22 - 12-20 weeks is about 12 weeks and one or more secondary doses is 2 secondary doses and a VEGF receptor fusion protein is aflibercept;
- 12-20 weeks is about 16 weeks and one or more secondary doses is 2 secondary doses and a VEGF receptor fusion protein is aflibercept;
- 12-20 weeks is about 20 weeks and one or more secondary doses is 2 secondary doses and a VEGF receptor fusion protein is aflibercept; and/or - 12-20 weeks is about 12-16 weeks and one or more secondary doses is 2 secondary doses and a VEGF receptor fusion protein is aflibercept.
(i) comprises two polypeptides that comprise (1) a VEGFR1 component comprising amino acids 27 to 129 of SEQ ID NO: 2; (2) a VEGFR2 component comprising amino acids 130-231 of SEQ
ID NO: 2; and (3) a multimerization component comprising amino acids 232-457 of SEQ ID NO:
2;
(ii) comprises two polypeptides that comprise an immunoglobin-like (Ig) domain 2 of VEGFR1, an Ig domain 3 of a VEGFR2, and a multimerizing component;
(iii) comprises two polypeptides that comprise an immunoglobin-like (Ig) domain 2 of VEGFR1, an Ig domain 3 of VEGFR2, an Ig domain 4 of VEGFR2 and a multimerizing component;
(iv) comprises two VEGFR1R2-FcAC1(a) polypeptides encoded by the nucleic acid sequence of SEQ ID NO: 1; or (v) is selected from the group consisting of: aflibercept and conbercept
receptor fusion protein.
Date Recue/Date Received 2023-02-22
40 mg/ml VEGF receptor fusion protein, 10 mM sodium phosphate, 40 mM NaCI, 0.03%
polysorbate 20 and 5% sucrose, with a pH of 6.2.
receptor fusion protein, histidine-based buffer and arginine.
Date Recue/Date Received 2023-02-22
high molecular weight species immediately after manufacture and purification and/or less than or equal to about 6% high molecular weight species after storage for about 24 months at about 2-8 C.
at least about 100 mg/ml of a VEGF receptor fusion protein;
about 10-100 mM L-arginine;
sucrose;
a histidine-based buffer; and a surfactant;
wherein the formulation has a pH of about 5.0 to about 6.8; wherein the VEGF
receptor fusion protein has less than about 3.5% high molecular weight species immediately after manufacture and purification and/or less than or equal to about 6% high molecular weight species after storage for about 24 months at about 2-8 C.
_ = 140 mg/ml aflibercept; 20 mM histidine-based buffer; 5 % sucrose; 0.03 %
polysorbate 20; 10 mM L-arginine; pH 5.8;
= 150 + 15 mg/ml aflibercept, 10 mM phosphate-based buffer, 8 + 0.8% (w/v) sucrose, _ 0.02-0.04% (w/v) polysorbate 20 and 50 mM L-arginine, pH 5.9-6.5;
= 103-126 mg/ml aflibercept, 10 + 1 mM histidine-based buffer, 5 + 0.5%
(w/v) sucrose, 0.02-0.04% (w/v) polysorbate 20, and 50 + 5 mM L-arginine, pH 5.5-6.1;
= 140 mg/ml aflibercept, 10 mM histidine-based buffer, 2.5 % (w/v) sucrose, 2.0 % (w/v) proline, 0.03 % (w/v) polysorbate 20 and 50 mM L-arginine, pH 5.8;
Date Recue/Date Received 2023-02-22 = 114.3 mg/ml aflibercept, 10 mM histidine-based buffer, 5% (w/v) sucrose, 0.03% (w/v) polysorbate 20 and 50 mM L-arginine, pH 5.8;
= >100 mg/ml aflibercept, histidine-based buffer and L-arginine;
= >100 mg/ml aflibercept at about pH 5.8, wherein the formulation forms <3%
HMW
aggregates after incubation at 5 C for 2 months;
= About 114.3 mg/mL aflibercept; 10 mM ¨ 50 mM histidine-based buffer, sugar, non-ionic surfactant, L-Arginine, pH 5.8; or = About 114.3 mg/mL aflibercept; 10 mM His/His-HCI-based buffer, 5%
sucrose, 0.03%
polysorbate-20, 50 mM L-Arginine, pH 5.8.
67 I; 68 I; 69 I; 70 I; 71 I; 72 I; 73 I; 74 I; 75 I; 76 I; 77 I;
78 I; 79 I; 80 I; 81 I; 82 I; 83 I; 84 I; 85 I; 86 I; 87 I; 88 I; 89 I; 90 I; 91 I; 92 I; 93 I; 94 I; 95 I; 96 I; 97 I;
98 I; 99 I; or 100 I.
_
receptor fusion protein to both eyes of the subject.
= Increase in best corrected visual acuity (BCVA) by >5, >10, >15, or >20 letters;
= No decrease in best corrected visual acuity (BCVA);
= Elimination of retinal fluid;
= Elimination of intraretinal fluid (IRF) and/or subretinal fluid;
= Decrease in total lesion choroidal neovascularization (CNV) area;
= Loss of or decrease in intraretinal fluid;
= Loss of or decrease in subretinal fluid;
= Decrease in central subfield retinal thickness (CST);
Date Recue/Date Received 2023-02-22 = Increase in vision-related quality of life;
= Lack of treatment-emergent adverse events (AEs) and/or serious AEs (SAEs);
= ETDRS letter score of at least 69 (approximate 20/40 Snellen equivalent);
= Increase in BCVA as measured by the Early Treatment Diabetic Retinopathy Study (ETDRS) visual acuity chart by >5, >10, >15, or >20 letters, or lack of loss thereof during the course of treatment;
= Increase in BCVA as averaged over a period of 12 weeks;
= No intraretinal fluid (IRF) and no subretinal fluid;
= Decrease in choroidal neovascularization (CNV) size;
= Decrease in total lesion CNV area from baseline;
= Loss of IRF and/or SRF;
= Decrease in central subfield retinal thickness (CST);
= Increase in vision-related quality of life as measured by the National Eye Institute Visual Functioning Questionnaire-25 (NEI-VFQ-25);
= Lack of treatment-emergent adverse events (AEs) and/or serious AEs (SAEs);
= Efficacy and/or safety, in a subject suffering from nAMD, similar to that of aflibercept which is intravitreally dosed at 2 mg approximately every 4 weeks for the first 3 months, followed by 2 mg approximately once every 8 weeks or once every 2 months wherein efficacy is measured as increase in BCVA and/or reduction in central retinal thickness, and wherein safety is as measured as the incidence of adverse events such as blood pressure increase, intraocular pressure increase, visual impairment, vitreous floaters, vitreous detachment, iris neovascularization and/or vitreous hemorrhage;
= No detectable anti-drug antibody during receipt of treatment;
= Improvement in best corrected visual acuity (BVCA) by week 4, week 8, week 12, week 16, week 20, week 24, week 28, week 32, week 36, week 40, week 44, week 48, week 52, week 56 or week 60 from start of treatment (baseline);
= Increase in BCVA as measured by the Early Treatment Diabetic Retinopathy Study (ETDRS) visual acuity chart or Snellen equivalent by letters, letters, Ll. letters, letters, letters or >7 letters;
= Improvement in BCVA, by 4 weeks after initiation of treatment, of about 2 or 3 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 3 letters (ETDRS
or Snellen equivalent) when on HDq16 regimen;
Date Recue/Date Received 2023-02-22 = Improvement in BCVA, by 8 weeks after initiation of treatment, of about 5 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 4 or 5 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 12 weeks after initiation of treatment, of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 16 weeks after initiation of treatment, of about 6 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 20 weeks after initiation of treatment, of about 6 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 letters (ETDRS
or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 24 weeks after initiation of treatment, of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 28 weeks after initiation of treatment, of about 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 letters (ETDRS
or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 32 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 7 letters (ETDRS
or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 36 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 letters (ETDRS
or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 40 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 44 weeks after initiation of treatment, of about 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 5 or 6 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 48 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 letters (ETDRS
or Snellen equivalent) when on HDq16 regimen;
Date Recue/Date Received 2023-02-22 = Improvement in BCVA, by 52 weeks after initiation of treatment, of about 7 or 8 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 56 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 60 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, from about 48 to about 60 weeks after initiation of treatment, of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq12 regimen; or of about 6 or 7 letters (ETDRS or Snellen equivalent) when on HDq16 regimen;
= Improvement in BCVA, by 60 weeks after initiation of treatment, of about 5, 10 or 15 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or the HDq16 regimen;
= An improvement in BCVA by about week 8, 9, 10, 11 or 12 after initiation of treatment which is maintained (within about +1 or +2 ETDRS letters or Snellen equivalent) thereafter during the treatment regimen;
= A BCVA by 4 weeks after initiation of treatment of about 63 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 63 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 8 weeks after initiation of treatment of about 65 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 65 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by12 weeks after initiation of treatment of about 66 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 16 weeks after initiation of treatment of about 66 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 20 weeks after initiation of treatment of about 66 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
Date Recue/Date Received 2023-02-22 = A BCVA by 24 weeks after initiation of treatment of about 66 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 28 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66Ietter5 (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 32 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 67 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 36 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 40 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 44 weeks after initiation of treatment of about 68 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 48 weeks after initiation of treatment of about 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 52 weeks after initiation of treatment of about 67 or 68 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 56 weeks after initiation of treatment of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA by 60 weeks after initiation of treatment of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 or 67 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
= A BCVA between about week 48 and about 60 week after initiation of treatment of about 66 to about 72 letters (ETDRS or Snellen equivalent) when on the HDq12 regimen; or a BCVA of about 66 to about 70 letters (ETDRS or Snellen equivalent) when on the HDq16 regimen;
Date Recue/Date Received 2023-02-22 = Retina without fluid (total fluid, intraretinal fluid [IRF] and/or subretinal fluid [SRF]) in center subfield;
= No subretinal pigment epithelium fluid;
= Lack of fluid leakage on fluorescein angiography (FA);
= Decrease in central retinal thickness (CRT) by at least about 100, 125, 130, 135, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149 or 150 micrometers;
= A change in central retinal thickness, by 4 weeks after initiation of treatment of about -120 or -121 or -122 or -122.4 or -120.2 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -126 or -127 or-126.6 or -126.3 micrometers (+
about 10, 11 or 12 micrometers) when on the HDq16 regimen;
= A change in central retinal thickness, by 8 weeks after initiation of treatment of about -132, -133, -134, -135 or -136 or -136.2 or -132.8 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -139 or -140 or -139.5 or -139.6 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen;
= A change in central retinal thickness, by 12 weeks after initiation of treatment of about -136, -137, -138, -139, -140 or -141 or -140.9 or -136.6 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -144 or -143 or -143.5 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen = A change in central retinal thickness, by 16 weeks after initiation of treatment of about -120 or -121 or -122 or -123 or -124 or -123.4 or -120.1 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -132 or -133 or -132.1 or -133.1 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen;
= A change in central retinal thickness, by 20 weeks after initiation of treatment of about -110 or -111 or -112 or -113 or -114 or -113.6 or -110.9 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -115 or -116 or -117 or or -115.8 or -117.7 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen;
= A change in central retinal thickness, by 24 weeks after initiation of treatment of about -134, -135, -136 or -137 or -138 or -137.6 or -134.9 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -105 or -106 or -107 or -108 or -105.3 or -107.8 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen;
= A change in central retinal thickness, by 28 weeks after initiation of treatment of about -130, -131 or -132 or -133 or -134 or -133.7 or -130.7 micrometers (+ about 10, 11 or 12 Date Recue/Date Received 2023-02-22 micrometers) when on the HDq12 regimen; or of about -144 or -145 or -146 or -147 or -148 or -144.7 or -147.2 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen;
= A change in central retinal thickness, by 32 weeks after initiation of treatment of about -118 or -19 or -120 or -121 or -120.4 or -118.1 micrometers (+ about 10, 11 or micrometers) when on the HDq12 regimen; or of about -141 or -142 or -143 or -144 or -141.5 or -144 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen;
= A change in central retinal thickness, by 36 weeks after initiation of treatment of about -142 or -143 or -144 or -144.2 or -142.2 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -126 or -127, -128 or -129 or -130 or -131 or -126.4 or -130.5 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen;
= A change in central retinal thickness, by 40 weeks after initiation of treatment of about -131, -132, -133 or -134 or -133.8 or -131.2 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -127, -128 or -127.5 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen;
= A change in central retinal thickness, by 44 weeks after initiation of treatment of about -120 or -121 or -122 or -123 or -124 or -125 or -124.7 or -120.3 micrometers (+
about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -143, -144 or -145 or -144.8 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen;
= A change in central retinal thickness, by 48 weeks after initiation of treatment of about -142 or -143 or -144 or -144.4 or -142.3 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -143 or -144 or -145 or -146 or -147 or -148 or -143.8 or -147.1 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen;
= A change in central retinal thickness, by 52 weeks after initiation of treatment of about -143.2 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -139.6 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen;
= A change in central retinal thickness, by 56 weeks after initiation of treatment of about -136.3 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -137.5 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen;
Date Recue/Date Received 2023-02-22 = A change in central retinal thickness, by 60 weeks after initiation of treatment of about -151.8 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq12 regimen; or of about -148.8 micrometers (+ about 10, 11 or 12 micrometers) when on the HDq16 regimen;
= A central retinal thickness by week 4 after initiation of treatment of about 248.2 micrometers when on the HDq12 regimen; or of about 244.1 micrometers when on the HDq16 regimen;
= A central retinal thickness by week 8 after initiation of treatment of about 234.4 micrometers when on the HDq12 regimen; or of about 231.2 micrometers when on the HDq16 regimen;
= A central retinal thickness by week 12 after initiation of treatment of about 229.7 micrometers when on the HDq12 regimen; or of about 226.7 micrometers when on the HDq16 regimen;
= A central retinal thickness by week 16 after initiation of treatment of about 247.2 micrometers when on the HDq12 regimen; or of about 238.6 micrometers when on the HDq16 regimen;
= A central retinal thickness by week 20 after initiation of treatment of about 257 micrometers when on the HDq12 regimen; or of about 254.9 micrometers when on the HDq16 regimen;
= A central retinal thickness by week 24 after initiation of treatment of about 233 micrometers when on the HDq12 regimen; or of about 265.4 micrometers when on the HDq16 regimen;
= A central retinal thickness by week 28 after initiation of treatment of about 236.9 micrometers when on the HDq12 regimen; or of about 226 micrometers when on the HDq16 regimen;
= A central retinal thickness by week 32 after initiation of treatment of about 250.2 micrometers when on the HDq12 regimen; or of about 229.2 micrometers when on the HDq16 regimen;
= A central retinal thickness by week 36 after initiation of treatment of about 226.4 micrometers when on the HDq12 regimen; or of about 244.3 micrometers when on the HDq16 regimen;
= A central retinal thickness by week 40 after initiation of treatment of about 236.8 micrometers when on the HDq12 regimen; or of about 243.7 micrometers when on the HDq16 regimen;
Date Recue/Date Received 2023-02-22 = A central retinal thickness by week 44 after initiation of treatment of about 245.9 micrometers when on the HDq12 regimen; or of about 227.7 micrometers when on the HDq16 regimen;
= A central retinal thickness by week 48 after initiation of treatment of about 226.2 micrometers when on the HDq12 regimen; or of about 226.9 micrometers when on the HDq16 regimen;
= A central retinal thickness by week 52 after initiation of treatment of about 227.4 micrometers when on the HDq12 regimen; or of about 231.1 micrometers when on the HDq16 regimen;
= A central retinal thickness by week 56 after initiation of treatment of about 234.3 micrometers when on the HDq12 regimen; or of about 233.2 micrometers when on the HDq16 regimen;
= A central retinal thickness by week 60 after initiation of treatment of about 218.8 micrometers when on the HDq12 regimen; or of about 221.9 micrometers when on the HDq16 regimen;
= A CRT by about week 4, 5, 6, 7 or 8 after initiation of treatment or a reduction in CRT by week 4, 5, 6, 7 or 8 after initiation of treatment which is maintained (within about +10, +11 or +12 micrometers) thereafter during the treatment regimen;
_ = At about 4 hours after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.0409 (+0.0605) or 0 mg/L (or <0.0156 mg/L);
= At about 8 hours after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.05 (+3.78), 0.0973 (+0.102) or 0.0672 mg/L;
= At about day 2 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.11 (+2.21), 0.146 (+0.110) or 0.0903 mg/L;
= At about day 3 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.11 (+2.06), 0.137 (+0.0947) or 0.112 mg/L;
= At about day 5 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.08 (+1.86), 0.0933 (+0.0481) or 0.0854 mg/L;
= At about day 8 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.07 (+1.75), 0.0794 (+0.0413) or 0.0682 mg/L
;
= At about day 15 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.04 (+1.76), 0.0435 (+0.0199) or 0.0385 mg/L
;
Date Recue/Date Received 2023-02-22 = At about day 22 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.02 (+1.76), 0.0213 (+0.0148) or 0.0232 mg/L;
= At about day 29 after treatment initiation of HDq12 or HDq16, a free aflibercept concentration in plasma of about 0.00766 (+0.00958) or 0 mg/L (or <0.0156 mg/L);
= At about 4 hours post-dose after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.00 mg/L;
= At about 8 hours post-dose after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.00 mg/L;
= At about day 2 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.06 (+3.50) or 0.124 (+0.186) mg/L;
= At about day 3 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.13 (+2.07) or 0.173 (+0.155) mg/L;
= At about day 5 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.18 (+1.88) or 0.223 (+0.157) mg/L;
= At about day 8 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.31 (+1.56) or 0.334 (+0.135) mg/L;
= At about day 15 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.37 (+1.50) or 0.393 (+0.130) mg/L;
= At about day 22 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.25 (+3.00) or 0.335 (+0.155) mg/L;
= At about day 29 after treatment initiation of HDq12 or HDq16, an adjusted bound aflibercept concentration in plasma of about 0.32 (+1.39) or 0.331 (+0.0953) mg/L;
= Non-inferior BVCA compared to that of aflibercept which is intravitreally dosed at 2 mg approximately every 4 weeks for the first 5 injections followed by 2 mg approximately once every 8 weeks or once every 2 months;
= Ocular and non-ocular safety or death rate, in a subject suffering from DME, similar to that of aflibercept which is intravitreally dosed at 2 mg approximately every 4 weeks for the first 3 or 4 or 5 injections followed by 2 mg approximately once every 8 weeks or once every 2 months;
= An improvement in best corrected visual acuity by 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44 or 48 weeks from start of treatment;
= An increase in best corrected visual acuity, as measured by Early Treatment Diabetic Retinopathy Study (ETDRS) visual acuity chart or Snellen equivalent of 2 letters, 3 Date Recue/Date Received 2023-02-22 letters, 4 letters, 5 letters, 6 letters or > 7 letters by 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 or 60 weeks from start of treatment;
= A retina without fluid (total fluid, intraretinal fluid [IRF] and/or subretinal fluid [SRF]) in center subfield by 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 or 60 weeks from start of treatment; and/or = a decrease in central retinal thickness (CRT) of at least 100, 125, 130, 135, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149 or 150 micrometers by 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56 or 60 weeks from start of treatment.
receptor fusion protein are administered to the subject in the first year;
= 1 initial dose, 2 secondary doses and 2 tertiary doses of said > 8mg VEGF
receptor fusion protein are administered to the subject in the first year; or = 1 initial dose, 2 secondary doses and 3 tertiary doses of said > 8mg VEGF
receptor fusion protein are administered to the subject in the first year followed by 2 -4 tertiary doses in the second year.
Date Recue/Date Received 2023-02-22
receptor fusion protein, followed by one or more secondary doses of about 8 mg or more of the VEGF
receptor fusion protein, followed by one or more tertiary doses of about 8 mg or more of the VEGF
receptor fusion protein;
wherein each secondary dose is administered about 2 to 4 weeks after the immediately preceding dose; and wherein each tertiary dose is administered about 12-16 weeks after the immediately preceding dose and wherein the VEGF receptor fusion protein is aflibercept and wherein the vitreal half-life of aflibercept is increased compared to the intravitreal half-life of aflibercept after intravitreal application of 40 mg/mL aflibercept, 10 mM
phosphate buffer, 5%
Sucrose, 0.03% polysorbate 20, 40 mM NaCI, pH 6.2 ¨ 6.3.
receptor fusion protein to nAMD patients, wherein the instruction comprises instruction that VEGF receptor fusion protein 8 mg treatment is initiated with 1 injection per month (every 4 weeks) for 3 consecutive doses, wherein the instruction comprises instruction that after the initial 3 consecutive doses the injection interval may be lengthened up to every 16 weeks or every 20 weeks, and wherein the instruction comprises instruction that the treatment interval may be adjusted based on the physician's judgement of visual and/or anatomic outcomes.
Date Recue/Date Received 2023-02-22
Priority Applications (15)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| TW112109388A TW202400214A (en) | 2022-03-15 | 2023-03-14 | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders |
| JP2023039398A JP2023135646A (en) | 2022-03-15 | 2023-03-14 | Long-term high-dose VEGF antagonist regimen for the treatment of neovascular eye disorders |
| IL315374A IL315374A (en) | 2022-03-15 | 2023-03-14 | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders |
| PCT/US2023/015225 WO2023177691A1 (en) | 2022-03-15 | 2023-03-14 | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders |
| CN202380025712.6A CN119136823A (en) | 2022-03-15 | 2023-03-14 | Extended high-dose VEGF antagonist regimen for the treatment of angiogenic eye diseases |
| AU2023233561A AU2023233561A1 (en) | 2022-03-15 | 2023-03-14 | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders |
| CA3253640A CA3253640A1 (en) | 2022-03-15 | 2023-03-14 | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders |
| US18/121,499 US20240024420A1 (en) | 2022-03-15 | 2023-03-14 | Extended, High Dose VEGF Antagonist Regimens for Treatment of Angiogenic Eye Disorders |
| AU2023201638A AU2023201638A1 (en) | 2022-03-15 | 2023-03-15 | Extended, High Dose VEGF Antagonist Regimens for Treatment of Angiogenic Eye Disorders |
| KR1020230034231A KR20230135013A (en) | 2022-03-15 | 2023-03-15 | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders |
| EP23162090.7A EP4245312A1 (en) | 2022-03-15 | 2023-03-15 | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders |
| JOJO/P/2024/0202A JOP20240202A1 (en) | 2022-03-15 | 2024-09-09 | Extended-release, high-dose anti-VEGF regimens for the treatment of ocular vascular disorders |
| MX2024011079A MX2024011079A (en) | 2022-03-15 | 2024-09-10 | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders |
| CL2024002733A CL2024002733A1 (en) | 2022-03-15 | 2024-09-11 | Extended regimens with high doses of VEGF antagonists for the treatment of angiogenic ocular disorders. |
| CL2025001818A CL2025001818A1 (en) | 2022-03-15 | 2025-06-18 | Use of aflibercept to treat or prevent age-related neovascular macular degeneration. |
Applications Claiming Priority (16)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202263319869P | 2022-03-15 | 2022-03-15 | |
| US63/319,869 | 2022-03-15 | ||
| US202263404512P | 2022-09-07 | 2022-09-07 | |
| US63/404,512 | 2022-09-07 | ||
| US202263404893P | 2022-09-08 | 2022-09-08 | |
| US63/404,893 | 2022-09-08 | ||
| US202263411594P | 2022-09-29 | 2022-09-29 | |
| US63/411,594 | 2022-09-29 | ||
| US202263412165P | 2022-09-30 | 2022-09-30 | |
| US63/412,165 | 2022-09-30 | ||
| US202263421298P | 2022-11-01 | 2022-11-01 | |
| US63/421,298 | 2022-11-01 | ||
| US202263434920P | 2022-12-22 | 2022-12-22 | |
| US63/434,920 | 2022-12-22 | ||
| US202363444480P | 2023-02-09 | 2023-02-09 | |
| US63/444,480 | 2023-02-09 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CA3190733A1 true CA3190733A1 (en) | 2023-09-15 |
Family
ID=87975472
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CA3190733A Pending CA3190733A1 (en) | 2022-03-15 | 2023-02-22 | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders |
Country Status (1)
| Country | Link |
|---|---|
| CA (1) | CA3190733A1 (en) |
-
2023
- 2023-02-22 CA CA3190733A patent/CA3190733A1/en active Pending
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20190117767A1 (en) | Methods and formulations for treating vascular eye diseases | |
| EP4245312A1 (en) | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders | |
| AU2022275786B2 (en) | Extended, high dose VEGF antagonist regimens for treatment of angiogenic eye disorders | |
| EP4245313A1 (en) | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders | |
| CA3190733A1 (en) | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders | |
| EP4480491A1 (en) | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders | |
| HK40099476A (en) | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders | |
| CA3190726A1 (en) | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders | |
| HK40119109A (en) | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders | |
| HK40099475A (en) | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders | |
| HK40094129A (en) | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders | |
| HK40094129B (en) | Extended, high dose vegf antagonist regimens for treatment of angiogenic eye disorders |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| EEER | Examination request |
Effective date: 20231116 |
|
| D15 | Examination report completed |
Free format text: ST27 STATUS EVENT CODE: A-2-2-D10-D15-D126 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: EXAMINER'S REPORT Effective date: 20241017 |
|
| MFA | Maintenance fee for application paid |
Free format text: FEE DESCRIPTION TEXT: MF (APPLICATION, 2ND ANNIV.) - STANDARD Year of fee payment: 2 |
|
| U00 | Fee paid |
Free format text: ST27 STATUS EVENT CODE: A-2-2-U10-U00-U101 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: MAINTENANCE REQUEST RECEIVED Effective date: 20250123 |
|
| U11 | Full renewal or maintenance fee paid |
Free format text: ST27 STATUS EVENT CODE: A-2-2-U10-U11-U102 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: MAINTENANCE FEE PAYMENT DETERMINED COMPLIANT Effective date: 20250123 Free format text: ST27 STATUS EVENT CODE: A-2-2-U10-U11-U102 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: MAINTENANCE FEE PAYMENT PAID IN FULL Effective date: 20250123 |
|
| P11 | Amendment of application requested |
Free format text: ST27 STATUS EVENT CODE: A-2-2-P10-P11-P100 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: AMENDMENT RECEIVED - RESPONSE TO EXAMINER'S REQUISITION Effective date: 20250214 |
|
| P11 | Amendment of application requested |
Free format text: ST27 STATUS EVENT CODE: A-2-2-P10-P11-P102 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: AMENDMENT DETERMINED COMPLIANT Effective date: 20250224 |
|
| P13 | Application amended |
Free format text: ST27 STATUS EVENT CODE: A-2-2-P10-P13-X000 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: APPLICATION AMENDED Effective date: 20250224 |
|
| W00 | Other event occurred |
Free format text: ST27 STATUS EVENT CODE: A-2-2-W10-W00-W111 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: CORRESPONDENT DETERMINED COMPLIANT Effective date: 20250224 |
|
| R00 | Party data change recorded |
Free format text: ST27 STATUS EVENT CODE: A-2-2-R10-R00-R116 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: APPOINTMENT OF AGENT REQUEST Effective date: 20250603 Free format text: ST27 STATUS EVENT CODE: A-2-2-R10-R00-R119 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: REVOCATION OF AGENT REQUEST Effective date: 20250603 |
|
| W00 | Other event occurred |
Free format text: ST27 STATUS EVENT CODE: A-2-2-W10-W00-W111 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: CORRESPONDENT DETERMINED COMPLIANT Effective date: 20250606 |
|
| R17 | Change to representative recorded |
Free format text: ST27 STATUS EVENT CODE: A-2-2-R10-R17-R117 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: APPOINTMENT OF AGENT REQUIREMENTS DETERMINED COMPLIANT Effective date: 20250609 Free format text: ST27 STATUS EVENT CODE: A-2-2-R10-R17-R121 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: REVOCATION OF AGENT REQUIREMENTS DETERMINED COMPLIANT Effective date: 20250609 |
|
| W00 | Other event occurred |
Free format text: ST27 STATUS EVENT CODE: A-2-2-W10-W00-W100 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: LETTER SENT Effective date: 20250609 |
|
| P11 | Amendment of application requested |
Free format text: ST27 STATUS EVENT CODE: A-2-2-P10-P11-P101 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: AMENDMENT RECEIVED - VOLUNTARY AMENDMENT Effective date: 20251022 |
|
| P11 | Amendment of application requested |
Free format text: ST27 STATUS EVENT CODE: A-2-2-P10-P11-P102 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: AMENDMENT DETERMINED COMPLIANT Effective date: 20251120 |
|
| P13 | Application amended |
Free format text: ST27 STATUS EVENT CODE: A-2-2-P10-P13-X000 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: APPLICATION AMENDED Effective date: 20251120 |
|
| W00 | Other event occurred |
Free format text: ST27 STATUS EVENT CODE: A-2-2-W10-W00-W111 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: CORRESPONDENT DETERMINED COMPLIANT Effective date: 20251120 |
|
| D00 | Search and/or examination requested or commenced |
Free format text: ST27 STATUS EVENT CODE: A-2-2-D10-D00-D156 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: REQUEST FOR CONTINUED EXAMINATION SENT - EXAMINATION ON HOLD Effective date: 20251127 |
|
| D15 | Examination report completed |
Free format text: ST27 STATUS EVENT CODE: A-2-2-D10-D15-D126 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: EXAMINER'S REPORT Effective date: 20251127 |
|
| MFA | Maintenance fee for application paid |
Free format text: FEE DESCRIPTION TEXT: MF (APPLICATION, 3RD ANNIV.) - STANDARD Year of fee payment: 3 |
|
| U00 | Fee paid |
Free format text: ST27 STATUS EVENT CODE: A-2-2-U10-U00-U101 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: MAINTENANCE REQUEST RECEIVED Effective date: 20260123 |
|
| U11 | Full renewal or maintenance fee paid |
Free format text: ST27 STATUS EVENT CODE: A-2-2-U10-U11-U102 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: MAINTENANCE FEE PAYMENT PAID IN FULL Effective date: 20260123 |
|
| D11 | Substantive examination requested |
Free format text: ST27 STATUS EVENT CODE: A-2-2-D10-D11-D131 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: REQUEST FOR CONTINUED EXAMINATION (RCE) RECEIVED Effective date: 20260327 |
|
| P11 | Amendment of application requested |
Free format text: ST27 STATUS EVENT CODE: A-2-2-P10-P11-P100 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: AMENDMENT RECEIVED - RESPONSE TO EXAMINER'S REQUISITION Effective date: 20260327 |
|
| W00 | Other event occurred |
Free format text: ST27 STATUS EVENT CODE: A-2-2-W10-W00-W111 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: CORRESPONDENT DETERMINED COMPLIANT Effective date: 20260330 |
|
| D00 | Search and/or examination requested or commenced |
Free format text: ST27 STATUS EVENT CODE: A-2-2-D10-D00-D133 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: REQUEST FOR CONTINUED EXAMINATION (IN EXAMINATION) DETERMINED COMPLIANT Effective date: 20260401 Free format text: ST27 STATUS EVENT CODE: A-2-2-D10-D00-D174 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: REQUEST FOR CONTINUED EXAMINATION REQUIREMENTS DETERMINED COMPLIANT Effective date: 20260401 |
|
| P11 | Amendment of application requested |
Free format text: ST27 STATUS EVENT CODE: A-2-2-P10-P11-P102 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: AMENDMENT DETERMINED COMPLIANT Effective date: 20260401 |
|
| P13 | Application amended |
Free format text: ST27 STATUS EVENT CODE: A-2-2-P10-P13-X000 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: APPLICATION AMENDED Effective date: 20260401 |
|
| W00 | Other event occurred |
Free format text: ST27 STATUS EVENT CODE: A-2-2-W10-W00-W100 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: LETTER SENT Effective date: 20260401 Free format text: ST27 STATUS EVENT CODE: A-2-2-W10-W00-W111 (AS PROVIDED BY THE NATIONAL OFFICE); EVENT TEXT: CORRESPONDENT DETERMINED COMPLIANT Effective date: 20260401 |