CA3080640C - Cd47 blockade with radiation therapy - Google Patents
Cd47 blockade with radiation therapy Download PDFInfo
- Publication number
- CA3080640C CA3080640C CA3080640A CA3080640A CA3080640C CA 3080640 C CA3080640 C CA 3080640C CA 3080640 A CA3080640 A CA 3080640A CA 3080640 A CA3080640 A CA 3080640A CA 3080640 C CA3080640 C CA 3080640C
- Authority
- CA
- Canada
- Prior art keywords
- use according
- cells
- radiation
- blocking agent
- treatment
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 238000001959 radiotherapy Methods 0.000 title abstract description 51
- 101150084532 CD47 gene Proteins 0.000 title 1
- 101000868279 Homo sapiens Leukocyte surface antigen CD47 Proteins 0.000 claims abstract description 130
- 102100032913 Leukocyte surface antigen CD47 Human genes 0.000 claims abstract description 128
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 105
- 101000863873 Homo sapiens Tyrosine-protein phosphatase non-receptor type substrate 1 Proteins 0.000 claims abstract description 80
- 102100029948 Tyrosine-protein phosphatase non-receptor type substrate 1 Human genes 0.000 claims abstract description 76
- 238000011282 treatment Methods 0.000 claims abstract description 63
- 230000005855 radiation Effects 0.000 claims abstract description 52
- 201000011510 cancer Diseases 0.000 claims abstract description 35
- 239000002981 blocking agent Substances 0.000 claims abstract description 32
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 26
- 201000010099 disease Diseases 0.000 claims abstract description 24
- 102000049963 human SIRPA Human genes 0.000 claims abstract description 4
- 210000004027 cell Anatomy 0.000 claims description 79
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 18
- 239000003814 drug Substances 0.000 claims description 15
- 201000000050 myeloid neoplasm Diseases 0.000 claims description 15
- 229940079593 drug Drugs 0.000 claims description 14
- 206010025323 Lymphomas Diseases 0.000 claims description 10
- 208000032839 leukemia Diseases 0.000 claims description 9
- 238000005194 fractionation Methods 0.000 claims description 7
- 201000005787 hematologic cancer Diseases 0.000 claims description 7
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 claims description 7
- 208000031261 Acute myeloid leukaemia Diseases 0.000 claims description 6
- 201000005962 mycosis fungoides Diseases 0.000 claims description 6
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 claims description 5
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 5
- 239000003937 drug carrier Substances 0.000 claims description 5
- 238000002347 injection Methods 0.000 claims description 5
- 239000007924 injection Substances 0.000 claims description 5
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 claims description 4
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 claims description 4
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 4
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 claims description 4
- 206010033128 Ovarian cancer Diseases 0.000 claims description 4
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 claims description 4
- 238000001802 infusion Methods 0.000 claims description 4
- 208000020816 lung neoplasm Diseases 0.000 claims description 4
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 claims description 3
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 claims description 3
- 208000011691 Burkitt lymphomas Diseases 0.000 claims description 3
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 claims description 3
- 208000017604 Hodgkin disease Diseases 0.000 claims description 3
- 208000021519 Hodgkin lymphoma Diseases 0.000 claims description 3
- 208000010747 Hodgkins lymphoma Diseases 0.000 claims description 3
- 208000022435 Light chain deposition disease Diseases 0.000 claims description 3
- 208000034578 Multiple myelomas Diseases 0.000 claims description 3
- 201000003793 Myelodysplastic syndrome Diseases 0.000 claims description 3
- 206010042971 T-cell lymphoma Diseases 0.000 claims description 3
- 208000027585 T-cell non-Hodgkin lymphoma Diseases 0.000 claims description 3
- 201000003444 follicular lymphoma Diseases 0.000 claims description 3
- 201000005202 lung cancer Diseases 0.000 claims description 3
- 210000004881 tumor cell Anatomy 0.000 claims description 3
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 claims description 2
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 claims description 2
- 208000009359 Sezary Syndrome Diseases 0.000 claims description 2
- 208000021388 Sezary disease Diseases 0.000 claims description 2
- 208000031673 T-Cell Cutaneous Lymphoma Diseases 0.000 claims description 2
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 claims description 2
- 201000007241 cutaneous T cell lymphoma Diseases 0.000 claims description 2
- 208000025638 primary cutaneous T-cell non-Hodgkin lymphoma Diseases 0.000 claims description 2
- 201000007224 Myeloproliferative neoplasm Diseases 0.000 claims 2
- 108091006020 Fc-tagged proteins Proteins 0.000 claims 1
- 208000014767 Myeloproliferative disease Diseases 0.000 claims 1
- 230000003325 follicular Effects 0.000 claims 1
- 230000000637 radiosensitizating effect Effects 0.000 claims 1
- 206010057249 Phagocytosis Diseases 0.000 abstract description 7
- 230000008782 phagocytosis Effects 0.000 abstract description 7
- 230000001093 anti-cancer Effects 0.000 abstract description 6
- 230000004913 activation Effects 0.000 abstract description 3
- 239000011230 binding agent Substances 0.000 abstract description 3
- 230000000694 effects Effects 0.000 description 29
- 239000013598 vector Substances 0.000 description 21
- 238000002725 brachytherapy Methods 0.000 description 20
- 108020001507 fusion proteins Proteins 0.000 description 19
- 102000037865 fusion proteins Human genes 0.000 description 19
- 238000000034 method Methods 0.000 description 19
- 150000001413 amino acids Chemical group 0.000 description 17
- 210000002540 macrophage Anatomy 0.000 description 16
- 108090000765 processed proteins & peptides Proteins 0.000 description 16
- 102000039446 nucleic acids Human genes 0.000 description 13
- 108020004707 nucleic acids Proteins 0.000 description 13
- 150000007523 nucleic acids Chemical class 0.000 description 13
- 239000012636 effector Substances 0.000 description 12
- 108091033319 polynucleotide Proteins 0.000 description 12
- 102000040430 polynucleotide Human genes 0.000 description 12
- 239000002157 polynucleotide Substances 0.000 description 12
- 229920001184 polypeptide Polymers 0.000 description 12
- 102000004196 processed proteins & peptides Human genes 0.000 description 12
- 108090000623 proteins and genes Proteins 0.000 description 12
- 238000011284 combination treatment Methods 0.000 description 11
- 230000004927 fusion Effects 0.000 description 11
- 125000003729 nucleotide group Chemical group 0.000 description 11
- 235000001014 amino acid Nutrition 0.000 description 10
- 239000002773 nucleotide Substances 0.000 description 10
- 102000004169 proteins and genes Human genes 0.000 description 10
- 235000018102 proteins Nutrition 0.000 description 9
- 238000002560 therapeutic procedure Methods 0.000 description 9
- 241000699670 Mus sp. Species 0.000 description 8
- 239000003795 chemical substances by application Substances 0.000 description 8
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 7
- 230000004075 alteration Effects 0.000 description 7
- 238000002710 external beam radiation therapy Methods 0.000 description 7
- 230000014509 gene expression Effects 0.000 description 7
- 210000001519 tissue Anatomy 0.000 description 7
- 230000037396 body weight Effects 0.000 description 6
- 230000004083 survival effect Effects 0.000 description 6
- -1 two Chemical class 0.000 description 6
- 239000003981 vehicle Substances 0.000 description 6
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- 210000000481 breast Anatomy 0.000 description 5
- 230000002489 hematologic effect Effects 0.000 description 5
- 238000007912 intraperitoneal administration Methods 0.000 description 5
- 210000001672 ovary Anatomy 0.000 description 5
- 238000006467 substitution reaction Methods 0.000 description 5
- 210000001015 abdomen Anatomy 0.000 description 4
- 239000000654 additive Substances 0.000 description 4
- 230000000996 additive effect Effects 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- 230000001976 improved effect Effects 0.000 description 4
- 230000005865 ionizing radiation Effects 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 239000000203 mixture Substances 0.000 description 4
- 239000002953 phosphate buffered saline Substances 0.000 description 4
- 210000002307 prostate Anatomy 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- 238000011277 treatment modality Methods 0.000 description 4
- 230000004614 tumor growth Effects 0.000 description 4
- 238000002729 3-dimensional conformal radiation therapy Methods 0.000 description 3
- 241000239290 Araneae Species 0.000 description 3
- 208000003950 B-cell lymphoma Diseases 0.000 description 3
- 208000031648 Body Weight Changes Diseases 0.000 description 3
- 206010006187 Breast cancer Diseases 0.000 description 3
- 208000026310 Breast neoplasm Diseases 0.000 description 3
- 108020004414 DNA Proteins 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 238000011579 SCID mouse model Methods 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 230000000903 blocking effect Effects 0.000 description 3
- 230000004579 body weight change Effects 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 238000002648 combination therapy Methods 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- 238000003364 immunohistochemistry Methods 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 230000001965 increasing effect Effects 0.000 description 3
- 230000008595 infiltration Effects 0.000 description 3
- 238000001764 infiltration Methods 0.000 description 3
- 238000002721 intensity-modulated radiation therapy Methods 0.000 description 3
- 230000003993 interaction Effects 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 108020004999 messenger RNA Proteins 0.000 description 3
- 230000035755 proliferation Effects 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 239000013603 viral vector Substances 0.000 description 3
- 230000003612 virological effect Effects 0.000 description 3
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- RFLVMTUMFYRZCB-UHFFFAOYSA-N 1-methylguanine Chemical compound O=C1N(C)C(N)=NC2=C1N=CN2 RFLVMTUMFYRZCB-UHFFFAOYSA-N 0.000 description 2
- FZWGECJQACGGTI-UHFFFAOYSA-N 2-amino-7-methyl-1,7-dihydro-6H-purin-6-one Chemical compound NC1=NC(O)=C2N(C)C=NC2=N1 FZWGECJQACGGTI-UHFFFAOYSA-N 0.000 description 2
- OVONXEQGWXGFJD-UHFFFAOYSA-N 4-sulfanylidene-1h-pyrimidin-2-one Chemical compound SC=1C=CNC(=O)N=1 OVONXEQGWXGFJD-UHFFFAOYSA-N 0.000 description 2
- OIVLITBTBDPEFK-UHFFFAOYSA-N 5,6-dihydrouracil Chemical compound O=C1CCNC(=O)N1 OIVLITBTBDPEFK-UHFFFAOYSA-N 0.000 description 2
- LRFVTYWOQMYALW-UHFFFAOYSA-N 9H-xanthine Chemical compound O=C1NC(=O)NC2=C1NC=N2 LRFVTYWOQMYALW-UHFFFAOYSA-N 0.000 description 2
- 208000010507 Adenocarcinoma of Lung Diseases 0.000 description 2
- 208000036832 Adenocarcinoma of ovary Diseases 0.000 description 2
- 108091035707 Consensus sequence Proteins 0.000 description 2
- 241000701022 Cytomegalovirus Species 0.000 description 2
- 102000009109 Fc receptors Human genes 0.000 description 2
- 108010087819 Fc receptors Proteins 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- HYVABZIGRDEKCD-UHFFFAOYSA-N N(6)-dimethylallyladenine Chemical compound CC(C)=CCNC1=NC=NC2=C1N=CN2 HYVABZIGRDEKCD-UHFFFAOYSA-N 0.000 description 2
- 206010061328 Ovarian epithelial cancer Diseases 0.000 description 2
- 208000027190 Peripheral T-cell lymphomas Diseases 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- 108700005078 Synthetic Genes Proteins 0.000 description 2
- 208000031672 T-Cell Peripheral Lymphoma Diseases 0.000 description 2
- 229940126302 TTI-621 Drugs 0.000 description 2
- 241000245032 Trillium Species 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- 231100000987 absorbed dose Toxicity 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 210000003679 cervix uteri Anatomy 0.000 description 2
- 230000001684 chronic effect Effects 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 239000000539 dimer Substances 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- 210000003743 erythrocyte Anatomy 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 208000014829 head and neck neoplasm Diseases 0.000 description 2
- 102000044459 human CD47 Human genes 0.000 description 2
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 239000007951 isotonicity adjuster Substances 0.000 description 2
- 201000005249 lung adenocarcinoma Diseases 0.000 description 2
- 208000020968 mature T-cell and NK-cell non-Hodgkin lymphoma Diseases 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 231100000956 nontoxicity Toxicity 0.000 description 2
- 230000002611 ovarian Effects 0.000 description 2
- 208000013371 ovarian adenocarcinoma Diseases 0.000 description 2
- 201000006588 ovary adenocarcinoma Diseases 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 102200072304 rs1057519530 Human genes 0.000 description 2
- 102220054711 rs115275492 Human genes 0.000 description 2
- 102220266399 rs1555186817 Human genes 0.000 description 2
- 102220074214 rs373822815 Human genes 0.000 description 2
- 102200067664 rs397507595 Human genes 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 2
- HKZAAJSTFUZYTO-LURJTMIESA-N (2s)-2-[[2-[[2-[[2-[(2-aminoacetyl)amino]acetyl]amino]acetyl]amino]acetyl]amino]-3-hydroxypropanoic acid Chemical compound NCC(=O)NCC(=O)NCC(=O)NCC(=O)N[C@@H](CO)C(O)=O HKZAAJSTFUZYTO-LURJTMIESA-N 0.000 description 1
- WJNGQIYEQLPJMN-IOSLPCCCSA-N 1-methylinosine Chemical compound C1=NC=2C(=O)N(C)C=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O WJNGQIYEQLPJMN-IOSLPCCCSA-N 0.000 description 1
- HLYBTPMYFWWNJN-UHFFFAOYSA-N 2-(2,4-dioxo-1h-pyrimidin-5-yl)-2-hydroxyacetic acid Chemical compound OC(=O)C(O)C1=CNC(=O)NC1=O HLYBTPMYFWWNJN-UHFFFAOYSA-N 0.000 description 1
- SGAKLDIYNFXTCK-UHFFFAOYSA-N 2-[(2,4-dioxo-1h-pyrimidin-5-yl)methylamino]acetic acid Chemical compound OC(=O)CNCC1=CNC(=O)NC1=O SGAKLDIYNFXTCK-UHFFFAOYSA-N 0.000 description 1
- YSAJFXWTVFGPAX-UHFFFAOYSA-N 2-[(2,4-dioxo-1h-pyrimidin-5-yl)oxy]acetic acid Chemical compound OC(=O)COC1=CNC(=O)NC1=O YSAJFXWTVFGPAX-UHFFFAOYSA-N 0.000 description 1
- XMSMHKMPBNTBOD-UHFFFAOYSA-N 2-dimethylamino-6-hydroxypurine Chemical compound N1C(N(C)C)=NC(=O)C2=C1N=CN2 XMSMHKMPBNTBOD-UHFFFAOYSA-N 0.000 description 1
- SMADWRYCYBUIKH-UHFFFAOYSA-N 2-methyl-7h-purin-6-amine Chemical compound CC1=NC(N)=C2NC=NC2=N1 SMADWRYCYBUIKH-UHFFFAOYSA-N 0.000 description 1
- KOLPWZCZXAMXKS-UHFFFAOYSA-N 3-methylcytosine Chemical compound CN1C(N)=CC=NC1=O KOLPWZCZXAMXKS-UHFFFAOYSA-N 0.000 description 1
- LQLQRFGHAALLLE-UHFFFAOYSA-N 5-bromouracil Chemical compound BrC1=CNC(=O)NC1=O LQLQRFGHAALLLE-UHFFFAOYSA-N 0.000 description 1
- KSNXJLQDQOIRIP-UHFFFAOYSA-N 5-iodouracil Chemical compound IC1=CNC(=O)NC1=O KSNXJLQDQOIRIP-UHFFFAOYSA-N 0.000 description 1
- KELXHQACBIUYSE-UHFFFAOYSA-N 5-methoxy-1h-pyrimidine-2,4-dione Chemical compound COC1=CNC(=O)NC1=O KELXHQACBIUYSE-UHFFFAOYSA-N 0.000 description 1
- ZLAQATDNGLKIEV-UHFFFAOYSA-N 5-methyl-2-sulfanylidene-1h-pyrimidin-4-one Chemical compound CC1=CNC(=S)NC1=O ZLAQATDNGLKIEV-UHFFFAOYSA-N 0.000 description 1
- LRSASMSXMSNRBT-UHFFFAOYSA-N 5-methylcytosine Chemical compound CC1=CNC(=O)N=C1N LRSASMSXMSNRBT-UHFFFAOYSA-N 0.000 description 1
- DCPSTSVLRXOYGS-UHFFFAOYSA-N 6-amino-1h-pyrimidine-2-thione Chemical compound NC1=CC=NC(S)=N1 DCPSTSVLRXOYGS-UHFFFAOYSA-N 0.000 description 1
- MSSXOMSJDRHRMC-UHFFFAOYSA-N 9H-purine-2,6-diamine Chemical compound NC1=NC(N)=C2NC=NC2=N1 MSSXOMSJDRHRMC-UHFFFAOYSA-N 0.000 description 1
- 206010002091 Anaesthesia Diseases 0.000 description 1
- 208000007690 Brenner tumor Diseases 0.000 description 1
- 206010073258 Brenner tumour Diseases 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- VYZAMTAEIAYCRO-UHFFFAOYSA-N Chromium Chemical compound [Cr] VYZAMTAEIAYCRO-UHFFFAOYSA-N 0.000 description 1
- GUTLYIVDDKVIGB-OUBTZVSYSA-N Cobalt-60 Chemical compound [60Co] GUTLYIVDDKVIGB-OUBTZVSYSA-N 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- 102220585510 D site-binding protein_S66T_mutation Human genes 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 230000005778 DNA damage Effects 0.000 description 1
- 231100000277 DNA damage Toxicity 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 102220542110 Feline leukemia virus subgroup C receptor-related protein 2_F94V_mutation Human genes 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- BCCRXDTUTZHDEU-VKHMYHEASA-N Gly-Ser Chemical compound NCC(=O)N[C@@H](CO)C(O)=O BCCRXDTUTZHDEU-VKHMYHEASA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 208000012766 Growth delay Diseases 0.000 description 1
- 229920000209 Hexadimethrine bromide Polymers 0.000 description 1
- 101100477531 Homo sapiens SIRPA gene Proteins 0.000 description 1
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 1
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 1
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- 241000703391 Lipovnik virus Species 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 206010061269 Malignant peritoneal neoplasm Diseases 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 102000005640 Myosin Type II Human genes 0.000 description 1
- 108010045128 Myosin Type II Proteins 0.000 description 1
- SGSSKEDGVONRGC-UHFFFAOYSA-N N(2)-methylguanine Chemical compound O=C1NC(NC)=NC2=C1N=CN2 SGSSKEDGVONRGC-UHFFFAOYSA-N 0.000 description 1
- 208000034176 Neoplasms, Germ Cell and Embryonal Diseases 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- HCWPIIXVSYCSAN-IGMARMGPSA-N Radium-226 Chemical compound [226Ra] HCWPIIXVSYCSAN-IGMARMGPSA-N 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- WOUIMBGNEUWXQG-VKHMYHEASA-N Ser-Gly Chemical compound OC[C@H](N)C(=O)NCC(O)=O WOUIMBGNEUWXQG-VKHMYHEASA-N 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 229940126301 TTI-622 Drugs 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical group OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 125000000641 acridinyl group Chemical group C1(=CC=CC2=NC3=CC=CC=C3C=C12)* 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 230000037005 anaesthesia Effects 0.000 description 1
- 238000004873 anchoring Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 230000005809 anti-tumor immunity Effects 0.000 description 1
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 230000003190 augmentative effect Effects 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- DZBUGLKDJFMEHC-UHFFFAOYSA-N benzoquinolinylidene Chemical group C1=CC=CC2=CC3=CC=CC=C3N=C21 DZBUGLKDJFMEHC-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 230000029918 bioluminescence Effects 0.000 description 1
- 238000005415 bioluminescence Methods 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 208000035269 cancer or benign tumor Diseases 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 230000022131 cell cycle Effects 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 235000013339 cereals Nutrition 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 201000006612 cervical squamous cell carcinoma Diseases 0.000 description 1
- TVFDJXOCXUVLDH-YPZZEJLDSA-N cesium-131 Chemical compound [131Cs] TVFDJXOCXUVLDH-YPZZEJLDSA-N 0.000 description 1
- TVFDJXOCXUVLDH-RNFDNDRNSA-N cesium-137 Chemical compound [137Cs] TVFDJXOCXUVLDH-RNFDNDRNSA-N 0.000 description 1
- 229960005395 cetuximab Drugs 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 229910052804 chromium Inorganic materials 0.000 description 1
- 239000011651 chromium Substances 0.000 description 1
- 230000007665 chronic toxicity Effects 0.000 description 1
- 231100000160 chronic toxicity Toxicity 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 238000002711 conventional external beam radiation therapy Methods 0.000 description 1
- 229910052802 copper Inorganic materials 0.000 description 1
- 239000010949 copper Substances 0.000 description 1
- 230000003436 cytoskeletal effect Effects 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 239000000890 drug combination Substances 0.000 description 1
- 238000009509 drug development Methods 0.000 description 1
- 235000013601 eggs Nutrition 0.000 description 1
- 230000005611 electricity Effects 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 230000003028 elevating effect Effects 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 210000003238 esophagus Anatomy 0.000 description 1
- 238000010195 expression analysis Methods 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 239000010200 folin Substances 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 238000002825 functional assay Methods 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 230000003463 hyperproliferative effect Effects 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 238000012744 immunostaining Methods 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- ZCYVEMRRCGMTRW-YPZZEJLDSA-N iodine-125 Chemical compound [125I] ZCYVEMRRCGMTRW-YPZZEJLDSA-N 0.000 description 1
- 229940044173 iodine-125 Drugs 0.000 description 1
- GKOZUEZYRPOHIO-IGMARMGPSA-N iridium-192 Chemical compound [192Ir] GKOZUEZYRPOHIO-IGMARMGPSA-N 0.000 description 1
- 210000000867 larynx Anatomy 0.000 description 1
- 230000002045 lasting effect Effects 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 201000005296 lung carcinoma Diseases 0.000 description 1
- 210000004324 lymphatic system Anatomy 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- IZAGSTRIDUNNOY-UHFFFAOYSA-N methyl 2-[(2,4-dioxo-1h-pyrimidin-5-yl)oxy]acetate Chemical compound COC(=O)COC1=CNC(=O)NC1=O IZAGSTRIDUNNOY-UHFFFAOYSA-N 0.000 description 1
- 238000011294 monotherapeutic Methods 0.000 description 1
- 210000000214 mouth Anatomy 0.000 description 1
- XJVXMWNLQRTRGH-UHFFFAOYSA-N n-(3-methylbut-3-enyl)-2-methylsulfanyl-7h-purin-6-amine Chemical compound CSC1=NC(NCCC(C)=C)=C2NC=NC2=N1 XJVXMWNLQRTRGH-UHFFFAOYSA-N 0.000 description 1
- MDJFHRLTPRPZLY-UHFFFAOYSA-N nimorazole Chemical compound [O-][N+](=O)C1=CN=CN1CCN1CCOCC1 MDJFHRLTPRPZLY-UHFFFAOYSA-N 0.000 description 1
- 229960004918 nimorazole Drugs 0.000 description 1
- 210000003300 oropharynx Anatomy 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- KDLHZDBZIXYQEI-OIOBTWANSA-N palladium-103 Chemical compound [103Pd] KDLHZDBZIXYQEI-OIOBTWANSA-N 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 201000002524 peritoneal carcinoma Diseases 0.000 description 1
- 210000001539 phagocyte Anatomy 0.000 description 1
- 239000002831 pharmacologic agent Substances 0.000 description 1
- 150000004713 phosphodiesters Chemical class 0.000 description 1
- PTMHPRAIXMAOOB-UHFFFAOYSA-N phosphoramidic acid Chemical compound NP(O)(O)=O PTMHPRAIXMAOOB-UHFFFAOYSA-N 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 239000002534 radiation-sensitizing agent Substances 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000002629 repopulating effect Effects 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 102200153332 rs116840818 Human genes 0.000 description 1
- 102220042944 rs117812409 Human genes 0.000 description 1
- 102200025792 rs179363886 Human genes 0.000 description 1
- 102220024927 rs199472833 Human genes 0.000 description 1
- 102200145334 rs2274084 Human genes 0.000 description 1
- 102200121507 rs587777568 Human genes 0.000 description 1
- KJTLSVCANCCWHF-BKFZFHPZSA-N ruthenium-106 Chemical compound [106Ru] KJTLSVCANCCWHF-BKFZFHPZSA-N 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 238000007493 shaping process Methods 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 230000008054 signal transmission Effects 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 238000009097 single-agent therapy Methods 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 210000004872 soft tissue Anatomy 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 230000010473 stable expression Effects 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000005846 sugar alcohols Polymers 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 231100000057 systemic toxicity Toxicity 0.000 description 1
- 230000002123 temporal effect Effects 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-K thiophosphate Chemical compound [O-]P([O-])([O-])=S RYYWUUFWQRZTIU-UHFFFAOYSA-K 0.000 description 1
- 210000002105 tongue Anatomy 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000005026 transcription initiation Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000010474 transient expression Effects 0.000 description 1
- 206010044412 transitional cell carcinoma Diseases 0.000 description 1
- 208000016525 transitional cell neoplasm Diseases 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 210000004981 tumor-associated macrophage Anatomy 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- WCNMEQDMUYVWMJ-JPZHCBQBSA-N wybutoxosine Chemical compound C1=NC=2C(=O)N3C(CC([C@H](NC(=O)OC)C(=O)OC)OO)=C(C)N=C3N(C)C=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O WCNMEQDMUYVWMJ-JPZHCBQBSA-N 0.000 description 1
- 229940075420 xanthine Drugs 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K41/00—Medicinal preparations obtained by treating materials with wave energy or particle radiation ; Therapies using these preparations
- A61K41/0038—Radiosensitizing, i.e. administration of pharmaceutical agents that enhance the effect of radiotherapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1774—Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
- A61N5/00—Radiation therapy
- A61N5/10—X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy
- A61N5/1077—Beam delivery systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
- A61N5/00—Radiation therapy
- A61N5/10—X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy
- A61N2005/1092—Details
- A61N2005/1098—Enhancing the effect of the particle by an injected agent or implanted device
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61N—ELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
- A61N5/00—Radiation therapy
- A61N5/10—X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Zoology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Biomedical Technology (AREA)
- Cell Biology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Pathology (AREA)
- Radiology & Medical Imaging (AREA)
- Toxicology (AREA)
- Marine Sciences & Fisheries (AREA)
- Hematology (AREA)
- Oncology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
This patent application relates to the treatment of cancer and other diseases that have a CD47+ phenotype. Treatment involves the use of radiation and a CD47 -binding agent, preferably a CD47-binding form of human signal regulatory protein alpha (SIRPa) that inhibits activation of the CD47/ SIRPa axis and mediates phagocytosis of CD47+ disease cells. An anti-cancer effect of a CD47 blocking agent is enhanced when combined with radiation therapy. The anti-cancer effect of a CD47 blocking agent such as SIRPaFc is enhanced when combined with radiation therapy.
Description
Field [001] This disclosure relates to the treatment of cancer and other disease cells that have a CD47+ phenotype. Treatment involves the use of radiation and a CD47-binding form of human signal regulatory protein alpha (SIRPa) that inhibits activation of the CD47/SIRPa axis and mediates phagocytosis of the CD47+ disease cells.
Incorporation by Reference of Materials Submitted Electronically
Incorporation by Reference of Materials Submitted Electronically
[002] This application contains, as a separate part of the disclosure, a Sequence Listing in computer readable form (Filename: 5949-P54543PC00_SequenceListing.ta; Size:
27,812 bytes; Created: November 5, 2018).
Backaround
27,812 bytes; Created: November 5, 2018).
Backaround
[003] CD47 is an immune checkpoint that binds to signal regulatory protein alpha (SIRPa) and delivers a "do not eat" signal to suppress macrophage phagocytosis. Tumor cells frequently overexpress CD47 to evade macrophage-mediated destruction.
Trillium's W02014/094122 describes a protein drug that inhibits the interaction between CD47 and SIRPa. This CD47 blocking agent is a foal' of human SIRPa that incorporates a particular region of its extracellular domain linked with a particularly useful form of an IgG1 -based Fc region. A related form of SIRPa having an IgG4-based Fc region is also described. In these forms, SIRPaFc shows dramatic effects on the viability of cancer cells that present with a CD47+ phenotype. The effect is seen particularly on acute myelogenous leukemia (AML) cells, and on many other types of cancer. A soluble folin of SIRP having significantly altered primary structure and enhanced CD47 binding affinity is described in W02013/109752.
Trillium's W02014/094122 describes a protein drug that inhibits the interaction between CD47 and SIRPa. This CD47 blocking agent is a foal' of human SIRPa that incorporates a particular region of its extracellular domain linked with a particularly useful form of an IgG1 -based Fc region. A related form of SIRPa having an IgG4-based Fc region is also described. In these forms, SIRPaFc shows dramatic effects on the viability of cancer cells that present with a CD47+ phenotype. The effect is seen particularly on acute myelogenous leukemia (AML) cells, and on many other types of cancer. A soluble folin of SIRP having significantly altered primary structure and enhanced CD47 binding affinity is described in W02013/109752.
[004] Other CD47 blockade drugs have been described in the literature and these include various CD47 antibodies (see for instance Stanford's U58562997, and InhibRx' W02014/123580), each comprising different antigen binding sites but having, in common, the ability to compete with endogenous SIRPa for binding to CD47, thereby to allow interaction with macrophages and, ultimately, to increase the rate of CD47+
cancer cell depletion. These CD47 antibodies have activities in vivo that are quite different from those intrinsic to SIRPa-based drugs. The latter, for instance, display negligible binding to red blood cells whereas the opposite property in CD47 antibodies creates a need for strategies that accommodate the drug "sink" that follows administration.
Date Recue/Date Received 2024-02-28
cancer cell depletion. These CD47 antibodies have activities in vivo that are quite different from those intrinsic to SIRPa-based drugs. The latter, for instance, display negligible binding to red blood cells whereas the opposite property in CD47 antibodies creates a need for strategies that accommodate the drug "sink" that follows administration.
Date Recue/Date Received 2024-02-28
[005] Still other agents are proposed for use in blocking the CD47/SIRPa axis.
These include CD47Fc proteins (see Viral Logic's W02010/083253), and SIRPa, antibodies as described in UHN's W02013/056352, Stanford's W02016/022971, Eberhard's US
6913894, and elsewhere.
These include CD47Fc proteins (see Viral Logic's W02010/083253), and SIRPa, antibodies as described in UHN's W02013/056352, Stanford's W02016/022971, Eberhard's US
6913894, and elsewhere.
[006] The CD47 blockade approach in anti-cancer drug development shows great promise. It would be useful to provide methods and means for improving the effect of these drugs, and in particular for improving the effect of the CD47 blockade drugs, especially those that incorporate SIRPa.
Summary
Summary
[007] It has been determined that the anti-cancer benefit of radiation therapy is enhanced when combined with an inhibitor of the SIRPa/CD47 axis, and particularly when such treatment uses a combination of radiation therapy and a CD47 blocking agent that is or comprises a CD47-binding form of SIRPa. This combination therapy is useful to control the vitality, growth and/or proliferation of CD47+ disease cells, such as CD47+
cancer cells that include solid cancers such as ovarian cancers and lung cancers, and blood cancers such as leukemias, lymphomas, myelomas, and the like. The two treatment modalities cooperate in their effects on cancer cells, and can result in the depletion of more cancer cells than can be accounted for by their individual effects.
cancer cells that include solid cancers such as ovarian cancers and lung cancers, and blood cancers such as leukemias, lymphomas, myelomas, and the like. The two treatment modalities cooperate in their effects on cancer cells, and can result in the depletion of more cancer cells than can be accounted for by their individual effects.
[008] In one aspect, there is provided a method for treating CD47+ disease cells in a subject in need thereof, comprising administering to the subject, in a treatment-effective combination, (1) radiation therapy, and (2) a CD47 blocking agent that comprises a CD47-binding form of human SIRPa.
[009] In embodiments, concurrent administration is preferred. In the alternative, CD47 blocking agent is administered to a subject that has received radiation therapy, or a subject that will receive radiation therapy. In consecutive treatment, the effect of one therapy desirably overlaps, within the subject, with the effect of the other therapy.
[0010] In other embodiments, the radiation therapy is provided as external beam radiation. In other embodiments, the CD47 blocking agent is or comprises an Fc fusion of a CD47-binding form of SIRPa. In specific embodiments, the Fc fusion can be an IgG1 fusion, an IgG4 fusion, or an IgG fusion that is altered to reduce or eliminate effector function.
[0011] In other aspects, there is provided the use of radiation therapy in combination with a CD47 blocking agent that is or comprises a CD47-binding form of SIRPa, for the treatment of a subject presenting with a disease comprising CD47+ disease cells.
[0012] In another aspect there is provided an article of manufacture comprising a .. container comprising a CD47-binding form of SIRPa in an amount suitable for dosing a subject undergoing CD47+ disease therapy, wherein the article or the container comprises instruction to use said SIRPcc in combination with radiation therapy.
[0013] Many of the CD47 blockade drugs described herein are polypeptides. Another aspect of this disclosure relates to use of a polynucleotide (nucleic acid) that comprises a io nucleotide sequence encoding the CD47 blockade drug (and/or a vector and/or a host cell comprising such polynucleotide) to effectively deliver the CD47 blockade drug to the subject.
Exemplary nucleic acids include DNA and RNA. Relatedly, the invention includes synthetic genes that comprise said coding sequences and one or more expression control sequences, such as promoters, start codons, or polyadenylation signal sequences. The invention also includes vectors that comprise the nucleic acids or synthetic genes, and isolated cells transformed or transfected with the genes or vectors. The disclosure contemplates use of any of the foregoing (including compositions comprising the foregoing) as part of a combination therapy with radiation therapy.
Exemplary nucleic acids include DNA and RNA. Relatedly, the invention includes synthetic genes that comprise said coding sequences and one or more expression control sequences, such as promoters, start codons, or polyadenylation signal sequences. The invention also includes vectors that comprise the nucleic acids or synthetic genes, and isolated cells transformed or transfected with the genes or vectors. The disclosure contemplates use of any of the foregoing (including compositions comprising the foregoing) as part of a combination therapy with radiation therapy.
[0014] Other features and advantages of the present disclosure will become apparent .. from the following detailed description. It should be understood, however, that the detailed description and the specific examples while indicating preferred embodiments of the disclosure are given by way of illustration only, since various changes and modifications within the spirit and scope of the disclosure will become apparent to those skilled in the art from this detailed description.
Reference to the Drawin 2S
Reference to the Drawin 2S
[0015] Figure 1:
VPD450 labelled SU-DHL-6 were irradiated with 2 Gy and co-cultured with normal donor derived polarized macrophages: MO (no priming), MI (IFN-y), M2a (IL-4), M2b (HAGG-1-IL-10), and M2C (IL-10+TGFr3) in the presence of isotype control human IgGlFc or SIRPaFc (SEQ#25). Phagocytosis is reported as the percent of maximum phagocytosis for each macrophage subtype.
VPD450 labelled SU-DHL-6 were irradiated with 2 Gy and co-cultured with normal donor derived polarized macrophages: MO (no priming), MI (IFN-y), M2a (IL-4), M2b (HAGG-1-IL-10), and M2C (IL-10+TGFr3) in the presence of isotype control human IgGlFc or SIRPaFc (SEQ#25). Phagocytosis is reported as the percent of maximum phagocytosis for each macrophage subtype.
[0016] Figures 2A-2J:
NOD/SCID mice were implanted subcutaneously with SU-DHL-6 (human B lymphoma) or A549 (human lung carcinoma) cells and treated with intratumoural SIRPaFc, localized irradiation (IR, 225 kVp, 13 mA) to the tumor sites, or IR+SIRPaFc. Mean tumor growth is shown in Figure 2A and spider plots are shown in Figures 2B-2E (for an SU-DHL-6 model).
Mean tumor growth is shown in Figure 2F and spider plots are shown in Figures 2G-2J (for an A549 model). P values are in comparison to the PBS control groups (**, p<0.01, ***
p<0.001). No toxicity was observed for all treatment groups as measured by body weight change.
NOD/SCID mice were implanted subcutaneously with SU-DHL-6 (human B lymphoma) or A549 (human lung carcinoma) cells and treated with intratumoural SIRPaFc, localized irradiation (IR, 225 kVp, 13 mA) to the tumor sites, or IR+SIRPaFc. Mean tumor growth is shown in Figure 2A and spider plots are shown in Figures 2B-2E (for an SU-DHL-6 model).
Mean tumor growth is shown in Figure 2F and spider plots are shown in Figures 2G-2J (for an A549 model). P values are in comparison to the PBS control groups (**, p<0.01, ***
p<0.001). No toxicity was observed for all treatment groups as measured by body weight change.
[0017] Figure 3:
The percent of macrophages of total number of cells at the tumor sites following treatment in the SU-DHL-6 model, measured by immunohistochemistry (IHC). Tumor tissues were collected when the animals reached their ethical endpoint (a tumor size exceeding 1.5 cm in any dimension) or on day 33 as shown in Figures 2B-2E.
The percent of macrophages of total number of cells at the tumor sites following treatment in the SU-DHL-6 model, measured by immunohistochemistry (IHC). Tumor tissues were collected when the animals reached their ethical endpoint (a tumor size exceeding 1.5 cm in any dimension) or on day 33 as shown in Figures 2B-2E.
[0018] Figures 4A-4I:
NOD/SCID mice with palpable SU-DHL-6 tumors were treated with IR and SIRPaFc in a sequential manner or concurrent administration.
(Figure 4A) Mean growth of SU-DHL-6 tumors in 8 treatment groups.
(Figures 4B-4I) Tumor growth spider plots of individual animals. P values are in comparison to the week 1 IR week 2 PBS group (*, p<0.05, **, p<0.01)
NOD/SCID mice with palpable SU-DHL-6 tumors were treated with IR and SIRPaFc in a sequential manner or concurrent administration.
(Figure 4A) Mean growth of SU-DHL-6 tumors in 8 treatment groups.
(Figures 4B-4I) Tumor growth spider plots of individual animals. P values are in comparison to the week 1 IR week 2 PBS group (*, p<0.05, **, p<0.01)
[0019] Figure 5:
NOD/SCID mice were implanted intraperitoneally (IP) with luciferase expressing cells, which were either BRCA competent (SKOV-3 Luc+BRCA+) or BRCA knockdown (SKOV-3 Luc+BRCA-). Mice were randomized using bioluminescence imaging (BLI) on day 6 following tumor inoculation. Treatment was initiated on day 7, which include (1) vehicle control, (2) SIRPaFc (10 mg/kg, 3 times/week, 3 weeks), (3) whole abdomen IR (2 fractions of 2 Gy on days 7 and 10, 4x4 cm collimator, 225 kVp, 13 mA), and (4) IR+SIRPaFc. (A) survival of mice bearing SKOV-3 Luc+BRCA+ tumors, (B) survival of mice bearing SKOV-3 Luc+BRCA- tumors. Median survival was indicated in the parentheses. The combination of IR and SIRPaFc resulted in significantly improved animal survival as compared to vehicle control in both tumor models.
Detailed Description
NOD/SCID mice were implanted intraperitoneally (IP) with luciferase expressing cells, which were either BRCA competent (SKOV-3 Luc+BRCA+) or BRCA knockdown (SKOV-3 Luc+BRCA-). Mice were randomized using bioluminescence imaging (BLI) on day 6 following tumor inoculation. Treatment was initiated on day 7, which include (1) vehicle control, (2) SIRPaFc (10 mg/kg, 3 times/week, 3 weeks), (3) whole abdomen IR (2 fractions of 2 Gy on days 7 and 10, 4x4 cm collimator, 225 kVp, 13 mA), and (4) IR+SIRPaFc. (A) survival of mice bearing SKOV-3 Luc+BRCA+ tumors, (B) survival of mice bearing SKOV-3 Luc+BRCA- tumors. Median survival was indicated in the parentheses. The combination of IR and SIRPaFc resulted in significantly improved animal survival as compared to vehicle control in both tumor models.
Detailed Description
[0020] The present treatment method combines a CD47 blocking agent, and radiation therapy, thereby improving the efficacy with which CD47+ disease cells and tumours are treated.
[0021] Improved efficacy can manifest as a less-than-additive effect, wherein the effect of the combination is greater than the effect of each component alone, but less than the sum of the effects of both components, or it may be an additive effect, wherein the effect of the combination is equivalent to the sum of the effects of the components when used individually, or it may be a greater-than-additive effect, wherein the effect of the combination 3.0 is greater than the sum of the effects of each component used alone.
Greater-than-additive effects may also be described as synergistic. The improved efficacy of the combination can be determined by a number of methods known in the art. Improved efficacy can result in a statistically significant increase in the ability of the combination to inhibit the growth or proliferation or vitality of CD47+ disease cells when compared to the effect of each component alone. In embodiments, the effect is a greater than additive effect.
Thus a treatment effective amount or dose of IR with SIRPaFc is preferably an amount or dose of the combination that gives an additive or greater than additive effect on the vitality of CD47+
disease cells, or on any other treatment-relevant parameter.
Greater-than-additive effects may also be described as synergistic. The improved efficacy of the combination can be determined by a number of methods known in the art. Improved efficacy can result in a statistically significant increase in the ability of the combination to inhibit the growth or proliferation or vitality of CD47+ disease cells when compared to the effect of each component alone. In embodiments, the effect is a greater than additive effect.
Thus a treatment effective amount or dose of IR with SIRPaFc is preferably an amount or dose of the combination that gives an additive or greater than additive effect on the vitality of CD47+
disease cells, or on any other treatment-relevant parameter.
[0022] An agent that has CD47 blocking activity is an agent that interferes with and dampens or blocks signal transmission that results when CD47 interacts with macrophage-presented SIRPa. CD47-binding forms of human SIRPa are the preferred CD47 blocking agents for use in the combination herein disclosed. These agents are based on the extracellular region of human SIRPa. They comprise at least a part of the extracellular region of human SIRPa effective for CD47 binding affinity and specificity.
CD47-binding forms of SIRPa include those SIRPa forms that lack the membrane anchoring component of SIRPa and/or the intracellular region of SIRPa. Different types of these useful forms of SIRPa are described in the literature and include those referenced in Novartis' WO
2010/070047, Stanford's W02013/109752, and Trillium Therapeutics' W02014/094122 (see also US 9,969,789), as well as bispecific forms of these.
CD47-binding forms of SIRPa include those SIRPa forms that lack the membrane anchoring component of SIRPa and/or the intracellular region of SIRPa. Different types of these useful forms of SIRPa are described in the literature and include those referenced in Novartis' WO
2010/070047, Stanford's W02013/109752, and Trillium Therapeutics' W02014/094122 (see also US 9,969,789), as well as bispecific forms of these.
[0023] In a preferred embodiment, the CD47-binding form of SIRPa is an Fc fusion.
More particularly, the CD47 blocking agent suitably comprises the human SIRPa protein, in a form fused directly, or indirectly, with an antibody constant region, or Fc (fragment crystallisable) Unless otherwise stated, the term "human SIRPa." as used herein refers to a wild type, endogenous, mature form of human SIRPa. In humans, the SIRPa protein is found in two major forms. One form, the variant 1 or V1 form, has the amino acid sequence set out as NCBI RefSeq NP_542970.1 (residues 27-504 constitute the mature form).
Another form, the variant 2 or V2 form, differs by 13 amino acids and has the amino acid sequence set out in GenBank as CAA71403.1 (residues 30-504 constitute the mature form). These two forms of SIRPa constitute about 80% of the forms of SIRPa present in humans, and both are embraced herein by the term "human SIRPa". Also embraced by the term "human SIRPa"
are the minor forms thereof that are endogenous to humans and have the same property of triggering signal transduction through CD47 upon binding thereto. The present disclosure is directed most preferably to the drug combinations that include the human SIRP
variant 2 form, or V2.
More particularly, the CD47 blocking agent suitably comprises the human SIRPa protein, in a form fused directly, or indirectly, with an antibody constant region, or Fc (fragment crystallisable) Unless otherwise stated, the term "human SIRPa." as used herein refers to a wild type, endogenous, mature form of human SIRPa. In humans, the SIRPa protein is found in two major forms. One form, the variant 1 or V1 form, has the amino acid sequence set out as NCBI RefSeq NP_542970.1 (residues 27-504 constitute the mature form).
Another form, the variant 2 or V2 form, differs by 13 amino acids and has the amino acid sequence set out in GenBank as CAA71403.1 (residues 30-504 constitute the mature form). These two forms of SIRPa constitute about 80% of the forms of SIRPa present in humans, and both are embraced herein by the term "human SIRPa". Also embraced by the term "human SIRPa"
are the minor forms thereof that are endogenous to humans and have the same property of triggering signal transduction through CD47 upon binding thereto. The present disclosure is directed most preferably to the drug combinations that include the human SIRP
variant 2 form, or V2.
[0024] In the present treatment combination, useful SIRPaFc fusion proteins comprise one of the three so-called immunoglobulin (Ig) domains that lie within the extracellular region of human SIRPa. More particularly, the present SIRPaFc proteins .. incorporate residues 32-137 of human SIRPa (a 106-mer), which constitute and define the IgV domain of the V2 form according to current nomenclature. This SIRPa sequence, shown below, is referenced herein as SEQ ID NO: 1.
EELQV IQPDKS V SVAAGES AILHC TV TS LIPV GP IQWFRGAGPAREL IYNQKEGHFPRV
TTVSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGA (SEQ ID NO: 1)
EELQV IQPDKS V SVAAGES AILHC TV TS LIPV GP IQWFRGAGPAREL IYNQKEGHFPRV
TTVSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGA (SEQ ID NO: 1)
[0025] In a preferred embodiment, the SIRPaFc fusion protein incorporates the IgV
domain as defined by SEQ ID NO: 1, and additional, flanking residues contiguous within the SIRPa sequence. This preferred form of the IgV domain, represented by residues 31-148 of the V2 form of human SIRPa, is a 118-mer having SEQ ID NO: 2 shown below:
EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPR
VTTVSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPS
(SEQ ID NO: 2)
domain as defined by SEQ ID NO: 1, and additional, flanking residues contiguous within the SIRPa sequence. This preferred form of the IgV domain, represented by residues 31-148 of the V2 form of human SIRPa, is a 118-mer having SEQ ID NO: 2 shown below:
EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPR
VTTVSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPS
(SEQ ID NO: 2)
[0026] A SIRPa fusion protein can incorporate an Fc region having effector function.
Fc refers to "fragment crystallisable" and represents the constant region of an antibody comprised principally of the heavy chain constant region and components within the hinge region. Suitable Fc components thus are those having effector function. An Fc component "having effector function" is an Fc component having at least some effector function, such as at least some contribution to antibody-dependent cellular cytotoxicity or some ability to fix complement. Also, the Fc will at least bind to Fc receptors. These properties can be revealed using assays established for this purpose. Functional assays include the standard chromium release assay that detects target cell lysis. By this definition, an Fc region that is wild type IgG1 or IgG4 has effector function, whereas the Fe region of a human IgG4 mutated to eliminate effector function, such as by incorporation of an alteration series that includes Pro233, Va1234, Ala235 and deletion of Gly236 (EU), is considered not to have effector .. function. In a preferred embodiment, the Fe is based on human antibody of the IgG1 isotype.
In embodiments, the Fe region includes the lower hinge-CH2-CH3 domains.
Fc refers to "fragment crystallisable" and represents the constant region of an antibody comprised principally of the heavy chain constant region and components within the hinge region. Suitable Fc components thus are those having effector function. An Fc component "having effector function" is an Fc component having at least some effector function, such as at least some contribution to antibody-dependent cellular cytotoxicity or some ability to fix complement. Also, the Fc will at least bind to Fc receptors. These properties can be revealed using assays established for this purpose. Functional assays include the standard chromium release assay that detects target cell lysis. By this definition, an Fc region that is wild type IgG1 or IgG4 has effector function, whereas the Fe region of a human IgG4 mutated to eliminate effector function, such as by incorporation of an alteration series that includes Pro233, Va1234, Ala235 and deletion of Gly236 (EU), is considered not to have effector .. function. In a preferred embodiment, the Fe is based on human antibody of the IgG1 isotype.
In embodiments, the Fe region includes the lower hinge-CH2-CH3 domains.
[0027] In a specific embodiment, the Fe region is based on the amino acid sequence of a human IgG1 set out as P01857 in UniProtKB/Swiss-Prot, residues 104-330, and has the amino acid sequence shown below and referenced herein as SEQ ID NO: 3:
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY
VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE
KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPG
K*
(SEQ ID NO: 3)
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY
VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE
KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPG
K*
(SEQ ID NO: 3)
[0028] Thus, in embodiments, the Fe region has either a wild type or consensus sequence of an IgG1 constant region. In alternative embodiments, the Fe region incorporated in the fusion protein is derived from any IgG1 antibody having a typical effector-active constant region. The sequences of such Fe regions can correspond, for example, with the Fe regions of any of the following IgG1 sequences (all referenced from GenBank), for example:
BAG65283 (residues 242-473)õ BAC04226.1 (residues 247-478), BAC05014.1 (residues 240-471), CAC20454.1 (residues 99-320), BAC05016.1 (residues 238-469), BAC85350.1 (residues 243-474), BAC85529.1 (residues 244-475), and BAC85429.1 (residues (238-469).
BAG65283 (residues 242-473)õ BAC04226.1 (residues 247-478), BAC05014.1 (residues 240-471), CAC20454.1 (residues 99-320), BAC05016.1 (residues 238-469), BAC85350.1 (residues 243-474), BAC85529.1 (residues 244-475), and BAC85429.1 (residues (238-469).
[0029] In the alternative, the Fe region can be a wild type or consensus sequence of an IgG2 or IgG3 sequence, examples thereof being shown below:
a human IgG2, for example:
APPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNA
KTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPR
EP QVYTLPP SREEMTKNQVS LTC LVKGFYP SDISVEWESNGQPENNYKTTPPMLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO:
4), as comprised in P01859 of the UniProtKB/Swiss-Prot database;
a human IgG3, for example:
APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA
KTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPR
EP QVYTLP P SREEMTKN QV S LTC LVKGFYP S DIAVEWES S GQP ENNYNTTP P MLD SD
GSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK (SEQ ID NO: 5), as comprised in P01860 of the UniProtKB/Swiss-Prot database;
a human IgG2, for example:
APPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNA
KTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPR
EP QVYTLPP SREEMTKNQVS LTC LVKGFYP SDISVEWESNGQPENNYKTTPPMLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO:
4), as comprised in P01859 of the UniProtKB/Swiss-Prot database;
a human IgG3, for example:
APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNA
KTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPR
EP QVYTLP P SREEMTKN QV S LTC LVKGFYP S DIAVEWES S GQP ENNYNTTP P MLD SD
GSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK (SEQ ID NO: 5), as comprised in P01860 of the UniProtKB/Swiss-Prot database;
[0030] In other embodiments, the Fc region has a sequence of a wild type human IgG4 constant region. In alternative embodiments, the Fc region incorporated in the fusion protein is derived from any IgG4 antibody having a constant region with effector activity that is present but, naturally, is significantly less potent than the IgG1 Fc region, The sequences of such Fc regions can correspond, for example, with the Fc regions of any of the following IgG4 sequences: P01861 (residues 99-327) from UniProtKB/Swiss-Prot and CAC20457.1 (residues 99-327) from GenBank.
[0031] In a specific embodiment, the Fc region is based on the amino acid sequence of a human IgG4 set out as P01861 in UniProtKB/Swiss-Prot, residues 99-327, and has the amino acid sequence shown below and referenced herein as SEQ ID NO: 6:
ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFN
WYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSS
IEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN
NYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFS CS VMHEALHNHYTQKSLS LSL
GK (SEQ ID NO: 6)
ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFN
WYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSS
IEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN
NYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFS CS VMHEALHNHYTQKSLS LSL
GK (SEQ ID NO: 6)
[0032] In embodiments, the Fc region incorporates one or more alterations; usually not more than about 10, e.g., up to 5 such alterations, including amino acid substitutions that affect certain Fc properties. In one specific and preferred embodiment, the Fc region incorporates an alteration at position 228 (EU numbering), in which the serine at this position is substituted by a proline (5228P), thereby to stabilize the disulfide linkage within the Fc dimer. Other alterations within the Fc region can include substitutions that alter glycosylation, such as substitution of Asn297 by glycine or alanine; half-life enhancing alterations such as T252L, T2535, and T256F as taught in US62777375, and many others.
Particularly useful are those alterations that enhance Fc properties while remaining silent with respect to conformation, e.g., retaining Fc receptor binding.
Particularly useful are those alterations that enhance Fc properties while remaining silent with respect to conformation, e.g., retaining Fc receptor binding.
[0033] In a specific embodiment, and in the case where the Fc component is an IgG4 Fc, the Fc incorporates at least the 5228P mutation, and has the amino acid sequence set out below and referenced herein as SEQ ID NO: 7:
ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFN
WYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSS
IEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN
GK
(SEQ ID NO: 7) 100341 The CD47 blocking agent used in the treatment combination is thus preferably a SIRP fusion protein useful to inhibit the binding of human SIRPa and human CD47, thereby to inhibit or reduce transmission of the signal mediated via SIRPa-bound CD47, the fusion protein comprising a human SIRPa component and, fused therewith, an Fc component, wherein the SIRPa component comprises or consists of a single IgV domain of human SIRPa V2 and the Fc component is the constant region of a human IgG having effector function.
100351 In one embodiment, the CD47 blocking agent comprises a SIRPa component consisting at least of residues 32-137 of the V2 form of wild type human SIRPa, i.e., SEQ ID
NO: 1. In a preferred embodiment, the SIRPa component consists of residues 31-148 of the V2 form of human SIRPa, i.e., SEQ ID NO: 2. In another embodiment, the Fc component is the Fc component of the human IgG1 designated P01857, and in a specific embodiment has the amino acid sequence that incorporates the lower hinge-CH2-CH3 region thereof i.e., SEQ
ID NO: 3.
100361 In a preferred embodiment, therefore, the SIRPaFc fusion protein is provided and used in a secreted dimeric fusion form, wherein the fusion protein incorporates a SIRPa component having SEQ ID NO: 1 and preferably SEQ ID NO: 2 and, fused therewith, an Fc .. region having effector function and having SEQ ID NO: 3. When the SIRPa component is SEQ ID NO: 1, this fusion protein comprises SEQ ID NO: 8, shown below:
EELQVIQPDKSV SVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPRV
TTV SESTKRENMDF SI SISNITP ADA GTYY CV KFRKGSPDTEFKS GAGTEL SVRAKP SD
KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV
DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKALPAPIEK
TISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGS FFLY SKLTVDKSRWQQGNVF SC SVMHEALHNHYTQKSLSLSPGK*
(SEQ ID NO: 8) 100371 When the SIRPa component is SEQ ID NO: 2, this fusion protein comprises SEQ ID NO: 9, (also referred to herein as TTI-621) shown below:
EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPR
VTTVSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPS
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY
VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE
KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPG
K (SEQ ID NO: 9). This is also referred to herein as TTI-621 and as SIRPaFc in the examples.
[0038] In alternative embodiments, the Fc component of the fusion protein is based on an IgG4, and preferably an IgG4 that incorporates the S228P mutation. In the case where the fusion protein incorporates the preferred SIRPa IgV domain of SEQ ID NO:
2, the resulting IgG4-based SIRPa-Fc protein has SEQ ID NO 10, shown below (also referred to as TTI-622):
EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPR
VTTVSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPS
ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFN
WYVDGVEVHNAKTKPREEQFNSTYRVV SVLTVLHQDWLNGKEYKCKVSNKGLP S S
IEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN
NYKTTPPVLDSDGSFFLY SRLTVDKSRWQEGNVFS C SVMHEALHNHYTQKSLSLSL
GK (SEQ ID NO: 10) [0039] In preferred embodiment, the fusion protein comprises, as the SIRPa IgV
domain of the fusion protein, a sequence that is SEQ ID NO: 2. A preferred SIRPaFc is SEQ
ID NO: 9. Another preferred SIRPaFc is SEQ ID NO: 10.
[0040] The SIRPa sequence incorporated within the CD47 blocking agent can be varied from the wild type sequence, as described in the literature. That is, useful substitutions within SIRPa include one or more of the following: L4V/I, V61/L, A21V, V271/L, I31T/S/F, E47V/L, K53R, E54Q, H56P/R, 566T/G, K68R, V92I, F94V/L, V63I, and/or F103V
(SEQ
ID NO: 15).
[0041] In embodiments, the CD47 blockade drug is a variant of human SIRPa having higher binding affinity for human CD47 than wild type SIRPa. In a specific embodiment, the variant SIRPa has the sequence:
EEELQIIQPDKSVSVAAGESAILHCTITSLFPVGPIQWFRGAGPARVLIYNQRQGPFPR
VTTVSETTKRENMDFSISISNITPADAGTYYCIKFRKGSPDTEFKSGAGIELSVRAKP
.. (SEQ ID NO: 11) [0042] This SIRPa variant comprises the following amino acid substitutions relative to wild type SIRPa:
V6I + V27I + I31F + E47V + K53R + E54Q + H56P +S66T + V92I. In a specific embodiment, this variant SIRPa sequence can be fused with a mutated IgG4 Fc region including a Ser228Pro (EU) having virtually no effector function, to yield a CD47 blockade drug having the sequence shown in SEQ ID NO: 12:
EEELQIIQPDKSVSVAAGES AILHCTITSLFPVGPIQWFRGAGPARVLIYNQRQGPFPR
VTTVSETTKRENMDFSISISNITPADAGTYYCIKFRKGSPDTEFKSGAGTELSVRAKPS
ES KYGPPCPPCPAPPVAGP SVFLFPP KPKDTLMISRTPEVTCVVVDV SQEDP EVQFNW
YVDGVEVHNAKTKPREEQFNSTYRVVSVUTVLHQDWLNGKEYKCKVSNKGLPS SIE
KTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYP SDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSC SVMHEALHNHYTQKSLSLSLG
K* (SEQ ID NO: 12) [0043] In the SIRPaFc fusion protein, the SIRPa component and the Fc component are fused, either directly or indirectly, to provide a single chain polypeptide that is ultimately produced as a dimer in which the single chain polypeptides are coupled through intrachain .. disulfide bonds formed within the Fc region. The nature of the fusing region is not critical.
The fusion may be direct between the two components, with the SIRP component constituting the N-terminal end of the fusion and the Fc component constituting the C-terminal end. Alternatively, the fusion may be indirect, through a linker comprised of one or more amino acids, desirably genetically encoded amino acids, such as two, three, four, five, six, seven, eight, nine or ten amino acids, or any number of amino acids between 5 and 100 amino acids, such as between 5 and 50, 5 and 30 or 5 and 20 amino acids. A
linker may comprise a peptide that is encoded by DNA constituting a restriction site, such as a BamHI, EcoRI, HindIII, PstI, Sall and XhoI site and the like.
[0044] The linker amino acids typically and desirably have some flexibility to allow the Fc and the SIRP components to adopt their active conformations. Residues that allow for such flexibility typically are Gly, Asn and Ser, so that virtually any combination of these residues (and particularly Gly and Ser) within a linker is likely to provide the desired linking effect. In one example, such a linker is based on the so-called G4S sequence (Gly-Gly-Gly-Gly-Ser, SEQ ID NO: 14) which may repeat as (G4S)n where n is 1, 2, 3 or more, or is based on (Gly)n, (Ser)n, (Ser-Gly)n or (Gly-Ser)n and the like. In another embodiment, the linker is GTELSVRAKPS (SEQ ID NO: 13). This sequence constitutes SIRP a sequence that C-terminally flanks the IgV domain (it being understood that this flanking sequence could be considered either a linker or a different form of the IgV domain when coupled with the IgV
minimal sequence described above). It is necessary only that the fusing region or linker permits the components to adopt their active conformations, and this can be achieved by any form of linker useful in the art.
[0045] As noted, the SIRPaFc fusion is useful to inhibit interaction between SIRPa and CD47, thereby to block signalling across this axis. Stimulation of SIRPa on macrophages by CD47 is known to inhibit macrophage-mediated phagocytosis by deactivating myosin-II and the contractile cytoskeletal activity involved in pulling a target into a macrophage. Activation of this cascade is therefore important for the survival of CD47+ disease cells, and blocking this pathway enables macrophages to eradicate or at least reduce the CD47+ disease cell population.
[0046] For administration, the SIRPaFc is formulated with a pharmaceutically acceptable carrier, and in a therapeutically effective amount.
Pharmaceutically acceptable carriers include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible and useful in the art of protein/antibody formulation. Examples of pharmaceutically acceptable carriers include one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition. Pharmaceutically acceptable carriers may further comprise minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the pharmacological agent. Solutions that are suitable for intravenous administration, such as by injection or infusion, are particularly useful.
[0047] As used herein, -therapeutically effective amount" refers to an amount of the CD47 blocking agent, e.g., SIRPaFc, which is effective, at dosages and for a particular period of time necessary, to achieve the desired therapeutic result.
Similarly, a "medicinally"
useful amount is an amount useful for any medicinal purpose. The SIRPaFc fusion protein can be administered to the subject through any of the routes established for protein delivery, in particular intravenous, intradermal and subcutaneous injection or infusion, or by oral or nasal administration. In one embodiment, the SIRPaFc is administered by injection or infusion directly into the tumour. For administration to a subject presenting with CD47+
disease cells, the dose for the CD47 blockade drug will be within the range from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 mg/kg, of the host body weight. For example dosages can be 0.3 mg/kg body weight, 1 mg/kg body weight, 3 mg/kg body weight, mg/kg body weight or 10 mg/kg body weight or within the range of 0.1 -100 mg/kg. For direct intratumoural injection, a unit dose of 1-5mg is suitable, per tumour.
[0048] The present treatment combination comprises both a CD47 blocking agent that 5 is a CD47-binding form of a SIRPa, as just described, and radiation therapy, known also as radiotherapy or RT. In an embodiment, the RT is external beam radiotherapy (EBR). In an alternative embodiment, the RT is brachytherapy.
[0049] Radiotherapy is the treatment of cancer and other diseases with ionizing radiation. It is a very well established approach to the treatment of numerous types of cancer, and has been refined so that each cancer type typically receives an RT
treatment regimen tailored for that particular cancer. Ionizing radiation deposits energy that injures or destroys cells in the area being treated by damaging their genetic material, making it impossible for these cells to continue to grow. Radiotherapy can be used to treat localized solid tumors, such as cancers of the ovary, prostate, skin, tongue, larynx, brain, breast, or cervix. It can also be used to treat so-called blood cancers including leukemia and lymphoma (cancers of the blood-forming cells and lymphatic system, respectively).
[0050] In an embodiment, the RT is external-beam radiation (EBR) therapy.
Conventional external beam radiation therapy (2DXRT) is delivered via two-dimensional beams using kilovoltage therapy X-ray units or medical linear accelerators which generate high energy x-rays. 2DXRT mainly consists of a single beam of radiation delivered to the patient from several directions: often front or back, and both sides. External-beam radiation therapy is most often delivered in the form of photon beams (either x-rays or gamma rays).
Many types of external-beam radiation therapy are delivered using a linear accelerator that uses electricity to form a stream of fast-moving subatomic particles. Subjects can receive external-beam radiation therapy in daily treatment sessions over the course of several weeks.
The number of treatment sessions depends on many factors, including the total radiation dose that will be given. Another useful type of external-beam radiation therapy is 3-dimensional conformal radiation therapy (3D-CRT). 3D-CRT uses sophisticated computer software and advanced treatment machines to deliver radiation to very precisely shaped target areas.
[0051] Still other methods of external-beam radiation therapy are useful in the present treatment method. These include intensity-modulated radiation therapy (IMRT), which uses hundreds of tiny radiation beam-shaping devices, i.e., collimators, to deliver a dose of radiation. The collimators can be stationary or can move during treatment, allowing the intensity of the radiation beams to change during treatment sessions, so that different areas of a tumor or nearby tissues can be hit with different doses of radiation. IMRT
can be used to increase the radiation dose to treatment areas.
[0052] In use, each of the two treatment modalities in the present method will be utilized as it would be used in monotherapy, i.e., as it would be used independently of its combination with any other agent. Methods of administration and dosing will be consistent with established applications as a monotherapeutic, so that each modality provides, where it can, an anti-cancer benefit that will be enhanced when the modalities are combined in treating a given subject.
[0053] In embodiments, subjects will receive most types of external-beam radiation therapy up to 5 days a week for several weeks. One dose (a single fraction) of the total planned dose of radiation is given each day. Occasionally, two treatments a day are given.
Most types of external-beam radiation therapy are given in once-daily fractions, so that damage to normal tissue is minimized and to increase the likelihood that cancer cells are 1.5 exposed to radiation at the points in the cell cycle when they are most vulnerable to DNA
damage. Fractionation of a dosing schedule is now common, including accelerated fractionation where treatment is given in larger daily or weekly doses to reduce the number of weeks of treatment; hyperfractionation whereby smaller doses of radiation are given more than once a day; and hypofractionation by which larger doses are given once a day or less often to reduce the number of treatments.
[0054] Fractionation regimens are individualised between different radiation therapy centers and even between individual doctors. In North America, Australia, and Europe, the typical fractionation schedule for adults is 1.8 to 2 Gy per day, five days a week. In some cancer types, prolongation of the fraction schedule over too long can allow for the tumor to begin repopulating, and for these tumor types, including head-and-neck and cervical squamous cell cancers, radiation treatment is preferably completed within a certain amount of time. For children, a typical fraction size may be 1.5 to 1.8 Gy per day, as smaller fraction sizes are associated with reduced incidence and severity of late-onset side effects in normal tissues.
[0055] In some cases, two fractions per day are used near the end of a course of treatment. This schedule, known as a concomitant boost regimen or hyperfractionation, is used on tumors that regenerate more quickly when they are smaller. In particular, tumors in the head-and-neck demonstrate this behavior.
[0056]
Hypofractionation is a radiation treatment in which the total dose of radiation is divided into large doses. Typical doses vary significantly by cancer type, from 2.2 Gy/fraction to 20 Gy/fraction. The logic behind hypofractionation is to lessen the possibility of the cancer returning by not giving the cells enough time to reproduce and also to exploit the unique biological radiation sensitivity of some tumors. One commonly treated site where there is very good evidence for such treatment is in breast cancer. Short course hypofractionated treatments over 3-4 weeks e.g. 40 Gy in 15 fractions or 42.5 Gy in 16 fractions, have been shown to be as effective as more protracted 5-6 week treatments with respect to cancer control.
[0057] An alternative fractionation schedule is Continuous Hyperfractionated Accelerated Radiation therapy. CHART is used to treat lung cancer and consists of three smaller fractions per day. Another increasingly well-known alternative fractionation schedule, used to treat breast cancer, is called Accelerated Partial Breast Irradiation (APBI).
APBI can be performed with external beam radiation. APBI involves two high-dose fractions 1.5 per day for five days, compared to whole breast irradiation, in which a single, smaller fraction is given five times a week over a six-to-seven-week period.
[0058]
Thus, for radiotherapy, dosing levels and regimens will be determined by the type, location and stage of cancer being treated. The dose can be photon- or proton-based and expressed either in Roentgens or in Gray units, to indicate the exposed dose (Rn) or the absorbed dose (Gy) of radiation. The Gray is a derived unit of ionizing radiation dose, which is a measure of the amount of radiation energy absorbed by 1 kilogram of human tissue. It is related to the rad, which is 0.01Gy. Generally, appropriate dosing will range from about 1 to about 300 Gy per exposure. Total dosages per exposure can vary from about 1 to about 500 Gy and particularly 40-70Gy.
[0059] By definition, one roentgen of air kerma (kinetic energy released per unit mass) deposits 0.00877 grays (0.877 rads) of absorbed dose in dry air, or 0.0096 Gy (0.96 rad) in soft tissue. One roentgen (air kerma) of X-rays may deposit anywhere from 0.01 to 0.04 Gy (1.0 to 4.0 rad) in bone depending on the beam energy. Dosage ranges for X-rays in the present method range from daily doses of 50 to 200 roentgens as well as all intermediate dosage levels therebetween for prolonged periods of time such as 3 to 4 weeks, to single doses of 2000 to 6000 roentgens (including, but not limited to 2500, 3000, 3500, 4000, 4500, 5000, and 5500 roentgens).
[0060]
External beam radiotherapy schedules used in accordance with the present method can also vary. In certain embodiments, a particular schedule can comprise daily treatments about 5 times per week for about six to about seven weeks or can comprise about twice daily treatments for about two to about three weeks.
[0061] In alternative embodiments, the radiation therapy can be brachytherapy. In brachytherapy, a source of radiation source is placed inside or next to the area requiring treatment. It is used as a treatment particularly for breast, cervical, prostate and skin cancer.
Brachytherapy involves the precise placement of short-range radiation-sources (radioisotopes) directly at the tumour. These are enclosed in a protective capsule or wire, which allows the ionizing radiation to treat and kill surrounding tissue.
[0062] A course of brachytherapy thus begins with placement of the radiation source and ends with its removal or when the source radiation expires. The dose rate of brachytherapy refers to the level or 'intensity' with which the radiation is delivered to the surrounding medium and is expressed in Grays per hour (Gy/h). Low-dose rate (LDR) brachytherapy involves implanting radiation sources that emit radiation at a rate of up to 2 Gy/h. LDR brachytherapy is commonly used for cancers of the oral cavity, oropharynx, sarcomas and prostate. Medium-dose rate (MDR) brachytherapy is characterized by a medium rate of dose delivery, ranging between 2 Gy/h to 12 Gy/h. In high-dose rate (HDR) brachytherapy, the rate of dose delivery exceeds 12 Gy/h. The most common applications of FIDR brachytherapy are in tumours of the cervix, esophagus, lungs, breasts and prostate.
[0063] Pulsed-dose rate (PDR) brachytherapy involves short pulses of radiation, typically once an hour, to simulate the overall rate and effectiveness of LDR
treatment.
Typical tumour sites treated by PDR brachytherapy are gynaecological and head and neck cancers.
[0064] The placement of radiation sources in the target area can be temporary or permanent. Temporary brachytherapy involves placement of radiation sources for a set duration (usually a number of minutes or hours) before being withdrawn.
Treatment duration will depend on many factors, such as the required rate of dose delivery and the type, size and location of the cancer. In LDR and PDR brachytherapy, the source stays in place up to 24 hours and is then removed, while in HDR brachytherapy this time is typically just a few minutes [0065] Permanent brachytherapy, also known as seed implantation, involves placing small LDR radioactive seeds or pellets (about the size of a grain of rice) in the tumour or treatment site and leaving them there permanently to gradually decay. Over a period of weeks or months, the radiation emitted by the sources will decline to almost zero.
The inactive seeds then remain in the treatment site but with no lasting effect.
[0066] Commonly used sources of brachytherapy radiation include Cesium-131, Cesium-137, Cobalt-60, Iridium-192, Iodine-125, Palladium-103, Ruthenium-106 and Radium-226.
[0067] As noted, in the present treatment method, the CD47 blocking agent is a CD47-binding form of human SIRPa that is used in combination with radiation therapy to treat CD47+ diseases and particularly hyperproliferative disease and especially cancer. In terms of an anti-cancer effect, such as a depletion of CD47+ cancer cells, the treatment modalities cooperate to provide an enhanced reduction in cancer cell vitality, activity or mortality. The cooperative or enhanced effect of the combination can also be revealed in the context of other parameters, such as a reduction in cancer cell viability, size, number, or distribution, or improvement in overall burden of a tumour. It can also manifest as an increased infiltration of tumours by macrophages or any other phagocytic cell type.
[0068] The treatment modalities in the present combination can be delivered sequentially or, essentially at the same time, i.e. concurrently. In embodiments, the RT can .. be given before administration of SIRPaFc. In general, the delivery of one modality relative the other in temporal terms refers to the delivery of one modality in terms of one course of treatment, versus the delivery of the other modality in terms of its course of treatment. Thus, concurrent delivery means that courses of treatment overlap, whereas successive delivery means that courses of treatment do not overlap physically.
[0069] In some embodiments, EBR therapy can be administered within about 1-minutes, or 2-48 hours or more prior to and/or after administering the CD47 blocking agent.
In other embodiments, radiation therapy can be administered within from about 1 day to about 21 days prior to and/or after administering the CD47 blocking agent. In some embodiments, the time period for treatment can be extended significantly, however, where several weeks (e.g., about 1, about 2, about 3, about 4, about 5, about 6, about 7, or about 8 weeks or more) lapse between the administration of the CD47 blocking agent and the radiation therapy. It is important only that the effect of one agent is present in the subject when the other agent is administered. It is desirable in one embodiment that the agents are used concurrently and that their activities overlap actively within the subject undergoing treatment. In the context of brachytherapy, the modalities can be used concurrently, meaning that internal radiation is in place during a course of treatment with the CD47-binding agent, or the CD47-binding agent treatment can be administered to a subject that has completed a course of brachytherapy.
[0070] As revealed in the results shown in the Examples herein, it is believed that the benefit of combining radiotherapy and CD47 blockade therapy lies in elevating the number of macrophages that infiltrate tumours to deplete disease cells, with SIPRa-Fc augmenting the anti-tumor immunity induced by RT. The present method thus can be characterized as a method for increasing the number of macrophages present within a tumour, comprising treating the tumour with a combination of SIRPaFc and radiation to cause depletion of disease cells within the tumour.
[0071] In a further aspect, there is provided an article of manufacture containing the SIRPaFc drug in an amount useful for the treatment of the disorders described herein is provided. The article of manufacture comprises the SIRPaFc in a container and further comprises an indication or instruction, such as a label affixed to the container or included with the article that the SIRPaFc is for use in combination with radiation therapy. Suitable containers include, for example, bottles, vials, syringes, and test tubes. The containers may be formed from a variety of materials such as glass or plastic. The container holds a composition which is effective for treating the condition and may have a sterile access port (for example the container may be an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle). The article of manufacture may further comprise a second container comprising a pharmaceutically-acceptable buffer, such as phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other matters desirable from a commercial and use standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.
[0072] The present treatment combination is useful to treat a variety of CD47+
disease cells. These include particularly CD47+ cancer cells, including liquid and solid tumours. The term "CD47+" is used with reference to the phenotype of cells targeted for binding by the CD47 blocking agent. Cells that are CD47+ can be identified by flow cytometry using CD47 antibody as the affinity ligand. CD47 antibodies that are labeled appropriately are available commercially for this use (for example, the antibody product of clone B6H12 is available from eBioscience). The cells examined for CD47 phenotype can include standard tumour biopsy samples including particularly blood samples taken from the subject suspected of harbouring endogenous CD47+ cancer cells. CD47 disease cells of particular interest as targets for therapy with the present fusion proteins are those that "over-express" CD47. These CD47+ cells typically are disease cells, and present CD47 at a density on their surface that exceeds the normal CD47 density for a cell of a given type. CD47 overexpression will vary across different cell types, but is meant herein to refer to any CD47 level that is determined, for instance by flow cytometry as exemplified herein or by immunostaining or by gene expression analysis or the like, to be greater than the level measurable on a counterpart cell having a CD47 phenotype that is normal for that cell type.
[0073] The types of ovarian cancer that can be treated with the present treatment combination include those within the three major categories, according to the kind of cells from which they were formed, i.e., (1) epithelial tumors that arise from cells that line or cover the ovaries; (2) germ cell tumors that originate from cells that are destined to form eggs within the ovaries; and (3) sex cord-stromal cell tumors that begin in the connective cells that io hold the ovaries together and produce female hormones. Also included are tumors that are adjacent to ovarian tissues, such as extraovarian peritoneal carcinoma (intraperitoneal carcinomatosis), the common epithelial tumors including serous, endometrioid, mucinous, and clear cell tumors ____________________________________________________ that include benign (noncancerous) or malignant (cancerous) tumors.
[0074] Also treatable with the present treatment combination are the rare types of ovarian tumours, such as Brenner tumors, undifferentiated tumors, and transitional cell tumors as well as germ cell tumours that are formed from egg-making cells within the ovaries.
[0075] In other embodiments, the treatment combination can be used to inhibit the growth or proliferation of hematological cancers. As used herein, "hematological cancer"
refers to a cancer of the blood, and includes leukemia, lymphoma and myeloma among others. "Leukemia" refers to a cancer of the blood, in which too many white blood cells that are ineffective in fighting infection are made, thus crowding out the other parts that make up the blood, such as platelets and red blood cells. It is understood that cases of leukemia are classified as acute or chronic. Certain forms of leukemia may be, by way of example, acute lymphocytic leukemia (ALL); acute myeloid leukemia (AML); chronic lymphocytic leukemia (CLL); chronic myel og en ous leukemia (CML); my el oproli ferativ e disorder/neoplasm (MPDS); and myelodysplastic syndrome. "Lymphoma" may refer to T
cell lymphoma and B cell lymphoma, Hodgkin's lymphoma, both indolent and aggressive non-Hodgkin's lymphoma, Burkitt's lymphoma, and follicular lymphoma (small cell and large cell), among others. Myeloma may refer to multiple myeloma (MM), giant cell myeloma, heavy-chain myeloma, and light chain or Bence-Jones myeloma.
[0076] In some embodiments, the hematological cancer treated with the treatment combination is a CD47+ leukemia, preferably selected from acute lymphocytic leukemia, acute myeloid leukemia, chronic lymphocytic leukemia, chronic myelogenous leukemia, and myelodysplastic syndrome, preferably, acute myeloid leukemia.
[0077] In other embodiments, the hematological cancer treated with the treatment combination is a CD47+ lymphoma or myeloma selected from a T cell lymphoma including .. cutaneous T cell lymphoma, Sezary Syndrome and mycosis fungoides, Hodgkin's lymphoma, both indolent and aggressive non-Hodgkin's lymphoma, Burkitt's lymphoma, B
cell lymphoma, follicular lymphoma (small cell and large cell), multiple myeloma (MM), giant cell myeloma, heavy-chain myeloma, and light chain or Bence-Jones myeloma as well as leimyosarcoma. In some embodiments, the hematological cancer is diffuse large B-cell .. lymphoma (DLBCL) or peripheral T cell lymphoma (PTCL) [0078] In another embodiment, the treatment combination is used to treat ovarian cancer. In a further embodiment, the combination is used to treat lung cancer.
In another embodiment, the treatment combination is used to treat melanoma.
[0079] It will be appreciated that the radiosensitivity of the cancer can be enhanced by giving certain radiosensitizing drugs during a course of radiation therapy.
Examples of radiosensitizers include: cisplatin, nimorazole, and cetuximab, among many others.
[0080] In some embodiments, the CD47 blockade therapeutic, described herein as a polypeptide (e.g., a fusion protein or an antibody), is administered as a "nucleotide equivalent" (a CD47 blockade polynucleotide) via gene therapy methods. In one embodiment, the CD47 blockade polynucleotide is encoded in a plasmid or vector.
Accordingly, in exemplary aspects, the CD47 blockade peptides are used or administered by way of administering a CD47 blockade nucleic acid comprising a nucleotide sequence encoding a CD47 blockade polypeptide described herein. In exemplary instances, the nucleic acid comprises a nucleotide sequence which encodes any of the CD47 blockade polypeptides described herein. The nucleic acid or polynucleotide generally is a polymer of DNA or RNA, which can be single-stranded or double- stranded, which can contain natural, non-natural, or altered nucleotides, and which can contain a natural, non-natural or altered inter-nucleotide linkage, such as a phosphoroamidate linkage or a phosphorothioate linkage, instead of the phosphodiester found between the nucleotides of an unmodified oligonucleotide.
Exemplary polynucleotide constructs are described in U.S. Patent No. 9,979,789. In some variations, the CD47 blockade polynucleotide (or vector) includes sequence encoding a signal peptide operably linked to sequence encoding the CD47 blockade therapeutic, to direct/facilitate secretion of the CD47 blockade therapeutic from transformed/transfected cells.
Date Recue/Date Received 2024-02-28 [0081] In exemplary aspects, the nucleic acids are constructed based on chemical synthesis and/or enzymatic ligation reactions. See, for example, Sambrook et al., Molecular Cloning: A Laboratory Manual. 3rd ed., Cold Spring Harbor Press, Cold Spring Harbor, N.Y.
2001; and Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, N.Y., 1994. For example, a nucleic acid can be chemically synthesized using naturally occurring nucleotides or modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed upon hybridization (e.g., phosphorothioate derivatives and acridine substituted nucleotides). Examples of modified nucleotides that can be used to generate the nucleic acids include, but are not limited to, 5-fluorouracil, 5-bromouracil, 5-chIorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetyl cy tos ine, 5-(carboxyhydroxymethyl) uracil, 5- carboxymethylaminomethy1-2-thiouridme, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N -substituted adenine, 7-methylguanine, 5-methylammomethyluracil, 5- methoxyarninomethy1-2-thiouracil, beta-D-mannosylqueosine, 5'- methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6-isopentenyladenine, uracil- 5-oxyacetic acid (v), wybutoxosine, pseudouratil, queosine, 2-thiocytosine, 5-methyl-2- thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5-oxyacetic acid methylester, 3- (3-amino-3-N-2-carboxypropyl) uracil, and 2,6-diaminopurine. Nucleic acids can be expanded using both recombinant means and synthetic means (e.g., PC R).
[0082] In some variations, the nucleic acids are incorporated into a vector. As used herein, a "vector" or "expression vector" is any molecule or moiety which transports, transduces or otherwise acts as a carrier of a heterologous molecule such as the nucleic acids encoding a CD47 blockade polypeptide. In exemplary aspects, the vector is a genetically-modified polynucleotide construct that permits the expression of an mRNA, protein, polypeptide, or peptide by a host cell, when the construct comprises a nucleotide sequence encoding the mRNA, protein, polypeptide, or peptide, and the vector is contacted with the cell under conditions sufficient to have the mRNA, protein, polypeptide, or peptide expressed within the cell.
[0083]
Suitable vectors include those designed for propagation and expansion or for expression or both, such as plasmids and viruses. Preferably, the vector is a viral vector, e.g., a retroviral vector. A "viral vector" is a vector which comprises one or more polynucleotide regions encoding or comprising payload molecule of interest, e.g., a transgene, a polynucleotide encoding a polypeptide or multi-polypeptide. In exemplary aspects, the viral vector is a vaccinia virus vector, a poxvirus vector, an adenovirus vector, an adeno-associated virus vector, or a herpes simplex virus vector.
[0084] Desirably, the polynucleotide or vector comprises regulatory sequences, such as transcription and translation initiation and termination codons.
Furthermore, in some variations, a promoter is used that is selective of specific for the types of cells to which the CD47 blockade polynucleotide is to be targeted, or which is inducible, or which is cycle-specific. In some variations, the promoter is a viral promoter, e.g., a cytomegalovirus (CMV) 3.0 promoter, an SV40 promoter, an RSV promoter, CAG promoter and a promoter found in the long-terminal repeat of the murine stem cell virus. The vectors can be designed for transient expression or stable expression. Also, the vectors can be made for constitutive expression or for inducible expression.
[0085] Methods of delivering nucleic acids for expression in cells are known in the art and include for example, lipid delivery using cationic lipids or other chemical methods (e.g., calcium phosphate precipitation, DEAE-dextran, polybrene), electroporation, or viral delivery. See, e.g., Sambrook and Russell, Molecular Cloning: A Laboratory Manual, 3rd ed. Cold Spring Harbor Press, Cold Spring Harbor, NY (2001), Nayerossadat et al., Adv Biomed Res 1: 27 (2012); and Hesier, William (ed.), Gene Delivery to Mammalian Cells, Vol 1., Non-viral Gene Transfer Techniques, Methods in Molecular Biology, Humana Press, (2004).
Examples [0086] The combination of RT and a CD47-blocking agent SIRPaFc (SEQ#9) was examined in xenograft tumor models.
Materials and Methods [0087] The in vivo efficacy of radiation therapy (RT), SIRPaFc, and RTd-SIRPaFc was evaluated in subcutaneous B cell lymphoma (SUDHL-6) and solid tumor xenografts, including the radio-insensitive A549 lung adenocarcinoma (subcutaneous), and ovarian adenocarcinoma (intraperitoneal). For subcutaneous tumor models, SIRPaFc (10 mg/kg) or vehicle was administered intratumourally 30 minutes prior to radiotherapy, 3 times per week for 3-4 weeks. Tumors were locally irradiated using an image-guided small animal irradiator (225 kVp, 13 mA) at a dose of 4-6 Gy for 3 fractions. Tumor volumes were monitored using standard caliper measurement. Tumor-associated macrophages were quantitatively assessed using flow cytometry and immunohistochemistry. For intraperitoneal tumor models of ovarian cancer, SIRPaFc (10 mg/kg) or vehicle was administered intraperitoneally 60 minutes prior to radiotherapy, 3 times per week for 3 weeks. Mice were treated with whole abdomen radiation (WAR) using image-guided X-ray IR.
Briefly, mice were injected intraperitoneally (i.p.) with 100 mg/kg of D-luciferin 5 min prior to BLI
acquisition. The mice were positioned on a stage and imaged by BLI followed by under anesthesia. Superimposed BLI and CT images were used to guide the radiation beam to the abdomen, with all the tumors included in the collimated area (4x4 cm). IR
was conducted at 225kVp and 13 mA with a copper filter. The isocenter of the radiation beam was set at 0.5 cm above the stage. The irradiation regimen was 2 fractions of 2 Gy on days 7 and 10.
Systemic toxicity of the treatments was evaluated by body weight change.
Results 100881 In both SU-DHL-6 and A549 tumor models, RT+SIRPaFc had a more profound effect on tumor control than RT alone. In SU-DHL-6, 88% (7/8) of mice treated with both SIRPaFc and external beam radiation were tumor-free at the end of the study whereas none were tumor-free when treated with RT or SIRPaFc alone, although there was tumor growth delay with each individual therapy compared to vehicle.
RT+SIRPaFc led to an increased infiltration of macrophages at the tumor sites in SU-DHL-6.
Statistically significant tumor control was also observed in A549 tumor bearing mice treated with RT-FSIRPaFc compared to either treatment alone. No toxicity was observed for localized RT
on the tumors and the combination of RT and SIRPaFc. In intraperitoneal tumor models of BRCA competent and knockdown SKOV-3, as measured by animal survival, statistically significant tumor control was achieved by RT+SIRPaFc, compared to vehicle control and RT
alone. As measured by body weight change, no chronic toxicity was observed for whole abdomen RT and its combination with SIRPaFc.
100891 As shown in the Figures, SIRPaFc increases phagocytosis of irradiated tumor cells by macrophages. It also enhances the anti-tumor effect of radiation therapy in xenograft tumor models of SU-DHL-6 (B lymphoma), A549 (lung adenocarcinoma), and BRCA
competent as well as knockdown SKOV-3 (ovarian adenocarcinoma). The combination of SIRPaFc and radiation leads to elevated macrophage infiltration at the tumor sites.
Sequencing of radiation and SIRPaFc impacts the efficacy of treatment, with concurrent SIRPaFc and IR being the most effective, followed by IR administered prior to SIRPaFc, and lastly, SIRPocfc prior to IR. These in vivo results show that concurrent radiation and CD47 blockade using SIRPaFc, e.g. administration of SIRPaFc during a course of radiation, or vice versa, can enhance tumor control and is a viable combination therapy that is superior to either treatment alone in terms of anti-cancer efficacy.
[0090] While the present disclosure has been described with reference to what are presently considered to be the preferred examples, it is to be understood that the disclosure is not limited to the disclosed examples. To the contrary, the disclosure is intended to cover various modifications and equivalent arrangements included within the spirit and scope of the appended claims.
Date Recue/Date Received 2024-02-28
ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFN
WYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSS
IEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN
GK
(SEQ ID NO: 7) 100341 The CD47 blocking agent used in the treatment combination is thus preferably a SIRP fusion protein useful to inhibit the binding of human SIRPa and human CD47, thereby to inhibit or reduce transmission of the signal mediated via SIRPa-bound CD47, the fusion protein comprising a human SIRPa component and, fused therewith, an Fc component, wherein the SIRPa component comprises or consists of a single IgV domain of human SIRPa V2 and the Fc component is the constant region of a human IgG having effector function.
100351 In one embodiment, the CD47 blocking agent comprises a SIRPa component consisting at least of residues 32-137 of the V2 form of wild type human SIRPa, i.e., SEQ ID
NO: 1. In a preferred embodiment, the SIRPa component consists of residues 31-148 of the V2 form of human SIRPa, i.e., SEQ ID NO: 2. In another embodiment, the Fc component is the Fc component of the human IgG1 designated P01857, and in a specific embodiment has the amino acid sequence that incorporates the lower hinge-CH2-CH3 region thereof i.e., SEQ
ID NO: 3.
100361 In a preferred embodiment, therefore, the SIRPaFc fusion protein is provided and used in a secreted dimeric fusion form, wherein the fusion protein incorporates a SIRPa component having SEQ ID NO: 1 and preferably SEQ ID NO: 2 and, fused therewith, an Fc .. region having effector function and having SEQ ID NO: 3. When the SIRPa component is SEQ ID NO: 1, this fusion protein comprises SEQ ID NO: 8, shown below:
EELQVIQPDKSV SVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPRV
TTV SESTKRENMDF SI SISNITP ADA GTYY CV KFRKGSPDTEFKS GAGTEL SVRAKP SD
KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV
DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKALPAPIEK
TISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
KTTPPVLDSDGS FFLY SKLTVDKSRWQQGNVF SC SVMHEALHNHYTQKSLSLSPGK*
(SEQ ID NO: 8) 100371 When the SIRPa component is SEQ ID NO: 2, this fusion protein comprises SEQ ID NO: 9, (also referred to herein as TTI-621) shown below:
EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPR
VTTVSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPS
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY
VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE
KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPG
K (SEQ ID NO: 9). This is also referred to herein as TTI-621 and as SIRPaFc in the examples.
[0038] In alternative embodiments, the Fc component of the fusion protein is based on an IgG4, and preferably an IgG4 that incorporates the S228P mutation. In the case where the fusion protein incorporates the preferred SIRPa IgV domain of SEQ ID NO:
2, the resulting IgG4-based SIRPa-Fc protein has SEQ ID NO 10, shown below (also referred to as TTI-622):
EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPR
VTTVSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPS
ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFN
WYVDGVEVHNAKTKPREEQFNSTYRVV SVLTVLHQDWLNGKEYKCKVSNKGLP S S
IEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN
NYKTTPPVLDSDGSFFLY SRLTVDKSRWQEGNVFS C SVMHEALHNHYTQKSLSLSL
GK (SEQ ID NO: 10) [0039] In preferred embodiment, the fusion protein comprises, as the SIRPa IgV
domain of the fusion protein, a sequence that is SEQ ID NO: 2. A preferred SIRPaFc is SEQ
ID NO: 9. Another preferred SIRPaFc is SEQ ID NO: 10.
[0040] The SIRPa sequence incorporated within the CD47 blocking agent can be varied from the wild type sequence, as described in the literature. That is, useful substitutions within SIRPa include one or more of the following: L4V/I, V61/L, A21V, V271/L, I31T/S/F, E47V/L, K53R, E54Q, H56P/R, 566T/G, K68R, V92I, F94V/L, V63I, and/or F103V
(SEQ
ID NO: 15).
[0041] In embodiments, the CD47 blockade drug is a variant of human SIRPa having higher binding affinity for human CD47 than wild type SIRPa. In a specific embodiment, the variant SIRPa has the sequence:
EEELQIIQPDKSVSVAAGESAILHCTITSLFPVGPIQWFRGAGPARVLIYNQRQGPFPR
VTTVSETTKRENMDFSISISNITPADAGTYYCIKFRKGSPDTEFKSGAGIELSVRAKP
.. (SEQ ID NO: 11) [0042] This SIRPa variant comprises the following amino acid substitutions relative to wild type SIRPa:
V6I + V27I + I31F + E47V + K53R + E54Q + H56P +S66T + V92I. In a specific embodiment, this variant SIRPa sequence can be fused with a mutated IgG4 Fc region including a Ser228Pro (EU) having virtually no effector function, to yield a CD47 blockade drug having the sequence shown in SEQ ID NO: 12:
EEELQIIQPDKSVSVAAGES AILHCTITSLFPVGPIQWFRGAGPARVLIYNQRQGPFPR
VTTVSETTKRENMDFSISISNITPADAGTYYCIKFRKGSPDTEFKSGAGTELSVRAKPS
ES KYGPPCPPCPAPPVAGP SVFLFPP KPKDTLMISRTPEVTCVVVDV SQEDP EVQFNW
YVDGVEVHNAKTKPREEQFNSTYRVVSVUTVLHQDWLNGKEYKCKVSNKGLPS SIE
KTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYP SDIAVEWESNGQPENN
YKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSC SVMHEALHNHYTQKSLSLSLG
K* (SEQ ID NO: 12) [0043] In the SIRPaFc fusion protein, the SIRPa component and the Fc component are fused, either directly or indirectly, to provide a single chain polypeptide that is ultimately produced as a dimer in which the single chain polypeptides are coupled through intrachain .. disulfide bonds formed within the Fc region. The nature of the fusing region is not critical.
The fusion may be direct between the two components, with the SIRP component constituting the N-terminal end of the fusion and the Fc component constituting the C-terminal end. Alternatively, the fusion may be indirect, through a linker comprised of one or more amino acids, desirably genetically encoded amino acids, such as two, three, four, five, six, seven, eight, nine or ten amino acids, or any number of amino acids between 5 and 100 amino acids, such as between 5 and 50, 5 and 30 or 5 and 20 amino acids. A
linker may comprise a peptide that is encoded by DNA constituting a restriction site, such as a BamHI, EcoRI, HindIII, PstI, Sall and XhoI site and the like.
[0044] The linker amino acids typically and desirably have some flexibility to allow the Fc and the SIRP components to adopt their active conformations. Residues that allow for such flexibility typically are Gly, Asn and Ser, so that virtually any combination of these residues (and particularly Gly and Ser) within a linker is likely to provide the desired linking effect. In one example, such a linker is based on the so-called G4S sequence (Gly-Gly-Gly-Gly-Ser, SEQ ID NO: 14) which may repeat as (G4S)n where n is 1, 2, 3 or more, or is based on (Gly)n, (Ser)n, (Ser-Gly)n or (Gly-Ser)n and the like. In another embodiment, the linker is GTELSVRAKPS (SEQ ID NO: 13). This sequence constitutes SIRP a sequence that C-terminally flanks the IgV domain (it being understood that this flanking sequence could be considered either a linker or a different form of the IgV domain when coupled with the IgV
minimal sequence described above). It is necessary only that the fusing region or linker permits the components to adopt their active conformations, and this can be achieved by any form of linker useful in the art.
[0045] As noted, the SIRPaFc fusion is useful to inhibit interaction between SIRPa and CD47, thereby to block signalling across this axis. Stimulation of SIRPa on macrophages by CD47 is known to inhibit macrophage-mediated phagocytosis by deactivating myosin-II and the contractile cytoskeletal activity involved in pulling a target into a macrophage. Activation of this cascade is therefore important for the survival of CD47+ disease cells, and blocking this pathway enables macrophages to eradicate or at least reduce the CD47+ disease cell population.
[0046] For administration, the SIRPaFc is formulated with a pharmaceutically acceptable carrier, and in a therapeutically effective amount.
Pharmaceutically acceptable carriers include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible and useful in the art of protein/antibody formulation. Examples of pharmaceutically acceptable carriers include one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition. Pharmaceutically acceptable carriers may further comprise minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the pharmacological agent. Solutions that are suitable for intravenous administration, such as by injection or infusion, are particularly useful.
[0047] As used herein, -therapeutically effective amount" refers to an amount of the CD47 blocking agent, e.g., SIRPaFc, which is effective, at dosages and for a particular period of time necessary, to achieve the desired therapeutic result.
Similarly, a "medicinally"
useful amount is an amount useful for any medicinal purpose. The SIRPaFc fusion protein can be administered to the subject through any of the routes established for protein delivery, in particular intravenous, intradermal and subcutaneous injection or infusion, or by oral or nasal administration. In one embodiment, the SIRPaFc is administered by injection or infusion directly into the tumour. For administration to a subject presenting with CD47+
disease cells, the dose for the CD47 blockade drug will be within the range from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 mg/kg, of the host body weight. For example dosages can be 0.3 mg/kg body weight, 1 mg/kg body weight, 3 mg/kg body weight, mg/kg body weight or 10 mg/kg body weight or within the range of 0.1 -100 mg/kg. For direct intratumoural injection, a unit dose of 1-5mg is suitable, per tumour.
[0048] The present treatment combination comprises both a CD47 blocking agent that 5 is a CD47-binding form of a SIRPa, as just described, and radiation therapy, known also as radiotherapy or RT. In an embodiment, the RT is external beam radiotherapy (EBR). In an alternative embodiment, the RT is brachytherapy.
[0049] Radiotherapy is the treatment of cancer and other diseases with ionizing radiation. It is a very well established approach to the treatment of numerous types of cancer, and has been refined so that each cancer type typically receives an RT
treatment regimen tailored for that particular cancer. Ionizing radiation deposits energy that injures or destroys cells in the area being treated by damaging their genetic material, making it impossible for these cells to continue to grow. Radiotherapy can be used to treat localized solid tumors, such as cancers of the ovary, prostate, skin, tongue, larynx, brain, breast, or cervix. It can also be used to treat so-called blood cancers including leukemia and lymphoma (cancers of the blood-forming cells and lymphatic system, respectively).
[0050] In an embodiment, the RT is external-beam radiation (EBR) therapy.
Conventional external beam radiation therapy (2DXRT) is delivered via two-dimensional beams using kilovoltage therapy X-ray units or medical linear accelerators which generate high energy x-rays. 2DXRT mainly consists of a single beam of radiation delivered to the patient from several directions: often front or back, and both sides. External-beam radiation therapy is most often delivered in the form of photon beams (either x-rays or gamma rays).
Many types of external-beam radiation therapy are delivered using a linear accelerator that uses electricity to form a stream of fast-moving subatomic particles. Subjects can receive external-beam radiation therapy in daily treatment sessions over the course of several weeks.
The number of treatment sessions depends on many factors, including the total radiation dose that will be given. Another useful type of external-beam radiation therapy is 3-dimensional conformal radiation therapy (3D-CRT). 3D-CRT uses sophisticated computer software and advanced treatment machines to deliver radiation to very precisely shaped target areas.
[0051] Still other methods of external-beam radiation therapy are useful in the present treatment method. These include intensity-modulated radiation therapy (IMRT), which uses hundreds of tiny radiation beam-shaping devices, i.e., collimators, to deliver a dose of radiation. The collimators can be stationary or can move during treatment, allowing the intensity of the radiation beams to change during treatment sessions, so that different areas of a tumor or nearby tissues can be hit with different doses of radiation. IMRT
can be used to increase the radiation dose to treatment areas.
[0052] In use, each of the two treatment modalities in the present method will be utilized as it would be used in monotherapy, i.e., as it would be used independently of its combination with any other agent. Methods of administration and dosing will be consistent with established applications as a monotherapeutic, so that each modality provides, where it can, an anti-cancer benefit that will be enhanced when the modalities are combined in treating a given subject.
[0053] In embodiments, subjects will receive most types of external-beam radiation therapy up to 5 days a week for several weeks. One dose (a single fraction) of the total planned dose of radiation is given each day. Occasionally, two treatments a day are given.
Most types of external-beam radiation therapy are given in once-daily fractions, so that damage to normal tissue is minimized and to increase the likelihood that cancer cells are 1.5 exposed to radiation at the points in the cell cycle when they are most vulnerable to DNA
damage. Fractionation of a dosing schedule is now common, including accelerated fractionation where treatment is given in larger daily or weekly doses to reduce the number of weeks of treatment; hyperfractionation whereby smaller doses of radiation are given more than once a day; and hypofractionation by which larger doses are given once a day or less often to reduce the number of treatments.
[0054] Fractionation regimens are individualised between different radiation therapy centers and even between individual doctors. In North America, Australia, and Europe, the typical fractionation schedule for adults is 1.8 to 2 Gy per day, five days a week. In some cancer types, prolongation of the fraction schedule over too long can allow for the tumor to begin repopulating, and for these tumor types, including head-and-neck and cervical squamous cell cancers, radiation treatment is preferably completed within a certain amount of time. For children, a typical fraction size may be 1.5 to 1.8 Gy per day, as smaller fraction sizes are associated with reduced incidence and severity of late-onset side effects in normal tissues.
[0055] In some cases, two fractions per day are used near the end of a course of treatment. This schedule, known as a concomitant boost regimen or hyperfractionation, is used on tumors that regenerate more quickly when they are smaller. In particular, tumors in the head-and-neck demonstrate this behavior.
[0056]
Hypofractionation is a radiation treatment in which the total dose of radiation is divided into large doses. Typical doses vary significantly by cancer type, from 2.2 Gy/fraction to 20 Gy/fraction. The logic behind hypofractionation is to lessen the possibility of the cancer returning by not giving the cells enough time to reproduce and also to exploit the unique biological radiation sensitivity of some tumors. One commonly treated site where there is very good evidence for such treatment is in breast cancer. Short course hypofractionated treatments over 3-4 weeks e.g. 40 Gy in 15 fractions or 42.5 Gy in 16 fractions, have been shown to be as effective as more protracted 5-6 week treatments with respect to cancer control.
[0057] An alternative fractionation schedule is Continuous Hyperfractionated Accelerated Radiation therapy. CHART is used to treat lung cancer and consists of three smaller fractions per day. Another increasingly well-known alternative fractionation schedule, used to treat breast cancer, is called Accelerated Partial Breast Irradiation (APBI).
APBI can be performed with external beam radiation. APBI involves two high-dose fractions 1.5 per day for five days, compared to whole breast irradiation, in which a single, smaller fraction is given five times a week over a six-to-seven-week period.
[0058]
Thus, for radiotherapy, dosing levels and regimens will be determined by the type, location and stage of cancer being treated. The dose can be photon- or proton-based and expressed either in Roentgens or in Gray units, to indicate the exposed dose (Rn) or the absorbed dose (Gy) of radiation. The Gray is a derived unit of ionizing radiation dose, which is a measure of the amount of radiation energy absorbed by 1 kilogram of human tissue. It is related to the rad, which is 0.01Gy. Generally, appropriate dosing will range from about 1 to about 300 Gy per exposure. Total dosages per exposure can vary from about 1 to about 500 Gy and particularly 40-70Gy.
[0059] By definition, one roentgen of air kerma (kinetic energy released per unit mass) deposits 0.00877 grays (0.877 rads) of absorbed dose in dry air, or 0.0096 Gy (0.96 rad) in soft tissue. One roentgen (air kerma) of X-rays may deposit anywhere from 0.01 to 0.04 Gy (1.0 to 4.0 rad) in bone depending on the beam energy. Dosage ranges for X-rays in the present method range from daily doses of 50 to 200 roentgens as well as all intermediate dosage levels therebetween for prolonged periods of time such as 3 to 4 weeks, to single doses of 2000 to 6000 roentgens (including, but not limited to 2500, 3000, 3500, 4000, 4500, 5000, and 5500 roentgens).
[0060]
External beam radiotherapy schedules used in accordance with the present method can also vary. In certain embodiments, a particular schedule can comprise daily treatments about 5 times per week for about six to about seven weeks or can comprise about twice daily treatments for about two to about three weeks.
[0061] In alternative embodiments, the radiation therapy can be brachytherapy. In brachytherapy, a source of radiation source is placed inside or next to the area requiring treatment. It is used as a treatment particularly for breast, cervical, prostate and skin cancer.
Brachytherapy involves the precise placement of short-range radiation-sources (radioisotopes) directly at the tumour. These are enclosed in a protective capsule or wire, which allows the ionizing radiation to treat and kill surrounding tissue.
[0062] A course of brachytherapy thus begins with placement of the radiation source and ends with its removal or when the source radiation expires. The dose rate of brachytherapy refers to the level or 'intensity' with which the radiation is delivered to the surrounding medium and is expressed in Grays per hour (Gy/h). Low-dose rate (LDR) brachytherapy involves implanting radiation sources that emit radiation at a rate of up to 2 Gy/h. LDR brachytherapy is commonly used for cancers of the oral cavity, oropharynx, sarcomas and prostate. Medium-dose rate (MDR) brachytherapy is characterized by a medium rate of dose delivery, ranging between 2 Gy/h to 12 Gy/h. In high-dose rate (HDR) brachytherapy, the rate of dose delivery exceeds 12 Gy/h. The most common applications of FIDR brachytherapy are in tumours of the cervix, esophagus, lungs, breasts and prostate.
[0063] Pulsed-dose rate (PDR) brachytherapy involves short pulses of radiation, typically once an hour, to simulate the overall rate and effectiveness of LDR
treatment.
Typical tumour sites treated by PDR brachytherapy are gynaecological and head and neck cancers.
[0064] The placement of radiation sources in the target area can be temporary or permanent. Temporary brachytherapy involves placement of radiation sources for a set duration (usually a number of minutes or hours) before being withdrawn.
Treatment duration will depend on many factors, such as the required rate of dose delivery and the type, size and location of the cancer. In LDR and PDR brachytherapy, the source stays in place up to 24 hours and is then removed, while in HDR brachytherapy this time is typically just a few minutes [0065] Permanent brachytherapy, also known as seed implantation, involves placing small LDR radioactive seeds or pellets (about the size of a grain of rice) in the tumour or treatment site and leaving them there permanently to gradually decay. Over a period of weeks or months, the radiation emitted by the sources will decline to almost zero.
The inactive seeds then remain in the treatment site but with no lasting effect.
[0066] Commonly used sources of brachytherapy radiation include Cesium-131, Cesium-137, Cobalt-60, Iridium-192, Iodine-125, Palladium-103, Ruthenium-106 and Radium-226.
[0067] As noted, in the present treatment method, the CD47 blocking agent is a CD47-binding form of human SIRPa that is used in combination with radiation therapy to treat CD47+ diseases and particularly hyperproliferative disease and especially cancer. In terms of an anti-cancer effect, such as a depletion of CD47+ cancer cells, the treatment modalities cooperate to provide an enhanced reduction in cancer cell vitality, activity or mortality. The cooperative or enhanced effect of the combination can also be revealed in the context of other parameters, such as a reduction in cancer cell viability, size, number, or distribution, or improvement in overall burden of a tumour. It can also manifest as an increased infiltration of tumours by macrophages or any other phagocytic cell type.
[0068] The treatment modalities in the present combination can be delivered sequentially or, essentially at the same time, i.e. concurrently. In embodiments, the RT can .. be given before administration of SIRPaFc. In general, the delivery of one modality relative the other in temporal terms refers to the delivery of one modality in terms of one course of treatment, versus the delivery of the other modality in terms of its course of treatment. Thus, concurrent delivery means that courses of treatment overlap, whereas successive delivery means that courses of treatment do not overlap physically.
[0069] In some embodiments, EBR therapy can be administered within about 1-minutes, or 2-48 hours or more prior to and/or after administering the CD47 blocking agent.
In other embodiments, radiation therapy can be administered within from about 1 day to about 21 days prior to and/or after administering the CD47 blocking agent. In some embodiments, the time period for treatment can be extended significantly, however, where several weeks (e.g., about 1, about 2, about 3, about 4, about 5, about 6, about 7, or about 8 weeks or more) lapse between the administration of the CD47 blocking agent and the radiation therapy. It is important only that the effect of one agent is present in the subject when the other agent is administered. It is desirable in one embodiment that the agents are used concurrently and that their activities overlap actively within the subject undergoing treatment. In the context of brachytherapy, the modalities can be used concurrently, meaning that internal radiation is in place during a course of treatment with the CD47-binding agent, or the CD47-binding agent treatment can be administered to a subject that has completed a course of brachytherapy.
[0070] As revealed in the results shown in the Examples herein, it is believed that the benefit of combining radiotherapy and CD47 blockade therapy lies in elevating the number of macrophages that infiltrate tumours to deplete disease cells, with SIPRa-Fc augmenting the anti-tumor immunity induced by RT. The present method thus can be characterized as a method for increasing the number of macrophages present within a tumour, comprising treating the tumour with a combination of SIRPaFc and radiation to cause depletion of disease cells within the tumour.
[0071] In a further aspect, there is provided an article of manufacture containing the SIRPaFc drug in an amount useful for the treatment of the disorders described herein is provided. The article of manufacture comprises the SIRPaFc in a container and further comprises an indication or instruction, such as a label affixed to the container or included with the article that the SIRPaFc is for use in combination with radiation therapy. Suitable containers include, for example, bottles, vials, syringes, and test tubes. The containers may be formed from a variety of materials such as glass or plastic. The container holds a composition which is effective for treating the condition and may have a sterile access port (for example the container may be an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle). The article of manufacture may further comprise a second container comprising a pharmaceutically-acceptable buffer, such as phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other matters desirable from a commercial and use standpoint, including other buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.
[0072] The present treatment combination is useful to treat a variety of CD47+
disease cells. These include particularly CD47+ cancer cells, including liquid and solid tumours. The term "CD47+" is used with reference to the phenotype of cells targeted for binding by the CD47 blocking agent. Cells that are CD47+ can be identified by flow cytometry using CD47 antibody as the affinity ligand. CD47 antibodies that are labeled appropriately are available commercially for this use (for example, the antibody product of clone B6H12 is available from eBioscience). The cells examined for CD47 phenotype can include standard tumour biopsy samples including particularly blood samples taken from the subject suspected of harbouring endogenous CD47+ cancer cells. CD47 disease cells of particular interest as targets for therapy with the present fusion proteins are those that "over-express" CD47. These CD47+ cells typically are disease cells, and present CD47 at a density on their surface that exceeds the normal CD47 density for a cell of a given type. CD47 overexpression will vary across different cell types, but is meant herein to refer to any CD47 level that is determined, for instance by flow cytometry as exemplified herein or by immunostaining or by gene expression analysis or the like, to be greater than the level measurable on a counterpart cell having a CD47 phenotype that is normal for that cell type.
[0073] The types of ovarian cancer that can be treated with the present treatment combination include those within the three major categories, according to the kind of cells from which they were formed, i.e., (1) epithelial tumors that arise from cells that line or cover the ovaries; (2) germ cell tumors that originate from cells that are destined to form eggs within the ovaries; and (3) sex cord-stromal cell tumors that begin in the connective cells that io hold the ovaries together and produce female hormones. Also included are tumors that are adjacent to ovarian tissues, such as extraovarian peritoneal carcinoma (intraperitoneal carcinomatosis), the common epithelial tumors including serous, endometrioid, mucinous, and clear cell tumors ____________________________________________________ that include benign (noncancerous) or malignant (cancerous) tumors.
[0074] Also treatable with the present treatment combination are the rare types of ovarian tumours, such as Brenner tumors, undifferentiated tumors, and transitional cell tumors as well as germ cell tumours that are formed from egg-making cells within the ovaries.
[0075] In other embodiments, the treatment combination can be used to inhibit the growth or proliferation of hematological cancers. As used herein, "hematological cancer"
refers to a cancer of the blood, and includes leukemia, lymphoma and myeloma among others. "Leukemia" refers to a cancer of the blood, in which too many white blood cells that are ineffective in fighting infection are made, thus crowding out the other parts that make up the blood, such as platelets and red blood cells. It is understood that cases of leukemia are classified as acute or chronic. Certain forms of leukemia may be, by way of example, acute lymphocytic leukemia (ALL); acute myeloid leukemia (AML); chronic lymphocytic leukemia (CLL); chronic myel og en ous leukemia (CML); my el oproli ferativ e disorder/neoplasm (MPDS); and myelodysplastic syndrome. "Lymphoma" may refer to T
cell lymphoma and B cell lymphoma, Hodgkin's lymphoma, both indolent and aggressive non-Hodgkin's lymphoma, Burkitt's lymphoma, and follicular lymphoma (small cell and large cell), among others. Myeloma may refer to multiple myeloma (MM), giant cell myeloma, heavy-chain myeloma, and light chain or Bence-Jones myeloma.
[0076] In some embodiments, the hematological cancer treated with the treatment combination is a CD47+ leukemia, preferably selected from acute lymphocytic leukemia, acute myeloid leukemia, chronic lymphocytic leukemia, chronic myelogenous leukemia, and myelodysplastic syndrome, preferably, acute myeloid leukemia.
[0077] In other embodiments, the hematological cancer treated with the treatment combination is a CD47+ lymphoma or myeloma selected from a T cell lymphoma including .. cutaneous T cell lymphoma, Sezary Syndrome and mycosis fungoides, Hodgkin's lymphoma, both indolent and aggressive non-Hodgkin's lymphoma, Burkitt's lymphoma, B
cell lymphoma, follicular lymphoma (small cell and large cell), multiple myeloma (MM), giant cell myeloma, heavy-chain myeloma, and light chain or Bence-Jones myeloma as well as leimyosarcoma. In some embodiments, the hematological cancer is diffuse large B-cell .. lymphoma (DLBCL) or peripheral T cell lymphoma (PTCL) [0078] In another embodiment, the treatment combination is used to treat ovarian cancer. In a further embodiment, the combination is used to treat lung cancer.
In another embodiment, the treatment combination is used to treat melanoma.
[0079] It will be appreciated that the radiosensitivity of the cancer can be enhanced by giving certain radiosensitizing drugs during a course of radiation therapy.
Examples of radiosensitizers include: cisplatin, nimorazole, and cetuximab, among many others.
[0080] In some embodiments, the CD47 blockade therapeutic, described herein as a polypeptide (e.g., a fusion protein or an antibody), is administered as a "nucleotide equivalent" (a CD47 blockade polynucleotide) via gene therapy methods. In one embodiment, the CD47 blockade polynucleotide is encoded in a plasmid or vector.
Accordingly, in exemplary aspects, the CD47 blockade peptides are used or administered by way of administering a CD47 blockade nucleic acid comprising a nucleotide sequence encoding a CD47 blockade polypeptide described herein. In exemplary instances, the nucleic acid comprises a nucleotide sequence which encodes any of the CD47 blockade polypeptides described herein. The nucleic acid or polynucleotide generally is a polymer of DNA or RNA, which can be single-stranded or double- stranded, which can contain natural, non-natural, or altered nucleotides, and which can contain a natural, non-natural or altered inter-nucleotide linkage, such as a phosphoroamidate linkage or a phosphorothioate linkage, instead of the phosphodiester found between the nucleotides of an unmodified oligonucleotide.
Exemplary polynucleotide constructs are described in U.S. Patent No. 9,979,789. In some variations, the CD47 blockade polynucleotide (or vector) includes sequence encoding a signal peptide operably linked to sequence encoding the CD47 blockade therapeutic, to direct/facilitate secretion of the CD47 blockade therapeutic from transformed/transfected cells.
Date Recue/Date Received 2024-02-28 [0081] In exemplary aspects, the nucleic acids are constructed based on chemical synthesis and/or enzymatic ligation reactions. See, for example, Sambrook et al., Molecular Cloning: A Laboratory Manual. 3rd ed., Cold Spring Harbor Press, Cold Spring Harbor, N.Y.
2001; and Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, N.Y., 1994. For example, a nucleic acid can be chemically synthesized using naturally occurring nucleotides or modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed upon hybridization (e.g., phosphorothioate derivatives and acridine substituted nucleotides). Examples of modified nucleotides that can be used to generate the nucleic acids include, but are not limited to, 5-fluorouracil, 5-bromouracil, 5-chIorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetyl cy tos ine, 5-(carboxyhydroxymethyl) uracil, 5- carboxymethylaminomethy1-2-thiouridme, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N -substituted adenine, 7-methylguanine, 5-methylammomethyluracil, 5- methoxyarninomethy1-2-thiouracil, beta-D-mannosylqueosine, 5'- methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6-isopentenyladenine, uracil- 5-oxyacetic acid (v), wybutoxosine, pseudouratil, queosine, 2-thiocytosine, 5-methyl-2- thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5-oxyacetic acid methylester, 3- (3-amino-3-N-2-carboxypropyl) uracil, and 2,6-diaminopurine. Nucleic acids can be expanded using both recombinant means and synthetic means (e.g., PC R).
[0082] In some variations, the nucleic acids are incorporated into a vector. As used herein, a "vector" or "expression vector" is any molecule or moiety which transports, transduces or otherwise acts as a carrier of a heterologous molecule such as the nucleic acids encoding a CD47 blockade polypeptide. In exemplary aspects, the vector is a genetically-modified polynucleotide construct that permits the expression of an mRNA, protein, polypeptide, or peptide by a host cell, when the construct comprises a nucleotide sequence encoding the mRNA, protein, polypeptide, or peptide, and the vector is contacted with the cell under conditions sufficient to have the mRNA, protein, polypeptide, or peptide expressed within the cell.
[0083]
Suitable vectors include those designed for propagation and expansion or for expression or both, such as plasmids and viruses. Preferably, the vector is a viral vector, e.g., a retroviral vector. A "viral vector" is a vector which comprises one or more polynucleotide regions encoding or comprising payload molecule of interest, e.g., a transgene, a polynucleotide encoding a polypeptide or multi-polypeptide. In exemplary aspects, the viral vector is a vaccinia virus vector, a poxvirus vector, an adenovirus vector, an adeno-associated virus vector, or a herpes simplex virus vector.
[0084] Desirably, the polynucleotide or vector comprises regulatory sequences, such as transcription and translation initiation and termination codons.
Furthermore, in some variations, a promoter is used that is selective of specific for the types of cells to which the CD47 blockade polynucleotide is to be targeted, or which is inducible, or which is cycle-specific. In some variations, the promoter is a viral promoter, e.g., a cytomegalovirus (CMV) 3.0 promoter, an SV40 promoter, an RSV promoter, CAG promoter and a promoter found in the long-terminal repeat of the murine stem cell virus. The vectors can be designed for transient expression or stable expression. Also, the vectors can be made for constitutive expression or for inducible expression.
[0085] Methods of delivering nucleic acids for expression in cells are known in the art and include for example, lipid delivery using cationic lipids or other chemical methods (e.g., calcium phosphate precipitation, DEAE-dextran, polybrene), electroporation, or viral delivery. See, e.g., Sambrook and Russell, Molecular Cloning: A Laboratory Manual, 3rd ed. Cold Spring Harbor Press, Cold Spring Harbor, NY (2001), Nayerossadat et al., Adv Biomed Res 1: 27 (2012); and Hesier, William (ed.), Gene Delivery to Mammalian Cells, Vol 1., Non-viral Gene Transfer Techniques, Methods in Molecular Biology, Humana Press, (2004).
Examples [0086] The combination of RT and a CD47-blocking agent SIRPaFc (SEQ#9) was examined in xenograft tumor models.
Materials and Methods [0087] The in vivo efficacy of radiation therapy (RT), SIRPaFc, and RTd-SIRPaFc was evaluated in subcutaneous B cell lymphoma (SUDHL-6) and solid tumor xenografts, including the radio-insensitive A549 lung adenocarcinoma (subcutaneous), and ovarian adenocarcinoma (intraperitoneal). For subcutaneous tumor models, SIRPaFc (10 mg/kg) or vehicle was administered intratumourally 30 minutes prior to radiotherapy, 3 times per week for 3-4 weeks. Tumors were locally irradiated using an image-guided small animal irradiator (225 kVp, 13 mA) at a dose of 4-6 Gy for 3 fractions. Tumor volumes were monitored using standard caliper measurement. Tumor-associated macrophages were quantitatively assessed using flow cytometry and immunohistochemistry. For intraperitoneal tumor models of ovarian cancer, SIRPaFc (10 mg/kg) or vehicle was administered intraperitoneally 60 minutes prior to radiotherapy, 3 times per week for 3 weeks. Mice were treated with whole abdomen radiation (WAR) using image-guided X-ray IR.
Briefly, mice were injected intraperitoneally (i.p.) with 100 mg/kg of D-luciferin 5 min prior to BLI
acquisition. The mice were positioned on a stage and imaged by BLI followed by under anesthesia. Superimposed BLI and CT images were used to guide the radiation beam to the abdomen, with all the tumors included in the collimated area (4x4 cm). IR
was conducted at 225kVp and 13 mA with a copper filter. The isocenter of the radiation beam was set at 0.5 cm above the stage. The irradiation regimen was 2 fractions of 2 Gy on days 7 and 10.
Systemic toxicity of the treatments was evaluated by body weight change.
Results 100881 In both SU-DHL-6 and A549 tumor models, RT+SIRPaFc had a more profound effect on tumor control than RT alone. In SU-DHL-6, 88% (7/8) of mice treated with both SIRPaFc and external beam radiation were tumor-free at the end of the study whereas none were tumor-free when treated with RT or SIRPaFc alone, although there was tumor growth delay with each individual therapy compared to vehicle.
RT+SIRPaFc led to an increased infiltration of macrophages at the tumor sites in SU-DHL-6.
Statistically significant tumor control was also observed in A549 tumor bearing mice treated with RT-FSIRPaFc compared to either treatment alone. No toxicity was observed for localized RT
on the tumors and the combination of RT and SIRPaFc. In intraperitoneal tumor models of BRCA competent and knockdown SKOV-3, as measured by animal survival, statistically significant tumor control was achieved by RT+SIRPaFc, compared to vehicle control and RT
alone. As measured by body weight change, no chronic toxicity was observed for whole abdomen RT and its combination with SIRPaFc.
100891 As shown in the Figures, SIRPaFc increases phagocytosis of irradiated tumor cells by macrophages. It also enhances the anti-tumor effect of radiation therapy in xenograft tumor models of SU-DHL-6 (B lymphoma), A549 (lung adenocarcinoma), and BRCA
competent as well as knockdown SKOV-3 (ovarian adenocarcinoma). The combination of SIRPaFc and radiation leads to elevated macrophage infiltration at the tumor sites.
Sequencing of radiation and SIRPaFc impacts the efficacy of treatment, with concurrent SIRPaFc and IR being the most effective, followed by IR administered prior to SIRPaFc, and lastly, SIRPocfc prior to IR. These in vivo results show that concurrent radiation and CD47 blockade using SIRPaFc, e.g. administration of SIRPaFc during a course of radiation, or vice versa, can enhance tumor control and is a viable combination therapy that is superior to either treatment alone in terms of anti-cancer efficacy.
[0090] While the present disclosure has been described with reference to what are presently considered to be the preferred examples, it is to be understood that the disclosure is not limited to the disclosed examples. To the contrary, the disclosure is intended to cover various modifications and equivalent arrangements included within the spirit and scope of the appended claims.
Date Recue/Date Received 2024-02-28
Claims (18)
1. A use of a treatment-effective combination of a CD47 blocking agent and radiation for treating a subject presenting with CD47+ disease cells, wherein the radiation is external beam radiation, and wherein the CD47 blocking agent comprises an Fc fusion protein comprising the IgV region of soluble human signal regulatory protein alpha (SIRPa) variant 2.
2. The use according to claim 1, wherein the subject is human.
3. The use according to claim 1 or 2, wherein the CD47 blocking agent comprises SEQ
ID NO: 9.
ID NO: 9.
4. The use according to claim 1 or 2, wherein the CD47 blocking agent comprises SEQ
ID NO: 10.
ID NO: 10.
5. The use according to any one of claims 1 to 4, wherein the CD47 blocking agent is formulated with a pharmaceutically acceptable carrier.
6. The use according to any one of claims 1 to 5, wherein the subject presents with CD47+
cancer cells that are blood cancer cells or solid tumour cells.
cancer cells that are blood cancer cells or solid tumour cells.
7. The use according to claim 6, wherein the cancer cells are blood cancer cells.
8. The use according to claim 7, wherein the blood cancer cells are cells of a leukemia selected from acute lymphocytic leukemia; acute myeloid leukemia; chronic lymphocytic leukemia; chronic myelogenous leukemia; myeloproliferative disorder/neoplasm;
and myelodysplastic syndrome.
and myelodysplastic syndrome.
9. The use according to claim 7, wherein the blood cancer cells are cells of a lymphoma selected from a T cell lymphoma, cutaneous T cell lymphoma, Sezary Syndrome, mycosis fungoides, Hodgkin's lymphoma, indolent non-Hodgkin's lymphoma, aggressive non-Hodgkin's lymphoma, Burkitt's lymphoma, small cell follicular lymphoma, and large cell follicular lym phom a.
10. The use according to claim 7, wherein the blood cancer cells are cells of a myeloma selected from multiple myeloma (MM), giant cell myeloma, heavy-chain myeloma, light chain myeloma, and Bence-Jones myeloma.
11. The use according to claim 6, wherein the CD47+ cancer cells are cells of an ovarian cancer or a lung cancer.
12. The use according to any one of claims 1 to 11, wherein the CD47 blocking agent and the radiation treatment are for use concurrently in the subject.
13. The use according to any one of claims 1 to 11, wherein a course of treatment with the CD47 blocking agent overlaps with a course of the radiation treatment.
14. The use according to any one of claims 1 to 11, wherein the CD47 blocking agent is for use in a subject that has undergone at least one course of the radiation treatment.
15. The use according to any one of claims 1 to 6, wherein the subject has a tumour, and the CD47 blocking agent is for use by injection or infusion directly into the tumour.
16. The use according to claim 14, wherein the radiation treatment comprises a fractionation dosing schedule.
17. The use according to any one of claims 1 to 11, wherein the CD47 blocking agent and the radiation treatment are for use sequentially.
18. The use according to any one of claims 1 to 17, further comprising use of a radiosensitizing drug during a course of the radiation treatment.
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762582008P | 2017-11-06 | 2017-11-06 | |
| US62/582,008 | 2017-11-06 | ||
| PCT/CA2018/051392 WO2019084692A1 (en) | 2017-11-06 | 2018-11-05 | Cd47 blockade with radiation therapy |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CA3080640A1 CA3080640A1 (en) | 2019-05-09 |
| CA3080640C true CA3080640C (en) | 2024-04-09 |
Family
ID=66332799
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CA3080640A Active CA3080640C (en) | 2017-11-06 | 2018-11-05 | Cd47 blockade with radiation therapy |
Country Status (4)
| Country | Link |
|---|---|
| US (1) | US11771764B2 (en) |
| EP (1) | EP3706775A4 (en) |
| CA (1) | CA3080640C (en) |
| WO (1) | WO2019084692A1 (en) |
Families Citing this family (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11771764B2 (en) | 2017-11-06 | 2023-10-03 | Pfizer Inc. | CD47 blockade with radiation therapy |
| EP3846855B1 (en) * | 2018-09-04 | 2024-12-04 | Pfizer Inc. | Cd47 blockade with parp inhibition for disease treatment |
| US11591390B2 (en) | 2018-09-27 | 2023-02-28 | Celgene Corporation | SIRP-α binding proteins and methods of use thereof |
| AU2019349651B2 (en) | 2018-09-27 | 2023-12-07 | Celgene Corporation | SIRP alpha binding proteins and methods of use thereof |
| EP3886915A4 (en) * | 2018-11-29 | 2022-10-19 | PF Argentum IP Holdings LLC | BIOMARKERS FOR CD47 BLOCKING THERAPY |
| US20240034788A1 (en) * | 2020-08-20 | 2024-02-01 | The Board Of Trustees Of The Leland Stanford Junior University | Abscopal therapy for cancer |
| EP4232052A4 (en) * | 2020-10-22 | 2025-08-20 | Actinium Pharmaceuticals Inc | COMBINATION OF RADIOIMMUNOTHERAPY AND CD47 BLOCKADE IN THE TREATMENT OF CANCER |
| EP4329520A1 (en) * | 2021-04-27 | 2024-03-06 | Pfizer Inc. | Enhancement of cd47 blockade therapy with dhfr inhibitors |
| KR20230016152A (en) * | 2021-07-19 | 2023-02-01 | 주식회사유한양행 | Sirp-alpha variants and use thereof |
| CN121108300A (en) * | 2021-12-21 | 2025-12-12 | Fbd生物制品有限公司 | Engineered SIRPalpha variants and methods of use thereof |
Family Cites Families (24)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| WO2001040307A1 (en) | 1999-11-30 | 2001-06-07 | Eberhard-Karls-Universität Tübingen Universitätsklinikum | Antibodies against signal regulator proteins |
| DK3056515T4 (en) | 2008-01-15 | 2025-10-20 | Univ Leland Stanford Junior | METHOD FOR MANIPULATING PHAGOCYTOSIS MEDIATED BY CD47 |
| AU2009279676C1 (en) * | 2008-08-07 | 2015-08-06 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Radioprotectants targeting thrombospondin-1 and CD47 |
| KR20110112299A (en) | 2008-12-19 | 2011-10-12 | 노파르티스 아게 | Soluble polypeptide for use in the treatment of autoimmune and inflammatory disorders |
| WO2010083253A2 (en) | 2009-01-14 | 2010-07-22 | Viral Logic Systems Technology Corp. | Cd47 related compositions and methods for treating immunological diseases and disorders |
| US10907209B2 (en) | 2009-05-15 | 2021-02-02 | University Health Network | Compositions and methods for treating hematological cancers targeting the SIRPα CD47 interaction |
| WO2012170250A1 (en) * | 2011-06-07 | 2012-12-13 | Radiation Control Technologies, Inc. | Morpholino oligonucleotides capable of inhibiting cd47-mediated cellular damage and uses thereof |
| WO2013056352A1 (en) | 2011-10-19 | 2013-04-25 | University Health Network | Antibodies and antibody fragments targeting sirp-alpha and their use in treating hematologic cancers |
| HUE050875T2 (en) | 2012-01-17 | 2021-01-28 | Univ Leland Stanford Junior | High affinity SIRP-alpha reagents |
| JP6572131B2 (en) | 2012-12-12 | 2019-09-04 | バスキュロックス インコーポレイテッド | CD47 antibody for treatment |
| EP4116331A1 (en) | 2012-12-17 | 2023-01-11 | PF Argentum IP Holdings LLC | Treatment of cd47+ disease cells with sirp alpha-fc fusions |
| PE20151408A1 (en) | 2013-02-06 | 2015-10-15 | Inhibrx Llc | CD47 ANTIBODIES THAT DO NOT EXHAUST PLATELETS OR RED BALLOONS AND METHODS OF USING THEM |
| US9979789B2 (en) | 2013-07-27 | 2018-05-22 | Michael Lu | Open wireless architecture (OWA) unified airborne and terrestrial communications architecture |
| CA2936376A1 (en) | 2014-01-10 | 2015-07-16 | Shanghai Birdie Biotech, Inc. | Conjugated compounds and compositions for targeted immunotherapy |
| CN105233291A (en) | 2014-07-09 | 2016-01-13 | 博笛生物科技有限公司 | Combination Therapy Compositions and Methods of Combination Therapy for the Treatment of Cancer |
| US10087257B2 (en) | 2014-08-08 | 2018-10-02 | The Board Of Trustees Of The Leland Stanford Junior University | SIRP alpha-antibody fusion proteins |
| WO2017180519A1 (en) * | 2016-04-10 | 2017-10-19 | George State University Research Foundation, Inc. | Methods for treating cancer and inhibiting graft rejection |
| US20190091290A1 (en) | 2016-04-15 | 2019-03-28 | Trillium Therapeutics Inc. | Macrophage stimulation in cd47 blockade therapy |
| EP3534965A4 (en) | 2016-11-03 | 2020-06-24 | Trillium Therapeutics Inc. | IMPROVEMENTS IN CD47 BLOCKADERAPY THROUGH HDAC INHIBITORS |
| CA3042581A1 (en) | 2016-11-03 | 2018-05-11 | Trillium Therapeutics Inc. | Enhancement of cd47 blockade therapy by proteasome inhibitors |
| WO2018176132A1 (en) | 2017-03-28 | 2018-10-04 | Trillium Therapeutics Inc. | Cd47 blockade therapy |
| US20190062428A1 (en) | 2017-06-19 | 2019-02-28 | Surface Oncology, Inc. | Combination of anti-cd47 antibodies and cell death-inducing agents, and uses thereof |
| US11771764B2 (en) | 2017-11-06 | 2023-10-03 | Pfizer Inc. | CD47 blockade with radiation therapy |
-
2018
- 2018-11-05 US US16/759,981 patent/US11771764B2/en active Active
- 2018-11-05 EP EP18874304.1A patent/EP3706775A4/en active Pending
- 2018-11-05 WO PCT/CA2018/051392 patent/WO2019084692A1/en not_active Ceased
- 2018-11-05 CA CA3080640A patent/CA3080640C/en active Active
Also Published As
| Publication number | Publication date |
|---|---|
| EP3706775A1 (en) | 2020-09-16 |
| CA3080640A1 (en) | 2019-05-09 |
| US11771764B2 (en) | 2023-10-03 |
| US20210244816A1 (en) | 2021-08-12 |
| EP3706775A4 (en) | 2021-09-01 |
| WO2019084692A1 (en) | 2019-05-09 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CA3080640C (en) | Cd47 blockade with radiation therapy | |
| US9132281B2 (en) | Focused radiation for augmenting immune-based therapies against neoplasms | |
| JP6240600B2 (en) | Variants of humanized immune monoclonal antibodies | |
| JP5960597B2 (en) | Combined immunotherapy for cancer treatment | |
| EP3846855B1 (en) | Cd47 blockade with parp inhibition for disease treatment | |
| US20240018258A1 (en) | Cd47 blockade therapy with cd38 antibody | |
| US20230270861A1 (en) | Inhibitors of the Artemin Pathway for Treatment of Cancer | |
| AU2019235627B2 (en) | Improvements in CD47 blockade therapy by EGFR antibody | |
| Kanegasaki et al. | Reduced number of lymphocytes by X-ray irradiation: a problem in a combination therapy trial that elicits the abscopal effect in preclinical studies using electron beam irradiation | |
| KR102373965B1 (en) | Pharmaceutical composition for enhancing radiotherapy containing fusion protein comprising il-2 protein and cd80 protein | |
| US20240423983A1 (en) | Enhancement of cd47 blockade therapy with dhfr inhibitors |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| EEER | Examination request |
Effective date: 20231024 |
|
| EEER | Examination request |
Effective date: 20231024 |
|
| EEER | Examination request |
Effective date: 20231024 |
|
| EEER | Examination request |
Effective date: 20231024 |
|
| EEER | Examination request |
Effective date: 20231024 |
|
| EEER | Examination request |
Effective date: 20231024 |