CA3068969A1

CA3068969A1 - Multiplexed receptor-ligand interaction screens

Info

Publication number: CA3068969A1
Application number: CA3068969A
Authority: CA
Inventors: Sriram Kosuri; Eric Jones
Original assignee: University of California San Diego UCSD
Current assignee: University of California San Diego UCSD
Priority date: 2017-07-05
Filing date: 2018-07-05
Publication date: 2019-01-10
Also published as: JP7671316B2; KR20200024305A; KR102628446B1; JP2020530281A; US20200255844A1; JP2023058651A; CN111133100A; WO2019010270A1; AU2018297258B2; EP3649236A4; EP3649236A1; JP7229223B2; AU2018297258A1

Abstract

Aspects of the disclosure relate to a population of cells, wherein each cell comprises: i.) a heterologous receptor gene; ii.) an inducible reporter comprising a receptor-responsive element; wherein expression of the reporter is dependent on the activation of the activity of the receptor encoded by the receptor gene, and wherein the reporter comprises a barcode comprising an index region that is unique to the heterologous receptor gene; and wherein the cells express different heterologous receptors and wherein each single cell expresses one or more copies of one specific heterologous receptor and one or more copies of one specific reporter.

Description

DESCRIPTION
MULTIPLEXED RECEPTOR-LIGAND INTERACTION SCREENS
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of priority of U.S.
Provisional Patent Application No. 62/528,833, filed July 5, 2017, which is hereby incorporated by reference in its entirety.
BACKGROUND

[0002] This invention was made with Government support under 1555952, awarded by the National Science Foundation. The Government has certain rights in the invention.
1. Field of the Invention

[0003] The current disclosure relates to the field of medicine and drug discovery.
2. Description of Related Art

[0004] G protein-coupled receptors (GPCRs) are one of the most important classes of drug targets, with approximately one-third of currently marketed drugs having their effect through GPCRs. G protein-coupled receptors (GPCRs) represent 50-60% of the current drug targets. This family of membrane proteins plays a crucial role in drug discovery today.
Classically, a number of drugs based on GPCRs have been developed for such different indications as cardiovascular, metabolic, neurodegenerative, psychiatric, and oncologic diseases.

[0005] Moreover, there are currently few, if any methods that allow for an effective and efficient large-scale screen of thousands and even tens of thousands of receptors in a single assay platform. There is a significant need in the art for improvements in receptor and ligand interaction screens.
SUMMARY OF THE DISCLOSURE

[0006] The current disclosure relates to nucleic acids, vectors, cells, viral particles, and methods that can be used to determine specific receptor activation.
Accordingly, certain embodiments relate to nucleic acids comprising i.) a heterologous receptor gene; and ii.) an inducible reporter comprising a receptor-responsive element; wherein the expression of the reporter is dependent on the activation of the activity of the receptor encoded by the receptor gene, and wherein the reporter comprises a barcode comprising an index region that is uniquely identifiable to the heterologous receptor gene. Further aspects relate to a vector comprising nucleic acids of the disclosure. Further aspects relate to a vector comprising a heterologous receptor gene. The term "heterologous," in the context of polynucleotides, refers to a gene or polynucleotide that has been transferred to a cell by gene transfer methods known in the art or described herein; progeny of such cells may also be referred to as containing the heterologous nucleic acid sequence if the exogenously derived sequence remains in the descendant cells. The cell may already contain an endogenous gene that is identical to the heterologous receptor gene or the cell may lack any endogenous genes that are related or identical to the heterologous gene. The term "heterologous cell" or "host cell"
refers to a cell intentionally containing a heterologous nucleic acid sequence

[0007] The term "encode" as it is applied to polynucleotides refers to a polynucleotide which is said to "encode" a polypeptide if, in its native state or when manipulated by methods well known to those skilled in the art, it can be transcribed and/or translated to produce the mRNA for the polypeptide and/or a fragment thereof. The antisense strand is the complement of such a nucleic acid, and the encoding sequence can be deduced therefrom.

[0008] In some embodiments, the vector further comprises an inducible reporter; wherein expression of the reporter is dependent on the activation of the activity of the receptor encoded by the receptor gene, and wherein the reporter comprises a barcode comprising an index region that is unique to the heterologous receptor gene. Further aspects relate to a vector comprising an inducible reporter comprising a barcode.

[0009] Further aspects relate to a population of cells, wherein each cell comprises: i.) a heterologous receptor gene; ii.) an inducible reporter comprising a receptor-responsive element; wherein expression of the reporter is dependent on the activation of the activity of the receptor encoded by the receptor gene, and wherein the reporter comprises a barcode comprising an index region that is unique to the heterologous receptor gene;
and wherein the cells express different heterologous receptors and wherein each single cell expresses one or more copies of one specific heterologous receptor and one or more copies of one specific reporter. For example, the population of cells may comprise at least a first cell with a first receptor gene and a first inducible reporter, a second cell with a second receptor gene and a second inducible reporter, a third cell with a third receptor gene and an inducible reporter, a fourth cell with a fourth receptor gene and a fourth inducible reporter. and a 1000th cell with a 1000th receptor gene and a 1000th inducible reporter. etc.. The population of cells may comprise cells, each of which contains only one receptor and an associated inducible reporter comprising a barcode comprising an index region that can be used to identify the heterologous receptor that is activated in the same cell. The population of cells may comprise at least or at most 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, 2500, 2600, 2700, 2800, 2900, 3000, 3100, 3200, 3300, 3400, 3500, 3600, 3700, 3800, 3900, 4000, 4500, 5000, 6000, 7000, 8000, 9000, 104,105, 106, 107', 108, 109, or 1010 cells (or any derivable range therein), which represents the number of different receptor genes and their associated inducible reporter. Furthermore, in some embodiments, the inducible reporter produces an expressed nucleic acid that uniquely identifies the heterologous receptor gene that was expressed in that cell. The different receptor genes may be receptors belonging to a class of receptors, such as olfactory receptors, hormone receptors, adrenoceptors, drug-responsive receptors, and the like. Accordingly, the population of cells may comprise cells that express one and only one receptor gene (although it may be expressed from multiple copies of the same gene) and one and only one associated inducible reporter (although there may be multiple copies of the inducible reporter). In some embodiments, the cells each express one variant of the same receptor gene. It is contemplated that a single screen may involve the number of cells/receptors discussed herein. This differs in scale than other screens, which may involve employing screens serially in order to have the magnitude of some embodiments provided by this disclosure.

[0010] Further embodiments relate to a cell comprising i.) a heterologous receptor gene;
and ii.) an inducible reporter comprising a receptor-responsive element;
wherein expression of the reporter is dependent on the activation of the activity of the receptor encoded by the receptor gene, and wherein the reporter comprises a barcode comprising an index region that is unique to the heterologous receptor gene. In some embodiments, expression of the heterologous gene is "sustainable," meaning expression of the heterologous gene remains at level that is within about or within at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100% of an expression level of cells from 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50 passages or more (or any range derivable therein) prior to the later cells or from 1, 2, 3, 4, 5, 6, 7 days and/or 1, 2, 3, 4, 5 weeks and/or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 months (or any range derivable therein) at a point in time prior to those later cells. In certain embodiments, the cells exhibit sustainable expression of the receptors to be tested. In some embodiments, cells express the receptors at a level that is within 2x of the level first measured following 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50 passages or more (or any range derivable therein).

[0011] In some embodiments, the receptor gene encodes for a G-protein coupled receptor (GPCR). In some embodiments, the reporter is induced upon signal transduction by the activated receptor protein. In some embodiments, activation of the receptor protein comprises binding of the receptor to a ligand. In some embodiments, the receptor gene further comprises one or more additional polynucleotides encoding for an auxiliary polypeptide. In some embodiments, the auxiliary polypeptide comprises a selectable or screenable protein. In some embodiments, the auxiliary polypeptide comprises a protein or peptide tag. In some embodiments, the auxiliary polypeptide comprises a transcription factor. In some embodiments, the auxiliary polypeptide comprises one or more trafficking tags. In some embodiments, the auxiliary polypeptide comprises two trafficking tage. In some embodiments, the auxiliary polypeptide comprises at least, at most, or exactly 1, 2, 3, 4, or 5 (or any derivable range therein) trafficking tags. In some embodiments, the trafficking tags comprise a Lucy and/or Rho trafficking tags. In some embodiments, the trafficking tag comprises a signal peptide. In some embodiments, the signal peptide is a cleavable peptide cleaved in vivo by endogenous proteins. Exemplary auxiliary polypeptides are described herein. In some embodiments, the receptor gene encodes for a fusion protein comprising the receptor gene and the auxiliary polypeptide. In some embodiments, the fusion protein comprises a protease site between the receptor gene and the auxiliary polypeptide.

[0012] In some embodiments, the reporter is induced by signal transduction upon activation of the GPCR. In some embodiments, the receptor-responsive element comprises one or more of a cAMP response element (CRE), a nuclear factor of activated T-cells response element (NFAT-RE), serum response element (SRE), and serum response factor response element (SRF-RE). In some embodiments, the receptor-responsive element comprises a DNA element that is bound by the auxiliary polypeptide transcription factor. In some embodiments, the auxiliary polypeptide transcription factor comprises reverse tetracycline-controlled transactivator (rtTA), and the receptor-responsive element comprises a tetracycline responsive element (TRE).

[0013] In some embodiments, the receptor-response element comprises CRE. In some embodiments, the CRE comprises at least 5 repeats of tgacgtca (SEQ ID NO:1).
In some embodiments, the CRE comprises at least, at most, or exactly 3, 4, 5, 6, 7, 8, 9, or 10 repeats of SEQ ID NO:1 (or any derivable range therein). In some embodiments, the CRE
comprises cgtcgtgacgtcagacagaccacgcgatcgctcgagtccgccggtcaatccggtgacgtcacgggcctcttcgctatta cgccagct ggcgaaagggggttgacgtcacattaaatcggccaacgcgcggggagaggcggtgacgtcaacaggcatcgtggtgtca cgctcg tcgtgacgtcagtcgctttaactggccctggctttggcagcctgtagcctgacgtcagagagcctgacgtcaGagagcg gagactcta gagggtatataatggaagctcgaattccagcttggcattccggtactgttggtaaa (SEQ ID NO:2) or a sequence that is at least, at most, or exactly 70, 75, 80, 85, 90, 95, 96, 97, 98, or 99%
identical to SEQ ID
NO:2 or a fragment thereof, for example, a fragment of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 125, 150, 175, 200, 225 250, 275, 300, 301, 302, 304, 305, 306, 307, 308, 309, 310, 312, 313, 314, or 315 contiguous nucleic acids of SEQ ID NO:2 (or any derivable range therein).

[0014] In some embodiments, the GPCR is an olfactory receptor (OR). ORs are known in the art and further described herein. In some embodiments, the receptor gene comprises a nuclear hormone receptor gene. In some embodiments, the receptor gene comprises a receptor tyrosine kinase gene.
In some embodiments, the receptor comprises an adrenoceptor. In some embodiments, the adrenoceptor comprises a beta-2 adrenergic receptor. In some embodiments, the receptor comprises a receptor described herein. In some embodiments, the receptor is a transmembrane receptor. In some embodiments, the receptor is an intracellular receptor.

[0015]
In some embodiments, the vector is a viral vector. In further embodiments, the vector is one known in the art and/or described herein. In some embodiments, the vector comprises a lentiviral vector.

[0016]
In some embodiments, the receptor gene comprises a constitutive promoter.
Exemplary constitutive promoters include, CMV, RSV, 5V40 and the like. In some embodiments, the receptor gene comprises a conditional promoter. The term "conditional promoter" as used herein refers to a promoter that can be induced by the addition of an inducer and/or switched from the "off' state to the "on" state or the "on"
state to the "off' state by the change of conditions, such as the change of temperature or the addition of a molecule such as an activator, a co-activator, or a ligand. Examples of a conditional promoter includes a "Tet-on" or "Tet-off' system, which can be used to inducible express proteins in cells.

[0017] In some embodiments, the reporter comprises an expressed RNA. In some embodiments, the reporter comprises a barcode of at least 10 nucleic acids.
The barcode may be, be at least, or be at most, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more nucleic acids (or any derivable range therein) in length. In some embodiments, the reporter comprises or further comprises an open reading frame (ORF); wherein the gene comprises a 3' untranslated region (UTR). In some embodiments, the barcode is located in the 3'UTR of a gene, reporter, or other nucleic acid segment, such as for a gene encoding a fluorescent protein. In some embodiments, the ORF
encodes a selectable or screenable protein. In some embodiments, the ORF
encodes a fluorescent protein. In some embodiments, the ORF encodes a luciferase protein.

[0018]
In some embodiments, the receptor gene is flanked at the 5' and/or 3' end by insulator sequences. In some embodiments, the reporter is flanked at the 5' and/or 3' end by insulator sequences. In some embodiments, the reporter gene is flanked at only the 5' end or at only the 3' end. In some embodiments, the reporter gene is not flanked at the 3' end by an insulator. In some embodiments, the reporter gene is not flanked at the 5' end by an insulator. In some embodiments, the receptor gene is flanked at only the 5' end or at only the 3' end. In some embodiments, the receptor gene is not flanked at the 3' end by an insulator.
In some embodiments, the receptor gene is not flanked at the 5' end by an insulator.

[0019]
In some embodiments, the insulator comprises a cHS4 insulator. In some embodiments, the insulator comprises GAGGGACAGCCCCCCCCCAAAGCCCCCAGGGATGTAATTACGTCCCTCCCCCGCT
AGGGGGCAGCAGCGAGCCGCCCGGGGCTCCGCTCCGGTCCGGCGCTCCCCCCGC
ATCCCCGAGCCGGCAGCGTGCGGGGACAGCCCGGGCACGGGGAAGGTGGCACG
GGATCGCTTTCCTCTGAACGCTTCTCGCTGCTCTTTGAGCCTGCAGACACCTGGG
GGGATACGGGGAAAA (SEQ ID NO:3) or a sequence that is at least, at most, or exactly 70, 75, 80, 85, 90, 95, 96, 97, 98, or 99% identical to SEQ ID NO:3 or a fragment thereof, for example, a fragment of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,

20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 125, 150, 175, 200, 205, 210, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229, 230, or 231 contiguous nucleic acids of SEQ ID
NO:3 (or any derivable range therein).
[0020]
In some embodiments, the insulator is a CTCF insulator, which is regulated by the CTCF repressor, or gypsy insulator, which is found in the gypsy retrotransposon of Drosophila.

[0021]
In some embodiments, the vector comprises a second, third, fourth, or fifth barcode. In some embodiments, at least one of the second, third, or fourth barcode comprises an index region that is unique to one or more of: an assay condition or a position on a microplate. Assay conditions may include the addition of a specific ligand, the addition of a specific concentration of a ligand, or variant of a ligand, or concentration or variant of a metabolite, small molecule, polypeptide, inhibitor, repressor, or nucleic acid. In some embodiments, the additional barcode may be used to identify where the cell was positioned on a microplate, so that the assay conditions at that particular position may be identified and connected to the barcode.

[0022] Further aspects of the disclosure relate to a viral particle comprising one or more vectors or nucleic acids of the disclosure.
Yet further aspects of the disclosure relate to a cell comprising a nucleic acid, vector, or viral particle of the disclosure. Further embodiments relate to a cell comprising a plurality of copies of a vector of the disclosure. In some embodiments, the cell comprises at least three copies of the vector. In some embodiments, the cell comprises at least four copies of the vector. In some embodiments, the cell comprises at least, at most, or exactly 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, or 20 copies (or any derivable range therein) of the vector.

[0023] In some embodiments, the cell or cells of the disclosure further comprises one or more genes encoding for one or more accessory proteins. In some embodiments, the one or more accessory proteins comprises one or more of a G a-subunit, Ric-8B, RTP1L, RTP2, RTP3, RTP4, CHMR3, and RTP1S. In some embodiments, the one or more accessory proteins comprises an arrestin protein. In some embodiments, the one or more accessory proteins comprises a Gi or Gq protein. In some embodiments, the arrestin protein is fused to a protease. In some embodiments, the one or more accessory proteins comprises one or more of a chaperone protein, a G protein, and a guanine nucleotide exchange factor. In some embodiments, the accessory proteins are integrated into the genome of the cell. As shown in the examples of the application, stable integration of the accessory factors provides for surprisingly good results, compared to transient expression. In some embodiments, the accessory proteins are transiently expressed. In some embodiments, the cell comprises stable integration of one or more exogenous nucleotides encoding one or more accessory factor genes, wherein the accessory factor genes comprise RTP1S, RTP2, G a-subunit (NCBI gene ID:2774), or Ric-8b (NCBI Gene ID 237422).

[0024] In some embodiments, the cell further comprises a receptor protein expressed from the heterologous receptor gene. In some embodiments, the receptor protein is localized intracellularly. In some embodiments, the cell lacks an endogenous gene that encodes for a protein that is at least 80% identical to the heterologous receptor gene. In some embodiments, the cell lacks an endogenous gene that encodes for a protein that is at least, at most, or exactly 65, 70, 75, 80, 85, 90, 95, 96, 97, 98, 99, or 100% identical (or any derivable range therein) to the heterologous receptor gene. In some embodiments, the receptor gene is integrated into the cell's genome. In some embodiments, the inducible reporter is integrated into the cell's genome. In some embodiments, the receptor gene and/or the inducible reporter is/are transiently expressed.

[0025] In some embodiments, the receptor gene and inducible reporter are genetically linked. In some embodiments, the receptor gene and inducible reporter are genetically unlinked. In some embodiments, the receptor gene and inducible reporter are inserted into the cell's genome and are within or separated by at least 10, 50, 100, 200, 500, 1000, 2000, 3000, 5000, or 10000 base pairs (bp) (or any range derivable therein) from each other. In further embodiments, the receptor gene and the inducible reporter are on separate genetic elements, such as separate chromosomes and/or extrachromosomal molecules.

[0026] In some embodiments, the integrated receptor gene and/or inducible reporter are integrated into the cellular genome by targeted integration. In some embodiments, the integrated receptor gene and/or inducible reporter are randomly integrated into the genome.
In some embodiments, the random integration comprises transposition of the receptor gene and/or inducible reporter. In some embodiments, the cell comprises at least 2 copies of the receptor gene and/or inducible reporter. In other methods of random integration, DNA can be introduced into a cell and allowed to randomly integrate through recombination. In some embodiments, the integration is into the H11 safe harbor locus. In some embodiments, the integration is targeted integration into the H11 safe harbor locus.

[0027] In some embodiments, the receptor gene comprises a constitutive promoter. In some embodiments, the expression of the receptor is constitutive. In some embodiments, the receptor gene comprises a conditional promoter. In some embodiments, the expression of the receptor is conditional or inducible. In some embodiments, the heterologous receptor gene is operatively coupled to an inducible promoter. In some embodiments, the inducible or conditional promoter is a tetracycline response element.

[0028] In some embodiments, the expression level of the heterologous receptor is at a physiologically relevant expression level. The term "physiologically relevant expression level" refers to an expression level that is similar or equivalent to the endogenous expression level of the receptor in a cell. In other embodiments, the level of expression may below a physiologically relevant level. It is contemplated that in some embodiments, the sensitivity of sequencing a barcode allows for expression levels that are lower than what is needed for less sensitive assays. In some embodiments, the level of RNA transcripts is, is at least, or is at most about 10, 102,103, 104,105, 106, 107', 108, 109, or 1010 or any range derivable therein.

[0029] In some embodiments, the cell or cells are frozen. In some embodiments, the cell is a mammalian cell. In some embodiments, the cell is a human embryonic kidney (HEK293T) cells.

[0030] Further aspects relate to an assay system comprising the cells or population of cells described herein.

[0031] Further aspects relate to a method for screening for ligand and receptor binding, the method comprising: contacting the cell or cells of the disclosure with a ligand; detecting one or more reporters; and determining the identity of the one or more reporters; wherein the identity of the reporter indicates the identity of the bound receptor. Methods may involve screening some number of receptors and/or some number of ligands within a certain time period. In some embodiments, a single screen involves assaying about, at least about, or at most about 10, 102,103, 104,105, 106, 107', 108, 109, or 1010 different cells and/or receptors (or any range derivable therein) with about, about at least, or about at most 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, 2500, 2600, 2700, 2800, 2900, 3000, 3100, 3200, 3300, 3400, 3500, 3600, 3700, 3800, 3900, 4000, 4500, 5000, 6000, 7000, 8000, 9000, 104,105, 106, 107', 108, 109, or 1010 ligands or potential ligands (or any range derivable therein) in a matter of 2, 3, 4, 5, 6, 7 days and/or 1, 2, 3, 4, 5 weeks and/or 1, 2, 3, 4, 5, or 6 months (and any range deriveable therein), where the screen begins when cells are contacted with a candidate ligand and the screen ends when a receptor is identified by its sequenced barcode.

[0032] In some embodiments, at least 300 different heterologous receptors are expressed in a population of cells. In some embodiments, at least 2, 5, 10, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, 10000, 20000, 30000, 40000, 50000, or more receptors are expressed in a population of cells.
In some embodiments, the population of cells comprises at least or at most 104,105, 106, 107', 108, 109, 1010, 1011, or 1012 cells (or any range derivable therein). In some embodiments, the population of cells are co-mixed in one composition. The composition may be a suspended composition of cells or a plated composition of cells. In some embodiments, the population of cells are adhered to a substrate, such as a cell culture dish. In some embodiments, the population of cells are contained within one well of a substrate or within one cell culture dish.

[0033] In some embodiments, determining the identity of the reporter comprises isolating nucleic acids from the cell. In some embodiments, the nucleic acids comprise RNA. In some embodiments, the method further comprises performing a reverse transcriptase reaction on the isolated RNA to make a cDNA. In some embodiments, the method further comprises amplifying the isolated nucleic acids. In some embodiments, the method further comprises sequencing the isolated nucleic acids. In some embodiments, the reverse transcriptase reaction is performed in the lysate. In some embodiments, detecting one or more reporters comprises detecting the level of fluorescence from the cell or cells. In some embodiments, the method further comprises plating the cells. In some embodiments, the cells are plated onto a 96-well cell culture plate. In some embodiments, the cells or cells are frozen and the method further comprises thawing frozen cells.

[0034] Certain aspects of the disclosure relate to a method for screening for ligand and receptor binding comprising: contacting a population of cells with a ligand;
wherein each cell of the population of cells comprises: i.) a heterologous receptor gene;
and ii.) an inducible reporter comprising a receptor-responsive element; wherein expression of the reporter is dependent on the activation of the activity of the receptor encoded by the receptor gene, and wherein the reporter comprises a barcode comprising an index region that is unique to the heterologous receptor gene; and wherein the population of cells express at least 2 different receptors from the heterologous receptor genes and wherein each single cell has one or more copies of one specific heterologous receptor and one or more copies of one specific reporter; detecting one or more reporters; and determining the identity of the one or more reporters; wherein the identity of the reporter indicates the identity of the bound receptor.

[0035] Methods further involve expressing in a cell any receptor identified in a screen.
The receptor may be purified or isolated. One or more identified receptors may also be cloned. It may then be transfected into a different host cell for expression.

[0036] Further aspects relate to a vector library comprising at least two different vectors, wherein the vectors comprise different heterologous receptor genes and different inducible reporters. The vectors may be a vector described herein. Further aspects relate to a cell library comprising the population of cells of the disclosure. Further aspects relate to a viral library comprising at least two viral particles of the disclosure, wherein the viral particles comprise different heterologous receptor genes and different inducible reporters.

[0037] Further aspects relate to a method for making a library of cells comprising receptor proteins, the method comprising: i.) expressing a nucleic acid or vector of the disclosure in cells or ii.) infecting the cells with a viral particle of the disclosure;
wherein the cells express different heterologous receptors and wherein each single cell has one or more copies of one specific heterologous receptor and one or more copies of one specific reporter. Each cell may have at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 copies (or any derivabley range therein) of the heterologous receptor gene and/or inducible reporter. In certain embodiments, the cell comprises at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 copies (or any derivable range therin) of a nucleic acid encoding the receptor gene and/or inducible reporter.

[0038] Further aspects relate to kits comprising vectors, cells, nucleic acids, libraries, primers, probes, sequencing reagents and/or buffers as described herein.

[0039] Further aspects relate to a nucleic acid comprising: i.) a heterologous receptor gene operatively coupled to an inducible promoter; and ii.) a reporter comprising a receptor-responsive element; wherein the expression of the reporter is dependent on the activation of the activity of the receptor encoded by the heterologous receptor gene, and wherein the reporter comprises a barcode comprising an index region that is unique to the heterologous receptor gene. In some embodiments, the comprises at least 2 copies to at least 6 copies of the nucleic acid.

[0040] The term "an equivalent nucleic acid" refers to a nucleic acid having a nucleotide sequence having a certain degree of homology with the nucleotide sequence of the nucleic acid or complement thereof. A homolog of a double stranded nucleic acid is intended to include nucleic acids having a nucleotide sequence which has a certain degree of homology with or with the complement thereof. In one aspect, homologs of nucleic acids are capable of hybridizing to the nucleic acid or complement thereof. Nucleic acids of the disclosure also include equivalent nucleic acids.

[0041] A polynucleotide or polynucleotide region (or a polypeptide or polypeptide region) may have at least, at more, or exactly, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% (or any derivable range therein) of "sequence identity" or "homology" to another sequence means that, when aligned, that percentage of bases (or amino acids) are the same in comparing the two sequences. This alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in Ausubel et al. eds. (2007) Current Protocols in Molecular Biology.

[0042] Biologically equivalent polynucleotides are those having the specified percent homology and encoding a polypeptide having the same or similar biological activity.

[0043] "About" and "approximately" shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements.
Typically, exemplary degrees of error are within 20 percent (%), preferably within 10%, and more preferably within 5% of a given value or range of values. Alternatively, and particularly in biological systems, the terms "about" and "approximately" may mean values that are within an order of magnitude, preferably within 5-fold and more preferably within 2-fold of a given value. In some embodiments it is contemplated that an numerical value discussed herein may be used with the term "about" or "approximately."

[0044] As used herein, the term "comprising" is intended to mean that the compositions and methods include the recited elements, but not excluding others.
"Consisting essentially of" when used to define compositions and methods, shall mean excluding other elements of any essential significance to the combination for the stated purpose.
"Consisting essentially of' in the context of pharmaceutical compositions of the disclosure is intended to include all the recited active agents and excludes any additional non-recited active agents, but does not exclude other components of the composition that are not active ingredients.
Thus, a composition consisting essentially of the elements as defined herein would not exclude trace contaminants from the isolation and purification method and pharmaceutically acceptable carriers, such as phosphate buffered saline, preservatives and the like.
"Consisting of" shall mean excluding more than trace elements of other ingredients and substantial method steps for administering the compositions of this invention or process steps to produce a composition or achieve an intended result. Embodiments defined by each of these transition terms are within the scope of this invention.

[0045] The terms "protein", "polypeptide" and "peptide" are used interchangeably herein when referring to a gene product or functional protein.

[0046] The terms "contacted" and "exposed," when applied to a cell, are used herein to describe the process by which an agent is delivered to a target cell or are placed in direct juxtaposition with the target cell or target molecule.

[0047] The use of the word "a" or "an" when used in conjunction with the term "comprising" in the claims and/or the specification may mean "one," but it is also consistent with the meaning of "one or more," "at least one," and "one or more than one."

[0048] Throughout this application, the term "about" is used to indicate that a value includes the standard deviation of error for the device or method being employed to determine the value.

[0049] The use of the term "or" in the claims is used to mean "and/or"
unless explicitly indicated to refer to alternatives only or the alternatives are mutually exclusive, although the disclosure supports a definition that refers to only alternatives as well as "and/or." As used herein "another" may mean at least a second or more.
[0001] As used in this specification and claim(s), the words "comprising" (and any form of comprising, such as "comprise" and "comprises"), "having" (and any form of having, such as "have" and "has"), "including" (and any form of including, such as "includes"
and "include") or "containing" (and any form of containing, such as "contains" and "contain") are inclusive or open-ended and do not exclude additional, unrecited elements or method steps. It is contemplated that any embodiment set forth with the term "comprising" may also be substituted with the word "consisting of' for "comprising."

[0050] It is contemplated that any method or composition described herein can be implemented with respect to any other method or composition described herein and that different embodiments may be combined.

[0051] Use of the one or more compositions may be employed based on methods described herein. Use of one or more compositions may be employed in the preparation of medicaments for treatments according to the methods described herein. Other embodiments are discussed throughout this application. Any embodiment discussed with respect to one aspect of the disclosure applies to other aspects of the disclosure as well and vice versa. The embodiments in the Example section are understood to be embodiments that are applicable to all aspects of the technology described herein.

[0052] Other objects, features and advantages of the present invention will become apparent from the following detailed description. It should be understood, however, that the detailed description and the specific examples, while indicating preferred embodiments of the invention, are given by way of illustration only, since various changes and modifications within the spirit and scope of the invention will become apparent to those skilled in the art from this detailed description.
BRIEF DESCRIPTION OF THE DRAWINGS

[0053] The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present invention. The invention may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.

[0054] FIG. 1. Overview of Multiplexed Reporter Scheme. Diagram detailing multiplexed scheme. Diagram detailing the barcoding strategy for the OR
library. Each OR
is linked to a unique barcode in the 3' UTR of the reporter gene. Mukku3a cells are clonally integrated with each OR, pooled, and seeded for odorant induction. After induction, the barcoded transcripts are sequenced and quantified to determine the relative affinity for each odorant-receptor pair.

[0055] FIG 2. Ind. Cell Line Luc/RNA and Pilot Screen. a) Show Ind. Luc for Stable Cell Line b) Show Ind. RNA for Stable Cell Line a) Individual, stable OR activation with known ligands measured via a cAMP responsive luciferase genetic reporter in Mukku3a cells. b) Individual, stable OR activation with known ligands measured via Q-RTPCR of the barcoded genetic reporter in Mukku3a cells.

[0056] FIG. 3. Combined v. Sep Genetic Reporter. a) Schematic of Sep v.
Comb b) Sep v. Comb Transient Data. a) Plasmid configuration for encoding the OR and the reporter separately and together. b) Comparison of transient OR activation (M0R42-3 and MOR9-1) with known ligands measured via a cAMP responsive luciferase genetic reporter in the separate and combined configurations.

[0057] FIG. 4. Landing Pad. a) Schematic of Bxb 1 b) Integration Efficiency c) B2 and OR int Luc. a) Schematic of Bxb 1 recombination into a landing pad. HEK293T
cells were pre-engineered to contain a single copy of the landing pad the safe harbor locus H11 (Mukku 1 a cells). The landing pad contains the Bxb 1 recombinase recognition site attp. Co-expression of the recombinase and a plasmid containing the corresponding attb recognition site leads to a single, irreversible site-specific integration event. This integration strategy enables the clonal integration of a heterogeneous library in a single pot. b) Evaluation of the integration efficiency of the Bxb 1 landing pad using flow cytometry. Cells were co-transfected with plasmids expressing the recombinase and a plasmid that conditionally expresses mCherry upon integration as well as solely with the mCherry plasmid.
After multiple passages 7-8% of cells transfected with the recombinase as well were fluorescent and no cells without the recombinase were fluorescent. c) Combined genetic reporters encoding an OR (M0R42-3) and the beta-2 adrenergic receptor (ADRB2) were integrated into the landing pad. Both were induced with known agonists and genetic reporter activation was measured with a luciferase assay. Dose dependent activation was observed for ADRB2 but not for M0R42-3.

[0058] FIG. 5. Inducible Scheme. a) Schematic b) Trans and Int Ind. a) Mukku la cells were transduced to constitutively express a reverse tetracycline transactivator (m2rtTA) and the constitutive promoter driving OR expression was replaced with a tetracycline regulated promoter. (Tetracycline responsive GFP was integrated to confirm expression in the landing pad with addition of doxycycline.) b) The inducible combined genetic reporter was screened for OR activation transiently and integrated in the landing pad of Mukku2a cells. Transient activation of M0R42-3 was observed in the presence of dox when stimulated with odorant, but was not observed when integrated in the landing pad. The bars above each concentration of part b represent ¨ Dox (left bar) and + Dox (right bar).

[0059] FIG. 6. Copy Number. a) Transposon Scheme b) Cons. Transposon c) Ind.
Transposon d) QPCR. a) Diagram of the transposon schematic. The PiggyBac transposase excises the combined genetic reporter flanked by intermediate terminal repeats. Multiple copies of the sequence are then inserted at TTAA loci across the genome. b) When transposed in Mukku la cells under constitutive expression, M0R42-3 exhibits no dose responsive luciferase production to ligand. c) When transposed in Mukku2a under inducible expression, M0R42-3 exhibits robust dose responsive luciferase production to ligand in the presence of doxycycline. The bars above each concentration of part c represent ¨ Dox (left bar) and + Dox (right bar). d) Copy number of the transposon was determined for transposition of three different ORs by QPCR of genomic DNA. Absolute copy number was determined by comparing the Cq for the transposons relative to the clonally integrated combined genetic reporter in the landing pad. The bars in part d represent (from left to right) control, M0R203-1, MOR9-1, and 01fr62.

[0060] FIG. 7. a) Trans AF b) Clone Selection. a) Comparison of transient OR activation (01fr62 and MOR30-1) with known ligands measured via the combined luciferase genetic reporter in the presence or absence of the accessory factors RTP1S and RTP2.
b) Mukku2a cells were transposed with four accessory factors (RTP1S, RTP2, Gaolf, and Ric8b) regulated under inducible expression. Individual clones were isolated and functionally assessed for accessory factor expression. Clones were assayed for transient OR
activation (01fr62 and 0R7D4) with known ligands via the separate luciferase genetic reporter. The clone (Mukku3a) that displayed robust activation for both, typical morphology and growth rates was selected for downstream applications.

[0061] FIG. 8. Landing Pad Integration.

[0062] FIG. 9. A genomically integrated synthetic circuit allows screening of mammalian olfactory receptor activation. a.) Schematic of the synthetic circuit for stable OR expression and function in an engineered HEK293T cell line. b) M0R42-3 reporter activation expressing the receptor transiently or genomically integrated at varying copy number and under constitutive or inducible expression. c) 01fr62 reporter activation with/without accessory factors and transiently expressed/integrated into the engineered cell line. d) Dose-response curves for OR reporter activation integrated into the engineered cell line.

[0063] FIG. 10. Large-Scale, Multiplexed Screening of Olfactory Receptor-Odorant Interactions. a) Schematic for the creation of a library of OR reporter cell lines and for multiplexed screening. b) Comparison of MOR30-1 and 01fr62 reporter activation when tested with a transient or genomically integrated luciferase assay or the pooled RNA-seq .. assay. c) Heatmap of all interactions from the screen clustered by similarity of the odorant and receptor responses and colored by the lowest concentration that triggered reporter activity. d) Hits identified for four ORs (black) mapped onto a PCA projection of the chemical space of our odorant panel (grey).

[0064] FIG. 11. Engineering HEK293 Cells for Stable, Functional OR
Expression. a) Comparison of M0R42-3 activation from inducibly driven receptor expression that was either transiently transfected or integrated at single copy at the H11 genomic locus. B.
Activation from cells with M0R42-3 integrated at multiple copies in the genome under either constitutive or inducible expression. c) Relative receptor/reporter DNA copy number determined with qPCR for three transposed ORs relative to a single copy integrant. d) MOR30-1 and 01fr62 activation (stimulated with Decanoic Acid and 2-Coumaranone respectively) co-transfected with or without accessory factors (AF) Ga olf, , Ric8b, RTP1S, and RTP2. e) Cell line generation for stable accessory factor expression.
After transfection, clones were isolated and screened for activation of the ORs, 01fr62 and 0R7D4, that require accessory factors to functionally express. The dark grey bar represents the clone selected for further experiments.

[0065] FIG. 12. Design of a Multiplexed Genetic Reporter for OR
Activation. a) Schematic of the vector containing the OR expression cassette and genetic reporter for integration. b) M0R42-3 reporter activation in cells transiently co-expressing the receptor cassette on separate plasmids or together. c) Fold activation of an engineered CRE enhancer compared to Promega's pGL4.19 CRE enhancer. d) Basal activation of genetic reporter upon induction of the inducible OR promoter with or without a DNA insulator upstream of the CRE enhancer.

[0066] FIG. 13. Schematic of the Synthetic Olfactory Activation Circuit in the Engineered Cell Line. Full graphical representation of the expressed components for expression/signaling of the ORs and the barcoded reporter system as shown in FIG. 9 and described in Example 2. Receptor expression is controlled by the Tet-On system. After doxycycline induction, the OR is expressed on the cell surface with assistance from two exogenously expressed chaperones, RTP1S and RTP2. Upon odorant activation, g protein signaling triggers cAMP production. Signaling is augmented by transgenic expression of the native OR G alpha subunit, G olf , and its corresponding GEF, Ric8b. cAMP
leads to activation of the kinase PKA that phosphorylates the transcription factor CREB
leading to expression of the barcoded reporter.

[0067] FIG. 14. Pilot-Scale Recapitulation of Odorant Response in Multiplex. a) Heatmap displaying 40 pooled receptors response to 9 odorants and 2 mixtures.
Interactions are colored by the log 2 -fold activation of the genetic reporter. Odorant interactions previously identified (Saito et al. 2009) are boxed in yellow. b) Dose-response curves for odorants or forskolin (adenylate cyclase stimulator) screened against the OR library at 5 concentrations.
Curves for ORs known to interact with the odorant are colored. Stimulation with forskolin does not show substantial differential activity between ORs in our assay.

[0068] FIG. 15. Library Representation. Representation of Individual ORs in the OR
library. a) Frequency of each OR as a fraction of the library as determined by the relative activation of each reporter incubated with DMSO. b) The relationship between frequency of each OR in the library and the average coefficient of variation between biological replicate measurements of reporter activation for all conditions.

[0069] FIG. 16. Replicability of the Large-Scale Multiplexed Screen. a) Histogram displaying the distribution of the coefficient of variation for the OR library when stimulated with DMSO. b) Histogram displaying the distribution of the coefficient of variation for the OR library for all conditions assayed. c) Dose-response curves for the control odorants included on each 96-well plate assayed. Each color represents a different plate.

[0070] FIG. 17. Significance and Fold Change of High-Throughput Assay Data a) The False Discovery Rate (FDR)-- computed from a generalized linear model with a negative binomial assumption and then multiple hypothesis corrected--plotted against the fold change for each OR-odorant interaction. The dashed line represents the 1% FDR, a conservative cutoff used to identify interactions b) The subset of interactions chosen for an orthogonal individual luciferase assay color indicates whether the interaction was detected. Of the interactions passing a 1% FDR, 21 of 28 also showed interaction in the orthogonal followup assay.

[0071] FIG. 18. Recapitulation of the Screen in a Transient, Orthogonal System.
Secondary screen of chemicals against cell lines expressing a single olfactory receptor using a luciferase readout. Each plot shows the behavior of a negative control cell line not expressing an OR but treated with odorant (black line), as well as a cell line expressing a specific OR. In addition data from the high throughput sequencing screen (labeled Seq) is plotted for reference.

[0072] FIG. 19. Assay Correspondence with Previously Screened Odorant-Receptor Pairs. a) FDR plotted against fold induction for the 540 odorant-OR
interactions that were previously tested by Saito et al. Points are colored by the EC50 of the interaction identified by Saito et al. (2009). Grey points represent interactions not identified in the previous screen.
Comparing transient versus integrated luciferase assays revealed that, in some cases, the integrated system required a higher concentration of odorant to achieve significant activation, likely because of the lower DNA copy number of the CRE-driven luciferase and receptor.
Since the highest concentration of odorant assayed was 1 mM, low affinity interactions may be not have been detectable in this screen. b) The FDR in the assay related to the EC50 of the hit from the previous screen colored by the fold activation from the multiplexed screen.

[0073] FIG. 20. Clustering of Odorant Response for Receptors. Here we plot the locations of any hits (black) with respect to the other chemicals tested (grey) on the same coordinates as FIG. 20. This provides a visualization of the breadth of activity for a given OR with respect to the larger chemicals space.

[0074] FIG. 21 Deep Mutational Scanning Overview.

[0075] FIG. 22. Distribution of Library Activity.

[0076] FIG. 23. Variant activity landscape for (32 at 0.625 uM
Isoproterenol.

[0077] FIG. 24. Comparison to Individually Assayed Mutants

[0078] FIG. 25. Ligand Interaction Sites.

[0079] FIG. 26. k-means Clustering.

[0080] FIG. 27. A) Diagram of how Bxbl recombination works in the context of a test to ensure only one construct is inserted per cell (cells will be only red or green) B) Flow Results of Two Color Test C) Activity of Reporter when stimulated with B2 agonist, isoproterenol, in the KO or wild type cells. D) When adding transgenic B2 in the single copy locus we can recover the ability to read B2 activity E) can be down on an RNA level as well and fold activation improved with an insulator element.

[0081] FIG. 28. Diagram of B2 construct being inserted into H11 locus.
DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS

[0082] Brute-force chemical screens have significant financial costs, scaling issues, and in the case of some receptors, such as olfactory recedptors, the screens also suffer from unreliable functional expression. Recently, a large-scale effort to conduct a comprehensive olfactory screen for human receptors assayed 394 ORs across 73 odorants. The researchers constructed a cell line that in combination with transient transfection allowed expression of all required factors for functional OR expression. Activation of the transiently transfected OR
leads to luciferase reporter expression, which they can assay in multi-well plates. This screen required >50,000 individual measurements and took many years. This study alone doubled the known number of ligand-receptor binding pairs, and mapped 27 human OR
receptors to their chemical ligands. Despite the success of this approach, the scale required to perform this relatively small chemical screen was so large because every compound had to be tested at a range of concentrations across hundreds of ORs with each test requiring a separate transient transfection. Such methods thus have little chance of scaling to the types of methods of the disclosure.

[0083] The methods of the disclosure describe the construction of large libraries of receptors contained within cell lines that can report on their activity in multiplex using detection methods described herein. With this automatable characterization platform, the current methods can be used to investigate ligand and receptor binding on a scale that is much larger that has been performed before. The assays and methods can have a multitude of applications in drug discovery and testing.
I. Receptors and inducible reporter elements

[0084] The current methods, nucleic acids, vectors, viral particles, and cells of the disclosure relate to receptor proteins that, upon ligand engagement, induce the transcription of a reporter through the receptor-responsive element. Accordingly, the reporter is either under the direct control of the receptor protein or indirectly controlled by the receptor protein.
The term "receptor-responsive element" refers to an element in the promoter region of the inducible reporter that is bound by the receptor or a down-stream element of the receptor after receptor and ligand engagement. In some embodiments, the receptor protein is a G-protein coupled receptor (GPCR) or the receptor gene encodes for a GPCR. G
Protein Coupled Receptors (GPCRs) regulate a wide variety of normal biological processes and play a role in the pathophysiology of many diseases upon dysregulation of their downstream signaling activities. GPCR ligands include neurotransmitters, hormones, cytokines, and lipid signaling molecules. GPCRs regulate a wide variety of biological processes, such as vision, olfaction, the autonomic nervous system, and behavior. Besides its extracellular ligand, each GPCR binds specific intracellular heterotrimeric G-proteins composed of G-alpha, G-beta, and G-gamma subunits, which activate downstream signaling pathways. These intracellular signaling pathways include cAMP/PKA, calcium/NFAT, phospholipase C, protein tyrosine kinases, MAP kinases, PI-3-kinase, nitric oxide/cGMP, Rho, and JAK/STAT.
Disruptions in GPCR function or signaling contribute to pathological conditions as varied as their ligands and the processes they regulate, from neurological to immunological to hormonal disorders.
GPCRs represent 30 percent of all current drug development targets. Developing drug screening assays requires a survey of both target and related GPCR expression and function in the chosen cell-based model system as well as expression of related GPCRs to assess both direct and potential off-target side effects.

[0085] It is within the skill of one in the art to construct a receptor gene/receptor-responsive element based on the extensive knowledge of receptor signaling and transcriptional regulation effected by the receptor.

[0086] In the case of GPCRs, the inducible reporter comprises a response element that .. directs transcriptional activity of the reporter upon GPCR signal transduction activation by ligand engagement. GPCR response elements include: cAMP response element (CRE), nuclear factor of activated T-cells response element (NFAT-RE), serum response element (SRE) and serum response factor response element (SRF-RE). GPCRs can further be classified as Gs, GI, Gq, and G12. Examples of receptor gene/protein and response element is shown in the table below:
Receptor gene/protein Response element Gs CRE
Gi SRE
Gq NFAT-RE

[0087] The Golf or G olfactory receptor is a Gs GPCR whose signal transduction converts ATP to cAMP. cAMP then directs transcription through the CRE response element.

Exemplary olfactory receptors include those tabulated below:

[0089] Olfactory receptors, family 1:
Approved Previous Approved Name Synonyms Chromosome Symbol Symbols OR1A1 olfactory receptor family 1 0R17-7 17p13.3 subfamily A member 1 OR1A2 olfactory receptor family 1 0R17-6 17p13.3 subfamily A member 2 OR1AA1P olfactory receptor family 1 Xq26.2 subfamily AA member 1 pseudogene OR1AB1P olfactory receptor family 1 19p13.12 subfamily AB member 1 pseudogene OR1AC1P olfactory receptor family 1 17p13.3 subfamily AC member 1 pseudogene OR1B1 olfactory receptor family 1 0R9-B 9q33.2 subfamily B member 1 (gene/pseudogene) OR1C1 olfactory receptor family 1 TPCR27, 1q44 subfamily C member 1 HSTPCR27 OR17-23, olfactory receptor family 1 OR1D6P, OR1D3P OR11-13, 17p13.3 subfamily D member 3 pseudogene OR1D7P

olfactory receptor family 1 OR1D4 subfamily D member 4 0R17-30 17p13.3 (gene/pseudogene) olfactory receptor family 1 OR1D5 0R17-31 17p13.3 subfamily D member 5 OR17-2, OR1E9P, olfactory receptor family 1 HGM071, OR 1E1 OR1E5, 17p13.3 subfamily E member 1 0R17-32, olfactory receptor family 1 0R17-93, OR1E2 OR1E4 17p13.2 subfamily E member 2 0R17-135 olfactory receptor family 1 OR1E3 subfamily E member 3 OR1E3P 0R17-210 17p13.3 (gene/pseudogene) OR1F4, Olfmf, 0R16-0R1F6, 36, 0R16-37, OR1F7, OR16-88, olfactory receptor family 1 OR1F8, OR1F1 0R16-89, 16p13.3 subfamily F member 1 OR1F9, OR16-90, OR1F5, OLFMF, OR3-0R1F10, olfactory receptor family 1 OR1F3P, OR1F2P OLFMF2 16p13.3 subfamily F member 2 pseudogene OR1F2 olfactory receptor family 1 hs6M1-35P, OR1F12 OR1F12P 6p22.1 subfamily F member 12 OR1F12Q
olfactory receptor family 1 OR1G1 OR1G2 0R17-209 17p13.3 subfamily G member 1 olfactory receptor family 1 OR1H1P OR1H1 0ST26 9q33.2 subfamily H member 1 pseudogene OR1I1P, olfactory receptor family 1 ORM 0R19-20, 19p13.1 subfamily I member 1 olfactory receptor family 1 OR1J1 hg32 9q33.2 subfamily J member 1 olfactory receptor family 1 OR1J3, OR1J2 0ST044 9q33.2 subfamily J member 2 OR1J5 OR1J4 olfactory receptor family 1 HTPCRX01, 9q33.2 subfamily J member 4 HSHTPCRX01 OR1K1 olfactory receptor family 1 hg99, MNAB 9q33 subfamily K member 1 OR 1L1 olfactory receptor family 1 OR1L2 0R9-C 9q33.2 subfamily L member 1 OR1L3 olfactory receptor family 1 0R9-D 9q33.2 subfamily L member 3 OR1L4 olfactory receptor family 1 OR1L5 0R9-E 9q33.2 subfamily L member 4 OR1L6 olfactory receptor family 1 OR1L7 9q33.2 subfamily L member 6 OR1L8 olfactory receptor family 1 9q33.2 subfamily L member 8 OR1M1 olfactory receptor family 1 0R19-6 19p13.2 subfamily M member 1 olfactory receptor family 1 OR1M4P 19p13.2 subfamily M member 4 pseudogene olfactory receptor family 1 OR1N1 OR1N3 OR1-26 9q33.2 subfamily N member 1 olfactory receptor family 1 OR1N2 9q33.2 subfamily N member 2 olfactory receptor family 1 OR1P1 subfamily P member 1 OR1P1P 0R17-208 17p13.3 (gene/pseudogene) 0ST226, 0R9-A, olfactory receptor family 1 OR1Q2, OR1Q1 HSTPCR106, 9q33.2 subfamily Q member 1 OR1Q3 A, TPCR106 OR20A1P, olfactory receptor family 1 OR1R1P OR1R2P, 0R17-1 17p13.3 subfamily R member 1 pseudogene olfactory receptor family 1 OR1S1 subfamily S member 1 05T034 11q12.1 (gene/pseudogene) olfactory receptor family 1 OR1S2 11q12.1 subfamily S member 2 olfactory receptor family 1 OR1X1P 5q35.2 subfamily X member 1 pseudogene olfactory receptor family 1 OR1X5P 5q35.3 subfamily X member 5 pseudogene [0090] Olfactory receptors, family 2:
Approved Previous Approved Name Synonyms Chromosome Symbol Symbols OR2A1 olfactory receptor family 2 subfamily 7q35 A member 1 0R2A2 olfactory receptor family 2 subfamily OR2A2P, 05T008 7q35 A member 2 OR2A17P
OR2A3P olfactory receptor family 2 subfamily 7q35 A member 3 pseudogene 0R2A4 olfactory receptor family 2 subfamily OR2A10 6q23.2 A member 4 0R2A5 olfactory receptor family 2 subfamily 0R2A8, 0R7-138, 7q35 A member 5 0R2A26 0R7-141 0R2A7 olfactory receptor family 2 subfamily HSDJ0798C
7q35 A member 7 17 OR2A9P olfactory receptor family 2 subfamily HSDJ0798C
OR2A9 7q35 A member 9 pseudogene 17 0R2Al2 olfactory receptor family 2 subfamily OR2Al2P 7q35 A member 12 OR2A13P olfactory receptor family 2 subfamily 7q35 A member 13 pseudogene 0R2A14 olfactory receptor family 2 subfamily OR2A14P, 05T182 7q35 A member 14 0R2A6 OR2A15P olfactory receptor family 2 subfamily 0R2A28P 7q35 A member 15 pseudogene OR2A2OP olfactory receptor family 2 subfamily 0R2A20 7q35 A member 20 pseudogene 0R2A25 olfactory receptor family 2 subfamily 0R2A25P, 7q35 A member 25 0R2A27 OR2A41P olfactory receptor family 2 subfamily 7q35 A member 41 pseudogene 0R2A42 olfactory receptor family 2 subfamily 7q35 A member 42 OR2AD1P olfactory receptor family 2 subfamily OR2AD1, 6p22.1 AD member 1 pseudogene hs6M1-8P
OR2AE1 olfactory receptor family 2 subfamily OR2AE2 7q22.1 AE member 1 OR2AF1P olfactory receptor family 2 subfamily OR2AF2P Xq26.2 AF member 1 pseudogene OR2AG1 olfactory receptor family 2 subfamily OR2AG3 11p15.4 AG member 1 (gene/pseudogene) OR2AG2 olfactory receptor family 2 subfamily OR2AG2P 11p15.4 AG member 2 OR2AH1P olfactory receptor family 2 subfamily 1 1q12.1 AH member 1 pseudogene OR2AI1P olfactory receptor family 2 subfamily 5q35.3 AT member 1 pseudogene OR2AJ1 olfactory receptor family 2 subfamily OR2AJ1P OR2AJ1Q 1q44 AJ member 1 OR2AK2 olfactory receptor family 2 subfamily OR2AK1P 1q44 AK member 2 OR2AL1P olfactory receptor family 2 subfamily 11q22.3 AL member 1 pseudogene OR2AM1P olfactory receptor family 2 subfamily 9p13.3 AM member 1 pseudogene OR2A01P olfactory receptor family 2 subfamily 7q35 AO member 1 pseudogene OR2AP1 olfactory receptor family 2 subfamily OR2AP1P 12q13.2 AP member 1 OR2AQ1P olfactory receptor family 2 subfamily 1q23.1 AQ member 1 pseudogene OR2AS1P olfactory receptor family 2 subfamily 1q44 AS member 1 pseudogene OR2AS2P olfactory receptor family 2 subfamily 1q44 AS member 2 pseudogene OR2AT1P olfactory receptor family 2 subfamily 11q13.4 AT member 1 pseudogene OR2AT2P olfactory receptor family 2 subfamily 11q13.4 AT member 2 pseudogene OR2AT4 olfactory receptor family 2 subfamily 11q13.4 AT member 4 0R2B2 hs6M1-10, olfactory receptor family 2 subfamily 0R2B9 0R61, 6p22.1 B member 2 0R2B3 olfactory receptor family 2 subfamily OR2B3P 0R6-4 6p22.1 B member 3 OR2B4P olfactory receptor family 2 subfamily hs6M1-22 6p22.2-p21.32 B member 4 pseudogene 0R2B6 OR2B6P, 0R6-31, olfactory receptor family 2 subfamily OR2B1, dJ408B20.2, 6p22.1 B member 6 OR2B1P, 0R5-40, OR2B7P olfactory receptor family 2 subfamily hs6M1-31P 6p22.1 B member 7 pseudogene OR2B8P olfactory receptor family 2 subfamily 0R2B8 hs6M1-29P 6p22.1 B member 8 pseudogene OR2B11 olfactory receptor family 2 subfamily 1q44 B member 11 OR2BH1P olfactory receptor family 2 subfamily 11p14.1 BH member 1 pseudogene OR2C1 olfactory receptor family 2 subfamily OR2C2P OLFmf3 16p13.3 C member 1 0R2C3 olfactory receptor family 2 subfamily 0R2C4, 0ST742 1q44 C member 3 OR2C5P
0R2D2 olfactory receptor family 2 subfamily OR11-610, OR2D1 11p15.4 D member 2 hg27 0R2D3 olfactory receptor family 2 subfamily 11p15.4 D member 3 OR2E1P hs6M1-9, hs6M1-9p, olfactory receptor family 2 subfamily OR2E1, HS29K1, 6p22-p21.3 E member 1 pseudogene 0R2E2 OR2F1 0R2F4, OLF3, 0R7-olfactory receptor family 2 subfamily 0R2F5, 140, 0R7-7q35 F member 1 (gene/pseudogene) 0R2F3, 139, 0R14-0R2F2 olfactory receptor family 2 subfamily OR7-1 7q35 F member 2 OR2G1P olfactory receptor family 2 subfamily 0ST619, 6p22.2-p21.32 G member 1 pseudogene hs6M1-25 0R2G2 olfactory receptor family 2 subfamily 1q44 G member 2 0R2G3 olfactory receptor family 2 subfamily 1q44 G member 3 0R2G6 olfactory receptor family 2 subfamily 1q44 G member 6 OR2H1 olfactory receptor family 2 subfamily 0R2H6, 0R6-2 6p22.1 H member 1 0R2H8 0R2H2 olfactory receptor family 2 subfamily hs6M1-12 6p22.1 H member 2 OR2H4P 0R6-3, olfactory receptor family 2 subfamily 0R2H4, 6p22.2-p21.31 H member 4 pseudogene hs6M1-7, dJ80I19.6 OR2H5P 0R2H5, olfactory receptor family 2 subfamily hs6M1-13, 6p22.2-p21.31 H member 5 pseudogene 0R211P OR211, olfactory receptor family 2 subfamily 0R2I3P, HS6M114 6p22.1 I member 1 pseudogene 0R2I4P, OR2J1 0R6-5, olfactory receptor family 2 subfamily OR2J1P hs6M1-4, 6p22.1 J member 1 (gene/pseudogene) dJ80I19.2 0R2J2 0R6-8, olfactory receptor family 2 subfamily hs6M1-6, 6p22.1 J member 2 dJ80I19.4 0R2J3 olfactory receptor family 2 subfamily 0R6-6 6p22.1 J member 3 OR2J4P 0R6-9, olfactory receptor family 2 subfamily hs6M1-5, 6p22.2-p21.31 J member 4 pseudogene dJ80I19.5 0R2K2 HTPCRH06, olfactory receptor family 2 subfamily OR2AR1P HSHTPCRH 9q31.3 K member 2 OR2L1P HTPCRX02, olfactory receptor family 2 subfamily OR2L1, HSHTPCRX 1q44 L member 1 pseudogene OR2L7P

0R2L2 HTPCRH07, olfactory receptor family 2 subfamily OR2L4P, HSHTPCRH 1q44 L member 2 0R2L12 0R2L3 olfactory receptor family 2 subfamily 1q44 L member 3 0R2L5 olfactory receptor family 2 subfamily OR2L11, 1q44 L member 5 OR2L5P
OR2L6P olfactory receptor family 2 subfamily 1q44 L member 6 pseudogene 0R2L8 olfactory receptor family 2 subfamily 1q44 L member 8 (gene/pseudogene) OR2L9P olfactory receptor family 2 subfamily 1q44 L member 9 pseudogene OR2L13 olfactory receptor family 2 subfamily 0R2L14 1q44 L member 13 OR2M1P olfactory receptor family 2 subfamily OR2M1 0ST037 1q44 M member 1 pseudogene 0R2M2 olfactory receptor family 2 subfamily 0ST423, 1q44 M member 2 OR2M2Q
0R2M3 olfactory receptor family 2 subfamily 0R2M6, OST003 1q44 M member 3 OR2M3P
0R2M4 HTPCRX18, olfactory receptor family 2 subfamily TPCR100, 1q44 M member 4 HSHTPCRX
18, OST710 0R2M5 olfactory receptor family 2 subfamily OR2M5P 1q44 M member 5 0R2M7 olfactory receptor family 2 subfamily 1q44 M member 7 OR2N1P olfactory receptor family 2 subfamily 0R6-7 6p22.2-p21.31 N member 1 pseudogene OR2P1P olfactory receptor family 2 subfamily hs6M1-26 6p22.1 P member 1 pseudogene OR2Q1P olfactory receptor family 2 subfamily 0R7-2 7q33-q35 Q member 1 pseudogene OR2R1P olfactory receptor family 2 subfamily OR2R1 0ST058 7q35 R member 1 pseudogene OR2S1P olfactory receptor family 2 subfamily 0ST611 9p13.3 S member 1 pseudogene 0R2S2 olfactory receptor family 2 subfamily 9p13.3 S member 2 (gene/pseudogene) OR2T1 olfactory receptor family 2 subfamily OR1-25 1q44 T member 1 0R2T2 olfactory receptor family 2 subfamily OR2T2P 1q44 T member 2 0R2T3 olfactory receptor family 2 subfamily 1q44 T member 3 0R2T4 olfactory receptor family 2 subfamily OR2T4Q 1q44 T member 4 0R2T5 olfactory receptor family 2 subfamily 1q44 T member 5 0R2T6 olfactory receptor family 2 subfamily OR2T6P, 05T703 1q44 T member 6 0R2T9 0R2T7 olfactory receptor family 2 subfamily OR2T7P 05T723 1q44 T member 7 0R2T8 olfactory receptor family 2 subfamily OR2T8P 1q44 T member 8 OR2T10 olfactory receptor family 2 subfamily 1q44 T member 10 OR2T11 olfactory receptor family 2 subfamily OR2T11Q 1q44 T member 11 (gene/pseudogene) 0R2T12 olfactory receptor family 2 subfamily 1q44 T member 12 0R2T27 olfactory receptor family 2 subfamily 1q44 T member 27 0R2T29 olfactory receptor family 2 subfamily 1q44 T member 29 0R2T32P olfactory receptor family 2 subfamily 1q44 T member 32 pseudogene 0R2T33 olfactory receptor family 2 subfamily 1q44 T member 33 0R2T34 olfactory receptor family 2 subfamily 1q44 T member 34 0R2T35 olfactory receptor family 2 subfamily 1q44 T member 35 OR2U1P olfactory receptor family 2 subfamily OR2AU1P hs6M1-24 6p22.2-p21.32 U member 1 pseudogene OR2U2P olfactory receptor family 2 subfamily hs6M1-23 6p22.2-p21.32 U member 2 pseudogene OR2V1 olfactory receptor family 2 subfamily OR2V1P 0ST265 5q35.3 V member 1 0R2V2 olfactory receptor family 2 subfamily 0R2V3 0ST713 5q35.3 V member 2 OR2W1 olfactory receptor family 2 subfamily hs6M1-15 6p22.1 W member 1 OR2W2P olfactory receptor family 2 subfamily hs6M1-30P 6p22.1 W member 2 pseudogene 0R2W3 olfactory receptor family 2 subfamily OR2W8P, 0ST718 1q44 W member 3 OR2W3P
OR2W4P olfactory receptor family 2 subfamily 6p22.1 W member 4 pseudogene 0R2W5 olfactory receptor family 2 subfamily OR2W5P 0ST722 1q44 W member 5 (gene/pseudogene) OR2W6P olfactory receptor family 2 subfamily OR2W7P 6p22.1 W member 6 pseudogene OR2X1P olfactory receptor family 2 subfamily 1q44 X member 1 pseudogene OR2Y1 olfactory receptor family 2 subfamily 5q35.3 Y member 1 OR2Z1 olfactory receptor family 2 subfamily 0R2Z2 19p13.2 Z member 1 [0091] Olfactory receptors, family 3:
Approved Previous Approved Name Synonyms Chromosome Symbol Symbols OR3A1 olfactory receptor family 3 OLFRA03, 0R40, 17p13.3 subfamily A member 1 0R17-40 0R3A2 olfactory receptor family 3 OLFRA04, 17p13.3 subfamily A member 2 0R228, 0R17-228 0R3A3 0R3A6, olfactory receptor family 3 0R17-201, 0R17-0R3A7, 17p13.2 subfamily A member 3 137, 0R17-16 OR3A4P olfactory receptor family 3 0R3A4 17p13.3 subfamily A member 4 pseudogene OR3B1P olfactory receptor family 3 Xq28 subfamily B member 1 pseudogene OR3D1P olfactory receptor family 3 1q44 subfamily D member 1 pseudogene [0092] Olfactory receptors, family 4:
Approved Previous Approved Name Synonyms Chromosome Symbol Symbols olfactory receptor family 4 subfamily OR4A1P OR4A2OP OR11-30 11p11.12 A member 1 pseudogene olfactory receptor family 4 subfamily OR4A2P 1 lql 1 A member 2 pseudogene olfactory receptor family 4 subfamily OR4A3P 1 lql 1 A member 3 pseudogene olfactory receptor family 4 subfamily OR4A4P 0R4A4 1 1q11 A member 4 pseudogene olfactory receptor family 4 subfamily A member 5 olfactory receptor family 4 subfamily A member 6 pseudogene olfactory receptor family 4 subfamily A member 7 pseudogene olfactory receptor family 4 subfamily 0R4A8 OR4A8P 11q11 A member 8 (gene/pseudogene) olfactory receptor family 4 subfamily A member 9 pseudogene olfactory receptor family 4 subfamily A member 10 pseudogene olfactory receptor family 4 subfamily A member 11 pseudogene olfactory receptor family 4 subfamily OR4Al2P 1101 A member 12 pseudogene olfactory receptor family 4 subfamily A member 13 pseudogene olfactory receptor family 4 subfamily A member 14 pseudogene olfactory receptor family 4 subfamily A member 15 olfactory receptor family 4 subfamily A member 16 olfactory receptor family 4 subfamily OR4A17P 0R4A22P 11q11 A member 17 pseudogene olfactory receptor family 4 subfamily OR4A18P 11p11.12 A member 18 pseudogene olfactory receptor family 4 subfamily OR4A19P 11p11.12 A member 19 pseudogene olfactory receptor family 4 subfamily A member 21 pseudogene olfactory receptor family 4 subfamily OR4A4OP 11p11.2 A member 40 pseudogene olfactory receptor family 4 subfamily OR4A41P 11p11.2 A member 41 pseudogene olfactory receptor family 4 subfamily 0R4A42P 11p11.2 A member 42 pseudogene olfactory receptor family 4 subfamily 0R4A43P 11p11.2 A member 43 pseudogene olfactory receptor family 4 subfamily 0R4A44P 11p11.2 A member 44 pseudogene olfactory receptor family 4 subfamily 0R4A45P 11p11.2 A member 45 pseudogene olfactory receptor family 4 subfamily 0R4A46P 11p11.2 A member 46 pseudogene olfactory receptor family 4 subfamily 0R4A47 11p11.2 A member 47 olfactory receptor family 4 subfamily 0R4A48P 11p11.2 A member 48 pseudogene olfactory receptor family 4 subfamily 0R4A49P 11p11.12 A member 49 pseudogene olfactory receptor family 4 subfamily OR4A5OP 1 lql 1 A member 50 pseudogene olfactory receptor family 4 subfamily OR4B1 0ST208 11p11.2 B member 1 olfactory receptor family 4 subfamily OR4B2P hg449 11p11.2 B member 2 pseudogene olfactory receptor family 4 subfamily HTPCRX11, OR4C1P OR4C1 1 lql 1 C member 1 pseudogene HSHTPCRX11 olfactory receptor family 4 subfamily OR4C2P OR4C8P 11p11.2 C member 2 pseudogene olfactory receptor family 4 subfamily 0R4C3 11p11.2 C member 3 olfactory receptor family 4 subfamily OR4C17P, OR4C4P 0R4C47P 11q12.1 C member 4 pseudogene 0R4C17 olfactory receptor family 4 subfamily 0R4C5 OR4C5P OR4C5Q 11p11.2 C member 5 (gene/pseudogene) olfactory receptor family 4 subfamily C member 6 olfactory receptor family 4 subfamily C member 7 pseudogene olfactory receptor family 4 subfamily OR4C9P 11p11.2 C member 9 pseudogene olfactory receptor family 4 subfamily OR4C1OP 11p11.2 C member 10 pseudogene olfactory receptor family 4 subfamily C member 11 olfactory receptor family 4 subfamily 0R4C12 11p11.12 C member 12 olfactory receptor family 4 subfamily 0R4C13 11p11.12 C member 13 olfactory receptor family 4 subfamily C member 14 pseudogene olfactory receptor family 4 subfamily C member 15 olfactory receptor family 4 subfamily C member 16 (gene/pseudogene) olfactory receptor family 4 subfamily 0R4C45 11p11.12 C member 45 (gene/pseudogene) olfactory receptor family 4 subfamily C member 46 olfactory receptor family 4 subfamily 0R4C48P 11p11.12 C member 48 pseudogene olfactory receptor family 4 subfamily 0R4C49P 11p11.12 C member 49 pseudogene olfactory receptor family 4 subfamily C member 50 pseudogene olfactory receptor family 4 subfamily OR4D1 0R4D3 TPCR16 17q22 D member 1 olfactory receptor family 4 subfamily 0R4D2 17q22 D member 2 olfactory receptor family 4 subfamily 0R4D5 11q24.1 D member 5 olfactory receptor family 4 subfamily 0R4D6 11q12.1 D member 6 olfactory receptor family 4 subfamily OR4D7P 0ST724 11q12.1 D member 7 pseudogene olfactory receptor family 4 subfamily OR4D8P 11q12.1 D member 8 pseudogene olfactory receptor family 4 subfamily 0R4D9 11q12.1 D member 9 olfactory receptor family 4 subfamily OR4D10 OR4D1OP OST711 11q12.1 D member 10 olfactory receptor family 4 subfamily OR4D11 OR4D11P 11q12.1 D member 11 olfactory receptor family 4 subfamily OR4D12P OR7E103P 4p16.3 D member 12 pseudogene olfactory receptor family 4 subfamily OR4E1 OR4E1P 14q11.2 E member 1 (gene/pseudogene) olfactory receptor family 4 subfamily 0R4E2 14q11.2 E member 2 olfactory receptor family 4 subfamily HSDJ0609N19 6p25.3 F member 1 pseudogene olfactory receptor family 4 subfamily 0R4F2, hs6M1-0R4F2P 11p15.5 F member 2 pseudogene 11, S191N21 olfactory receptor family 4 subfamily 0R4F3 5q35.3 F member 3 olfactory receptor family 4 subfamily 0R4F4 0R4F18 15q26.3 F member 4 olfactory receptor family 4 subfamily 0R4F5 1p36.33 F member 5 olfactory receptor family 4 subfamily 0R4F6 0R4F12 15q26.3 F member 6 olfactory receptor family 4 subfamily OR4F7P OR4F10 6q27 F member 7 pseudogene olfactory receptor family 4 subfamily OR4F20P, OR4F8P 19p13.3 F member 8 pseudogene OR4F9P
olfactory receptor family 4 subfamily OR4F13P 15q26.3 F member 13 pseudogene olfactory receptor family 4 subfamily OR4F14P 0R4F14 15q26.3 F member 14 pseudogene olfactory receptor family 4 subfamily 0R4F15 15q26.3 F member 15 olfactory receptor family 4 subfamily 0R4F16 1p36.33 F member 16 OR4F19, olfactory receptor family 4 subfamily 0R4F17 OR4F11P, 19p13.3 F member 17 olfactory receptor family 4 subfamily 0R4F21 OR4F21P 8p23.3 F member 21 olfactory receptor family 4 subfamily 0R4F28P 15q26.3 F member 28 pseudogene olfactory receptor family 4 subfamily 0R4F29 1p36.33 F member 29 olfactory receptor family 4 subfamily OR4G1P OR4G8P OLB 19p13.3 G member 1 pseudogene olfactory receptor family 4 subfamily OR4G2P OR4G7P 15q26.3 G member 2 pseudogene olfactory receptor family 4 subfamily 0R4G3, OR4G3P OLC, OLC-7501 19p13.3 G member 3 pseudogene OR4G5P
olfactory receptor family 4 subfamily OR4G4P 1p36.33 G member 4 pseudogene olfactory receptor family 4 subfamily OR4G6P 15q26.3 G member 6 pseudogene olfactory receptor family 4 subfamily 0R4G11P 1p36.33 G member 11 pseudogene OR4H9P, OR4H1OP, OR4H5P, OR4H11P, OR4H5, OR15-71, OR4H7, 0R4H6, 0R15-0R4H7P, 82, OR4H9, OR4H2P, 0R5-39, 0R5-84, olfactory receptor family 4 subfamily OR4H3P, OR4H6P 0R4-114, 0R4- 15q11.2 H member 6 pseudogene OR4H11, 115, 0R4-119, OR4H2, 0R15-69, 0R15-0R4H3, 80, 0R15-81, OR4H1P, OR4H4P, OR4H10, OR4H4, OR4H8P, olfactory receptor family 4 subfamily 0R4H12P 0R4H12 Cl4orf14 14p13 H member 12 pseudogene olfactory receptor family 4 subfamily 0R4K1 14q11.2 K member 1 olfactory receptor family 4 subfamily 0R4K2 14q11.2 K member 2 olfactory receptor family 4 subfamily 0R4K3 OR4K3P 14q11.2 K member 3 (gene/pseudogene) olfactory receptor family 4 subfamily OR4K4P 14q11.2 K member 4 pseudogene olfactory receptor family 4 subfamily 0R4K5 14q11.22 K member 5 olfactory receptor family 4 subfamily OR4K6P 14q11.2 K member 6 pseudogene olfactory receptor family 4 subfamily OR4K7P OR4K1OP 18p11.21 K member 7 pseudogene olfactory receptor family 4 subfamily OR4K8P OR4K9P 18p11.21 K member 8 pseudogene olfactory receptor family 4 subfamily OR4K11P 0R21-1 21q11.2 K member 11 pseudogene olfactory receptor family 4 subfamily OR4K12P 0R21-2 21q11.2 K member 12 pseudogene olfactory receptor family 4 subfamily 0R4K13 14q11.2 K member 13 olfactory receptor family 4 subfamily 0R4K14 14q11.2 K member 14 olfactory receptor family 4 subfamily 0R4K15 OR4K15Q 14q11.2 K member 15 olfactory receptor family 4 subfamily OR4K16P 14q11.2 K member 16 pseudogene olfactory receptor family 4 subfamily 0R4K17 14q11.2 K member 17 olfactory receptor family 4 subfamily OR4L1 OR4L2P 14q11.2 L member 1 olfactory receptor family 4 subfamily OR4M1 14q11.2 M member 1 olfactory receptor family 4 subfamily 0R4M2 15q11.2 M member 2 olfactory receptor family 4 subfamily OR4N1P 14q11.2 N member 1 pseudogene olfactory receptor family 4 subfamily 0R4N2 14q11.2 N member 2 olfactory receptor family 4 subfamily OR4N3P 15q11.2 N member 3 pseudogene olfactory receptor family 4 subfamily 0R4N4 15q11.2 N member 4 olfactory receptor family 4 subfamily 0R4N5 14q11.2 N member 5 olfactory receptor family 4 subfamily P member 1 pseudogene olfactory receptor family 4 subfamily P member 4 olfactory receptor family 4 subfamily OR4Q1P 15q11.2 Q member 1 pseudogene olfactory receptor family 4 subfamily 0R4Q2 OR4Q2P 14q11.2 Q member 2 (gene/pseudogene) olfactory receptor family 4 subfamily 0R4Q3 0R4Q4 C14orf13 14p13 Q member 3 olfactory receptor family 4 subfamily OR4R1P 11p11.2 R member 1 pseudogene olfactory receptor family 4 subfamily R member 2 pseudogene olfactory receptor family 4 subfamily OR4R3P 11p11.12 R member 3 pseudogene olfactory receptor family 4 subfamily OR4S1 11p11.2 S member 1 olfactory receptor family 4 subfamily S member 2 olfactory receptor family 4 subfamily OR4T1P 14q11.2 T member 1 pseudogene olfactory receptor family 4 subfamily OR4U1P 14q11.2 U member 1 pseudogene olfactory receptor family 4 subfamily V member 1 pseudogene olfactory receptor family 4 subfamily OR4W1P Xq25 W member 1 pseudogene olfactory receptor family 4 subfamily OR4X1 11p11.2 X member 1 (gene/pseudogene) olfactory receptor family 4 subfamily 0R4X2 11p11.2 X member 2 (gene/pseudogene) olfactory receptor family 4 subfamily X member 7 pseudogene [0093] Olfactory receptors, family 5 Approved Previous Approved Name Synonyms Chromosome Symbol Symbols OR4A1P olfactory receptor family 5 subfamily OR5A1P 05T181 11q12.1 A member 1 OR4A2P olfactory receptor family 5 subfamily 11q12.1 A member 2 OR4A3P olfactory receptor family 5 subfamily OR5AC1P 3q11.2 AC member 1 (gene/pseudogene) OR4A4P olfactory receptor family 5 subfamily HSA1 3q11.2 AC member 2 0R4A5 olfactory receptor family 5 subfamily 3q11.2 AC member 4 pseudogene OR4A6P olfactory receptor family 5 subfamily 19q13.43 AH member 1 pseudogene OR4A7P olfactory receptor family 5 subfamily OR5AK5P 11q12.1 AK member 1 pseudogene 0R4A8 olfactory receptor family 5 subfamily 11q12.1 AK member 2 OR4A9P olfactory receptor family 5 subfamily OR5AK3 11q12.1 AK member 3 pseudogene OR4A1OP olfactory receptor family 5 subfamily 11q12.1 AK member 4 pseudogene OR4A11P olfactory receptor family 5 subfamily OR5AL1P 11q12.1 AL member 1 (gene/pseudogene) OR4Al2P olfactory receptor family 5 subfamily 11q12.1 AL member 2 pseudogene OR4A13P olfactory receptor family 5 subfamily 11q12.1 AM member 1 pseudogene OR4A14P olfactory receptor family 5 subfamily 11q12.1 AN member 1 0R4A15 olfactory receptor family 5 subfamily 11q12.1 AN member 2 pseudogene 0R4A16 olfactory receptor family 5 subfamily 1 lq AO member 1 pseudogene OR4A17P olfactory receptor family 5 subfamily 11q12.1 AP member 1 pseudogene OR4A18P olfactory receptor family 5 subfamily 11q12.1 AP member 2 OR4A19P olfactory receptor family 5 subfamily 11q12.1 AQ member 1 pseudogene OR4A21P olfactory receptor family 5 subfamily 11q12.1 AR member 1 (gene/pseudogene) OR4A4OP olfactory receptor family 5 subfamily 11q12.1 AS member 1 OR4A41P olfactory receptor family 5 subfamily 14q11.2 AU member 1 0R4A42P olfactory receptor family 5 subfamily Xq26.2 AW member 1 pseudogene 0R4A43P olfactory receptor family 5 subfamily 11q12.1 AZ member 1 pseudogene 0R4A44P OR5B9P, OR5B9, OR5B5P, OR8-122, OR5B14P, OR8-123, OR5B7P, olfactory receptor family 5 subfamily OR6-57, 0R5B7, 11q12.1 B member 1 pseudogene 0R6-55, OR5B8, OR3-144, OR5B8P, OR5B5, OR5B6, 0R4A45P olfactory receptor family 5 subfamily 0ST073 11q12.1 B member 2 0R4A46P olfactory receptor family 5 subfamily OR5B13 0ST129 11q12.1 B member 3 0R4A47 OR5B 11P, OR5B4P, 0R13-67, olfactory receptor family 5 subfamily OR5B10, 0R13-34, 11q12.1 B member 10 pseudogene 0R5B11, 0R13-64 0R4A48P olfactory receptor family 5 subfamily OR5B12P, 0ST743 11q12.1 B member 12 0R5B 16 0R4A49P olfactory receptor family 5 subfamily 11q12.1 B member 15 pseudogene OR4A5OP olfactory receptor family 5 subfamily OR5B2OP 11q12.1 B member 17 OR4B1 olfactory receptor family 5 subfamily 11q12.1 B member 19 pseudogene OR4B2P olfactory receptor family 5 subfamily 11q12.1 B member 21 OR4C1P olfactory receptor family 5 subfamily 11q12.1 BA member 1 pseudogene OR4C2P olfactory receptor family 5 subfamily 11q12.1 BB member 1 pseudogene 0R4C3 olfactory receptor family 5 subfamily 11q12.1 BC member 1 pseudogene OR4C4P olfactory receptor family 5 subfamily 11q12.1 BD member 1 pseudogene 0R4C5 olfactory receptor family 5 subfamily 11q12.1 BE member 1 pseudogene 0R4C6 olfactory receptor family 5 subfamily OR5BH2P Xq26.2 BH member 1 pseudogene OR4C7P olfactory receptor family 5 subfamily 0ST740 12q13.11 BJ member 1 pseudogene OR4C9P olfactory receptor family 5 subfamily 12q13.11 BK member 1 pseudogene OR4C1OP olfactory receptor family 5 subfamily 11q12.1 BL member 1 pseudogene OR4C11 olfactory receptor family 5 subfamily 3q11.2 BM member 1 pseudogene OR4C12 olfactory receptor family 5 subfamily 11q12.1 BN member 1 pseudogene OR4C13 olfactory receptor family 5 subfamily 11q12 BN member 2 pseudogene OR4C14P olfactory receptor family 5 subfamily 11q12.1 BP member 1 pseudogene OR4C15 olfactory receptor family 5 subfamily OR5BQ2P 11q12.1 BQ member 1 pseudogene OR4C16 olfactory receptor family 5 subfamily 11q12.1 BR member 1 pseudogene 0R4C45 olfactory receptor family 5 subfamily OR5B S 1 12q13.2 BS member 1 pseudogene 0R4C46 olfactory receptor family 5 subfamily 12q13.2 BT member 1 pseudogene 0R4C48P 0R9-F, olfactory receptor family 5 subfamily OR5C2P hRPK- 9q33.2 C member 1 0R4C49P OR5D6P, OR11-7a, OR5D1OP, 0R912-91, OR5D1P, 0R8-127, OR5D5P, 0R912-47, OR5D12P, 0R18-44, olfactory receptor family 5 subfamily OR5D8P, R5D9P, 1101 D member 2 pseudogene OR5D7P, 0R18-17, OR5D9P, 0R18-42, 0R5D12, 0R18-43, OR5D11P, 0R912-94, OR4C5OP olfactory receptor family 5 subfamily 0R5D3, OR11-8b, 11q12 D member 3 pseudogene 0R5D4 OR11-8c OR4D1 olfactory receptor family 5 subfamily D member 13 (gene/pseudogene) 0R4D2 olfactory receptor family 5 subfamily D member 14 0R4D5 olfactory receptor family 5 subfamily D member 15 pseudogene 0R4D6 olfactory receptor family 5 subfamily 11q12.1 D member 16 OR4D7P olfactory receptor family 5 subfamily D member 17 pseudogene OR4D8P olfactory receptor family 5 subfamily 11q12.1 D member 18 0R4D9 olfactory receptor family 5 subfamily TPCR24, OR5E1 11p15.4 E member 1 pseudogene HSTPCR24 OR4D10 olfactory receptor family 5 subfamily OR11-10 11q12.1 F member 1 OR4D11 olfactory receptor family 5 subfamily 11q12.1 F member 2 pseudogene OR4D12P olfactory receptor family 5 subfamily OR11-104, OR5G2P 11q12.1 G member 1 pseudogene 0R93 OR4E1 olfactory receptor family 5 subfamily OR5G6P, 11q12.1 G member 3 (gene/pseudogene) OR5G3P
0R4E2 olfactory receptor family 5 subfamily 11q12.1 G member 4 pseudogene OR4F1P olfactory receptor family 5 subfamily 11q12.1 G member 5 pseudogene OR4F2P HTPCRX14, olfactory receptor family 5 subfamily HSHTPCRX 3q11.2 H member 1 0R4F3 olfactory receptor family 5 subfamily 3q11.2 H member 2 0R4F4 olfactory receptor family 5 subfamily 3q11.2 H member 3 pseudogene 0R4F5 olfactory receptor family 5 subfamily 3q11.2 H member 4 pseudogene 0R4F6 olfactory receptor family 5 subfamily 3q11.2 H member 5 pseudogene OR4F7P olfactory receptor family 5 subfamily 3q11.2 H member 6 (gene/pseudogene) OR4F8P olfactory receptor family 5 subfamily 3q11.2 H member 7 pseudogene OR4F13P olfactory receptor family 5 subfamily OR5H8P 3q11.2 H member 8 (gene/pseudogene) OR4F14P olfactory receptor family 5 subfamily 3q11.2 H member 14 0R4F15 olfactory receptor family 5 subfamily 3q11.2 H member 15 0R4F16 olfactory receptor family 5 subfamily HS Olfl, 11q12.1 I member 1 OLF1 0R4F17 olfactory receptor family 5 subfamily 0R5J1 HTPCRHO2 11q12.1 J member 1 pseudogene 0R4F21 olfactory receptor family 5 subfamily 11q12.1 J member 2 0R4F28P olfactory receptor family 5 subfamily 1 1 q J member 7 pseudogene 0R4F29 HTPCRX10, olfactory receptor family 5 subfamily HSHTPCRX 3q11.2 K member 1 OR4G1P olfactory receptor family 5 subfamily 3q11.2 K member 2 OR4G2P olfactory receptor family 5 subfamily 3q11.2 K member 3 OR4G3P olfactory receptor family 5 subfamily 3q11.2 K member 4 OR4G4P olfactory receptor family 5 subfamily 0ST262 11q12.1 L member 1 (gene/pseudogene) OR4G6P HTPCRX16, olfactory receptor family 5 subfamily HSHTPCRX 11q12.1 L member 2 OR4G11P olfactory receptor family 5 subfamily OST050 1 1q11 M member 1 OR4H6P olfactory receptor family 5 subfamily 11q12.1 M member 2 pseudogene OR4H12P olfactory receptor family 5 subfamily 11q12.1 M member 3 OR4K1 olfactory receptor family 5 subfamily 11q12.1 M member 4 pseudogene 0R4K2 olfactory receptor family 5 subfamily 11q12.1 M member 5 pseudogene 0R4K3 olfactory receptor family 5 subfamily 11q12.1 M member 6 pseudogene OR4K4P olfactory receptor family 5 subfamily 11q12.1 M member 7 pseudogene 0R4K5 olfactory receptor family 5 subfamily 11q12.1 M member 8 OR4K6P olfactory receptor family 5 subfamily 11q12.1 M member 9 OR4K7P olfactory receptor family 5 subfamily 11q11 M member 10 OR4K8P olfactory receptor family 5 subfamily M member 11 OR4K11P olfactory receptor family 5 subfamily 11q12.1 M member 12 pseudogene OR4K12P olfactory receptor family 5 subfamily 11q12.1 M member 13 pseudogene 0R4K13 olfactory receptor family 5 subfamily OR5M15P 4p13 M member 14 pseudogene 0R4K14 olfactory receptor family 5 subfamily 11p15.4 P member 1 pseudogene 0R4K15 olfactory receptor family 5 subfamily JCG3 11p15.4 P member 2 OR4K16P olfactory receptor family 5 subfamily JCG1 11p15.4 P member 3 0R4K17 olfactory receptor family 5 subfamily 0ST730 11p15.4 P member 4 pseudogene OR4L1 olfactory receptor family 5 subfamily OR5R1P 11q12.1 R member 1 (gene/pseudogene) OR4M1 olfactory receptor family 5 subfamily 2q37.3 S member 1 pseudogene 0R4M2 olfactory receptor family 5 subfamily OR5T1P 11q12.1 T member 1 OR4N1P olfactory receptor family 5 subfamily 11q12.1 T member 2 0R4N2 olfactory receptor family 5 subfamily OR5T3Q 11q12.1 T member 3 OR4N3P olfactory receptor family 5 subfamily hs6M1-21 6p22.1 V member 1 0R4N4 olfactory receptor family 5 subfamily 11q12.1 W member 1 pseudogene 0R4N5 olfactory receptor family 5 subfamily OR5W2P, 11q12.1 W member 2 OR5W3P
[0094] Olfactory receptors, family 6:
Approved Previous Symbol Approved Name Symbols Synonyms Chromosome olfactory receptor family 6 subfamily OR6A2P, 0R6A2 OR11-55 11p15.4 A member 2 OR6A1 olfactory receptor family 6 subfamily OR6B 1 0R7-3 7q35 B member 1 olfactory receptor family 6 subfamily 0R6B2 OR6B2P 2q37.3 B member 2 olfactory receptor family 6 subfamily 0R6B3 OR6B3P OR6B3Q 2q37.3 B member 3 olfactory receptor family 6 subfamily OR6C 1 05T267 12q13.2 C member 1 olfactory receptor family 6 subfamily 0R6C2 0R6C67 12q13.2 C member 2 olfactory receptor family 6 subfamily 0R6C3 05T709 12q13.2 C member 3 olfactory receptor family 6 subfamily 0R6C4 12q13.2 C member 4 olfactory receptor family 6 subfamily OR6C5P 12q13.2 C member 5 pseudogene olfactory receptor family 6 subfamily 0R6C6 12q13.2 C member 6 olfactory receptor family 6 subfamily OR6C7P 12q13.2 C member 7 pseudogene olfactory receptor family 6 subfamily 0R6C64P 12q13.2 C member 64 pseudogene olfactory receptor family 6 subfamily 0R6C65 12q13.2 C member 65 olfactory receptor family 6 subfamily 0R6C66P 12q13.2 C member 66 pseudogene olfactory receptor family 6 subfamily 0R6C68 12q13.2 C member 68 olfactory receptor family 6 subfamily 0R6C69P 12q13.2 C member 69 pseudogene olfactory receptor family 6 subfamily 0R6C70 12q13.2 C member 70 olfactory receptor family 6 subfamily OR6C71P 12q13.2 C member 71 pseudogene olfactory receptor family 6 subfamily 0R6C72P 12q13.2 C member 72 pseudogene olfactory receptor family 6 subfamily 0R6C73P 12q13.2 C member 73 pseudogene olfactory receptor family 6 subfamily 0R6C74 12q13.2 C member 74 olfactory receptor family 6 subfamily 0R6C75 12q13.2 C member 75 olfactory receptor family 6 subfamily 0R6C76 12q13.2 C member 76 olfactory receptor family 6 subfamily OR6D1P 10q11.21 D member 1 pseudogene olfactory receptor family 6 subfamily OR6E1P 14q11.2 E member 1 pseudogene olfactory receptor family 6 subfamily OR6F1 0ST731 1q44 F member 1 olfactory receptor family 6 subfamily 0R6J2, OR6J1 14q11.2 J member 1 (gene/pseudogene) OR6J1P
olfactory receptor family 6 subfamily OR6K1P 1q23.1 K member 1 pseudogene olfactory receptor family 6 subfamily 0R6K2 1q23.1 K member 2 olfactory receptor family 6 subfamily 0R6K3 1q23.1 K member 3 olfactory receptor family 6 subfamily OR6K4P 1q23.1 K member 4 pseudogene olfactory receptor family 6 subfamily OR6K5P 1q23.1 K member 5 pseudogene olfactory receptor family 6 subfamily 0R6K6 1q23.1 K member 6 olfactory receptor family 6 subfamily OR6L1P 10q26.3 L member 1 pseudogene olfactory receptor family 6 subfamily OR6L2P 10q26.3 L member 2 pseudogene olfactory receptor family 6 subfamily OR6M1 11q24.1 M member 1 olfactory receptor family 6 subfamily OR6M2P 11q24.1 M member 2 pseudogene olfactory receptor family 6 subfamily OR6M3P 11q24.1 M member 3 pseudogene olfactory receptor family 6 subfamily OR6N1 1q23.1 N member 1 olfactory receptor family 6 subfamily 0R6N2 1q23.1 N member 2 olfactory receptor family 6 subfamily OR6P1 1q23.1 P member 1 olfactory receptor family 6 subfamily OR6Q1 11q12.1 Q member 1 (gene/pseudogene) olfactory receptor family 6 subfamily OR6R1P 1q44 R member 1 pseudogene olfactory receptor family 6 subfamily OR6R2P 8p21.3 R member 2 pseudogene olfactory receptor family 6 subfamily OR6S 1 OR6S1Q 14q11.2 S member 1 olfactory receptor family 6 subfamily OR6T1 11q24.1 T member 1 olfactory receptor family 6 subfamily OR6U2P OR6U1P 12q14.2 U member 2 pseudogene olfactory receptor family 6 subfamily OR6V1 GPR138 7q34 V member 1 olfactory receptor family 6 subfamily OR6W1P OR6W1 sdolf 7q34 W member 1 pseudogene olfactory receptor family 6 subfamily OR6X1 11q24.1 X member 1 olfactory receptor family 6 subfamily OR6Y1 0R6Y2 1q23.1 Y member 1 [0095] Olfactory receptors, family 7:
Approved Previous Approved Name Synonyms Chromosome Symbol Symbols OR7A1P olfactory receptor family 7 0R19-3, OR7A6P 19p13.12 subfamily A member 1 pseudogene OLF4p, hg513 OR7A2P olfactory receptor family 7 0R7A7, hg1003, OR19-19p13.12 subfamily A member 2 pseudogene 0R7A2 18, OLF4p OR7A3P OR7Al2P, OR11-7b, olfactory receptor family 7 OR7A14P, 0R19-12, 19p13.12 subfamily A member 3 pseudogene 0R7A14, 0R14-59, 0R7A5 olfactory receptor family 7 HTPCR2 19p13.1 subfamily A member 5 OR7A8P 0ST042, olfactory receptor family 7 OR7A9P HG83, 0R19- 19p13.12 subfamily A member 8 pseudogene OR7A10 olfactory receptor family 7 19p13.1 subfamily A member 10 OR7A11P olfactory receptor family 7 OR7A11 0ST527 19p13.12 subfamily A member 11 pseudogene OR7A15P OR7A4P, 0R19-134, olfactory receptor family 7 OR7A16P, OR19-1, 0R19- 19p13.12 subfamily A member 15 pseudogene 0R7A17 olfactory receptor family 7 HTPCRX19 19p13.12 subfamily A member 17 OR7A18P olfactory receptor family 7 19p13.12 subfamily A member 18 pseudogene OR7A19P olfactory receptor family 7 12q13.11 subfamily A member 19 pseudogene OR7C1 olfactory receptor family 7 OR7C4 OR19-5 19p13.1 subfamily C member 1 0R7C2 olfactory receptor family 7 OR7C3 0R1918 19p13.1 subfamily C member 2 OR7D1P olfactory receptor family 7 OR7D3P, OR19-A 19p13.2 subfamily D member 1 pseudogene 0R7D3 0R7D2 0R19-4, olfactory receptor family 7 HTPCRH03, 19p13.2 subfamily D member 2 0R7D4 olfactory receptor family 7 OR7D4P hg105, 0R19-B 19p13.2 subfamily D member 4 OR7D11P olfactory receptor family 7 19p13.2 subfamily D member 11 pseudogene OR7E1P olfactory receptor family 7 11q13.2 subfamily E member 1 pseudogene OR7E2P olfactory receptor family 7 OR7F2P, OR11-6, hg94 11q14.2 subfamily E member 2 pseudogene OR7E51P
OR7E4P olfactory receptor family 7 OR7F4P OR11-11a 11q13.4 subfamily E member 4 pseudogene OR7E5P olfactory receptor family 7 OR11-12, OR7F5P 11q12.1 subfamily E member 5 pseudogene F1131393 OR7E7P olfactory receptor family 7 7q21.3 subfamily E member 7 pseudogene OR7E8P olfactory receptor family 7 OR11-11a 8p23.1 subfamily E member 8 pseudogene OR7E1OP olfactory receptor family 7 OR11-1 8p23.1 subfamily E member 10 pseudogene OR7E11P olfactory receptor family 7 0R7E144P OR11-2 11q13.2 subfamily E member 11 pseudogene OR7E12P olfactory receptor family 7 0R7E58P, OR11-3 11p15.4 subfamily E member 12 pseudogene 0R7E79P
OR7E13P olfactory receptor family 7 OR11-4 11q14.2 subfamily E member 13 pseudogene OR7E14P olfactory receptor family 7 OR7E151P OR11-5 11p15.1 subfamily E member 14 pseudogene OR7E15P olfactory receptor family 7 OR7E80P, OR11-392, 8p23.1 subfamily E member 15 pseudogene 0R7E42P OST001 OR7E16P olfactory receptor family 7 OR7E60P, 0R19-133, 19p13.2 subfamily E member 16 pseudogene OR7E17P 0R19-9 OR7E18P olfactory receptor family 7 0R7E61, OR19-14, 19p13.2 subfamily E member 18 pseudogene 0R7E98P TPCR26 OR7E19P olfactory receptor family 7 0R7E65 0R19-7 19p13.2 subfamily E member 19 pseudogene OR7E21P olfactory receptor family 7 0R7E49P, OR4DG, 3p13 subfamily E member 21 pseudogene 0R7E127P 0ST035 0R7E22P olfactory receptor family 7 OR6DG, 3p12.3 subfamily E member 22 pseudogene 0R3.6 0R7E23P olfactory receptor family 7 0R7E92P 0R21-3 21q22.11 subfamily E member 23 pseudogene 0R7E24 OR19-8, olfactory receptor family 7 OR7E24P HSHT2, 19p13.2 subfamily E member 24 0R7E25P olfactory receptor family 7 OR19-C, crr-19p13.2 subfamily E member 25 pseudogene B-440L2 OR7E26P OR7E67P, OR1-51, OR1-olfactory receptor family 7 0R7E69P, 72, 0R1-73, 10p13 subfamily E member 26 pseudogene OR7E70P, olfactory receptor family 7 , 0ST128, hg616 2q24.1 subfamily E member 28 pseudogene OR7E107P
, OR7E27P
0R7E29P olfactory receptor family 7 OST032 3q21.2 subfamily E member 29 pseudogene OR7E31P olfactory receptor family 7 0R7E32P 0ST205 9q22.2 subfamily E member 31 pseudogene 0R7E33P olfactory receptor family 7 hg688 13q21.32 subfamily E member 33 pseudogene 0R7E35P olfactory receptor family 7 OR7E120 OST018 4p16.1 subfamily E member 35 pseudogene 0R7E36P olfactory receptor family 7 OR7E119P OST024 13q14.11 subfamily E member 36 pseudogene 0R7E37P olfactory receptor family 7 hg533 13q14.11 subfamily E member 37 pseudogene 0R7E38P olfactory receptor family 7 0R7E76 OST127 7q21.3 subfamily E member 38 pseudogene 0R7E39P olfactory receptor family 7 0R7E138P hg611 7p22.1 subfamily E member 39 pseudogene OR7E41P OR7F6P, olfactory receptor family 7 OR11-20, OR7E50P, 11p15.2 subfamily E member 41 pseudogene 0R7E95P hg84, 0R8-126 0R7E43P olfactory receptor family 7 0R4116 4p16.3 subfamily E member 43 pseudogene 0R7E46P olfactory receptor family 7 0ST379, 2p13.3 subfamily E member 46 pseudogene MCEEP
0R7E47P olfactory receptor family 7 0R7E141 12q13.13 subfamily E member 47 pseudogene OR7E53P 0R7E78P, olfactory receptor family 7 0R3-143, 0R3-0R7E78, 3q21.2 subfamily E member 53 pseudogene 142 0R7E55P OR2DG, olfactory receptor family 7 0R7E56P 0R3.2, 3p13 subfamily E member 55 pseudogene 0R7E59P olfactory receptor family 7 0R7E59, OST119 7p22.1 subfamily E member 59 pseudogene 0R7E137P
0R7E62P 0R7E63P, 0R7E62, 0R2-olfactory receptor family 7 0R7E64P, 53, 0R7E63, 2p13.3 subfamily E member 62 pseudogene 0R7E66P hg630, HG630, olfactory receptor family 7 OR7E6P, OR3DG, 3p13 subfamily E member 66 pseudogene OR7E2OP
OR3.3 0R7E83P olfactory receptor family 7 0R7E134P 4p16.1 subfamily E member 83 pseudogene 0R7E84P olfactory receptor family 7 0R7E54P 0ST185 4p16.1 subfamily E member 84 pseudogene 0R7E85P olfactory receptor family 7 0R7E88P 4p16.1 subfamily E member 85 pseudogene 0R7E86P olfactory receptor family 7 4p16.1 subfamily E member 86 pseudogene 0R7E87P olfactory receptor family 7 OR7E3P, OR11-9 11q13.4 subfamily E member 87 pseudogene OR7F3P
0R7E89P olfactory receptor family 7 2q24.1 subfamily E member 89 pseudogene OR7E9OP olfactory receptor family 7 0R7E123P 0ST705 2q24.1 subfamily E member 90 pseudogene OR7E91P olfactory receptor family 7 2p13.3 subfamily E member 91 pseudogene 0R7E93P olfactory receptor family 7 OR7E131P 3q21.2 subfamily E member 93 pseudogene 0R7E94P olfactory receptor family 7 4q21.21 subfamily E member 94 pseudogene 0R7E96P olfactory receptor family 7 8p23.1 subfamily E member 96 pseudogene 0R7E97P olfactory receptor family 7 3q21.2 subfamily E member 97 pseudogene 0R7E99P olfactory receptor family 7 4p16.3 subfamily E member 99 pseudogene OR7E100P olfactory receptor family 7 subfamily E member 100 3q13.2 pseudogene OR7E101P olfactory receptor family 7 subfamily E member 101 13q14.13 pseudogene OR7E102P olfactory receptor family 7 subfamily E member 102 0R7E102 2q11.1 pseudogene OR7E104P olfactory receptor family 7 subfamily E member 104 13q21.31 pseudogene OR7E105P olfactory receptor family 7 subfamily E member 105 14q22.1 pseudogene OR7E106P olfactory receptor family 7 subfamily E member 106 OR7E4OP 0ST215 14q22.1 pseudogene OR7E108P olfactory receptor family 7 subfamily E member 108 0ST726 9q22.2 pseudogene OR7E109P olfactory receptor family 7 subfamily E member 109 0ST721 9q22.2 pseudogene OR7E110P 0R7E68P, hg674, OR912-0R7E71P, olfactory receptor family 7 109, 0R912-0R7E72P, subfamily E member 110 46, 0R912- 10p13 OR7E73P, pseudogene 108, 0R912-0R7E74P, 110, hg523 OR7E111P olfactory receptor family 7 subfamily E member 111 13q21.32 pseudogene OR7E115P olfactory receptor family 7 subfamily E member 115 0ST704 10p13 pseudogene OR7E116P olfactory receptor family 7 subfamily E member 116 0ST733 9q22.2 pseudogene OR7E117P olfactory receptor family 7 subfamily E member 117 0ST716 1 1p15.4 pseudogene OR7E121P olfactory receptor family 7 subfamily E member 121 3p12.3 pseudogene 0R7E122P olfactory receptor family 7 subfamily E member 122 0ST719 3p25.3 pseudogene 0R7E125P olfactory receptor family 7 subfamily E member 125 PJCG6 8p23.1 pseudogene 0R7E126P olfactory receptor family 7 subfamily E member 126 hg500, OR11-1 11q13.4 pseudogene 0R7E128P olfactory receptor family 7 subfamily E member 128 11q13.4 pseudogene 0R7E129P olfactory receptor family 7 subfamily E member 129 3q22.1 pseudogene OR7E130P olfactory receptor family 7 subfamily E member 130 0ST702 3q21.2 pseudogene 0R7E136P olfactory receptor family 7 0R7E147P
subfamily E member 136 , 7p22.1 pseudogene OR7E139P

OR7E140P olfactory receptor family 7 subfamily E member 140 12p13.31 pseudogene 0R7E145P olfactory receptor family 7 subfamily E member 145 11q13.4 pseudogene 0R7E148P olfactory receptor family 7 subfamily E member 148 OR7E150P 12p13 pseudogene 0R7E149P olfactory receptor family 7 subfamily E member 149 12p13.31 pseudogene 0R7E154P olfactory receptor family 7 subfamily E member 154 8p23.1 pseudogene 0R7E155P olfactory receptor family 7 subfamily E member 155 13q14.11 pseudogene 0R7E156P olfactory receptor family 7 subfamily E member 156 13q21.31 pseudogene 0R7E157P olfactory receptor family 7 subfamily E member 157 8p23.1 pseudogene 0R7E158P olfactory receptor family 7 subfamily E member 158 8p23.1 pseudogene 0R7E159P olfactory receptor family 7 subfamily E member 159 14q22.1 pseudogene OR7E160P olfactory receptor family 7 subfamily E member 160 8p23.1 pseudogene OR7E161P olfactory receptor family 7 subfamily E member 161 8p23.1 pseudogene 0R7E162P olfactory receptor family 7 subfamily E member 162 4p16.3 pseudogene 0R7E163P olfactory receptor family 7 subfamily E member 163 4p16.3 pseudogene OR7G1 olfactory receptor family 7 OR7G1P 0R19-15 19p13.2 subfamily G member 1 0R7G2 olfactory receptor family 7 0ST260 19p13.2 subfamily G member 2 0R7G3 olfactory receptor family 7 0ST085 19p13.2 subfamily G member 3 OR7G15P olfactory receptor family 7 19p13.2 subfamily G member 15 pseudogene OR7H1P olfactory receptor family 7 OR7H1 19p13.2 subfamily H member 1 pseudogene OR7H2P olfactory receptor family 7 5q21.1 subfamily H member 2 pseudogene OR7K1P olfactory receptor family 7 14q12 subfamily K member 1 pseudogene OR7L1P olfactory receptor family 7 Xq26.2 subfamily L member 1 pseudogene OR7M1P olfactory receptor family 7 10q26.3 subfamily M member 1 pseudogene http://www.genenames.orglegi-binidownload?title,Genefam+data&submit,submit&hgne dbtag,on&preset,genefam&statu s,Appro-ved&status,Entry+Withdrawn&status opt,2&,on&format,text&limit,&.egifields =&.cgifields.chr8c.cgifields=status&cgifields=ligne dbta.g&where=g_d_gene fam name%2 ORLIKE%201(%50%20)0R7($1,)Szorder by,gd app sym sort [0096] Olfactory receptors, family 8:
Approved Previous Approved Name Synonyms Chromosome Symbol Symbols OR8A1 olfactory receptor family 8 subfamily 05T025 11q24.2 A member 1 OR8A2P olfactory receptor family 8 subfamily 11q24.2 A member 2 pseudogene OR8A3P olfactory receptor family 8 subfamily 1 1 q A member 3 pseudogene OR8B1P olfactory receptor family 8 subfamily OR8B11P OR11-561 11q24.2 B member 1 pseudogene 0R8B2 olfactory receptor family 8 subfamily 11q24.2 B member 2 0R8B3 olfactory receptor family 8 subfamily 11q24.2 B member 3 0R8B4 olfactory receptor family 8 subfamily OR8B4P 11q24.2 B member 4 (gene/pseudogene) OR8B5P olfactory receptor family 8 subfamily 11q25 B member 5 pseudogene OR8B6P olfactory receptor family 8 subfamily 11q25 B member 6 pseudogene OR8B7P olfactory receptor family 8 subfamily OR8B13P 11q25 B member 7 pseudogene 0R8B8 olfactory receptor family 8 subfamily TPCR85 11q24.2 B member 8 OR8B9P olfactory receptor family 8 subfamily 11q24.2 B member 9 pseudogene OR8B1OP olfactory receptor family 8 subfamily 11q24.2 B member 10 pseudogene OR8B12 olfactory receptor family 8 subfamily 11q24.2 B member 12 0R8C1P OR11-175, olfactory receptor family 8 subfamily OR8C3P, 0R912-45, 11q24.2 C member 1 pseudogene OR8C4P

OR8D1 olfactory receptor family 8 subfamily 0R8D3 OST004 11q24.2 D member 1 0R8D2 olfactory receptor family 8 subfamily 11q24.2 D member 2 (gene/pseudogene) 0R8D4 olfactory receptor family 8 subfamily 11q24.1 D member 4 OR8F1P olfactory receptor family 8 subfamily 11q24.2 F member 1 pseudogene OR8G1 olfactory receptor family 8 subfamily TPCR25, OR8G1P 11q24.2 G member 1 (gene/pseudogene) HSTPCR25 OR8G2P TPCR120, olfactory receptor family 8 subfamily 0R8G4, HSTPCR120, 11q24.2 G member 2 pseudogene 0R8G2 0RL206, OR8G3P olfactory receptor family 8 subfamily 11q24.2 G member 3 pseudogene 0R8G5 olfactory receptor family 8 subfamily OR8G5P, 11q24.2 G member 5 0R8G6 OR8G7P olfactory receptor family 8 subfamily 11q24.2 G member 7 pseudogene OR8H1 olfactory receptor family 8 subfamily 1 1q12.1 H member 1 0R8H2 olfactory receptor family 8 subfamily 11q12.1 H member 2 0R8H3 olfactory receptor family 8 subfamily 11q12.1 H member 3 OR8I1P olfactory receptor family 8 subfamily 11q12.1 I member 1 pseudogene 0R8I2 olfactory receptor family 8 subfamily 11q12.1 I member 2 0R8I4P olfactory receptor family 8 subfamily 1 lq I member 4 pseudogene OR8J1 olfactory receptor family 8 subfamily 11q12.1 J member 1 0R8J2 olfactory receptor family 8 subfamily OR8J2P 11q12.1 J member 2 (gene/pseudogene) 0R8J3 olfactory receptor family 8 subfamily 11q12.1 J member 3 OR8K1 olfactory receptor family 8 subfamily 11q12.1 K member 1 OR8K2P olfactory receptor family 8 subfamily 11q12.1 K member 2 pseudogene 0R8K3 olfactory receptor family 8 subfamily 11q12.1 K member 3 (gene/pseudogene) OR8K4P olfactory receptor family 8 subfamily 11q12.1 K member 4 pseudogene 0R8K5 olfactory receptor family 8 subfamily 11q12.1 K member 5 OR8L1P olfactory receptor family 8 subfamily 11q12.1 L member 1 pseudogene OR8Q1P olfactory receptor family 8 subfamily 11q24.2 Q member 1 pseudogene OR8R1P olfactory receptor family 8 subfamily 11q13.4 R member 1 pseudogene OR8S1 olfactory receptor family 8 subfamily 12q13.2 S member 1 OR8S21P olfactory receptor family 8 subfamily 12q13.11 S member 21 pseudogene OR8T1P olfactory receptor family 8 subfamily 12q13.11 T member 1 pseudogene OR8U1 olfactory receptor family 8 subfamily 11q12.1 U member 1 0R8U8 llql alternate olfactory receptor family 8 subfamily reference U member 8 locus 0R8U9 llql alternate olfactory receptor family 8 subfamily reference U member 9 locus OR8V1P olfactory receptor family 8 subfamily 11q12.1 V member 1 pseudogene OR8X1P olfactory receptor family 8 subfamily 11q24.2 X member 1 pseudogene [0097] Olfactory receptors, family 9:
Approved Previous Approved Name Synonyms Chromosome Symbol Symbols OR9A1P olfactory receptor family 9 subfamily HTPCRX06, OR9A1 7q34 A member 1 pseudogene HSHTPCRX06 0R9A2 olfactory receptor family 9 subfamily 7q34 A member 2 OR9A3P olfactory receptor family 9 subfamily OR9A6P 7q34 A member 3 pseudogene 0R9A4 olfactory receptor family 9 subfamily 7q34 A member 4 OR9G1 olfactory receptor family 9 subfamily 0R9G5 11q12.1 G member 1 OR9G2P olfactory receptor family 9 subfamily 0R9G6 11q12.1 G member 2 pseudogene OR9G3P olfactory receptor family 9 subfamily 11q12.1 G member 3 pseudogene 0R9G4 olfactory receptor family 9 subfamily 11q12.1 G member 4 olfactory receptor family 9 subfamily alternate G member 9 reference locus OR9H1P olfactory receptor family 9 subfamily 1q44 H member 1 pseudogene 0R911 olfactory receptor family 9 subfamily 11q12.1 I member 1 0R9I2P olfactory receptor family 9 subfamily 11q12.1 I member 2 pseudogene 0R9I3P olfactory receptor family 9 subfamily 0ST714 11q12.1 I member 3 pseudogene OR9K1P olfactory receptor family 9 subfamily 12q13.2 K member 1 pseudogene 0R9K2 olfactory receptor family 9 subfamily 12q13.2 K member 2 OR9L1P olfactory receptor family 9 subfamily OR9L2P 11q12.1 L member 1 pseudogene OR9M1P olfactory receptor family 9 subfamily OR5BG1P 11q12.1 M member 1 pseudogene OR9N1P olfactory receptor family 9 subfamily 7q34 N member 1 pseudogene OR9P1P olfactory receptor family 9 subfamily OR9P2P 7q34 P member 1 pseudogene OR9Q1 olfactory receptor family 9 subfamily 11q12.1 Q member 1 0R9Q2 olfactory receptor family 9 subfamily OR9Q2P 11q12.1 Q member 2 OR9R1P olfactory receptor family 9 subfamily 12q13.2 R member 1 pseudogene 0R9S24P olfactory receptor family 9 subfamily OR5J6P 2q37.3 S member 24 pseudogene [0098] Olfactory receptors, family 10:
Approved Previous Approved Name Synonyms Chromosome Symbol Symbols OR10A2 olfactory receptor family 10 OR10A2P 05T363 11p15.4 subfamily A member 2 OR10A3 olfactory receptor family 10 HTPCRX12, 11p15.4 subfamily A member 3 HSHTPCRX12 OR10A4 olfactory receptor family 10 OR10A4P 11p15.4 subfamily A member 4 OR10A5 olfactory receptor family 10 OR11-403, OR10A1 11p15.4 subfamily A member 5 JCG6 OR10A6 olfactory receptor family 10 subfamily A member 6 11p15.4 (gene/pseudogene) OR10A7 olfactory receptor family 10 12q13.2 subfamily A member 7 OR1OAA1P olfactory receptor family 10 1q23.1 subfamily AA member 1 pseudogene OR10AB1P olfactory receptor family 10 11p15.4 subfamily AB member 1 pseudogene OR1OAC1 olfactory receptor family 10 subfamily AC member 1 OR1OAC1P 7q35 (gene/pseudogene) OR1OAD1 olfactory receptor family 10 OR1OAD1P 12q13.11 subfamily AD member 1 OR10AE1P olfactory receptor family 10 OR1OAE2P 1q23.2 subfamily AE member 1 pseudogene OR1OAE3P olfactory receptor family 10 12q13.2 subfamily AE member 3 pseudogene OR10AF1P olfactory receptor family 10 11q12 subfamily AF member 1 pseudogene OR10AG1 olfactory receptor family 10 11q12.1 subfamily AG member 1 OR1OAH1P olfactory receptor family 10 7p22.1 subfamily AH member 1 pseudogene OR1OAK1P olfactory receptor family 10 1 lq subfamily AK member 1 pseudogene OR10B1P olfactory receptor family 10 OR10B2 19p13.12 subfamily B member 1 pseudogene OR10C1 olfactory receptor family 10 hs6M1-17, subfamily C member 1 OR10C2 6p22.1 (gene/pseudogene) OR10D1P olfactory receptor family 10 0ST074, OR10D2P 11q24.2 subfamily D member 1 pseudogene HTPCRX03 OR10D3 olfactory receptor family 10 OR10D3P HTPCRX09 11q24.2 subfamily D member 3 (putative) OR10D4P olfactory receptor family 10 OR10D4, 11q24.2 subfamily D member 4 pseudogene OR10D6P
OR10D5P olfactory receptor family 10 11q24.2 subfamily D member 5 pseudogene OR10G1P olfactory receptor family 10 14q11.2 subfamily G member 1 pseudogene OR10G2 olfactory receptor family 10 14q11.2 subfamily G member 2 OR10G3 olfactory receptor family 10 14q11.2 subfamily G member 3 OR10G4 olfactory receptor family 10 11q24.2 subfamily G member 4 OR10G5P olfactory receptor family 10 11q24.2 subfamily G member 5 pseudogene OR10G6 olfactory receptor family 10 OR10G6P OR10G6Q 11q24.1 subfamily G member 6 OR10G7 olfactory receptor family 10 11q24.2 subfamily G member 7 OR10G8 olfactory receptor family 10 11q24.2 subfamily G member 8 OR10G9 olfactory receptor family 10 OR10G1OP 11q24.2 subfamily G member 9 OR1OH1 olfactory receptor family 10 19p13.1 subfamily H member 1 OR1OH2 olfactory receptor family 10 19p13.1 subfamily H member 2 OR1OH3 olfactory receptor family 10 19p13.1 subfamily H member 3 OR1OH4 olfactory receptor family 10 19p13.12 subfamily H member 4 OR1OH5 olfactory receptor family 10 19p13.12 subfamily H member 5 OR10J1 olfactory receptor family 10 HGMPO7J, 1q23.2 subfamily J member 1 HSHGMPO7J
OR10J2P olfactory receptor family 10 1q23.2 subfamily J member 2 pseudogene OR10J3 olfactory receptor family 10 OR10J3P 1q23.2 subfamily J member 3 OR10J4 olfactory receptor family 10 subfamily J member 4 OR10J4P 0ST717 1q23.2 (gene/pseudogene) OR10J5 olfactory receptor family 10 1q23.2 subfamily J member 5 OR10J6P olfactory receptor family 10 0R10J6 1q23.2 subfamily J member 6 pseudogene OR10J7P olfactory receptor family 10 1q23.2 subfamily J member 7 pseudogene OR10J8P olfactory receptor family 10 1q23.2 subfamily J member 8 pseudogene OR10J9P olfactory receptor family 10 1q23.2 subfamily J member 9 pseudogene OR10K1 olfactory receptor family 10 1q23.1 subfamily K member 1 OR10K2 olfactory receptor family 10 1q23.1 subfamily K member 2 OR1ON1P olfactory receptor family 10 11q24.2 subfamily N member 1 pseudogene OR10P1 OR10P1P, olfactory receptor family 10 OR10P2P, OST701 12q13.2 subfamily P member 1 OR10Q1 olfactory receptor family 10 11q12.1 subfamily Q member 1 OR10Q2P olfactory receptor family 10 11q12.1 subfamily Q member 2 pseudogene OR1OR1P olfactory receptor family 10 1q23.1 subfamily R member 1 pseudogene OR1OR2 olfactory receptor family 10 OR1OR2Q 1q23.1 subfamily R member 2 OR1OR3P olfactory receptor family 10 1q23.1 subfamily R member 3 pseudogene OR10S1 olfactory receptor family 10 11q24.1 subfamily S member 1 OR10T1P olfactory receptor family 10 1q23.1 subfamily T member 1 pseudogene OR10T2 olfactory receptor family 10 1q23.1 subfamily T member 2 OR10U1P olfactory receptor family 10 12q13.2 subfamily U member 1 pseudogene OR10V1 olfactory receptor family 10 1 1q12.1 subfamily V member 1 OR10V2P olfactory receptor family 10 1 1q12.1 subfamily V member 2 pseudogene OR10V3P olfactory receptor family 10 11q12.1 subfamily V member 3 pseudogene OR10V7P olfactory receptor family 10 14q21.2 subfamily V member 7 pseudogene OR1OW1 olfactory receptor family 10 OR1OW1P 11q12.1 subfamily W member 1 OR10X1 olfactory receptor family 10 subfamily X member 1 OR10X1P 1q23.1 (gene/pseudogene) ORlOY 1P olfactory receptor family 10 1 1q12.1 subfamily Y member 1 pseudogene OR10Z1 olfactory receptor family 10 1q23.1 subfamily Z member 1 [0099] Olfactory receptors, family 11:
Approved Previous Approved Name Synonyms Chromosome Symbol Symbols OR11A1 olfactory receptor family 11 6p22.2-OR11A2 hs6M1-18 subfamily A member 1 p21.31 OR11G1P olfactory receptor family 11 14q11.2 subfamily G member 1 pseudogene OR11G2 olfactory receptor family 11 14q11.2 subfamily G member 2 OR11H1 olfactory receptor family 11 0R22-1 22q11.1 subfamily H member 1 0R11H2 OR11H2P, olfactory receptor family 11 0R11H8P, 14q11.2 subfamily H member 2 Cl4orf15 OR11H3P olfactory receptor family 11 15q11.2 subfamily H member 3 pseudogene OR11H4 olfactory receptor family 11 14q11.2 subfamily H member 4 OR11H5P olfactory receptor family 11 14q11.2 subfamily H member 5 pseudogene OR11H6 olfactory receptor family 11 14q11.2 subfamily H member 6 OR11H7 olfactory receptor family 11 subfamily H member 7 0R11H7P 14q11.2 (gene/pseudogene) OR11H12 olfactory receptor family 11 14q11.2 subfamily H member 12 OR11H13P olfactory receptor family 11 14q11.2 subfamily H member 13 pseudogene OR11I1P olfactory receptor family 11 OR11I2P 1p13.3 subfamily I member 1 pseudogene OR11J1P olfactory receptor family 11 15q11.2 subfamily J member 1 pseudogene OR11J2P olfactory receptor family 11 15q11.2 subfamily J member 2 pseudogene 0R11J5P olfactory receptor family 11 15q11.2 subfamily J member 5 pseudogene OR11K1P olfactory receptor family 11 15q11.2 subfamily K member 1 pseudogene OR11K2P olfactory receptor family 11 14p13 subfamily K member 2 pseudogene OR11L1 olfactory receptor family 11 1q44 subfamily L member 1 OR11M1P olfactory receptor family 11 12q13.11 subfamily M member 1 pseudogene OR11N1P olfactory receptor family 11 Xq26.2 subfamily N member 1 pseudogene OR11P1P olfactory receptor family 11 14q11 subfamily P member 1 pseudogene OR11Q1P olfactory receptor family 11 Xq26.1 subfamily Q member 1 pseudogene [0100] Olfactory receptors, family 12:
Approved Previous Approved Name Synonyms Chromosome Symbol Symbols OR11A1 olfactory receptor family 12 subfamily OR12D1P hs6M1-19 6p22.1 D member 1 (gene/pseudogene) OR11G1P olfactory receptor family 12 subfamily hs6M1-20 6p22.1 D member 2 (gene/pseudogene) OR11G2 olfactory receptor family 12 subfamily hs6M1-27 6p22.1 D member 3 [0101] Olfactory receptors, family 13:
Approved Previous Approved Name Synonyms Chromosome Symbol Symbols OR13A 1 olfactory receptor family 13 subfamily 10q11.21 A member 1 OR13C1P olfactory receptor family 13 subfamily 9q31.1 C member 1 pseudogene 0R13C2 olfactory receptor family 13 subfamily 9q31.1 C member 2 0R13C3 olfactory receptor family 13 subfamily 9q31.1 C member 3 0R13C4 olfactory receptor family 13 subfamily 9q31.1 C member 4 0R13C5 olfactory receptor family 13 subfamily 9q31.1 C member 5 OR13C6P olfactory receptor family 13 subfamily 9p13.3 C member 6 pseudogene 0R13C7 olfactory receptor family 13 subfamily OR13C7P 0ST706 9p13.3 C member 7 (gene/pseudogene) 0R13C8 olfactory receptor family 13 subfamily 9q31.1 C member 8 0R13C9 olfactory receptor family 13 subfamily 9q31.1 C member 9 OR13D1 olfactory receptor family 13 subfamily 9q31.1 D member 1 OR13D2P olfactory receptor family 13 subfamily 9q31.1 D member 2 pseudogene OR13D3P olfactory receptor family 13 subfamily 9q31.1 D member 3 pseudogene OR13E1P olfactory receptor family 13 subfamily 0R13E2 0ST741 9p13.3 E member 1 pseudogene OR13F1 olfactory receptor family 13 subfamily 9q31.1 F member 1 OR13G1 olfactory receptor family 13 subfamily 1q44 G member 1 OR13H1 olfactory receptor family 13 subfamily Xq26.2 H member 1 OR13I1P olfactory receptor family 13 subfamily 0R13I2P 9q31.1 I member 1 pseudogene OR13J1 olfactory receptor family 13 subfamily 9p13.3 J member 1 OR13K1P olfactory receptor family 13 subfamily Xq26.2 K member 1 pseudogene OR13Z1P olfactory receptor family 13 subfamily 1q21.1 Z member 1 pseudogene OR13Z2P olfactory receptor family 13 subfamily 1q21.1 Z member 2 pseudogene OR13Z3P olfactory receptor family 13 subfamily 1q21.1 Z member 3 pseudogene [0102] Olfactory receptors, family 14:
Approved Previous Approved Name Synonyms Chromosome Symbol Symbols olfactory receptor family 14 OR5AX1P, OR13A1 1q44 subfamily A member 2 OR5AX1 olfactory receptor family 14 OR13C1P OR5AT1 1q44 subfamily A member 16 olfactory receptor family 14 0R13C2 OR5BF1 1q44 subfamily C member 36 olfactory receptor family 14 OR5BU1P, 0R13C3 1q44 subfamily I member 1 OR5BU1 olfactory receptor family 14 0R13C4 OR5U1 hs6M1-28 6p22.1 subfamily J member 1 olfactory receptor family 14 0R13C5 OR5AY1 1q44 subfamily K member 1 olfactory receptor family 14 OR5AV1, OR13C6P 1q44 subfamily L member 1 pseudogene OR5AV1P
[0103] Olfactory receptors, family 51:

Approved Previous Approved Name Synonyms Chromosome Symbol Symbols 0R51A1P olfactory receptor family 51 11p15.4 subfamily A member 1 pseudogene OR51A2 olfactory receptor family 51 11p15.4 subfamily A member 2 OR51A3P olfactory receptor family 51 11p15.4 subfamily A member 3 pseudogene OR51A4 olfactory receptor family 51 11p15.4 subfamily A member 4 0R51A5P olfactory receptor family 51 11p15.4 subfamily A member 5 pseudogene OR51A6P olfactory receptor family 51 11p15.4 subfamily A member 6 pseudogene OR51A7 olfactory receptor family 51 11p15.4 subfamily A member 7 0R51A8P olfactory receptor family 51 11p15.4 subfamily A member 8 pseudogene OR51A9P olfactory receptor family 51 11p15.4 subfamily A member 9 pseudogene 0R51A1OP olfactory receptor family 51 OR51A11P, subfamily A member 10 11p15.4 pseudogene 0R51AB1P olfactory receptor family 51 subfamily AB member 1 11p15.4 pseudogene OR51B2 olfactory receptor family 51 subfamily B member 2 OR51B 1P 11p15.4 (gene/pseudogene) OR51B3P olfactory receptor family 51 11p15.4 subfamily B member 3 pseudogene 0R51B4 olfactory receptor family 51 11p15.4 subfamily B member 4 0R51B5 olfactory receptor family 51 11p15.4 subfamily B member 5 0R51B6 olfactory receptor family 51 11p15.4 subfamily B member 6 0R51B8P olfactory receptor family 51 11p15.4 subfamily B member 8 pseudogene OR51C1P olfactory receptor family 51 0R51C3P, 0ST734 11p15.4 subfamily C member 1 pseudogene OR51C2P
OR51C4P olfactory receptor family 51 11p15.4 subfamily C member 4 pseudogene OR51D1 olfactory receptor family 51 OR51D1Q 11p15.4 subfamily D member 1 OR51E1 OR51E1P, olfactory receptor family 51 0R52A3P, GPR136 1 1p15.4 subfamily E member 1 0R51E2 olfactory receptor family 51 PSGR 1 1p15.4 subfamily E member 2 OR51F1 olfactory receptor family 51 subfamily F member 1 OR51F1P 11p15.4 (gene/pseudogene) OR51F2 olfactory receptor family 51 11p15.4 subfamily F member 2 OR51F3P olfactory receptor family 51 11p15.4 subfamily F member 3 pseudogene OR51F4P olfactory receptor family 51 11p15.4 subfamily F member 4 pseudogene OR51F5P olfactory receptor family 51 11p15.4 subfamily F member 5 pseudogene 0R51G1 olfactory receptor family 51 subfamily G member 1 OR51G3P 11p15.4 (gene/pseudogene) OR51G2 olfactory receptor family 51 11p15.4 subfamily G member 2 OR51H1 olfactory receptor family Si OR51H1P 11p15.4 subfamily H member 1 OR51H2P olfactory receptor family Si 11p15.4 subfamily H member 2 pseudogene 0R5 iii olfactory receptor family Si 11p15.4 subfamily I member 1 OR51I2 olfactory receptor family Si 11p15.4 subfamily I member 2 ORME olfactory receptor family Si OR51J2, subfamily J member 1 11p15.4 (gene/pseudogene) 0R51K1P olfactory receptor family Si 11p15.4 subfamily K member 1 pseudogene 0R51L1 olfactory receptor family 51 11p15.4 subfamily L member 1 OR51M1 olfactory receptor family 51 11p15.4 subfamily M member 1 0R51N1P olfactory receptor family 51 11p15.4 subfamily N member 1 pseudogene 0R51P1P olfactory receptor family 51 0R51P2P 11p15.4 subfamily P member 1 pseudogene OR51Q1 olfactory receptor family 51 subfamily Q member 1 11p15.4 (gene/pseudogene) 0R51R1P olfactory receptor family 51 11p15.4 subfamily R member 1 pseudogene 0R51S1 olfactory receptor family 51 11p15.4 subfamily S member 1 0R51T1 olfactory receptor family 51 11p15.4 subfamily T member 1 OR51V1 olfactory receptor family 51 OR51Al2 11p15.4 subfamily V member 1 [0104] Olfactory receptors, family 52:
Approved Previous Approved Name Synonyms Chromosome Symbol Symbols OR52A1 olfactory receptor family 52 subfamily HPFH1OR 1115.4 A member 1 OR52A4P olfactory receptor family 52 subfamily 0R52A4 11p15.4 A member 4 pseudogene OR52A5 olfactory receptor family 52 subfamily 11p15.4 A member 5 OR52B1P olfactory receptor family 52 subfamily 11p15.4 B member 1 pseudogene 0R52B2 olfactory receptor family 52 subfamily 11p15.4 B member 2 OR52B3P olfactory receptor family 52 subfamily 11p15.4 B member 3 pseudogene 0R52B4 olfactory receptor family 52 subfamily 11p15.4 B member 4 (gene/pseudogene) OR52B5P olfactory receptor family 52 subfamily 11p15.4 B member 5 pseudogene 0R52B6 olfactory receptor family 52 subfamily 11p15.4 B member 6 OR52D1 olfactory receptor family 52 subfamily 11p15.4 D member 1 OR52E1 olfactory receptor family 52 subfamily OR52E1P 11p15.4 E member 1 (gene/pseudogene) 0R52E2 olfactory receptor family 52 subfamily 11p15.4 E member 2 0R52E3P olfactory receptor family 52 subfamily 11p15.4 E member 3 pseudogene 0R52E4 olfactory receptor family 52 subfamily 11p15.4 E member 4 0R52E5 olfactory receptor family 52 subfamily 11p15.4 E member 5 0R52E6 olfactory receptor family 52 subfamily 11p15.4 E member 6 0R52E7P olfactory receptor family 52 subfamily 11p15.4 E member 7 pseudogene 0R52E8 olfactory receptor family 52 subfamily 11p15.4 E member 8 0R52H1 olfactory receptor family 52 subfamily 11p15.4 H member 1 0R52H2P olfactory receptor family 52 subfamily 11p15.4 H member 2 pseudogene 0R5211 olfactory receptor family 52 subfamily I
11p15.4 member 1 0R52I2 olfactory receptor family 52 subfamily I
11p15.4 member 2 0R52J1P olfactory receptor family 52 subfamily J
11p15.4 member 1 pseudogene 0R52J2P olfactory receptor family 52 subfamily J
0R52J4P 11p15.4 member 2 pseudogene 0R52J3 olfactory receptor family 52 subfamily J
11p15.4 member 3 0R52K1 olfactory receptor family 52 subfamily 11p15.4 K member 1 0R52K2 olfactory receptor family 52 subfamily 11p15.4 K member 2 0R52K3P olfactory receptor family 52 subfamily 11p15.4 K member 3 pseudogene 0R52L1 olfactory receptor family 52 subfamily 11p15.4 L member 1 0R52L2P olfactory receptor family 52 subfamily 0R52L2 1115.4 L member 2 pseudogene 0R52M1 olfactory receptor family 52 subfamily OR52M1P 1115.4 M member 1 0R52M2P olfactory receptor family 52 subfamily 0R52M4 1115.4 M member 2 pseudogene 0R52N1 olfactory receptor family 52 subfamily 11p15.4 N member 1 0R52N2 olfactory receptor family 52 subfamily 11p15.4 N member 2 0R52N3P olfactory receptor family 52 subfamily 11p15.4 N member 3 pseudogene 0R52N4 olfactory receptor family 52 subfamily 11p15.4 N member 4 (gene/pseudogene) 0R52N5 olfactory receptor family 52 subfamily OR52N5Q 1115.4 N member 5 OR52P1P olfactory receptor family 52 subfamily OR52P1 11p15.4 P member 1 pseudogene 0R52P2P olfactory receptor family 52 subfamily 11p15.4 P member 2 pseudogene OR52Q1P olfactory receptor family 52 subfamily 11p15.4 Q member 1 pseudogene 0R52R1 olfactory receptor family 52 subfamily 11p15.4 R member 1 (gene/pseudogene) OR52S1P olfactory receptor family 52 subfamily 11p15.4 S member 1 pseudogene OR52T1P olfactory receptor family 52 subfamily 11p15.4 T member 1 pseudogene OR52U1P olfactory receptor family 52 subfamily 11p15.4 U member 1 pseudogene OR52V1P olfactory receptor family 52 subfamily 11p15.4 V member 1 pseudogene OR52W1 olfactory receptor family 52 subfamily OR52W1P 11p15.4 W member 1 OR52X1P olfactory receptor family 52 subfamily 11p15.4 X member 1 pseudogene 0R52Y1P olfactory receptor family 52 subfamily OR52Y2P 11p15.4 Y member 1 pseudogene 0R52Z1 olfactory receptor family 52 subfamily 0R52Z1P 11p15.4 Z member 1 (gene/pseudogene) [0105] Olfactory receptors, family 55:
Approved Previous Approved Name Synonyms Chromosome Symbol Symbols olfactory receptor family 55 subfamily 0R55B2P, OR55B1P 11p15.4 B member 1 pseudogene 0R55C1P
[0106] Olfactory receptors, family 56:
Approved Previous Approved Name Synonyms Chromosome Symbol Symbols 0R56A1 olfactory receptor family 56 subfamily 11p15.4 A member 1 0R56A3 olfactory receptor family 56 subfamily 0R56A6, 11p15.4 A member 3 0R56A3P
0R56A4 olfactory receptor family 56 subfamily 11p15.4 A member 4 0R56A5 olfactory receptor family 56 subfamily 0R56A5P 11p15.4 A member 5 0R56A7P olfactory receptor family 56 subfamily 11p15.4 A member 7 pseudogene 0R56B 1 olfactory receptor family 56 subfamily 11p15.4 B member 1 0R56B2P olfactory receptor family 56 subfamily 11p15.4 B member 2 pseudogene 0R56B3P olfactory receptor family 56 subfamily 11p15.4 B member 3 pseudogene 0R56B4 olfactory receptor family 56 subfamily 11p15.4 B member 4 Receptor gene/protein Response element Nuclear Hormone Receptors HRE (hormone response element) Estrogen receptor ERE (estrogen response element) ii-opioid receptor CRE
5-HT receptor CRE, SRE, and NFAT
Glucocorticoid receptor Glucocorticoid response element (GRE) Adrenergic receptor CRE
Androgen receptor Androgen response element (ARE) Thyroid hormone receptor HRE
[0107] Further exemplary receptor genes/proteins useful as heterologous receptors according to the methods and compositions of the disclosure include receptors such as those listed in the table below:
[0108] GPCR Receptors HGNC
HGNC
Family name Family name symbol symbol 5-Hydroxytryptamine receptors HTR1 A Adhesion Class GPCRs ADGRE2 5-Hydroxytryptamine receptors HTR1 B Adhesion Class GPCRs ADGRE3 5-Hydroxytryptamine receptors HTR1 D Adhesion Class GPCRs ADGRE4P
5-Hydroxytryptamine receptors HTR1 E Adhesion Class GPCRs ADGRE5 5-Hydroxytryptamine receptors HTR1 F Adhesion Class GPCRs ADGRF1 5-Hydroxytryptamine receptors HTR2A Adhesion Class GPCRs ADGRF2 5-Hydroxytryptamine receptors HTR2B Adhesion Class GPCRs ADGRF3 5-Hydroxytryptamine receptors HTR2C Adhesion Class GPCRs ADGRF4 5-Hydroxytryptamine receptors HTR4 Adhesion Class GPCRs ADGRF5 5-Hydroxytryptamine receptors HTR5A Adhesion Class GPCRs ADGRG1 5-Hydroxytryptamine receptors HTR5BP Adhesion Class GPCRs ADGRG2 5-Hydroxytryptamine receptors HTR6 Adhesion Class GPCRs ADGRG3 5-Hydroxytryptamine receptors HTR7 Adhesion Class GPCRs ADGRG4 Acetylcholine receptors (muscarinic) CHRM1 Adhesion Class GPCRs ADGRG5 Acetylcholine receptors (muscarinic) CHRM2 Adhesion Class GPCRs ADGRG6 Acetylcholine receptors (muscarinic) CHRM3 Adhesion Class GPCRs ADGRG7 Acetylcholine receptors (muscarinic) CHRM4 Adhesion Class GPCRs ADGRL1 Acetylcholine receptors (muscarinic) CHRM5 Adhesion Class GPCRs ADGRL2 Adenosine receptors ADORA1 Adhesion Class GPCRs ADGRL3 Adenosine receptors ADORA2A Adhesion Class GPCRs ADGRL4 Adenosine receptors ADORA2B Adhesion Class GPCRs ADGRV1 Adenosine receptors ADORA3 Adrenoceptors ADRA1 A
Adhesion Class GPCRs ADGRA1 Adrenoceptors ADRA1 B
Adhesion Class GPCRs ADGRA2 Adrenoceptors ADRA1 D
Adhesion Class GPCRs ADGRA3 Adrenoceptors ADRA2A
Adhesion Class GPCRs ADGRB1 Adrenoceptors ADRA2B
Adhesion Class GPCRs ADGRB2 Adrenoceptors ADRA2C
Adhesion Class GPCRs ADGRB3 Adrenoceptors ADRB1 Adhesion Class GPCRs CELSR1 Adrenoceptors ADRB2 Adhesion Class GPCRs CELSR2 Adrenoceptors ADRB3 Adhesion Class GPCRs CELSR3 Angiotensin receptors AGTR1 Adhesion Class GPCRs ADGRD1 Angiotensin receptors AGTR2 Adhesion Class GPCRs ADGRD2 Apelin receptor APLNR
Adhesion Class GPCRs ADGRE1 Bile acid receptor GPBAR1 HGNC
HGNC
Family name Family name symbol symbol Bombesin receptors NMBR Chemokine receptors XCR1 Bombesin receptors GRPR Chemokine receptors ACKR1 Bombesin receptors BRS3 Chemokine receptors ACKR2 Bradykin in receptors BDKRB1 Chemokine receptors ACKR3 Bradykin in receptors BDKRB2 Chemokine receptors ACKR4 Calcitonin receptors CALCR Chemokine receptors CCRL2 Calcitonin receptors Cholecystokinin receptors CCKAR
Calcitonin receptors Cholecystokinin receptors CCKBR
Calcitonin receptors Class A Orphans GPR1 Calcitonin receptors CALCRL Class A Orphans BRS3 Calcitonin receptors Class A Orphans GPR3 Calcitonin receptors Class A Orphans GPR4 Calcitonin receptors Class A Orphans GPR42 Calcium-sensing receptor CASR Class A Orphans GPR6 Cannabinoid receptors CNR1 Class A Orphans GPR12 Cannabinoid receptors CNR2 Class A Orphans GPR15 Chemerin receptor CMKLR1 Class A Orphans GPR17 Chemokine receptors CCR1 Class A Orphans GPR18 Chemokine receptors CCR2 Class A Orphans GPR19 Chemokine receptors CCR3 Class A Orphans GPR20 Chemokine receptors CCR4 Class A Orphans GPR21 Chemokine receptors CCR5 Class A Orphans GPR22 Chemokine receptors CCR6 Class A Orphans GPR25 Chemokine receptors CCR7 Class A Orphans GPR26 Chemokine receptors CCR8 Class A Orphans GPR27 Chemokine receptors CCR9 Class A Orphans GPR31 Chemokine receptors CCR10 Class A Orphans GPR32 Chemokine receptors CXCR1 Class A Orphans GPR33 Chemokine receptors CXCR2 Class A Orphans GPR34 Chemokine receptors CXCR3 Class A Orphans GPR35 Chemokine receptors CXCR4 Class A Orphans GPR37 Chemokine receptors CXCR5 Class A Orphans GPR37L1 Chemokine receptors CXCR6 Class A Orphans GPR39 Chemokine receptors CX3CR1 Class A Orphans GPR45 HGNC
HGNC
Family name Family name symbol symbol Class A Orphans GPR50 Class A Orphans GPR171 Class A Orphans GPR52 Class A Orphans GPR173 Class A Orphans GPR55 Class A Orphans GPR174 Class A Orphans GPR61 Class A Orphans GPR176 Class A Orphans GPR62 Class A Orphans GPR182 Class A Orphans GPR63 Class A Orphans GPR183 Class A Orphans GPR65 Class A Orphans LGR4 Class A Orphans GPR68 Class A Orphans LGR5 Class A Orphans GPR75 Class A Orphans LGR6 Class A Orphans GPR78 Class A Orphans MASI
Class A Orphans GPR79 Class A Orphans MASI L
Class A Orphans GPR82 Class A Orphans MRGPRD
Class A Orphans GPR83 Class A Orphans MRGPRE
Class A Orphans GPR84 Class A Orphans MRGPRF
Class A Orphans GPR85 Class A Orphans MRGPRG
Class A Orphans GPR87 Class A Orphans MRGPRX1 Class A Orphans GPR88 Class A Orphans MRGPRX2 Class A Orphans GPR101 Class A Orphans MRGPRX3 Class A Orphans GPR119 Class A Orphans MRGPRX4 Class A Orphans GPR132 Class A Orphans OPN3 Class A Orphans GPR135 Class A Orphans OPN4 Class A Orphans GPR139 Class A Orphans OPN5 Class A Orphans GPR141 Class A Orphans P2RY8 Class A Orphans GPR142 Class A Orphans P2RY10 Class A Orphans GPR146 Class A Orphans TAA R2 Class A Orphans GPR148 Class A Orphans TAAR3P
Class A Orphans GPR149 Class A Orphans TAAR4P
Class A Orphans GPR150 Class A Orphans TAAR5 Class A Orphans GPR151 Class A Orphans TAAR6 Class A Orphans GPR152 Class A Orphans TAAR8 Class A Orphans GPR153 Class A Orphans TAAR9 Class A Orphans GPR160 Class C Orphans GPR156 Class A Orphans GPR161 Class C Orphans GPR158 Class A Orphans GPR162 Class C Orphans GPR179 HGNC
HGNC
Family name Family name symbol symbol Class C Orphans GPRC5A Free fatty acid receptors FFAR2 Class C Orphans GPRC5B Free fatty acid receptors FFAR3 Class C Orphans GPRC5C Free fatty acid receptors FFAR4 Class C Orphans GPRC5D Free fatty acid receptors GPR42 Class C Orphans GPRC6A GABAB receptors Class Frizzled GPCRs FZD1 GABAB receptors GABBR1 Class Frizzled GPCRs FZD2 GABAB receptors GABBR2 Class Frizzled GPCRs FZD3 Galanin receptors GALR1 Class Frizzled GPCRs FZD4 Galanin receptors GALR2 Class Frizzled GPCRs FZD5 Galanin receptors GALR3 Class Frizzled GPCRs FZD6 Ghrelin receptor GHSR
Class Frizzled GPCRs FZD7 Glucagon receptor family GHRHR
Class Frizzled GPCRs FZD8 Glucagon receptor family GIPR
Class Frizzled GPCRs FZD9 Glucagon receptor family GLP1R
Class Frizzled GPCRs FZD10 Glucagon receptor family GLP2R
Class Frizzled GPCRs SMO Glucagon receptor family GCGR
Complement peptide receptors C3AR1 Glucagon receptor family SCTR
Complement peptide receptors C5AR1 Glycoprotein hormone receptors FSHR
Complement peptide receptors C5AR2 Glycoprotein hormone receptors LHCGR
Corticotropin-releasing factor CRHR1 Glycoprotein hormone receptors TSHR
receptors Gonadotrophin-releasing hormone GNRHR
Corticotropin-releasing factor CRHR2 receptors receptors Gonadotrophin-releasing hormone Dopamine receptors DRD1 receptors Dopamine receptors DRD2 GPR18, GPR55 and GPR119 GPR18 Dopamine receptors DRD3 GPR18, GPR55 and GPR119 GPR55 Dopamine receptors DRD4 GPR18, GPR55 and GPR119 GPR119 Dopamine receptors DRD5 G protein-coupled estrogen receptor Endothelin receptors EDNRA Histamine receptors HRH1 Endothelin receptors EDNRB Histamine receptors HRH2 Formylpeptide receptors FPR1 Histamine receptors HRH3 Formylpeptide receptors FPR2 Histamine receptors HRH4 Formylpeptide receptors FPR3 Hydroxycarboxylic acid receptors Free fatty acid receptors FFAR1 Hydroxycarboxylic acid receptors

88 HGNC
HGNC
Family name Family name symbol symbol Hydroxycarboxylic acid receptors HCAR3 Metabotropic glutamate receptors GRM5 Kisspeptin receptor KISS1R Metabotropic glutamate receptors Leukotriene receptors LTB4R Metabotropic glutamate receptors Leukotriene receptors LTB4R2 Metabotropic glutamate receptors Leukotriene receptors CYSLTR1 Motilin receptor MLNR
Leukotriene receptors CYSLTR2 Neuromedin U receptors NMUR1 Leukotriene receptors OXER1 Neuromedin U receptors NMUR2 Leukotriene receptors FPR2 Neuropeptide FF/neuropeptide AF

Lysophospholipid (LPA) receptors LPAR1 receptors Lysophospholipid (LPA) receptors LPAR2 Neuropeptide FF/neuropeptide AF NPFFR2 Lysophospholipid (LPA) receptors LPAR3 receptors Lysophospholipid (LPA) receptors LPAR4 Neuropeptide S receptor NPSR1 Lysophospholipid (LPA) receptors LPAR5 Neuropeptide W/neuropeptide B NPBWR1 Lysophospholipid (LPA) receptors LPAR6 receptors Lysophospholipid (Si P) receptors S1PR1 Neuropeptide W/neuropeptide B NPBWR2 receptors Lysophospholipid (Si P) receptors S1PR2 Neuropeptide Y receptors NPY1R
Lysophospholipid (Si P) receptors S1PR3 Neuropeptide Y receptors NPY2R
Lysophospholipid (Si P) receptors S1PR4 Neuropeptide Y receptors NPY4R
Lysophospholipid (Si P) receptors S1PR5 Neuropeptide Y receptors NPY5R
Melanin-concentrating hormone MCHR1 receptors Neuropeptide Y receptors NPY6R
Melanin-concentrating hormone MCHR2 Neurotensin receptors NTSR1 receptors Neurotensin receptors NTSR2 Melanocortin receptors MOIR Opioid receptors OPRD1 Melanocortin receptors MC2R Opioid receptors OPRK1 Melanocortin receptors MC3R Opioid receptors OPRM1 Melanocortin receptors MC4R Opioid receptors OPRL1 Melanocortin receptors MC5R Orexin receptors HCRTR1 Melatonin receptors MTNR1A Orexin receptors HCRTR2 Melatonin receptors MTNR1B Other 7TM proteins GPR107 Metabotropic glutamate receptors GRM1 Other 7TM
proteins GPR137 Metabotropic glutamate receptors GRM2 Other 7TM
proteins OR51E1 Metabotropic glutamate receptors GRM3 Other 7TM
proteins TPRA1 Metabotropic glutamate receptors GRM4 Other 7TM
proteins GPR143

89 HGNC
HGNC
Family name Family name symbol symbol Other 7TM proteins GPR157 Somatostatin receptors SSTR1 Oxoglutarate receptor OXGR1 Somatostatin receptors SSTR2 P2Y receptors P2RY1 Somatostatin receptors SSTR3 P2Y receptors P2RY2 Somatostatin receptors SSTR4 P2Y receptors P2RY4 Somatostatin receptors SSTR5 P2Y receptors P2RY6 Succinate receptor SUCNR1 P2Y receptors P2RY11 Tachykinin receptors TACR1 P2Y receptors P2RY12 Tachykinin receptors TACR2 P2Y receptors P2RY13 Tachykinin receptors TACR3 P2Y receptors P2RY14 Taste 1 receptors TAS1R1 Parathyroid hormone receptors PTH1R Taste 1 receptors TAS1R2 Parathyroid hormone receptors PTH2R Taste 1 receptors TAS1R3 Platelet-activating factor receptor PTAFR Taste 2 receptors TAS2R1 Prokineticin receptors PROKR1 Taste 2 receptors TAS2R3 Prokineticin receptors PROKR2 Taste 2 receptors TAS2R4 Prolactin-releasing peptide receptor PRLHR Taste 2 receptors TAS2R5 Prostanoid receptors PTGDR Taste 2 receptors TAS2R7 Prostanoid receptors PTGDR2 Taste 2 receptors TAS2R8 Prostanoid receptors PTGER1 Taste 2 receptors TAS2R9 Prostanoid receptors PTGER2 Taste 2 receptors TAS2R10 Prostanoid receptors PTGER3 Taste 2 receptors TAS2R13 Prostanoid receptors PTGER4 Taste 2 receptors TAS2R14 Prostanoid receptors PTGFR Taste 2 receptors TAS2R16 Prostanoid receptors PTGIR Taste 2 receptors TAS2R19 Prostanoid receptors TBXA2R Taste 2 receptors TAS2R20 Proteinase-activated receptors F2R Taste 2 receptors TAS2R30 Proteinase-activated receptors F2RL1 Taste 2 receptors TAS2R31 Proteinase-activated receptors F2RL2 Taste 2 receptors TAS2R38 Proteinase-activated receptors F2RL3 Taste 2 receptors TAS2R39 QRFP receptor QRFPR Taste 2 receptors TAS2R40 Relaxin family peptide receptors RXFP1 Taste 2 receptors TAS2R41 Relaxin family peptide receptors RXFP2 Taste 2 receptors TAS2R42 Relaxin family peptide receptors RXFP3 Taste 2 receptors TAS2R43 Relaxin family peptide receptors RXFP4 Taste 2 receptors TAS2R45 HGNC
HGNC
Family name Family name symbol symbol Taste 2 receptors TAS2R46 Urotensin receptor Taste 2 receptors TAS2R50 Vasopressin and oxytocin receptors Taste 2 receptors TAS2R60 Vasopressin and oxytocin receptors Thyrotropin-releasing hormone TRHR Vasopressin and oxytocin receptors AVPR2 receptors Vasopressin and oxytocin receptors OXTR
Thyrotropin-releasing hormone VIP and PACAP receptors ADCYAP1 R1 receptors VIP and PACAP receptors VIPR1 Trace amine receptor TAAR1 VIP and PACAP receptors VIPR2 [0109] Nuclear Hormone Receptors:
Family name HGNC symbol Family name HGNC symbol OB. DAX-like receptors NROB1 11. Vitamin D receptor-like OB. DAX-like receptors NROB2 receptors VDR
1A. Thyroid hormone receptors THRA 11. Vitamin D receptor-like 1A. Thyroid hormone receptors THRB receptors 1B. Retinoic acid receptors RARA 11. Vitamin D receptor-like 1B. Retinoic acid receptors RARB receptors 1B. Retinoic acid receptors RARG 2A. Hepatocyte nuclear factor-10. Peroxisome proliferator-receptors HNF4A
activated receptors PPARA 2A. Hepatocyte nuclear factor-4 10. Peroxisome proliferator-receptors HNF4G
activated receptors PPARD 2B. Retinoid X receptors RXRA
10. Peroxisome proliferator-2B. Retinoid X receptors RXRB
activated receptors PPARG 2B. Retinoid X receptors RXRG
1D. Rev-Erb receptors NR1D1 20. Testicular receptors NR2C1 1D. Rev-Erb receptors NR1 D2 20. Testicular receptors NR202 1F. Retinoic acid-related orphans RORA 2E. Tailless-like receptors NR2E1 1F. Retinoic acid-related orphans RORB 2E. Tailless-like receptors NR2E3 1F. Retinoic acid-related orphans RORC 2F. COUP-TF-like receptors NR2F1 1H. Liver X receptor-like receptors NR1H4 2F. COUP-TF-like receptors NR2F2 1H. Liver X receptor-like receptors NR1H5P 2F. COUP-TF-like receptors NR2F6 1H. Liver X receptor-like receptors NR1H3 3A. Estrogen receptors ESR1 1H. Liver X receptor-like receptors NR1H2 3A. Estrogen receptors ESR2 3B. Estrogen-related receptors ESRRA

Family name HGNC symbol Family name HGNC symbol 3B. Estrogen-related receptors ESRRB 4A. Nerve growth factor IB-like 3B. Estrogen-related receptors ESRRG receptors 30. 3-Ketosteroid receptors AR 4A. Nerve growth factor IB-like 30. 3-Ketosteroid receptors NR301 receptors 30. 3-Ketosteroid receptors NR3C2 5A. Fushi tarazu Fl -like receptors NR5A1 30. 3-Ketosteroid receptors PGR 5A. Fushi tarazu Fl -like receptors NR5A2 4A. Nerve growth factor IB-like 6A. Germ cell nuclear factor receptors NR4A1 receptors NR6A1 [0110] Catalytic Receptors HGNC
HGNC
Family name Family name symbol symbol GDNF receptor family GFRA1 IL-2 receptor family IL2RB
GDNF receptor family GFRA2 IL-2 receptor family IL2RG
GDNF receptor family GFRA3 IL-2 receptor family IL4R
GDNF receptor family GFRA4 IL-2 receptor family IL7R
IL-10 receptor family IL22RA2 IL-2 receptor family IL9R
IL-10 receptor family IL1ORA IL-2 receptor family IL13RA1 IL-10 receptor family IL1ORB IL-2 receptor family IL15RA
IL-10 receptor family IL20RA IL-2 receptor family IL21R
IL-10 receptor family IL20RB IL-2 receptor family CRLF2 IL-10 receptor family IL22RA1 IL-3 receptor family IL3RA
IL-10 receptor family IFNLR1 IL-3 receptor family IL5RA
IL-12 receptor family IL12RB1 IL-3 receptor family CSF2RA
IL-12 receptor family IL12RB2 IL-3 receptor family CSF2RB
IL-12 receptor family IL23R IL-6 receptor family IL6R
IL-17 receptor family IL17RA IL-6 receptor family IL6ST
IL-17 receptor family IL17RB IL-6 receptor family IL11 RA
IL-17 receptor family IL17R0 IL-6 receptor family IL27RA
IL-17 receptor family IL17RD IL-6 receptor family 1L31 RA
IL-17 receptor family IL17RE IL-6 receptor family CNTFR
IL-2 receptor family IL13RA2 IL-6 receptor family LEPR
IL-2 receptor family IL2RA IL-6 receptor family LIFR

HGNC
HGNC
Family name Family name symbol symbol IL-6 receptor family OSMR Integrins ITGB7 Immunoglobulin-like family of IL-1 Integrins ITGB8 receptors IL1 R1 Interferon receptor family IFNAR1 Immunoglobulin-like family of IL-1 Interferon receptor family IFNAR2 receptors IL1 R2 Interferon receptor family IFNGR1 Immunoglobulin-like family of IL-1 Interferon receptor family IFNGR2 receptors IL1RL1 Natriuretic peptide receptor family Immunoglobulin-like family of IL-1 Natriuretic peptide receptor family receptors IL1RL2 Natriuretic peptide receptor family GUCY2C
Immunoglobulin-like family of IL-1 Natriuretic peptide receptor family NPR3 receptors IL18R1 NOD-like receptor family NOD1 Integrins ITGA1 NOD-like receptor family NOD2 Integrins ITGA2 NOD-like receptor family NLRC3 Integrins ITGA2B
NOD-like receptor family NLRC4 Integrins ITGA3 NOD-like receptor family NLRC5 Integrins ITGA4 NOD-like receptor family NLRX1 Integrins ITGA5 NOD-like receptor family CIITA
Integrins ITGA6 NOD-like receptor family NLRP1 Integrins ITGA7 NOD-like receptor family NLRP2 Integrins ITGA8 NOD-like receptor family NLRP3 Integrins ITGA9 NOD-like receptor family NLRP4 Integrins ITGA1 0 NOD-like receptor family NLRP5 Integrins ITGA1 1 NOD-like receptor family NLRP6 Integrins ITGAD
NOD-like receptor family NLRP7 Integrins ITGAE
NOD-like receptor family NLRP8 Integrins ITGAL
NOD-like receptor family NLRP9 Integrins ITGAM
NOD-like receptor family NLRP1 0 Integrins ITGAV
NOD-like receptor family NLRP1 1 Integrins ITGAX
NOD-like receptor family NLRP12 Integrins ITGB1 NOD-like receptor family NLRP1 3 Integrins ITGB2 NOD-like receptor family NLRP1 4 Integrins ITGB3 Prolactin receptor family EPOR
Integrins ITGB4 Prolactin receptor family CSF3R
Integrins ITGB5 Prolactin receptor family GHR
Integrins ITGB6 Prolactin receptor family PRLR

HGNC HGNC
Family name Family name symbol symbol Prolactin receptor family MPL Receptor tyrosine phosphatase Receptor Guanylyl Cyclase (RGC) (RTP) family PTPRN
family NPR1 Receptor tyrosine phosphatase Receptor Guanylyl Cyclase (RGC) (RTP) family PTPRN2 family NPR2 Receptor tyrosine phosphatase Receptor Guanylyl Cyclase (RGC) (RTP) family PTPRO
family GUCY2C Receptor tyrosine phosphatase Receptor Guanylyl Cyclase (RGC) (RTP) family PTPRQ
family GUCY2D Receptor tyrosine phosphatase Receptor Guanylyl Cyclase (RGC) (RTP) family PTPRR
family GUCY2F Receptor tyrosine phosphatase Receptor Guanylyl Cyclase (RGC) (RTP) family PTPRS
family GUCY2GP Receptor tyrosine phosphatase Receptor tyrosine phosphatase (RTP) family PTPRT
(RTP) family PTPRA Receptor tyrosine phosphatase Receptor tyrosine phosphatase (RTP) family PTPRU
(RTP) family PTPRB Receptor tyrosine phosphatase Receptor tyrosine phosphatase (RTP) family PTPRZ1 (RTP) family PTPRC RIG-I-like receptor family DDX58 Receptor tyrosine phosphatase RIG-I-like receptor family IFIH1 (RTP) family PTPRD RIG-I-like receptor family DHX58 Receptor tyrosine phosphatase Toll-like receptor family TLR1 (RTP) family PTPRE Toll-like receptor family TLR2 Receptor tyrosine phosphatase Toll-like receptor family TLR3 (RTP) family PTPRF Toll-like receptor family TLR4 Receptor tyrosine phosphatase Toll-like receptor family TLR5 (RTP) family PTPRG
Toll-like receptor family TLR6 Receptor tyrosine phosphatase Toll-like receptor family TLR7 (RTP) family PTPRH
Toll-like receptor family TLR8 Receptor tyrosine phosphatase Toll-like receptor family TLR9 (RTP) family PTPRJ
Toll-like receptor family TLR10 Receptor tyrosine phosphatase Tumour necrosis factor (TN F) (RTP) family PTPRK
receptor family TNFRSF1A
Receptor tyrosine phosphatase Tumour necrosis factor (TN F) (RTP) family PTPRM
receptor family TNFRSF1B

HGNC HGNC
Family name Family name symbol symbol Tumour necrosis factor (TNF) Tumour necrosis factor (TNF) receptor family LTBR receptor family TNFRSF14 Tumour necrosis factor (TNF) Tumour necrosis factor (TNF) receptor family TNFRSF4 receptor family NGFR
Tumour necrosis factor (TNF) Tumour necrosis factor (TNF) receptor family 0D40 receptor family TNFRSF17 Tumour necrosis factor (TNF) Tumour necrosis factor (TNF) receptor family FAS receptor family TNFRSF18 Tumour necrosis factor (TNF) Tumour necrosis factor (TNF) receptor family TNFRSF6B receptor family TNFRSF19 Tumour necrosis factor (TNF) Tumour necrosis factor (TNF) receptor family 0D27 receptor family RELT
Tumour necrosis factor (TNF) Tumour necrosis factor (TNF) receptor family TNFRSF8 receptor family TNFRSF21 Tumour necrosis factor (TNF) Tumour necrosis factor (TNF) receptor family TNFRSF9 receptor family EDA2R
Tumour necrosis factor (TNF) Tumour necrosis factor (TNF) receptor family TNFRSF10A receptor family EDAR
Tumour necrosis factor (TNF) Type III receptor serine/threonine receptor family TNFRSF1OB kinases TGFBR3 Tumour necrosis factor (TNF) Type III RTKs: PDGFR, CSFR, Kit, receptor family TNFRSF10C FLT3 receptor family PDGFRA
Tumour necrosis factor (TNF) Type III RTKs: PDGFR, CSFR, Kit, receptor family TNFRSF1OD FLT3 receptor family PDGFRB
Tumour necrosis factor (TNF) Type III RTKs: PDGFR, CSFR, Kit, receptor family TNFRSF11A FLT3 receptor family KIT
Tumour necrosis factor (TNF) Type III RTKs: PDGFR, CSFR, Kit, receptor family TNFRSF11B FLT3 receptor family CSF1R
Tumour necrosis factor (TNF) Type III RTKs: PDGFR, CSFR, Kit, receptor family TNFRSF25 FLT3 receptor family FLT3 Tumour necrosis factor (TNF) Type II receptor serine/threonine receptor family TNFRSF12A kinases ACVR2A
Tumour necrosis factor (TNF) Type II receptor serine/threonine receptor family TNFRSF13B kinases ACVR2B
Tumour necrosis factor (TNF) Type II receptor serine/threonine receptor family TNFRSF13C kinases AMHR2 HGNC
HGNC
Family name Family name symbol symbol Type ll receptor serine/threonine Type IV RTKs: VEGF (vascular kinases BMPR2 endothelial growth factor) receptor Type ll receptor serine/threonine family FLT4 kinases TGFBR2 Type IX RTKs: MuSK MUSK
Type ll RTKs: Insulin receptor family INSR Type VIII
RTKs: ROR family ROR1 Type ll RTKs: Insulin receptor family IGF1R Type VIII
RTKs: ROR family ROR2 Type ll RTKs: Insulin receptor family INSRR Type VII RTKs: Neurotrophin Type I receptor serine/threonine receptor/Trk family NTRK1 kinases ACVRL1 Type VII RTKs: Neurotrophin Type I receptor serine/threonine receptor/Trk family NTRK2 kinases ACVR1 Type VII RTKs: Neurotrophin Type I receptor serine/threonine receptor/Trk family NTRK3 kinases BMPR1 A Type VI RTKs: PTK7/CCK4 PTK7 Type I receptor serine/threonine Type V RTKs: FGF (fibroblast growth kinases ACVR1B factor) receptor family FGFR1 Type I receptor serine/threonine Type V RTKs: FGF (fibroblast growth kinases TGFBR1 factor) receptor family FGFR2 Type I receptor serine/threonine Type V RTKs: FGF (fibroblast growth kinases BMPR1B factor) receptor family FGFR3 Type I receptor serine/threonine Type V RTKs: FGF (fibroblast growth kinases ACVR1C factor) receptor family FGFR4 Type I RTKs: ErbB (epidermal growth Type XIII RTKs: Ephrin receptor factor) receptor family EGFR family EPHA1 Type I RTKs: ErbB (epidermal growth Type XIII RTKs: Ephrin receptor factor) receptor family ERBB2 family EPHA2 Type I RTKs: ErbB (epidermal growth Type XIII RTKs: Ephrin receptor factor) receptor family ERBB3 family EPHA3 Type I RTKs: ErbB (epidermal growth Type XIII RTKs: Ephrin receptor factor) receptor family ERBB4 family EPHA4 Type IV RTKs: VEGF (vascular Type XIII RTKs: Ephrin receptor endothelial growth factor) receptor family EPHA5 family FLT1 Type XIII RTKs: Ephrin receptor Type IV RTKs: VEGF (vascular family EPHA6 endothelial growth factor) receptor Type XIII RTKs: Ephrin receptor family KDR family EPHA7 HGNC
HGNC
Family name Family name symbol symbol Type XIII RTKs: Ephrin receptor Type XIV RTKs: RET RET
family EPHA8 Type XIX RTKs: Leukocyte tyrosine Type XIII RTKs: Ephrin receptor kinase (LTK) receptor family LTK
family EPHA1 0 Type XIX RTKs: Leukocyte tyrosine Type XIII RTKs: Ephrin receptor kinase (LTK) receptor family ALK
family EPHB1 Type X RTKs: HGF (hepatocyte Type XIII RTKs: Ephrin receptor growth factor) receptor family MET
family EPHB2 Type X RTKs: HGF (hepatocyte Type XIII RTKs: Ephrin receptor growth factor) receptor family family EPHB3 Type XVIII RTKs: LMR family AATK
Type XIII RTKs: Ephrin receptor Type XVIII RTKs: LMR family family EPHB4 Type XVIII RTKs: LMR family Type XIII RTKs: Ephrin receptor Type XVII RTKs: ROS receptors family EPHB6 Type XVI RTKs: DDR (collagen Type XII RTKs: TIE family of receptor) family DDR1 angiopoietin receptors TIE1 Type XVI RTKs: DDR (collagen Type XII RTKs: TIE family of receptor) family DDR2 angiopoietin receptors TEK Type XV RTKs: RYK RYK
Type XI RTKs: TAM (TYR03-, AXL- Type XX RTKs: STYK1 STYK1 and MER-TK) receptor family AXL
Type XI RTKs: TAM (TYR03-, AXL-and MER-TK) receptor family TYRO3 Type XI RTKs: TAM (TYR03-, AXL-and MER-TK) receptor family MERTK
[0111] The ligands may be a known ligand for the receptor or a test compound. For example, in the case of olfactory receptors, the ligand may be an odorant.
Exemplary odorants include Geranyl acetate, Methyl formate, Methyl acetate, Methyl propionate, Methyl propanoate, Methyl butyrate, Methyl butanoate, Ethyl acetate, Ethyl butyrate, Ethyl butanoate, Isoamyl acetate, Pentyl butyrate, Pentyl butanoate, Pentyl pentanoate, Octyl acetate, Benzyl acetate, and Methyl anthranilate.
[0112] In some embodiments, the ligand comprises a small molecule, a polypeptide, or a nucleic acid ligand. Methods of the disclosure relate to screening procedures that detect ligand engagement with a receptor. Accordingly, the ligand may be a test compound or a drug. The methods of the disclosure can be utilized to determine ligand and receptor engagement for the purposes of determining ligand/drug efficacy and/or off-target effects. A
polypeptide ligand may be a peptide, which is fewer than 100 amino acids in length.
[0113] Chemical agents are "small molecule" compounds that are typically organic, non-peptide molecules, having a molecular weight less than 10,000 Da. In some embodiments, they are less than 5,000 Da, less than 1,000 Da, or less than 500 Da (and any range derivable therein). This class of modulators includes chemically synthesized molecules, for example, compounds from combinatorial chemical libraries. Synthetic compounds may be rationally .. designed or identified from screening methods described herein. Methods for generating and obtaining small molecules are well known in the art (Schreiber, Science 2000;
151:1964-1969; Radmann et al., Science 2000; 151:1947-1948, which are hereby incorporated by reference).
II. Reporter Systems A. Nucleic Acid Reporter [0114] The reporter comprises a barcode region, which comprises an index region that can identify the activated receptor. The index region can be a polynucleotide of at least, at most, or exactly 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 150, 200 or more (or any range derivable therein) nucleotides in length. The barcode may comprise one or more universal PCR regions, adaptors, linkers, or a combination thereof.
[0115] The index region of the barcode is a polynucleotide sequence that can be used to identify the heterologous receptor that is activated and/or expressed in the same cell as the barcode because it is unique to a particular heterologous receptor in the context of the screen .. being utilized. In embodiments relating to a populations of cells, determining the identity of the barcode is done by determining the nucleotide sequence of the index region in order to identify which receptor(s) has been activated in a population of cells. As discussed herein, methods may involve sequencing one or more index regions or having such index regions sequenced.
[0116] Nucleic acid constructs are generated by any means known in the art, including through the use of polymerases and solid state nucleic acid synthesis (e.g., on a column, multiwall plate, or microarray). The invention provides for the inclusion of barcodes, to facilitate the determination of the activity of specific nucleic acid regulatory elements (i.e.
receptor-responsive elements), which may be an indication of an activated receptor. These barcodes are included in the nucleic acid constructs and expression vectors containing the .. nucleic acid regulatory elements. Each index region of the barcode is unique to the corresponding heterologous receptor gene (i.e., although a particular nucleic acid regulatory element may have more than one barcodes or index regions (e.g., 2, 3, 4, 5, 10, or more), each barcode is indicative of the activation of a single receptor). These barcodes are oriented in the expression vector such that they are transcribed in the same mRNA
transcript as the associated open reading frame. The barcodes may be oriented in the mRNA
transcript 5' to the open reading frame, 3' to the open reading frame, immediately 5' to the terminal poly-A
tail, or somewhere in-between. In some embodiments, the barcodes are in the 3' untranslated region.
[0117] The unique portions of the barcodes may be continuous along the length of the barcode sequence or the barcode may include stretches of nucleic acid sequence that is not unique to any one barcode. In one application, the unique portions of the barcodes (i.e. index region(s)) may be separated by a stretch of nucleic acids that is removed by the cellular machinery during transcription into mRNA (e.g., an intron).
[0118] The inducible reporter includes a regulatory element, such as a promoter, and a barcode. In some embodiments, the regulatory element further includes an open reading frame. The open reading frame may encode for a selectable or screenable marker, as described herein. The nucleic acid regulatory element may be 5', 3', or within the open reading frame. The barcode may be located anywhere within the region to be transcribed into mRNA (e.g., upstream of the open reading frame, downstream of the open reading frame, or within the open reading frame). Importantly, the barcode is located 5' to the transcription termination site.
[0119] The barcodes and/or index regions are quantified or determined by methods known in the art, including quantitative sequencing (e.g., using an Illumina@
sequencer) or quantitative hybridization techniques (e.g., microarray hybridization technology or using a Luminex@ bead system). Sequencing methods are further described herein.

B. Sequencing methods to detect barcodes 1. Massively parallel signature sequencing (MPSS).
[0120] The first of the next-generation sequencing technologies, massively parallel signature sequencing (or MPSS), was developed in the 1990s at Lynx Therapeutics. MPSS
was a bead-based method that used a complex approach of adapter ligation followed by adapter decoding, reading the sequence in increments of four nucleotides. This method made it susceptible to sequence-specific bias or loss of specific sequences.
Because the technology was so complex, MPSS was only performed 'in-house' by Lynx Therapeutics and no DNA
sequencing machines were sold to independent laboratories. Lynx Therapeutics merged with Solexa (later acquired by Illumina) in 2004, leading to the development of sequencing-by-synthesis, a simpler approach acquired from Manteia Predictive Medicine, which rendered MPSS obsolete. However, the essential properties of the MPSS output were typical of later "next-generation" data types, including hundreds of thousands of short DNA
sequences. In the case of MPSS, these were typically used for sequencing cDNA for measurements of gene expression levels. Indeed, the powerful Illumina HiSeq2000, HiSeq2500 and MiSeq systems are based on MPSS.
2. Polony sequencing.
[0121] The Polony sequencing method, developed in the laboratory of George M. Church at Harvard, was among the first next-generation sequencing systems and was used to sequence a full genome in 2005. It combined an in vitro paired-tag library with emulsion PCR, an automated microscope, and ligation-based sequencing chemistry to sequence an E.
coli genome at an accuracy of >99.9999% and a cost approximately 1/9 that of Sanger sequencing. The technology was licensed to Agencourt Biosciences, subsequently spun out into Agencourt Personal Genomics, and eventually incorporated into the Applied Biosystems SOLiD platform, which is now owned by Life Technologies.
3. 454 pyrosequencing.
[0122] A parallelized version of pyrosequencing was developed by 454 Life Sciences, which has since been acquired by Roche Diagnostics. The method amplifies DNA
inside water droplets in an oil solution (emulsion PCR), with each droplet containing a single DNA
template attached to a single primer-coated bead that then forms a clonal colony. The sequencing machine contains many picoliter-volume wells each containing a single bead and sequencing enzymes. Pyrosequencing uses luciferase to generate light for detection of the individual nucleotides added to the nascent DNA, and the combined data are used to generate sequence read-outs. This technology provides intermediate read length and price per base compared to Sanger sequencing on one end and Solexa and SOLiD on the other.
4. Illumina (Solexa) sequencing.
[0123] Solexa, now part of Illumina, developed a sequencing method based on reversible dye-terminators technology, and engineered polymerases, that it developed internally. The terminated chemistry was developed internally at Solexa and the concept of the Solexa system was invented by Balasubramanian and Klennerman from Cambridge University's chemistry department. In 2004, Solexa acquired the company Manteia Predictive Medicine in order to gain a massivelly parallel sequencing technology based on "DNA
Clusters", which involves the clonal amplification of DNA on a surface. The cluster technology was co-acquired with Lynx Therapeutics of California. Solexa Ltd. later merged with Lynx to form Solexa Inc.
[0124] In this method, DNA molecules and primers are first attached on a slide and amplified with polymerase so that local clonal DNA colonies, later coined "DNA
clusters", are formed. To determine the sequence, four types of reversible terminator bases (RT-bases) are added and non-incorporated nucleotides are washed away. A camera takes images of the fluorescently labeled nucleotides, then the dye, along with the terminal 3' blocker, is chemically removed from the DNA, allowing for the next cycle to begin. Unlike pyrosequencing, the DNA chains are extended one nucleotide at a time and image acquisition can be performed at a delayed moment, allowing for very large arrays of DNA
colonies to be captured by sequential images taken from a single camera.
[0125] Decoupling the enzymatic reaction and the image capture allows for optimal throughput and theoretically unlimited sequencing capacity. With an optimal configuration, the ultimately reachable instrument throughput is thus dictated solely by the analog-to-digital conversion rate of the camera, multiplied by the number of cameras and divided by the number of pixels per DNA colony required for visualizing them optimally (approximately 10 pixels/colony). In 2012, with cameras operating at more than 10 MHz A/D
conversion rates and available optics, fluidics and enzymatics, throughput can be multiples of 1 million nucleotides/second, corresponding roughly to one human genome equivalent at lx coverage per hour per instrument, and one human genome re-sequenced (at approx. 30x) per day per instrument (equipped with a single camera).
5. SOLiD sequencing.
[0126] Applied Biosystems' (now a Life Technologies brand) SOLiD
technology employs sequencing by ligation. Here, a pool of all possible oligonucleotides of a fixed length are labeled according to the sequenced position. Oligonucleotides are annealed and ligated; the preferential ligation by DNA ligase for matching sequences results in a signal informative of the nucleotide at that position. Before sequencing, the DNA is amplified by emulsion PCR.
The resulting beads, each containing single copies of the same DNA molecule, are deposited on a glass slide. The result is sequences of quantities and lengths comparable to Illumina sequencing. This sequencing by ligation method has been reported to have some issue sequencing palindromic sequences.
6. Ion Torrent semiconductor sequencing.
[0127] Ion Torrent Systems Inc. (now owned by Life Technologies) developed a system based on using standard sequencing chemistry, but with a novel, semiconductor based detection system. This method of sequencing is based on the detection of hydrogen ions that are released during the polymerization of DNA, as opposed to the optical methods used in other sequencing systems. A microwell containing a template DNA strand to be sequenced is flooded with a single type of nucleotide. If the introduced nucleotide is complementary to the leading template nucleotide it is incorporated into the growing complementary strand. This causes the release of a hydrogen ion that triggers a hypersensitive ion sensor, which indicates that a reaction has occurred. If homopolymer repeats are present in the template sequence multiple nucleotides will be incorporated in a single cycle. This leads to a corresponding number of released hydrogens and a proportionally higher electronic signal.
7. DNA nanoball sequencing.
[0128] DNA nanoball sequencing is a type of high throughput sequencing technology used to determine the entire genomic sequence of an organism. The company Complete Genomics uses this technology to sequence samples submitted by independent researchers.
The method uses rolling circle replication to amplify small fragments of genomic DNA into DNA nanoballs. Unchained sequencing by ligation is then used to determine the nucleotide sequence. This method of DNA sequencing allows large numbers of DNA nanoballs to be sequenced per run and at low reagent costs compared to other next generation sequencing platforms. However, only short sequences of DNA are determined from each DNA
nanoball which makes mapping the short reads to a reference genome difficult. This technology has been used for multiple genome sequencing projects and is scheduled to be used for more.
8. Heliscope single molecule sequencing.
[0129] Heliscope sequencing is a method of single-molecule sequencing developed by Helicos Biosciences. It uses DNA fragments with added poly-A tail adapters which are attached to the flow cell surface. The next steps involve extension-based sequencing with cyclic washes of the flow cell with fluorescently labeled nucleotides (one nucleotide type at a time, as with the Sanger method). The reads are performed by the Heliscope sequencer. The reads are short, up to 55 bases per run, but recent improvements allow for more accurate reads of stretches of one type of nucleotides. This sequencing method and equipment were used to sequence the genome of the M13 bacteriophage.
9. Single molecule real time (SMRT) sequencing.
[0130] SMRT sequencing is based on the sequencing by synthesis approach.
The DNA is synthesized in zero-mode wave-guides (ZMWs) ¨ small well-like containers with the capturing tools located at the bottom of the well. The sequencing is performed with use of unmodified polymerase (attached to the ZMW bottom) and fluorescently labelled nucleotides flowing freely in the solution. The wells are constructed in a way that only the fluorescence occurring by the bottom of the well is detected. The fluorescent label is detached from the nucleotide at its incorporation into the DNA strand, leaving an unmodified DNA
strand.
According to Pacific Biosciences, the SMRT technology developer, this methodology allows detection of nucleotide modifications (such as cytosine methylation). This happens through the observation of polymerase kinetics. This approach allows reads of 20,000 nucleotides or more, with average read lengths of 5 kilobases.
C. Measurement of Gene or Barcode Expression [0131] Embodiments of the disclosure relate to determining the expression of a reporter barcode and/or reporter gene or open reading frame. The expression of the reporter can be determined by measuring the levels of RNA transcripts of the barcode or index region and any other polynucleotides expressed from the reporter construct. Suitable methods for this purpose include, but are not limited to, RT-PCR, Northern Blot, in situ hybridization, Southern Blot, slot-blotting, nuclease protection assay and oligonucleotide arrays.
[0132] In certain aspects, RNA isolated from cells can be amplified to cDNA or cRNA
before detection and/or quantitation. The isolated RNA can be either total RNA
or mRNA.
The RNA amplification can be specific or non-specific. In some embodiments, the amplification is specific in that it specifically amplifies reporter barcodes or regions thereof, such as an index region. In some embodiments, the amplification and/or reverse transcriptase step excludes random priming. Suitable amplification methods include, but are not limited to, reverse transcriptase PCR, isothermal amplification, ligase chain reaction, and Qbeta replicase. The amplified nucleic acid products can be detected and/or quantitated through hybridization to labeled probes. In some embodiments, detection may involve fluorescence resonance energy transfer (FRET) or some other kind of quantum dots.
[0133] Amplification primers or hybridization probes for a reporter barcode can be prepared from the sequence of the expressed portion of the reporter. The term "primer" or "probe" as used herein, is meant to encompass any nucleic acid that is capable of priming the synthesis of a nascent nucleic acid in a template-dependent process.
Typically, primers are oligonucleotides from ten to twenty and/or thirty base pairs in length, but longer sequences can be employed. Primers may be provided in double-stranded and/or single-stranded form, although the single-stranded form is preferred.
[0134] The use of a probe or primer of between 13 and 100 nucleotides, particularly between 17 and 100 nucleotides in length, or in some aspects up to 1-2 kilobases or more in length, allows the formation of a duplex molecule that is both stable and selective. Molecules having complementary sequences over contiguous stretches greater than 20 bases in length may be used to increase stability and/or selectivity of the hybrid molecules obtained. One may design nucleic acid molecules for hybridization having one or more complementary sequences of 20 to 30 nucleotides, or even longer where desired. Such fragments may be readily prepared, for example, by directly synthesizing the fragment by chemical means or by introducing selected sequences into recombinant vectors for recombinant production.
[0135] In one embodiment, each probe/primer comprises at least 15 nucleotides. For instance, each probe can comprise at least or at most 20, 25, 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 400 or more nucleotides (or any range derivable therein). They may have these lengths and have a sequence that is identical or complementary to a gene described herein. Particularly, each probe/primer has relatively high sequence complexity and does not have any ambiguous residue (undetermined "n" residues). The probes/primers can hybridize to the target gene, including its RNA transcripts, under stringent or highly stringent conditions. In some embodiments, because each of the biomarkers has more than one human sequence, it is contemplated that probes and primers may be designed for use with each of these sequences. For example, inosine is a nucleotide frequently used in probes or primers to hybridize to more than one sequence. It is contemplated that probes or primers may have inosine or other design implementations that accommodate recognition of more than one human sequence for a particular biomarker.
[0136] For applications requiring high selectivity, one will typically desire to employ relatively high stringency conditions to form the hybrids. For example, relatively low salt and/or high temperature conditions, such as provided by about 0.02 M to about 0.10 M NaCl at temperatures of about 50 C to about 70 C. Such high stringency conditions tolerate little, if any, mismatch between the probe or primers and the template or target strand and would be particularly suitable for isolating specific genes or for detecting specific mRNA transcripts.
It is generally appreciated that conditions can be rendered more stringent by the addition of increasing amounts of formamide.
[0137] In one embodiment, quantitative RT-PCR (such as TaqMan, ABI) is used for detecting and comparing the levels of RNA transcripts in samples. Quantitative RT-PCR
involves reverse transcription (RT) of RNA to cDNA followed by relative quantitative PCR
(RT-PCR). The concentration of the target DNA in the linear portion of the PCR
process is proportional to the starting concentration of the target before the PCR was begun. By determining the concentration of the PCR products of the target DNA in PCR
reactions that have completed the same number of cycles and are in their linear ranges, it is possible to determine the relative concentrations of the specific target sequence in the original DNA
mixture. If the DNA mixtures are cDNAs synthesized from RNAs isolated from different tissues or cells, the relative abundances of the specific mRNA from which the target sequence was derived may be determined for the respective tissues or cells. This direct proportionality between the concentration of the PCR products and the relative mRNA abundances is true in the linear range portion of the PCR reaction. The final concentration of the target DNA in the plateau portion of the curve is determined by the availability of reagents in the reaction mix and is independent of the original concentration of target DNA. Therefore, the sampling and quantifying of the amplified PCR products may be carried out when the PCR
reactions are in the linear portion of their curves. In addition, relative concentrations of the amplifiable cDNAs may be normalized to some independent standard, which may be based on either internally existing RNA species or externally introduced RNA species. The abundance of a particular mRNA species may also be determined relative to the average abundance of all mRNA species in the sample.
[0138] In one embodiment, the PCR amplification utilizes one or more internal PCR
standards. The internal standard may be an abundant housekeeping gene in the cell or it can specifically be GAPDH, GUSB and (3-2 microglobulin. These standards may be used to normalize expression levels so that the expression levels of different gene products can be compared directly. A person of ordinary skill in the art would know how to use an internal standard to normalize expression levels.
[0139] A problem inherent in some samples is that they are of variable quantity and/or quality. This problem can be overcome if the RT-PCR is performed as a relative quantitative RT-PCR with an internal standard in which the internal standard is an amplifiable cDNA
fragment that is similar or larger than the target cDNA fragment and in which the abundance of the mRNA encoding the internal standard is roughly 5-100 fold higher than the mRNA
encoding the target. This assay measures relative abundance, not absolute abundance of the respective mRNA species.
[0140] In another embodiment, the relative quantitative RT-PCR uses an external standard protocol. Under this protocol, the PCR products are sampled in the linear portion of their amplification curves. The number of PCR cycles that are optimal for sampling can be empirically determined for each target cDNA fragment. In addition, the reverse transcriptase products of each RNA population isolated from the various samples can be normalized for equal concentrations of amplifiable cDNAs.
[0141] A nucleic acid array can comprise at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 150, 200, 250 or more different polynucleotide probes, which may hybridize to different and/or the same biomarkers. Multiple probes for the same gene can be used on a single nucleic acid array. Probes for other disease genes can also be included in the nucleic acid array. The probe density on the array can be in any range. In .. some embodiments, the density may be 50, 100, 200, 300, 400, 500 or more probes/cm2.
[0142] Specifically contemplated are chip-based nucleic acid technologies such as those described by Hacia et al. (1996) and Shoemaker et al. (1996). Briefly, these techniques involve quantitative methods for analyzing large numbers of genes rapidly and accurately.
By tagging genes with oligonucleotides or using fixed probe arrays, one can employ chip technology to segregate target molecules as high density arrays and screen these molecules on the basis of hybridization (see also, Pease et al., 1994; and Fodor et al, 1991). It is contemplated that this technology may be used in conjunction with evaluating the expression level of one or more cancer biomarkers with respect to diagnostic, prognostic, and treatment methods.
[0143] Certain embodiments may involve the use of arrays or data generated from an array. Data may be readily available. Moreover, an array may be prepared in order to generate data that may then be used in correlation studies.
[0144] An array generally refers to ordered macroarrays or microarrays of nucleic acid molecules (probes) that are fully or nearly complementary or identical to a plurality of mRNA molecules or cDNA molecules and that are positioned on a support material in a spatially separated organization. Macroarrays are typically sheets of nitrocellulose or nylon upon which probes have been spotted. Microarrays position the nucleic acid probes more densely such that up to 10,000 nucleic acid molecules can be fit into a region typically 1 to 4 square centimeters. Microarrays can be fabricated by spotting nucleic acid molecules, e.g., genes, oligonucleotides, etc., onto substrates or fabricating oligonucleotide sequences in situ on a substrate. Spotted or fabricated nucleic acid molecules can be applied in a high density matrix pattern of up to about 30 non-identical nucleic acid molecules per square centimeter or higher, e.g. up to about 100 or even 1000 per square centimeter. Microarrays typically use coated glass as the solid support, in contrast to the nitrocellulose-based material of filter arrays. By having an ordered array of complementing nucleic acid samples, the position of each sample can be tracked and linked to the original sample. A variety of different array devices in which a plurality of distinct nucleic acid probes are stably associated with the surface of a solid support are known to those of skill in the art. Useful substrates for arrays include nylon, glass and silicon. Such arrays may vary in a number of different ways, including average probe length, sequence or types of probes, nature of bond between the probe and the array surface, e.g. covalent or non-covalent, and the like. The labeling and screening methods and the arrays are not limited in its utility with respect to any parameter except that the probes detect expression levels; consequently, methods and compositions may be used with a variety of different types of genes.

[0145] Representative methods and apparatus for preparing a microarray have been described, for example, in U.S. Patent Nos. 5,143,854; 5,202,231; 5,242,974;
5,288,644;
5,324,633; 5,384,261; 5,405,783; 5,412,087; 5,424,186; 5,429,807; 5,432,049;
5,436,327;
5,445,934; 5,468,613; 5,470,710; 5,472,672; 5,492,806; 5,525,464; 5,503,980;
5,510,270;
5,525,464; 5,527,681; 5,529,756; 5,532,128; 5,545,531; 5,547,839; 5,554,501;
5,556,752;
5,561,071; 5,571,639; 5,580,726; 5,580,732; 5,593,839; 5,599,695; 5,599,672;
5,610;287;
5,624,711; 5,631,134; 5,639,603; 5,654,413; 5,658,734; 5,661,028; 5,665,547;
5,667,972;
5,695,940; 5,700,637; 5,744,305; 5,800,992; 5,807,522; 5,830,645; 5,837,196;
5,871,928;
5,847,219; 5,876,932; 5,919,626; 6,004,755; 6,087,102; 6,368,799; 6,383,749;
6,617,112;
6,638,717; 6,720,138, as well as WO 93/17126; WO 95/11995; WO 95/21265; WO
95/21944; WO 95/35505; WO 96/31622; WO 97/10365; WO 97/27317; WO 99/35505; WO
09923256; WO 09936760; W00138580; WO 0168255; WO 03020898; WO 03040410; WO
03053586; WO 03087297; WO 03091426; W003100012; WO 04020085; WO 04027093;
EP 373 203; EP 785 280; EP 799 897 and UK 8 803 000; the disclosures of which are all herein incorporated by reference.
[0146] It is contemplated that the arrays can be high density arrays, such that they contain 100 or more different probes. It is contemplated that they may contain 1000, 16,000, 65,000, 250,000 or 1,000,000 or more different probes. The oligonucleotide probes range from 5 to 50, 5 to 45, 10 to 40, or 15 to 40 nucleotides in length in some embodiments.
In certain embodiments, the oligonucleotide probes are 20 to 25 nucleotides in length.
[0147] The location and sequence of each different probe sequence in the array are generally known. Moreover, the large number of different probes can occupy a relatively small area providing a high density array having a probe density of generally greater than about 60, 100, 600, 1000, 5,000, 10,000, 40,000, 100,000, or 400,000 different oligonucleotide probes per cm2. The surface area of the array can be about or less than about 1, 1.6,2, 3,4, 5, 6,7, 8, 9, or 10 cm2.
[0148] Moreover, a person of ordinary skill in the art could readily analyze data generated using an array. Such protocols include information found in WO 9743450; WO
03023058;
WO 03022421; WO 03029485; WO 03067217; WO 03066906; WO 03076928; WO
03093810; WO 03100448A1, all of which are specifically incorporated by reference.
[0149] In one embodiment, nuclease protection assays are used to quantify RNAs derived from the cancer samples. There are many different versions of nuclease protection assays known to those practiced in the art. The common characteristic that these nuclease protection assays have is that they involve hybridization of an antisense nucleic acid with the RNA to be quantified. The resulting hybrid double-stranded molecule is then digested with a nuclease that digests single-stranded nucleic acids more efficiently than double-stranded molecules.
The amount of antisense nucleic acid that survives digestion is a measure of the amount of the target RNA species to be quantified. An example of a nuclease protection assay that is commercially available is the RNase protection assay manufactured by Ambion, Inc. (Austin, Tex.).
III. Receptor gene and inducible reporter additions [0150] In certain embodiments, the receptor gene and or inducible reporter system comprises one or more polynucleotide sequences encoding for one or more auxiliary polypeptides. Exemplary auxiliary polypeptides include transcription factors, protein or peptide tag, and screenable or selectable genes.
A. Selection and screening genes [0151] In certain embodiments of the disclosure, the inducible reporter and/or the receptor gene may comprise or further comprise a selection or screening gene.
Furthermore, the cells, vectors, and viral particles of the disclosure may further comprise a selection or screening gene. In some embodiments, the selection or screening gene is fused to the receptor gene such that one fusion protein comprising a receptor protein fused to a selection or screening protein is present in the cell. Such genes would confer an identifiable change to the cell permitting easy identification of cells that have activation of the heterologous receptor gene.
Generally, a selectable (i.e. selection gene) gene is one that confers a property that allows for selection. A positive selectable gene is one in which the presence of the gene or gene product allows for its selection, while a negative selectable gene is one in which its presence of the gene or gene product prevents its selection. An example of a positive selectable gene is an antibiotic resistance gene.
[0152] Usually the inclusion of a drug selection gene aids in the cloning and identification of cells that have an activated receptor gene through, for example, successful ligand engagement. The selection gene may be a gene that confers resistance to neomycin, puromycin, hygromycin, DHFR, GPT, zeocin, G418, phleomycin, blasticidin, and histidinol, for example. In addition to genes conferring a phenotype that allows for the discrimination of receptor activation based on the implementation of conditions, other types of genes, including screenable genes such as GFP, whose gene product provides for colorimetric analysis, are also contemplated. Alternatively, screenable enzymes such as herpes simplex virus thymidine kinase (tk) or chloramphenicol acetyltransferase (CAT) may be utilized. One of skill in the art would also know how to employ screenable genes and their protein products, .. possibly in conjunction with FACS analysis. Further examples of selectable and screenable genes are well known to one of skill in the art. In certain embodiments, the gene produces a fluorescent protein, an enzymatically active protein, a luminescent protein, a photoactivatable protein, a photoconvertible protein, or a colorimetric protein. Fluorescent markers include, for example, GFP and variants such as YFP, RFP etc., and other fluorescent proteins such as DsRed, mPlum, mCherry, YPet, Emerald, CyPet, T-Sapphire, Luciferase, and Venus.
Photoactivatable markers include, for example, KFP, PA-mRFP, and Dronpa.
Photoconvertible markers include, for example, mEosFP, KikGR, and PS-CFP2.
Luminescent proteins include, for example, Neptune, FP595, and phialidin.
B. Protein or Peptide Tags [0153] Exemplary protein/peptide tags include AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE, SEQ ID NO:4), Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL, SEQ ID NO:5), polyglutamate tag, a peptide binding efficiently to anion-exchange resin such as Mono-Q (EEEEEE, SEQ ID
NO:6), E-tag, a peptide recognized by an antibody (GAPVPYPDPLEPR, SEQ ID
NO:7), FLAG-tag, a peptide recognized by an antibody (DYKDDDDK, SEQ ID NO:8), HA-tag, a peptide from hemagglutinin recognized by an antibody (YPYDVPDYA, SEQ ID NO:9), His-tag, 5-10 histidines bound by a nickel or cobalt chelate (HHHHHH, SEQ ID
NO:10), Myc-tag, a peptide derived from c-myc recognized by an antibody (EQKLISEEDL, SEQ
ID
NO:11), NE-tag, a novel 18-amino-acid synthetic peptide (TKENPRSNQEESYDDNES, SEQ ID NO:12) recognized by a monoclonal IgG1 antibody, which is useful in a wide spectrum of applications including Western blotting, ELIS A, flow cytometry, immunocytochemistry, immunoprecipitation, and affinity purification of recombinant proteins, S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS, SEQ
ID
NO:13), SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP, SEQ ID NO:14), Softag 1, for mammalian expression (SLAELLNAGLGGS, SEQ ID NO:15), Softag 3, for prokaryotic expression (TQDPSRVG, SEQ ID NO:16), Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK, SEQ
ID NO:17), TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC, SEQ ID NO:18), V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST, SEQ ID NO:19), VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK, SEQ ID NO:20), Xpress tag (DLYDDDDK, SEQ ID NO:21), Covalent peptide tags, Isopeptag, a peptide which binds covalently to pilin-C protein (TDKDMTITFTNKKDAE, SEQ ID NO:22), SpyTag, a peptide which binds covalently to SpyCatcher protein (AHIVMVDAYKPTK, SEQ ID NO:23), SnoopTag, a peptide which binds covalently to SnoopCatcher protein (KLGDIEFIKVNK, SEQ ID NO:24), BCCP
(Biotin Carboxyl Carrier Protein), a protein domain biotinylated by BirA
enabling recognition by streptavidin, Glutathione-S-transferase-tag, a protein which binds to immobilized glutathione, Green fluorescent protein-tag, a protein which is spontaneously fluorescent and can be bound by nanobodies, HaloTag, a mutated bacterial haloalkane dehalogenase that covalently attaches to a reactive haloalkane substrate, this allows attachment to a wide variety of substrates., Maltose binding protein-tag, a protein which binds to amylose agarose, Nus-tag, Thioredoxin-tag, Fc-tag, derived from immunoglobulin Fc domain, allow dimerization and solubilization. Can be used for purification on Protein-A
Sepharose, Designed Intrinsically Disordered tags containing disorder promoting amino acids (P,E,S,T,A,Q,G,..), and Ty-tag C. Transcription factors [0154] In some embodiments, the receptor gene encodes for a fusion protein comprising the receptor protein and an auxiliary polypeptide. In some embodiments, the auxiliary polypeptide is a transcription factor. In related embodiments, the inducible reporter comprises a receptor-responsive element, wherein the receptor-responsive element is bound by the transcription factor. Such transcription factors and responsive elements are known in the art and include, for example, reverse tetracycline-controlled transactivator (rtTA), which can induce transcription through a tetracycline-responsive element (TRE), Gal4p, which induces transcription through the GAL1 promoter, and estrogen receptor, which, when bound to a ligand, induces expression through the estrogen response element.
Accordingly, related embodiments include administering a ligand to activate transcription of an auxiliary polypeptide transcription factor.

IV. Vectors and Nucleic Acids [0155]
The current disclosure includes embodiments of nucleic acids comprising one or more of a heterologous receptor gene and an inducible reporter.
The terms "oligonucleotide,:" "polynucleotide," and "nucleic acid are used interchangeable and include linear oligomers of natural or modified monomers or linkages, including deoxyribonucleosides, ribonucleosides, a-anomeric forms thereof, peptide nucleic acids (PNAs), and the like, capable of specifically binding to a target polynucleotide by way of a regular pattern of monomer-to-monomer interactions, such as Watson-Crick type of base pairing, base stacking, Hoogsteen or reverse Hoogsteen types of base pairing, or the like.
Usually monomers are linked by phosphodiester bonds or analogs thereof to form oligonucleotides ranging in size from a few monomeric units, e.g. 3-4, to several tens of monomeric units. Whenever an oligonucleotide is represented by a sequence of letters, such as "ATGCCTG," it will be understood that the nucleotides are in 5'¨>3' order from left to right and that "A" denotes deoxyadenosine, "C" denotes deoxycytidine, "G"
denotes deoxyguanosine, and "T" denotes thymidine, unless otherwise noted. Analogs of phosphodiester linkages include phosphorothioate, phosphorodithioate, phosphoranilidate, phosphoramidate, and the like. It is clear to those skilled in the art when oligonucleotides having natural or non-natural nucleotides may be employed, e.g. where processing by enzymes is called for, usually oligonucleotides consisting of natural nucleotides are required.
[0156] The nucleic acid may be an "unmodified oligonucleotide" or "unmodified nucleic acid," which refers generally to an oligomer or polymer of ribonucleic acid (RNA) or deoxyribonucleic acid (DNA). In some embodiments a nucleic acid molecule is an unmodified oligonucleotide. This term includes oligonucleotides composed of naturally occurring nucleobases, sugars and covalent internucleoside linkages.
The term "oligonucleotide analog" refers to oligonucleotides that have one or more non-naturally occurring portions which function in a similar manner to oligonucleotides.
Such non-naturally occurring oligonucleotides are often selected over naturally occurring forms because of desirable properties such as, for example, enhanced cellular uptake, enhanced affinity for other oligonucleotides or nucleic acid targets and increased stability in the presence of nucleases. The term "oligonucleotide" can be used to refer to unmodified oligonucleotides or oligonucleotide analogs.

[0157] Specific examples of nucleic acid molecules include nucleic acid molecules containing modified, i.e., non-naturally occurring internucleoside linkages.
Such non-naturally internucleoside linkages are often selected over naturally occurring forms because of desirable properties such as, for example, enhanced cellular uptake, enhanced affinity for other oligonucleotides or nucleic acid targets and increased stability in the presence of nucleases. In a specific embodiment, the modification comprises a methyl group.
[0158] Nucleic acid molecules can have one or more modified internucleoside linkages.
As defined in this specification, oligonucleotides having modified internucleoside linkages include internucleoside linkages that retain a phosphorus atom and internucleoside linkages that do not have a phosphorus atom. For the purposes of this specification, and as sometimes referenced in the art, modified oligonucleotides that do not have a phosphorus atom in their internucleoside backbone can also be considered to be oligonucleosides.
[0159] Modifications to nucleic acid molecules can include modifications wherein one or both terminal nucleotides is modified.
[0160] One suitable phosphorus-containing modified internucleoside linkage is the phosphorothioate internucleoside linkage. A number of other modified oligonucleotide backbones (internucleoside linkages) are known in the art and may be useful in the context of this embodiment.
[0161] Representative U.S. patents that teach the preparation of phosphorus-containing internucleoside linkages include, but are not limited to, U.S. Pat. Nos.
3,687,808; 4,469,863;
4,476,301; 5,023,243, 5,177,196; 5,188,897; 5,264,423; 5,276,019; 5,278,302;
5,286,717;
5,321,131; 5,399,676; 5,405,939; 5,453,496; 5,455,233; 5,466,677; 5,476,925;
5,519,126;
5,536,821; 5,541,306; 5,550,111; 5,563,253; 5,571,799; 5,587,361; 5,194,599;
5,565,555;
5,527,899; 5,721,218; 5,672,697 5,625,050, 5,489,677, and 5,602,240 each of which is herein incorporated by reference.
[0162] Modified oligonucleoside backbones (internucleoside linkages) that do not include a phosphorus atom therein have internucleoside linkages that are formed by short chain alkyl or cycloalkyl internucleoside linkages, mixed heteroatom and alkyl or cycloalkyl internucleoside linkages, or one or more short chain heteroatomic or heterocyclic internucleoside linkages. These include those having amide backbones; and others, including those having mixed N, 0, S and CH2 component parts.

[0163] Representative U.S. patents that teach the preparation of the above non-phosphorous-containing oligonucleosides include, but are not limited to, U.S.
Pat. Nos.
5,034,506; 5,166,315; 5,185,444; 5,214,134; 5,216,141; 5,235,033; 5,264,562;
5,264,564;
5,405,938; 5,434,257; 5,466,677; 5,470,967; 5,489,677; 5,541,307; 5,561,225;
5,596,086;
5,602,240; 5,610,289; 5,602,240; 5,608,046; 5,610,289; 5,618,704; 5,623,070;
5,663,312;
5,633,360; 5,677,437; 5,792,608; 5,646,269 and 5,677,439, each of which is herein incorporated by reference.
[0164] Oligomeric compounds can also include oligonucleotide mimetics.
The term mimetic as it is applied to oligonucleotides is intended to include oligomeric compounds wherein only the furanose ring or both the furanose ring and the internucleotide linkage are replaced with novel groups, replacement of only the furanose ring with for example a morpholino ring, is also referred to in the art as being a sugar surrogate.
The heterocyclic base moiety or a modified heterocyclic base moiety is maintained for hybridization with an appropriate target nucleic acid.
[0165] Oligonucleotide mimetics can include oligomeric compounds such as peptide nucleic acids (PNA) and cyclohexenyl nucleic acids (known as CeNA, see Wang et al., J.
Am. Chem. Soc., 2000, 122, 8595-8602). Representative U.S. patents that teach the preparation of oligonucleotide mimetics include, but are not limited to, U.S.
Pat. Nos.
5,539,082; 5,714,331; and 5,719,262, each of which is herein incorporated by reference.
Another class of oligonucleotide mimetic is referred to as phosphonomonoester nucleic acid and incorporates a phosphorus group in the backbone. This class of olignucleotide mimetic is reported to have useful physical and biological and pharmacological properties in the areas of inhibiting gene expression (antisense oligonucleotides, ribozymes, sense oligonucleotides and triplex-forming oligonucleotides), as probes for the detection of nucleic acids and as auxiliaries for use in molecular biology. Another oligonucleotide mimetic has been reported wherein the furanosyl ring has been replaced by a cyclobutyl moiety.
[0166] Nucleic acid molecules can also contain one or more modified or substituted sugar moieties. The base moieties are maintained for hybridization with an appropriate nucleic acid target compound. Sugar modifications can impart nuclease stability, binding affinity or some .. other beneficial biological property to the oligomeric compounds.
[0167] Representative modified sugars include carbocyclic or acyclic sugars, sugars having substituent groups at one or more of their 2', 3' or 4' positions, sugars having substituents in place of one or more hydrogen atoms of the sugar, and sugars having a linkage between any two other atoms in the sugar. A large number of sugar modifications are known in the art, sugars modified at the 2' position and those which have a bridge between any 2 atoms of the sugar (such that the sugar is bicyclic) are particularly useful in this embodiment.
Examples of sugar modifications useful in this embodiment include, but are not limited to compounds comprising a sugar substituent group selected from: OH; F; 0-, S-, or N-alkyl; or 0-alkyl-0-alkyl, wherein the alkyl, alkenyl and alkynyl may be substituted or unsubstituted Cl to C10 alkyl or C2 to C10 alkenyl and alkynyl. Particularly suitable are: 2-methoxyethoxy (also known as 2'-0-methoxyethyl, 2'-M0E, or 2'-OCH2CH2OCH3), 2'4)-methyl (2'-0--CH3), 2'-fluoro (2'-F), or bicyclic sugar modified nucleosides having a bridging group connecting the 4' carbon atom to the 2' carbon atom wherein example bridge groups include --CH2-0--, --(CH2)2-0-- or --CH2--N(R3)--0 wherein R3 is H or alkyl.
[0168] One modification that imparts increased nuclease resistance and a very high binding affinity to nucleotides is the 2'-MOE side chain (Baker et al., J.
Biol. Chem., 1997, 272, 11944-12000). One of the immediate advantages of the 2'-MOE substitution is the improvement in binding affinity, which is greater than many similar 2' modifications such as 0-methyl, 0-propyl, and 0-aminopropyl. Oligonucleotides having the 2'-MOE
substituent also have been shown to be antisense inhibitors of gene expression with promising features for in vivo use (Martin, P., Hely. Chim. Acta, 1995, 78, 486-504; Altmann et al., Chimia, 1996, 50, 168-176; Altmann et al., Biochem. Soc. Trans., 1996, 24, 630-637;
and Altmann et al., Nucleosides Nucleotides, 1997, 16, 917-926).
[0169] 2'-Sugar substituent groups may be in the arabino (up) position or ribo (down) position. One 2'-arabino modification is 2'-F. Similar modifications can also be made at other positions on the oligomeric compound, particularly the 3' position of the sugar on the 3' terminal nucleoside or in 2'-5' linked oligonucleotides and the 5' position of 5' terminal nucleotide. Oligomeric compounds may also have sugar mimetics such as cyclobutyl moieties in place of the pentofuranosyl sugar. Representative U.S. patents that teach the preparation of such modified sugar structures include, but are not limited to, U.S. Pat. Nos.
4,981,957; 5,118,800; 5,319,080; 5,359,044; 5,393,878; 5,446,137; 5,466,786;
5,514,785;
5,519,134; 5,567,811; 5,576,427; 5,591,722; 5,597,909; 5,610,300; 5,627,053;
5,639,873;
5,646,265; 5,658,873; 5,670,633; 5,792,747; and 5,700,920, each of which is herein incorporated by reference in its entirety.

[0170] Nucleic acid molecules can also contain one or more nucleobase (often referred to in the art simply as "base") modifications or substitutions which are structurally distinguishable from, yet functionally interchangeable with, naturally occurring or synthetic unmodified nucleobases. Such nucleobase modifications can impart nuclease stability, binding affinity or some other beneficial biological property to the oligomeric compounds.
As used herein, "unmodified" or "natural" nucleobases include the purine bases adenine (A) and guanine (G), and the pyrimidine bases thymine (T), cytosine (C) and uracil (U).
Modified nucleobases also referred to herein as heterocyclic base moieties include other synthetic and natural nucleobases, many examples of which such as 5-methylcytosine (5-me-C), 5-hydroxymethyl cytosine, 7-deazaguanine and 7-deazaadenine among others.
[0171] Heterocyclic base moieties can also include those in which the purine or pyrimidine base is replaced with other heterocycles, for example 7-deaza-adenine, 7-deazaguanosine, 2-aminopyridine and 2-pyridone. Some nucleobases include those disclosed in U.S. Pat. No. 3,687,808, those disclosed in The Concise Encyclopedia Of Polymer Science And Engineering, pages 858-859, Kroschwitz, J. I., ed. John Wiley & Sons, 1990, those disclosed by Englisch et al., Angewandte Chemie, International Edition, 1991, 30, 613, and those disclosed by Sanghvi, Y. S., Chapter 15, Antisense Research and Applications, pages 289-302, Crooke, S. T. and Lebleu, B., ed., CRC Press, 1993. Certain of these nucleobases are particularly useful for increasing the binding affinity of the oligomeric compounds.
These include 5-substituted pyrimidines, 6-azapyrimidines and N-2, N-6 and 0-6 substituted purines, including 2 aminopropyladenine, 5-propynyluracil and 5-propynylcytosine.
[0172] Additional modifications to nucleic acid molecules are disclosed in U.S. Patent Publication 2009/0221685, which is hereby incorporated by reference. Also disclosed herein are additional suitable conjugates to the nucleic acid molecules.
[0173] The heterologous receptor gene and inducible reporter may be encoded by a nucleic acid molecule, such as a vector. In some embodiments, they are encoded on the same nucleic acid molecule. In some embodiments, they are encoded on separate nucleic acid molecules. In certain embodiments, the nucleic acid molecule can be in the form of a nucleic acid vector. The term "vector" is used to refer to a carrier nucleic acid molecule into which a heterologous nucleic acid sequence can be inserted for introduction into a cell where it can be replicated and expressed and/or integrated into the host cell's genome. A
nucleic acid sequence can be "heterologous," which means that it is in a context foreign to the cell in which the vector is being introduced or to the nucleic acid in which is incorporated, which includes a sequence homologous to a sequence in the cell or nucleic acid but in a position within the host cell or nucleic acid where it is ordinarily not found. Vectors include DNAs, RNAs, plasmids, cosmids, viruses (bacteriophage, animal viruses, and plant viruses), and artificial chromosomes (e.g., YACs). One of skill in the art would be well equipped to construct a vector through standard recombinant techniques (for example Sambrook et al., 2001; Ausubel et al., 1996, both incorporated herein by reference). Vectors may be used in a host cell to produce an antibody.
[0174] The term "expression vector" refers to a vector containing a nucleic acid sequence coding for at least part of a gene product capable of being transcribed or stably integrate into a host cell's genome and subsequently be transcribed. In some cases, RNA
molecules are then translated into a protein, polypeptide, or peptide. Expression vectors can contain a variety of "control sequences," which refer to nucleic acid sequences necessary for the transcription and possibly translation of an operably linked coding sequence in a particular host organism. In addition to control sequences that govern transcription and translation, vectors and expression vectors may contain nucleic acid sequences that serve other functions as well and are described herein.
[0175] The vectors disclosed herein can be any nucleic acid vector known in the art.
Exemplary vectors include plasmids, cosmids, bacterial artificial chromosomes (BACs) and viral vectors.
[0176] Any expression vector for animal cell can be used. Examples of suitable vectors include pAGE107 (Miyaji et al., 1990), pAGE103 (Mizukami and Itoh, 1987), pHSG274 (Brady et al., 1984), pKCR (O'Hare et al., 1981), pSG1 beta d2-4 (Miyaji et al., 1990) and the like.
[0177] Other examples of plasmids include replicating plasmids comprising an origin of replication, or integrative plasmids, such as for instance pUC, pcDNA, pBR, and the like.
[0178] Other examples of viral vectors include adenoviral, lentiviral, retroviral, herpes virus and AAV vectors. Such recombinant viruses may be produced by techniques known in the art, such as by transfecting packaging cells or by transient transfection with helper plasmids or viruses. Typical examples of virus packaging cells include PA317 cells, PsiCRIP
cells, GPenv+ cells, 293 cells, etc. Detailed protocols for producing such replication-defective recombinant viruses may be found for instance in WO 95/14785, WO
96/22378, U.S. Pat. No. 5,882,877, U.S. Pat. No. 6,013,516, U.S. Pat. No. 4,861,719, U.S. Pat. No.
5,278,056 and WO 94/19478.
[0179]
A "promoter" is a control sequence. The promoter is typically a region of a nucleic acid sequence at which initiation and rate of transcription are controlled. It may contain genetic elements at which regulatory proteins and molecules may bind such as RNA
polymerase and other transcription factors.
The phrases "operatively positioned,"
"operatively linked," "under control," and "under transcriptional control"
mean that a promoter is in a correct functional location and/or orientation in relation to a nucleic acid sequence to control transcriptional initiation and expression of that sequence. A promoter may or may not be used in conjunction with an "enhancer," which refers to a cis-acting regulatory sequence involved in the transcriptional activation of a nucleic acid sequence.
[0180]
Examples of promoters and enhancers used in the expression vector for animal cell include early promoter and enhancer of 5V40 (Mizukami and Itoh, 1987), LTR
promoter and enhancer of Moloney mouse leukemia virus (Kuwana et al., 1987), promoter (Mason et al., 1985) and enhancer (Gillies et al., 1983) of immunoglobulin H chain and the like.
[0181]
A specific initiation signal also may be required for efficient translation of coding sequences. These signals include the ATG initiation codon or adjacent sequences.
Exogenous translational control signals, including the ATG initiation codon, may need to be provided. One of ordinary skill in the art would readily be capable of determining this and providing the necessary signals.
[0182]
Vectors can include a multiple cloning site (MCS), which is a nucleic acid region that contains multiple restriction enzyme sites, any of which can be used in conjunction with standard recombinant technology to digest the vector. (See Carbonelli et al., 1999, Levenson et al., 1998, and Cocea, 1997, incorporated herein by reference.) [0183] Most transcribed eukaryotic RNA molecules will undergo RNA splicing to remove introns from the primary transcripts. Vectors containing genomic eukaryotic sequences may require donor and/or acceptor splicing sites to ensure proper processing of the transcript for protein expression. (See Chandler et al., 1997, incorporated herein by reference.) [0184]
The vectors or constructs will generally comprise at least one termination signal.
A "termination signal" or "terminator" is comprised of the DNA sequences involved in specific termination of an RNA transcript by an RNA polymerase. Thus, in certain embodiments a termination signal that ends the production of an RNA transcript is contemplated. A terminator may be necessary in vivo to achieve desirable message levels. In eukaryotic systems, the terminator region may also comprise specific DNA
sequences that permit site-specific cleavage of the new transcript so as to expose a polyadenylation site.
This signals a specialized endogenous polymerase to add a stretch of about 200 A residues .. (polyA) to the 3' end of the transcript. RNA molecules modified with this polyA tail appear to more stable and are translated more efficiently. Thus, in other embodiments involving eukaryotes, it is preferred that that terminator comprises a signal for the cleavage of the RNA, and it is more preferred that the terminator signal promotes polyadenylation of the message.
[0185] In expression, particularly eukaryotic expression, one will typically include a polyadenylation signal to effect proper polyadenylation of the transcript.
[0186] In order to propagate a vector in a host cell, it may contain one or more origins of replication sites (often termed "on"), which is a specific nucleic acid sequence at which replication is initiated. Alternatively an autonomously replicating sequence (ARS) can be employed if the host cell is yeast.
[0187] Some vectors may employ control sequences that allow it to be replicated and/or expressed in both prokaryotic and eukaryotic cells. One of skill in the art would further understand the conditions under which to incubate all of the above described host cells to maintain them and to permit replication of a vector. Also understood and known are techniques and conditions that would allow large-scale production of vectors, as well as production of the nucleic acids encoded by vectors and their cognate polypeptides, proteins, or peptides.
[0188] A further aspect of the disclosure relates to a cell or cells comprising a receptor gene and inducible reporter, as described herein. In some embodiments, a prokaryotic or eukaryotic cell is genetically transformed or transfected with at least one nucleic acid .. molecule or vector according to the disclosure. In some embodiments, the cells are infected with a viral particle of the current disclosure.
[0189] The term "transformation" or "transfection" means the introduction of a "foreign"
(i.e. extrinsic or extracellular) gene, DNA or RNA sequence to a host cell, so that the host cell will express the introduced gene or sequence to produce a desired substance, typically a protein or enzyme coded by the introduced gene or sequence. A host cell that receives and expresses introduced DNA or RNA has been "transformed" or "transfected." The construction of expression vectors in accordance with the current disclosure, and the transformation or transfection of the host cells can be carried out using conventional molecular biology techniques.
[0190] Suitable methods for nucleic acid delivery for transformation/transfection of a cell, a tissue or an organism for use with the current invention are believed to include virtually any method by which a nucleic acid (e.g., DNA) can be introduced into a cell, a tissue or an organism, as described herein or as would be known to one of ordinary skill in the art (e.g., Stadtfeld and Hochedlinger, Nature Methods 6(5):329-330 (2009); Yusa et al., Nat. Methods 6:363-369 (2009); Woltjen et al., Nature 458, 766-770 (9 Apr. 2009)). Such methods include, but are not limited to, direct delivery of DNA such as by ex vivo transfection (Wilson et al., Science, 244:1344-1346, 1989, Nabel and Baltimore, Nature 326:711-713, 1987), optionally with Fugene6 (Roche) or Lipofectamine (Invitrogen), by injection (U.S. Pat.
Nos. 5,994,624, 5,981,274, 5,945,100, 5,780,448, 5,736,524, 5,702,932, 5,656,610, 5,589,466 and 5,580,859, each incorporated herein by reference), including microinjection (Harland and Weintraub, J.
Cell Biol., 101:1094-1099, 1985; U.S. Pat. No. 5,789,215, incorporated herein by reference);
by electroporation (U.S. Pat. No. 5,384,253, incorporated herein by reference;
Tur-Kaspa et al., Mol. Cell Biol., 6:716-718, 1986; Potter et al., Proc. Nat'l Acad. Sci.
USA, 81:7161-7165, 1984); by calcium phosphate precipitation (Graham and Van Der Eb, Virology, 52:456-467, 1973; Chen and Okayama, Mol. Cell Biol., 7(8):2745-2752, 1987; Rippe et al., Mol. Cell Biol., 10:689-695, 1990); by using DEAE-dextran followed by polyethylene glycol (Gopal, Mol. Cell Biol., 5:1188-1190, 1985); by direct sonic loading (Fechheimer et al., Proc. Nat'l Acad. Sci. USA, 84:8463-8467, 1987); by liposome mediated transfection (Nicolau and Sene, Biochim. Biophys. Acta, 721:185-190, 1982; Fraley et al., Proc. Nat'l Acad.
Sci. USA, 76:3348-3352, 1979; Nicolau et al., Methods Enzymol., 149:157-176, 1987; Wong et al., Gene, 10:87-94, 1980; Kaneda et al., Science, 243:375-378, 1989; Kato et al., J Biol. Chem., .. 266:3361-3364, 1991) and receptor-mediated transfection (Wu and Wu, Biochemistry, 27:887-892, 1988; Wu and Wu, J. Biol. Chem., 262:4429-4432, 1987); and any combination of such methods, each of which is incorporated herein by reference.
V. Cells [0191] As used herein, the terms "cell," "cell line," and "cell culture"
may be used interchangeably. All of these terms also include both freshly isolated cells and in vitro cultured or expanded cells. All of these terms also include their progeny, which is any and all subsequent generations. It is understood that all progeny may not be identical due to deliberate or inadvertent mutations. In the context of expressing a heterologous nucleic acid sequence, a "host cell" or simply a "cell" refers to a prokaryotic or eukaryotic cell, and it includes any transformable organism that is capable of replicating a vector or expressing a heterologous gene encoded by a vector or integrated nucleic acid. A host cell can, and has been, used as a recipient for vectors, viruses, and nucleic acids. A host cell may be "transfected" or "transformed," which refers to a process by which exogenous nucleic acid, such as a recombinant protein-encoding sequence, is transferred or introduced into the host cell. A transformed cell includes the primary subject cell and its progeny.
[0192] In certain embodiments the nucleic acid transfer can be carried out on any prokaryotic or eukaryotic cell. In some aspects the cells of the disclosure are human cells. In other aspects the cells of the disclosure are an animal cell. In some aspects the cell or cells are cancer cells, tumor cells or immortalized cells. In further aspects, the cells represent a disease-model cell. In certain aspects the cells can be A549, B-cells, B16, BHK-21, C2C12, C6, CaCo-2, CAP/, CAP-T, CHO, CH02, CHO-DG44, CHO-K1, COS-1, Cos-7, CV-1, Dendritic cells, DLD-1, Embryonic Stem (ES) Cell or derivative, H1299, HEK, 293, 293T, 293FT, Hep G2, Hematopoietic Stem Cells, HOS, Huh-7, Induced Pluripotent Stem (iPS) Cell or derivative, Jurkat, K562, L5278Y, LNCaP, MCF7, MDA-MB-231, MDCK, Mesenchymal Cells, Min-6, Monocytic cell, Neuro2a, NIH 3T3, NIH3T3L1, K562, NK-cells, NSO, Panc-1, PC12, PC-3, Peripheral blood cells, Plasma cells, Primary Fibroblasts, RBL, Renca, RLE, SF21, SF9, SH-SY5Y, SK-MES-1, SK-N-SH, 5L3, 5W403, Stimulus-triggered Acquisition of Pluripotency (STAP) cell or derivate 5W403, T-cells, THP-1, Tumor cells, U205, U937, peripheral blood lymphocytes, expanded T cells, hematopoietic stem cells, or Vero cells. In some embodiments, the cells are HEK293T cells.
[0193] The term "passaged," as used herein, is intended to refer to the process of splitting cells in order to produce large number of cells from pre-existing ones. Cells may be passaged multiple times prior to or after any step described herein. Passaging involves splitting the cells and transferring a small number into each new vessel. For adherent cultures, cells first need to be detached, commonly done with a mixture of trypsin-EDTA. A small number of detached cells can then be used to seed a new culture, while the rest is discarded. Also, the amount of cultured cells can easily be enlarged by distributing all cells to fresh flasks. Cells may be kept in culture and incubated under conditions to allow cell replication. In some embodiments, the cells are kept in culture conditions that allow the cells to under 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more rounds of cell division.

[0194] In some embodiments, cells may subjected to limiting dilution methods to enable the expansion of clonal populations of cells. The methods of limiting dilution cloning are well known to those of skill in the art. Such methods have been described, for example for hybridomas but can be applied to any cell. Such methods are described in (Cloning .. hybridoma cells by limiting dilution, Journal of tissue culture methods, 1985, Volume 9, Issue 3, pp 175-177, by Joan C. Rener, Bruce L. Brown, and Roland M. Nardone) which is incorporated by reference herein.
[0195] Methods of the disclosure include the culturing of cells. Methods of culturing suspension and adherent cells are well-known to those skilled in the art. In some embodiments, cells are cultured in suspension, using commercially available cell-culture vessels and cell culture media. Examples of commercially available culturing vessels that may be used in some embodiments including ADME/TOX Plates, Cell Chamber Slides and Coverslips, Cell Counting Equipment, Cell Culture Surfaces, Corning HYPERFlask Cell Culture Vessels, Coated Cultureware, Nalgene Cryoware, Culture Chamber, Culture Dishes, Glass Culture Flasks, Plastic Culture Flasks, 3D Culture Formats, Culture Multiwell Plates, Culture Plate Inserts, Glass Culture Tubes, Plastic Culture Tubes, Stackable Cell Culture Vessels, Hypoxic Culture Chamber, Petri dish and flask carriers, Quickfit culture vessels, Scale-Up Cell Culture using Roller Bottles, Spinner Flasks, 3D Cell Culture, or cell culture bags.
.. [0196] In other embodiments, media may be formulated using components well-known to those skilled in the art. Formulations and methods of culturing cells are described in detail in the following references: Short Protocols in Cell Biology J. Bonifacino, et al., ed., John Wiley & Sons, 2003, 826 pp; Live Cell Imaging: A Laboratory Manual D. Spector & R.
Goldman, ed., Cold Spring Harbor Laboratory Press, 2004, 450 pp.; Stem Cells Handbook S.
Sell, ed., Humana Press, 2003, 528 pp.; Animal Cell Culture: Essential Methods, John M.
Davis, John Wiley & Sons, Mar 16, 2011; Basic Cell Culture Protocols, Cheryl D. Helgason, Cindy Miller, Humana Press, 2005; Human Cell Culture Protocols, Series:
Methods in Molecular Biology, Vol. 806, Mitry, Ragai R.; Hughes, Robin D. (Eds.), 3rd ed.
2012, XIV, 435 p. 89, Humana Press; Cancer Cell Culture: Method and Protocols, Cheryl D.
Helgason, Cindy Miller, Humana Press, 2005; Human Cell Culture Protocols, Series:
Methods in Molecular Biology, Vol. 806, Mitry, Ragai R.; Hughes, Robin D. (Eds.), 3rd ed.
2012, XIV, 435 p. 89, Humana Press; Cancer Cell Culture: Method and Protocols, Simon P.
Langdon, Springer, 2004; Molecular Cell Biology. 4th edition., Lodish H, Berk A, Zipursky SL, et al., New York: W. H. Freeman; 2000., Section 6.2Growth of Animal Cells in Culture, all of which are incorporated herein by reference.
VI. Genomic Integration of Nucleic Acids A. Targeted integration [0197] The current disclosure provides methods for targeting the integration of a nucleic acid. This is also referred to as "gene editing" herein and in the art. In some embodiments, targeted integration is achieved through the use of a DNA digesting agent/polynucleotide modification enzyme, such as a site-specific recombinase and/or a targeting endonuclease.
The term "DNA digesting agent" refers to an agent that is capable of cleaving bonds (i.e.
phosphodiester bonds) between the nucleotide subunits of nucleic acids.
[0198] In one aspect, the current disclosure includes targeted integration. One way of achieving this is through the use of an exogenous nucleic acid sequence (i.e., a landing pad) comprising at least one recognition sequence for at least one polynucleotide modification enzyme, such as a site-specific recombinase and/or a targeting endonuclease.
Site-specific recombinases are well known in the art, and may be generally referred to as invertases, resolvases, or integrases. Non-limiting examples of site-specific recombinases may include lambda integrase, Cre recombinase, FLP recombinase, gamma-delta resolvase, Tn3 resolvase, (I)C31 integrase, Bxb 1-integrase, and R4 integrase. Site-specific recombinases recognize specific recognition sequences (or recognition sites) or variants thereof, all of which are well known in the art. For example, Cre recombinases recognize LoxP sites and FLP
recombinases recognize FRT sites.
[0199] Contemplated targeting endonucleases include zinc finger nucleases (ZFNs), meganucleases, transcription activator-like effector nucleases (TALENs), CRIPSR/Cas-like endonucleases, I-Tevl nucleases or related monomeric hybrids, or artificial targeted DNA
double strand break inducing agents. Exemplary targeting endonucleases is further described below. For example, typically, a zinc finger nuclease comprises a DNA binding domain (i.e., zinc finger) and a cleavage domain (i.e., nuclease), both of which are described below. Also included in the definition of polynucleotide modification enzymes are any other useful fusion proteins known to those of skill in the art, such as may comprise a DNA
binding domain and a nuclease.

[0200] A landing pad sequence is a nucleotide sequence comprising at least one recognition sequence that is selectively bound and modified by a specific polynucleotide modification enzyme such as a site-specific recombinase and/or a targeting endonuclease. In general, the recognition sequence(s) in the landing pad sequence does not exist endogenously in the genome of the cell to be modified. For example, where the cell to be modified is a CHO cell, the recognition sequence in the landing pad sequence is not present in the endogenous CHO genome. The rate of targeted integration may be improved by selecting a recognition sequence for a high efficiency nucleotide modifying enzyme that does not exist endogenously within the genome of the targeted cell. Selection of a recognition sequence that does not exist endogenously also reduces potential off-target integration. In other aspects, use of a recognition sequence that is native in the cell to be modified may be desirable. For example, where multiple recognition sequences are employed in the landing pad sequence, one or more may be exogenous, and one or more may be native.
[0201] One of ordinary skill in the art can readily determine sequences bound and cut by site-specific recombinases and/or targeting endonucleases.
[0202] Multiple recognition sequences may be present in a single landing pad, allowing the landing pad to be targeted sequentially by two or more polynucleotide modification enzymes such that two or more unique nucleic acids (comprising, among other things, receptor genes and/or inducible reporters) can be inserted. Alternatively, the presence of multiple recognition sequences in the landing pad, allows multiple copies of the same nucleic acid to be inserted into the landing pad. When two nucleic acids are targeted to a single landing pad, the landing pad includes a first recognition sequence for a first polynucleotide modification enzyme (such as a first ZFN pair), and a second recognition sequence for a second polynucleotide modification enzyme (such as a second ZFN pair).
Alternatively, or additionally, individual landing pads comprising one or more recognition sequences may be integrated at multiple locations. Increased protein expression may be observed in cells transformed with multiple copies of a payload Alternatively, multiple gene products may be expressed simultaneously when multiple unique nucleic acid sequences comprising different expression cassettes are inserted, whether in the same or a different landing pad. Regardless of the number and type of nucleic acid, when the targeting endonuclease is a ZFN, exemplary ZFN pairs include hSIRT, hRSK4, and hAAVS1, with accompanying recognition sequences.
[0203] Generally speaking, a landing pad used to facilitate targeted integration may comprise at least one recognition sequence. For example, a landing pad may comprise at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten or more recognition sequences. In embodiments comprising more than one recognition sequence, the recognition sequences may be unique from one another (i.e. recognized by different polynucleotide modification enzymes), the same repeated sequence, or a combination of repeated and unique sequences.
[0204] One of ordinary skill in the art will readily understand that an exogenous nucleic acid used as a landing pad may also include other sequences in addition to the recognition sequence(s). For example, it may be expedient to include one or more sequences encoding selectable or screenable genes as described herein, such as antibiotic resistance genes, metabolic selection markers, or fluorescence proteins. Use of other supplemental sequences such as transcription regulatory and control elements (i.e., promoters, partial promoters, promoter traps, start codons, enhancers, introns, insulators and other expression elements) can also be present.
[0205] In addition to selection of an appropriate recognition sequence(s), selection of a targeting endonuclease with a high cutting efficiency also improves the rate of targeted integration of the landing pad(s). Cutting efficiency of targeting endonucleases can be determined using methods well-known in the art including, for example, using assays such as a CEL-1 assay or direct sequencing of insertions/deletions (Indels) in PCR
amplicons.
[0206] The type of targeting endonuclease used in the methods and cells disclosed herein can and will vary. The targeting endonuclease may be a naturally-occurring protein or an engineered protein. One example of a targeting endonuclease is a zinc-finger nuclease, which is discussed in further detail below.
[0207] Another example of a targeting endonuclease that can be used is an RNA-guided endonuclease comprising at least one nuclear localization signal, which permits entry of the endonuclease into the nuclei of eukaryotic cells. The RNA-guided endonuclease also comprises at least one nuclease domain and at least one domain that interacts with a guiding RNA. An RNA-guided endonuclease is directed to a specific chromosomal sequence by a guiding RNA such that the RNA-guided endonuclease cleaves the specific chromosomal sequence. Since the guiding RNA provides the specificity for the targeted cleavage, the endonuclease of the RNA-guided endonuclease is universal and may be used with different guiding RNAs to cleave different target chromosomal sequences. Discussed in further detail below are exemplary RNA-guided endonuclease proteins. For example, the RNA-guided endonuclease can be a CRISPR/Cas protein or a CRISPR/Cas-like fusion protein, an RNA-guided endonuclease derived from a clustered regularly interspersed short palindromic repeats (CRISPR)/CRISPR-associated (Cas) system.
[0208] The targeting endonuclease can also be a meganuclease.
Meganucleases are endodeoxyribonucleases characterized by a large recognition site, i.e., the recognition site generally ranges from about 12 base pairs to about 40 base pairs. As a consequence of this requirement, the recognition site generally occurs only once in any given genome. Among meganucleases, the family of homing endonucleases named LAGLIDADG has become a valuable tool for the study of genomes and genome engineering. Meganucleases may be targeted to specific chromosomal sequence by modifying their recognition sequence using techniques well known to those skilled in the art. See, for example, Epinat et al., 2003, Nuc.
Acid Res., 31(11):2952-62 and Stoddard, 2005, Quarterly Review of Biophysics, pp. 1-47.
[0209] Yet another example of a targeting endonuclease that can be used is a transcription activator-like effector (TALE) nuclease. TALEs are transcription factors from the plant .. pathogen Xanthomonas that may be readily engineered to bind new DNA
targets. TALEs or truncated versions thereof may be linked to the catalytic domain of endonucleases such as FokI to create targeting endonuclease called TALE nucleases or TALENs. See, e.g., Sanjana et al., 2012, Nature Protocols 7(1):171-192; Bogdanove A J, Voytas D F., 2011, Science, 333(6051):1843-6; Bradley P, Bogdanove A J, Stoddard B L., 2013, Curr Opin Struct Biol., 23(1):93-9.
[0210] Another exemplary targeting endonuclease is a site-specific nuclease. In particular, the site-specific nuclease may be a "rare-cutter" endonuclease whose recognition sequence occurs rarely in a genome. Preferably, the recognition sequence of the site-specific nuclease occurs only once in a genome. Alternatively, the targeting nuclease may be an artificial targeted DNA double strand break inducing agent.
[0211] In some embodiments, targeted integrated can be achieved through the use of an integrase. For example, The phiC31 integrase is a sequence-specific recombinase encoded within the genome of the bacteriophage phiC31. The phiC31 integrase mediates recombination between two 34 base pair sequences termed attachment sites (att), one found in the phage and the other in the bacterial host. This serine integrase has been show to function efficiently in many different cell types including mammalian cells.
In the presence of phiC31 integrase, an attB- containing donor plasmid can be unidirectional integrated into a target genome through recombination at sites with sequence similarity to the native attP site (termed pseudo-attP sites). phiC31 integrase can integrate a plasmid of any size, as a single copy, and requires no cofactors. The integrated transgenes are stably expressed and heritable.
[0212] In one embodiment, genomic integration of polynucleotides of the disclosure is achieved through the use of a transposase. For example, a synthetic DNA
transposon (e.g.
"Sleeping Beauty" transposon system) designed to introduce precisely defined DNA
sequences into the chromosome of vertebrate animals can be used. The Sleeping Beauty transposon system is composed of a Sleeping Beauty (SB) transposase and a transposon that was designed to insert specific sequences of DNA into genomes of vertebrate animals. DNA
transposons translocate from one DNA site to another in a simple, cut-and-paste manner.
Transposition is a precise process in which a defined DNA segment is excised from one DNA
molecule and moved to another site in the same or different DNA molecule or genome.
[0213] As do all other Tcl/mariner-type transposases, SB transposase inserts a transposon into a TA dinucleotide base pair in a recipient DNA sequence. The insertion site can be elsewhere in the same DNA molecule, or in another DNA molecule (or chromosome). In mammalian genomes, including humans, there are approximately 200 million TA
sites. The TA insertion site is duplicated in the process of transposon integration. This duplication of the TA sequence is a hallmark of transposition and used to ascertain the mechanism in some experiments. The transposase can be encoded either within the transposon or the transposase can be supplied by another source, in which case the transposon becomes a non-autonomous element. Non-autonomous transposons are most useful as genetic tools because after insertion they cannot independently continue to excise and re-insert. All of the DNA
transposons identified in the human genome and other mammalian genomes are non-autonomous because even though they contain transposase genes, the genes are non-functional and unable to generate a transposase that can mobilize the transposon.
VII. Methods of use [0214] The assays described herein make large-scale screens both time-and cost-effective.
Furthermore, the assays described herein are useful for the screening of a ligand for on and off-target effects, for determining the activity of variants of one or more receptors to a particular ligand or set of ligands, for mapping critical residues required in a receptor required for ligand binding, and for determining which residues in a receptor are non-critical for ligand binding.

[0215] In some aspects the assay methods relate to an assay wherin the receptors are variants of one receptor. In some embodiment, each variant comprises or consists of one substitution relative to the wild-type protein sequence. In some embodiments, each variant comprises or consists of at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 substitutions (or any derivable range therein), compared to the wild-type amino acid sequence. In some aspects, the methods comprise determining the activity of a population of receptors to a ligand, wherein the population of receptors comprises at least two variants of the same receptor, and wherein the activity is determined in response to a ligand. In some aspects, the population of receptors comprises at least, at most, or about 2, 10, 100, 200, 300, 400, 500, 1000, 1500, 2000, 3000, 4000, or 5000 receptors (or any derivable range therein) are screened. In some aspeccts at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 ligands (or any derivable range therein) are screened. In some aspects, at least, at most, or about 2, 10, 100, 200, 300, 400, 500, 1000, 1500, 2000, 3000, 4000, or 5000 receptors (or any derivable range therein) are screened in response to at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 ligands (or any derivable range therein). In some embodiments, the assays may be used to predict a patient's response to a ligand based on the determined activity of a variant receptor to the ligand. For example, the assays described herein may be used to predict a therapeutic response of a variant receptor to a ligand. This information may then be used in a treatment method to treat a patient having the variant receptor. In some embodiments, the methods comprise treating a patient with a ligand, wherein the patient has been deterimined to have a variant receptor. In some embodiments, the activity of the variant receptor to the ligand has been determined by a method described herein.
[0216] In some aspects, the assay is for deteriming the activity of a class of receptors to one or more ligands.
[0217] In some embodiments, the class of receptors are olfactory, GPCR, nuclear hormone, hormone, or catalytic receptors. In some embodiments, the receptor is an adrenoceptor, such as an alpha or beta adrenergic receptor or an alpha-1, alpha-2, beta-1, beta-2, or beta-3 adrenergic receptor, or an alpha-1A, alpha 1B, alpha-1D, alpha-2A, alpha-2B, or alpha-2C adrenergic receptor. In some embodiments, the receptor or class of receptors is one described herein.

VIII. Kits [0218] Certain aspects of the present disclosure also concern kits containing nucleic acids, vectors, or cells of the disclosure. The kits may be used to implement the methods of the disclosure. In some embodiments, kits can be used to evaluate the activation of a receptor gene or a group of receptor genes. In some embodiments, the kits can be used to evaluate variants of a single gene. In certain embodiments, a kit contains, contains at least or contains at most 1, 2, 3,4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 100, 500, 1,000 or more nucleic acid probes, primers, or synthetic RNA
molecules, or any value or range and combination derivable therein. In some embodiments, there are kits for evaluating the activation of or engagement of a receptor by a ligand. In some embodiments, universal probes or primers are included for amplifying, identifying, or sequencing a barcode or receptor. Such reagents may also be used to generate or test host cells that can be used in screens.
[0219] In certain embodiments, the kits may comprise materials for analyzing cell morphology and/or phenotype, such as histology slides and reagents, histological stains, alcohol, buffers, tissue embedding mediums, paraffin, formaldehyde, and tissue dehydrant.
[0220] Kits may comprise components, which may be individually packaged or placed in a container, such as a tube, bottle, vial, syringe, or other suitable container means.
[0221] Individual components may also be provided in a kit in concentrated amounts; in some embodiments, a component is provided individually in the same concentration as it would be in a solution with other components. Concentrations of components may be provided as lx, 2x, 5x, 10x, or 20x or more.
[0222] Kits for using probes, polypeptide or polynucleotide detecting agents of the disclosure for drug discovery are contemplated.
[0223] In certain aspects, negative and/or positive control agents are included in some kit embodiments. The control molecules can be used to verify transfection efficiency and/or control for transfection-induced changes in cells.
[0224] Embodiments of the disclosure include kits for analysis of a pathological sample by assessing a nucleic acid or polypeptide profile for a sample comprising, in suitable container means, two or more RNA probes or primers for detecting expressed polynucleotides. Furthermore, the probes or primers may be labeled. Labels are known in the art and also described herein. In some embodiments, the kit can further comprise reagents for labeling probes, nucleic acids, and/or detecting agents. The kit may also include labeling reagents, including at least one of amine-modified nucleotide, poly(A) polymerase, and poly(A) polymerase buffer. Labeling reagents can include an amine-reactive dye. Kits can comprise any one or more of the following materials: enzymes, reaction tubes, buffers, detergent, primers, probes, antibodies. In some embodiments, these kits include the needed apparatus for performing RNA extraction, RT-PCR, and gel electrophoresis.
Instructions for performing the assays can also be included in the kits.
[0225] The kits may further comprise instructions for using the kit for assessing expression, means for converting the expression data into expression values and/or means for analyzing the expression values to generate ligand/receptor interaction data.
[0226]
Kits may comprise a container with a label. Suitable containers include, for example, bottles, vials, and test tubes. The containers may be formed from a variety of materials such as glass or plastic. The container may hold a composition which includes a probe that is useful for the methods of the disclosure. The kit may comprise the container described above and one or more other containers comprising materials desirable from a commercial and user standpoint, including buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.
IX. Examples The following examples are included to demonstrate preferred embodiments of the disclosure. It should be appreciated by those of skill in the art that the techniques disclosed in the examples which follow represent techniques discovered by the inventor to function well in the practice of the disclosure, and thus can be considered to constitute preferred modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the disclosure.
Example 1 ¨ A Multiplexed Odorant-Receptor Screening System.
[0227]
Mammalian olfaction is a highly complex process and arguably the least understood sense. Olfactory receptors (ORs) are the first layer of odor perception. Human ORs are a set of 400 G protein-coupled receptors (GPCRs) that are monoallelically expressed in neurons located in the nasal epithelium. Odorants bind receptors in a many-to-many fashion, the pattern is transmitted to the olfactory bulb, and transformed into perception in the cortex. only ¨5% of human ORs have high affinity ligands identified for them, the large number of orphan receptors inhibits one's ability to interrogate the downstream neurobiology that governs olfaction. Previous deorphanization attempts utilized heterologous cell-based assays that screened each odorant-receptor pair individually. The high number of potential receptor-odorant combinations and the difficulty in achieving heterologous OR
expression has limited the throughput of "one-at-a-time" approaches. Instead, the inventors have engineered a stable OR expressing cell line that enables multiplexed odorant-receptor screening.
[0228] To measure receptor-odorant interactions, the inventors adapted a genetic reporter for cAMP signaling in HEK293T cells. Upon odorant binding, g-protein signaling stimulates cAMP production that leads to phosphorylation of the transcription factor CREB. CREB
binds the short, tandem-repeat sequence CRE and turns on transcription of a downstream reporter gene, usually luciferase. The assay was modified to include DNA
barcodes into the 3' UTR of the reporter gene that uniquely associate with one OR in the library expressed on the same plasmid (FIG. 1). Each cell is integrated with a single library member to ensure cAMP signaling does not trigger expression of barcodes corresponding to receptors not bound by odorant but present within the same cell. The inventors seeded the cell line into 96-well plates, induced each well with different odors, and sequenced the barcoded transcripts.
The inventors converted the relative abundance of each barcode into a heat map displaying affinity of the odors for each receptor.
[0229] Typical genetic reporter assays for GPCR activation co-transfect the receptor and reporter individually. In order to map each barcode to its corresponding OR, one would need to express all the components for the assay on a single plasmid enabling association of barcode and OR via sequencing. The inventors configured a plasmid to express all necessary components (FIG. 3). The inventors transiently screened a range of concentrations for two ORs, M0R42-3 and MOR9-1, with known, high-affinity ligands against both configurations and observed comparable reporter activation.
[0230] The multiplexing strategy requires stable, clonal integration of the OR library.
Initially, the inventors decided to use Bxb 1 recombination because it enabled each library member to be integrated at a single copy per cell in a single pot reaction.
The inventors engineered a 'landing pad' containing the Bxb 1 attp recombinase site into the H11 safe harbor locus of HEK293T cells FIG. 4). The engineered cell line is referred to as Mukkula (Table 1). Bxb 1 recombination irreversibly integrates plasmid DNA containing a complementary attb recognition site and disrupts the genomic attp sequence restricting a single recombination per cell. The inventors were unable to observe reporter activation when inducing M0R42-3 in the landing pad. However, the beta-2 adrenergic receptor, a canonical GPCR that also activates adenylate cyclase, robustly activated the reporter upon induction when expressed from the landing pad.
Modifications Name Landing Pad Mukkula Landing Pad, Tet rTA Mukku2a Landing Pad, Tet rTA, Accessory Factors Mukku3a [0231] ORs are notoriously difficult to heterologously express and stable, heterologous expression has never been reported. We hypothesized stable, constitutive expression of ORs could lead to many possible avenues of down-regulation and decided to attempt inducible expression. The inventors engineered Mukkula cells to express the reverse Tet transactivator and replaced the promoter driving OR expression with the Tet-On inducible promoter (FIG.
5). The inducible system achieved comparable reporter activation to the previous system transiently, but the inventors were still unable to observe reporter expression when in the landing pad. The next hypothesis was that a single OR gene was insufficient to achieve the expression necessary to activate the genetic reporter. The inventors flanked the genetic construct with intermediate terminal repeats and integrated the plasmid using a transposase (FIG. 6). Under constitutive OR expression, the reporter still did not respond to odorant.
Unexpectedly, the combination of transposing the reporter and controlling OR
expression inducibly restored the reporter's odorant response. QPCR confirmed the transposon was integrated at 4-6 copies per cell on average.
[0232]
Many ORs require co-expression of accessory factors for cell membrane trafficking and proper signal transduction when transiently expressed in heterologous systems (FIG. 7). It was predicted this would be an issue for stable expression as well and genomically integrated 4 accessory factor transgenes: RTP1S and RTP2 (chaperones that increase surface expression), Go,,,if (the G protein alpha subunit that natively interacts with ORs), and Ric8b (the guanine nucleotide exchange factor that associates with Gadi). The inventors pooled and transposed these 4 factors under Tet inducible regulation into Mukku2a cells. To create a cell line with potent OR expression capability, the inventors isolated single clones and transiently screened them for genetic reporter activation against 2 ORs, 01fr62 and 0R7D4, previously known to require accessory factors for heterologous functional expression.
[0233] 42 mouse ORs were cloned into the transposon vector containing a random barcode in the 3' UTR of the reporter gene and sequenced clones to map barcodes to each receptor. Next, each construct was individually transposed into Mukku3a cells and then the cells were pooled together post-transposition. Ultimately, the integrated Mukku3a cells inducibly express both the accessory factors and the OR under control of the Tet-On system (data not shown). The inventors tested a handful of receptors with known ligands both at the protein and transcript level to confirm the stable cell line would replicate previous receptor-odorant associations and work reliably for a large receptor cohort (FIG. 2A-B).
[0234] In order to make the assay amenable to high throughput screening, a 96-well plate compatible, in-lysate protocol for library preparation (FIG. 8) was developed.
Each well of the plate and the plates themselves were barcoded with custom indices. The inventors screened 4 separate concentrations of 96 odorants against our 42-receptor library yielding 16,128 unique receptor-ligand interactions. A heat map was constructed to display the relative activation of each receptor under each condition (FIG. 2C).
The odorant-receptor interaction space is complex and difficult to traverse.
The inventors have developed a platform that overcomes the challenge of heterologous OR
expression and compresses the interaction space through multiplexing. This platform economically and technologically enables large-scale deorphanization of mammalian ORs.
Example 2 ¨ Smell-seq: A Multiplexed GPCR Activity Assay for Decoding Olfactory Receptor-Ligand Interactions [0235] We developed a platform for multiplex receptor-ligand profiling by building libraries of stable human cell line reporters that can be read in multiplex by next generation sequencing in high-throughput formats. This technology generalizes to many other classes of receptors and allows high throughput screening for drug discovery for medicinally relevant GPCRs.

[0236] Interactions between small molecules and receptors underpin an organism's ability to sense and respond to its internal state and environment. For many drugs and natural products, the ability to to modulate the function of many biological targets at once are crucial for their efficacy. Such polypharmacology is difficult to study because we often do not know .. which chemicals interact with which targets. This many-on-many problem is laborious to study one interaction at a time and is especially manifest in the mammalian sense of smell.
[0237] Olfaction is mediated by a class of G protein-coupled receptors (GPCRs) known as olfactory receptors (ORs). GPCRs are a central player in small molecule signaling in mammals and are targeted by over 30% of FDA approved drugs. ORs are a large family of class A GPCRs that have specialized in many different evolutionary contexts with approximately 396, 1130 , and 1948 intact receptors in humans, mice, and elephants respectively. Each OR could potentially interact with a near infinite number of odorants and each odorant with many ORs. The vast majority of ORs remain orphan because of this complexity and because recapitulating mammalian GPCR function in vitro is challenging. In .. addition no crystal structure for any OR exists, hindering computational efforts to predict which odorants activate each OR.
[0238] Here we report a new HTS-compatible system to characterize small molecule libraries against mammalian OR libraries in multiplex (FIG. 9A). To do this, we developed both a stable cell line capable of functional OR expression (FIG. 11) and a multiplexed reporter for OR activity (FIG. 12). The final platform comprises a multi-copy, inducibly expressed OR sitting within the context of an engineered cell line with inducibly expressed proteins required for OR trafficking and signaling (FIG. 13). Activation of each OR leads to the expression of a reporter transcript with a unique 15 nucleotide barcode sequence. Each barcode identifies the OR, allowing for the multiplexed readout by amplicon RNA-seq of the barcodes (FIG. 9A, FIG. 13). Using this platform, we have screened at least 42 different receptors, and we have adapted this platform for high-throughput screening that has allowed for the discovery of novel odorant pairs. We found that multi-copy integration and inducible expression allowed for reporter activation. Individually these features yielded no response;
however, their combination resulted in a functional OR reporter cell line, which demonstrates a synergistic response not found when either multi-copy integration or inducible expression were used alone. We then inducibly expressed G alpha olf, Ric8b, RTP1S, RTP2, (FIG. 9B, FIG. 11). To engineer the reporter construct, we used protein trafficking tags to increase surface expression, added DNA insulator sequences to reduce background reporter activation, modified the cAMP response element (CRE) enhancer to improve reporter signal, and combined these elements into a single transposable vector to speed cell line development (FIG. 12). We validated our system on three murine ORs with known ligands, and observed induction and dose-dependent activation (FIG. 9C), including 01fr62 which has previously been difficult to express.
[0239] After modifications, we created a library of 42 murine OR-expressing cell lines and tested the multiplexed readout of activation. We first cloned and mapped the ORs to their corresponding barcodes via Sanger sequencing and transposed the plasmids individually into HEK-293T cells, pooling the cell lines together after selection (FIG. 10A). To pilot the multiplexed assay, we plated the cell library in 6-well culture dishes and added odorants known to activate specific ORs (FIG. 14); all but 3 ORs were present in enough cells to obtain reliable estimates of activation. Analysis of the sequencing readout recapitulated previously identified odorant-receptor pairs, and chemical mixtures appropriately activated multiple ORs. Interestingly, we found that the assay was robust to chemicals such as the direct adenylate cyclase stimulator forskolin, which nonspecifically stimulate cells independent of the OR they express. Because such chemicals activate all barcodes equivalently, such nuisance chemicals can easily be filtered out. Next, we adapted the platform for high-throughput screening in 96-well format. To decrease reagent cost and assay time, we developed an in-lysate reverse transcription protocol and used dual indexing to uniquely identify each well (see Methods). Using these improvements, we were able to recapitulate dose-response curves for known odorant-receptor pairs (FIG. 10B, FIG. 14). We observed reproducible results between identically treated but biologically independent wells (FIGS. 15-16).
[0240] We subsequently screened 182 odorants at three concentrations in triplicate against the OR cell library, the equivalent of ¨85,000 individual luciferase assays including controls (FIG. 10A, Table 2). Each 96-well plate in the assay contained positive control odorants and solvent DMSO wells for normalization (FIG. 16). We used the EdgeR software package to determine differentially responsive ORs based on a negative binomial model of barcode counts. We found 114 OR-odorant interactions (out of 7,200 possible), 81 of which are novel, and 24 interactions with 15 orphan receptors (FIG. 10C, FIG. 17 and Supplementary Table 4) (FDR = 1%; Benjamini-Hochberg correction). Overall 28 of 39 receptors were activated by at least one odorant, and 68 of 182 odorants activated at least one OR (Table 4).
We chose 37 interactions of at least 1.2 fold induction to test individually with a previously developed transient OR assay that has several important differences (FIG. 18). Of the 28 interactions called as hits at an FDR of 1%, 21 of them replicated in this orthogonal system (FIG. 17).
Even some of the seven that did not replicate are likely real. For instance, our assay registered two hits for MOR19-1 with high chemical similarity (methyl salicylate and benzyl salicylate) suggesting they are likely not false positives (FIG. 18). Additionally, three of nine interactions not passing the 1% FDR threshold showed activation in the orthogonal assay, indicating a conservative threshold. A previous large-scale OR deorphanization study used some of the same receptors and chemicals and we found that 9/12 of their reported interactions with EC50 below 10011M were also detected in our platform, though we did not identify most of the previous low affinity interactions (FIG. 19). Conversely, we also detect 14 interactions that this previous study tested, but called negative. Finally, our assay mostly recapitulated the combinations of odorant and OR that did not interact (493/507).
[0241]
We find that chemicals with similar features activate similar sets of ORs, including those receptors we deorphanize in this study. For example, the previously orphan MOR13-1 is activated by four chemicals with polar groups attached, in three cases, to stiff non-rotatable scaffolds. Another example is, MOR19-1, which has clear affinity for the salicylate functional group. To better understand how chemical similarity relates to receptor activation without relying on incomplete and sometimes arbitrary chemical descriptors, we used a previously validated computational autoencoder to represent each chemical in a ¨292 dimensional latent space, allowing nearly lossless compression of chemical structure (Data not shown). We find chemicals that activate the same OR tend to cluster distinctly (FIG. 10D, FIG. 20). For example, MOR5-1 ligands cluster in latent space, and shows that odorants that are long chain (>5 carbons) aldehydes and carboxylic acids activate the receptor. In addition MOR170-1 exhibits a broad activation pattern: binding ¨50% of all odorants containing a benzene ring and either a carbonyl or ether group, and this pattern is also reflected in the latent space. Many, but not all of the receptors . The activation landscape for the entire set of interactions suggest that some ORs are activated by disconnected chemical subspaces (FIG. 20). Understanding the space of chemicals that activates each OR
establishes the groundwork for prediction of novel odorant-OR interactions.
[0242]
Our incomplete understanding for how chemicals, whether they be endogenous ligands, drugs, natural products, or odors, interact with potential targets limits our ability to rationally develop new with the multitude of possible targets and functional pathways is challenging because a particular chemical can interact with multiple targets.
This is becoming increasingly apparent in both natural and therapeutic contexts. We anticipate that Smell-seq can be scaled to the 396-member human OR repertoire and comprehensively define OR
response to any odorant. The approximate cost per well for Smell-seq is on par with existing assays but multiplexing dramatically reduces cost and labor per interaction interrogated.
Efforts to more selectively hit particular targets or broadly activate sets of receptors utilize machine learning methods that rely on massive datasets. Multiplex methods like Smell-seq offer a scalable solution to generate quality data of this magnitude.
TABLES
Table 2: Olfactory receptors screened in this study Olfr62/

Table 3: Odorants screened in this study Pentanoic Acid Hexanoic Acid 1-nonanol Nonanal 4-hydroxycoumarin Dimedone 1-decanol Decanal 4-Chromanone (-)-Menthone (+)-2-Heptanol Citral 2-Butanone beta-ionone (+)-2-Octanol Hydroxycitronellal 2-Hexanone Pentyl acetate (-)-B-Citronellol Lyral 2-Heptanone Allyl heptanoate Geraniol Acetophenone 3-Heptanone Amyl hexanoate Linalool Control_l 2-Octanone Nonanoic Acid 1-Undecanol Control_2 3-Octanone Amyl butyrate Allyl phenylacetate Decanoic Acid Propionic Acid Butyl heptanoate Benzene DMSO

2_coumaranone Heptyl isobutyrate Benzyl acetate Prenyl_Acetate 2-Nonanone Hexyl acetate Phenyl acetate Vanillic Acid a-2,3-Hexanedione Butyl formate Octanethiol Amylcinnamaldehyde 3,4-Hexanedione Ethyl isobutyrate Nonanedioic Acid Eucalyptol Pentyl propionate (-)-Carvone 1-butanol Nonanethiol (Amyl propionate) (+)-Dihydrocarvone Isovaleric Acid Butanal Dihydro Myrcenol (+)-Camphor 1-propanol Pentanal Muscenone Dihydrojasmone 1-hexanol Hexanal ethyl maltol Benzophenone 1-heptanol Heptanal calone (+)-Pulegone 1-octanol Octanal Sandalwood Mysone benzyl benzoate Iso E Super w-Pentadecalactone (Pentamethylbenzaldehyde) Ethyl 2-methylbutyrate Olibanum Coeur MD 2-Phenylethanol Piperonyl alcohol trans-2-Dodecenal Turkish Rose Oil 2-Phenethyl acetate Piperonyl acetate Cedryl acetate Angel Eau de parfum (10 uM) Piperonal Tetrahydrofuran 1-Octen-3-one a-Hexylcinnamaldehyde Pyrazine Tetrahydropyran 2-Bromohexanoic acid Dior Jadone Eau de Benzaldehyde dimethyl parfum Sassafras oil acetal 6-Bromohexanoic acid Flowerbomb Viktor and Rolf thymol A 2-Methyl-1-propanethiol 2-Bromooctanoic acid Furfuryl methyl Chanel No 5 Triethylamine (+)-Dihydrocarveol disulfide Axe L-Turpentine (-)-Dihydrocarveol Ethyl isovalerate Bis(2-methy1-3-Aedione Anisaldehyde (+)-Perillaaldehyde furyl)disulphide) Isobornyl acetate [Dil ethyl sulfide (-)-Perillaaldehyde Dimethyl trisulfide a-Amylcinnamaldehyde trans-2,cis-6-dimethyl acetal Eugenol Benzyl salicylate Nonadienal (+)-Limonene oxide,mixture of cis and p-Tolyl isobutyrate Eugenol methyl ether trans trans-2-Nonenal (-)-Limonene oxide,mixture o-Tolyl isobutyrate 4-Ethylphenol of cis and trans Cinnamyl alcohol p-Tolyl phenylacetate Ethyl vanillin (R)-(+)-Limonene n-Decyl acetate 2-Methoxy-3-Methyl-pyrazine Vanillin (-)-Camphene Dimethyl anthranilate 2-Methoxypyrazine 2-Ethylphenol (+)-Camphene trans-2-Undecenal Methyl salicylate Guaiacol 2,3-Diethyl-5- Neryl isobutyrate methylpyrazine Anethole 2-bromophenol Ethyl disulfide cis-4-Decenal Myrcene Benzaldehyde Methyl disulfide Octyl formate trans-2-Methyl-2-butenal (A )-2-Butanol 2,3-Diethylpyrazine (2MB) p-cymene 2-Isopropy1-3-methoxypyrazine 2-Methylbutyric acid diacetyl helional 2-sec-Butyl-3- Cyclobutanecarboxylic methoxypyrazine acid galaxolide 1,9-nonanediol Isopentylamine (1-Amino-3-methylbutane, octanedioic acid cis-6-Nonenal Isoamylamine) isobutyraldehyde (suberic acid) Quinoline (1-Benzazine; 2,3- decanedioic acid Cinnamaldehyde Benzopyridine) Ethyl 2-methylpentanoate (sebacic acid) Anisole (Methoxybenzene, beta-Damascone Farnesene e,b,Farnesene Methyl phenyl ether) Table 4: Odorant-receptor pairs called as hits Minimum Activating OR Odorant Concentration (uM) MOR102-1 Cedryl acetate MOR112-1 Benzaldehyde MOR112-1 galaxolide 100 MOR119-1 Axe (10 uM) MOR119-1 Furfuryl methyl disulfide MOR119-1 n-Decyl acetate 100 MOR120-1 Cedryl acetate MOR120-1 Lyral MOR120-1 Nonanethiol MOR13-1 Benzaldehyde MOR13-1 Cyclobutanecarboxylic acid MOR13-1 Pentanoic Acid MOR13-1 trans-2-Methyl-2-butenal (2MB) MOR131-1 (-)-Perillaaldehyde MOR131-1 1-hexanol MOR131-1 3,4-Hexanedione MOR131-1 galaxolide M0R132-1 Cedryl acetate M0R133-1 3-Octanone M0R134-1 Chanel No 5 (10 uM) M0R136-1 (-)-Dihydrocarveol M0R136-1 (+)-Camphor 100 MOR136-1 (+)-Dihydrocarveol M0R136-1 2-Ethylphenol 100 M0R136-1 Olibanum Coeur MD

M0R139-1 (-)-Dihydrocarveol MOR139-1 (+)-Dihydrocarvone M0R139-1 (+)-Pulegone MOR139-1 2- s ec-B uty1-3 -methoxypyrazine M0R139-1 4-Chromanone M0R139-1 beta-ionone M0R139-1 Butanal M0R139-1 Dihydrojasmone MOR139-1 Dimethyl anthranilate M0R139-1 Eugenol M0R139-1 Eugenol methyl ether M0R139-1 helional M0R139-1 Neryl isobutyrate MOR139-1 Quinoline (1-B enzazine; 2,3 -B enzop yridine) 100 MOR142-1 Bis(2-methyl-3-furyl)disulphide) M0R142-1 Cedryl acetate M0R158-1 Iso E Super M0R165-1 decanedioic acid (sebacic acid) M0R165-1 Octyl formate MOR170-1 2-Bromohexanoic acid MOR170-1 2-Phenethyl acetate MOR170-1 4-Chromanone 100 MOR170-1 4-Ethylphenol MOR170-1 Anis aldehyde MOR170-1 Benzyl acetate MOR170-1 benzyl benzoate (Pentamethylbenzaldehyde) 10 MOR170-1 Chanel No 5 (10 uM) MOR170-1 Cinnamyl alcohol MOR170-1 Dimethyl anthranilate 10 MOR170-1 ethyl maltol MOR170-1 Eugenol methyl ether 10 MOR170-1 helional MOR170-1 Piperonal MOR170-1 Piperonyl acetate MOR170-1 Quinoline (1-B enzazine; 2,3 -B enzop yridine) 100 MOR170-1 Vanillin MOR180-1 a-Amylcinnamaldehyde dimethyl acetal MOR180-1 Axe (10 uM) M0R189-1 4-Chromanone M0R189-1 benzyl benzoate (Pentamethylbenzaldehyde) M0R189-1 beta-Damascone M0R189-1 beta-ionone M0R189-1 Cedryl acetate M0R189-1 Eugenol methyl ether MOR189-1 Quinoline (1-B enzazine; 2,3 -B enzop yridine) MOR19-1 Benzyl salicylate 10 MOR19-1 Methyl salicylate M0R199-1 ethyl maltol 100 M0R203-1 helional M0R203-1 Piperonyl acetate M0R208-1 Cedryl acetate M0R23-1 2-Bromooctanoic acid M0R23-1 6-Bromohexanoic acid 100 M0R23-1 Heptanal M0R23-1 Hexanoic Acid M0R23-1 Nonanal M0R23-1 Nonanoic Acid M0R23-1 Octanal 100 M0R25-1 (-)-Carvone M0R25-1 Decanal M0R25-1 Dec anoic-Acid 100 M0R25-1 Nonanoic Acid MOR30-1 Cedryl acetate MOR30-1 Decanal 100 MOR30-1 Decanoic-Acid 10 MOR30-1 Nonanal MOR30-1 Nonanoic Acid 100 MOR4-1 Hexanoic Acid MOR4-1 Pentanoic Acid MORS -1 2-Bromohexanoic acid MORS -1 2-Bromooctanoic acid MORS -1 6-Bromohexanoic acid MORS -1 cis-4-Decenal MORS -1 cis-6-Nonenal MORS -1 Decanoic-Acid MORS -1 Hexanoic Acid MORS -1 Nonanal MORS -1 Nonanoic Acid 100 MORS -1 Octanal MORS -1 Olibanum Coeur MD

01fr62 2-coumaranone 01fr62 Benzaldehyde 01fr62 Benzophenone 01fr62 ethyl maltol 01fr62 Piperonal 01fr62 Quinoline (1-B enzazine; 2,3 -B enzop yridine) MOR9-1 galaxolide Table 5: Primers and Sequences Used in This Study Primer SEQ ID Sequence Description NO:
OL001 25 CCCTTTAATCAGATGCGT Gene Specific RT, Reporter Gene, CG for Q-RTPCR
0L002 25 CTGCCTGCTTCACCACCT Gene Specific RT, GAPDH
TC
0L003 27 AAGTGCCTTCCTGCCCTT Gene Specific RT, Reporter Gene, TAATCAGATGCGTCG for RNA-seq, Also NGS Readl Primer OLOO4F 28 CGCCGAAGTGAAAACCA Pilot-Scale RNA-seq Round 1 CCTA Library Prep Amplification OLOO4R 29 AAGTGCCTTCCTGCCCTT Pilot-Scale RNA-seq Round 1 TAA Library Prep Amplification OLOO5F 30 CAAGCAGAAGACGGCAT P7+i7index+primer for RNAseq ACGAGAT NNNNNNNN library amplification CGAAGTGAAAACCACCT
A
OLOO5R 31 AATGATACGGCGACCAC P5+Readl+primer for pilot-scale CGAGATCTACACAAGTG RNAseq library amplification CCTTCCTGCCCTTTAA
0L006 32 CGGGTTTCTTGGCCTTGT i7 index read primer, pilot-scale AGGTGGTTTTCACTTCG experiment OLOO7F 33 ggaataACGCGTNNNNNNN Amplification of fragment NNNNNNNNCGACGCATC containing barcode to be cloned TGATTAAAGGG into reporter plasmid OLOO7R 34 ggaaggACCGGTtctagtcaaggc Amplification of fragment actatacat containing barcode to be cloned into reporter plasmid OLOO8F 35 tgctcctggccctgctgaccctaggcctg Amplification of fragment gctCATATGAATGGCACAG containing the OR to be cloned AAGGCCC into the reporter plasmid OLOO8R 36 AGTCGGCCCTGCTGAGG Amplification of fragment AGTCTTTCCACCTGCAGG containing the OR to be cloned TCTTATCATGTCTGCTCG into the reporter plasmid AA
0L009 37 CTTCTACGTGCCCTTCTC Sequencing and linking barcodes/ORs in the reporter vector OL010 38 CCTGCAGGTCTTATCATG Sequencing and linking TC barcodes/ORs in the reporter vector OL011 39 TACAGGCGGAATGGACG Sequencing and linking AG barcodes/ORs in the reporter vector OL012F 40 AAGTGAAAACCACCTAC QPCR of the transposon for copy AAGG number analysis OL012R 41 CCCTTTAATCAGATGCGT QPCR of the transposon for copy CG number analysis 0L013 42 AATGATACGGCGACCAC P5+i5+Readl+primer, for large-CGAGATCTACAC scale library amplification NNNNNNNN
AAGTGCCTTCCTGCCCTT
TAA
LP001F 43 TGGGCAGTTCCAGGCTTA Genomic Amplification of the H11 TAGTC locus with the landing pad LP001R 44 GGGCGTACTTGGCATATG Genomic Amplification of the H11 ATACAC locus with the landing pad List of indices used for Pilot-Scale Screen (i7) Name SEQ ID Index NO:

List of Indices Used for Large-Scale Odorant Screen Well SEQ ID Plate SEQ lD NO:
NO:
Index 1 (i7 Index 2 (i5 side) side) METHODS
1. Odorant-Receptor Activation Luciferase Assay (Transient) [0243] The Dual-Glo Luciferase Assay System (Promega) was used to measure OR-odorant responses as previously described (Zhuang and Matsunami 2008) .
HEK293T cells (ATCC #11268) were plated in poly-D-lysine coated white 96-well plates (Corning) at a density of 7,333 cells per well in 100 ul DMEM (Thermo Fisher Scientific). 24 hours later, cells were transfected using lipofectamine 2000 (Thermo Fisher Scientific) with 5 ng/well of plasmids encoding ORs and 10 ng/well of luciferase driven by a cyclic AMP
response element or 10 ng/well of a plasmid encoding both the OR and the luciferase gene, and in both cases 5 ng/well of a plasmid encoding Renilla luciferase. Experiments conducted with accessory factors included 5 ng/well of plasmids encoding RTP1S (Gene ID:
132112) and RTP2 (Gene ID: 344892) . Inducibly expressed ORs were transfected with 1 ug/ml doxycycline (Sigma-Aldrich) added to the transfection media. 10-100 mM odorant stocks were established in DMSO or ethanol. 24 h after transfection, transfection medium was removed and replaced with 25 ul/well of the appropriate concentration of odorant diluted from the stocks into CD293 (Thermo Fisher Scientific). Four hours after odorant stimulation, the Dual-Glo Luciferase Assay kit was administered according to the manufacturer's instructions. Luminescence was measured using the M1000 plate reader (Tecan).
All luminescence values were normalized to Renilla luciferase activity to control for transfection efficiency in a given well. Data were analyzed with Microsoft Excel and R.
2. Odorant-Receptor Activation Luciferase Assay (Integrated) [0244] HEK293T and HEK293T derived cells integrated with the combined receptor/reporter plasmids were plated at a density of 7333 cells/well in 100 uL DMEM in poly-D-lysine coated 96-well plates. 24 hours later, 1 ug/ml doxycycline was added to the well medium. Odorant stimulation, luciferase reagent addition, and luminescence measurements were carried out in the same manner as the transient assays.
Constitutively expressed ORs were assayed in the same manner without doxycycline addition.
Data were analyzed with Microsoft Excel and R.
3. Odor Stimulation and RNA Extraction for Pilot-Scale Multiplexed Odorant Screening [0245] HEK293T and HEK293T derived cells transposed with the combined receptor/reporter plasmid were plated at a density of 200k cells/well in a 6 well plate in 2 mL
DMEM. 24 hours later, 1 ug/ml doxycycline was added to the well medium. 10-100 mM
odorant stocks were established in DMSO or ethanol. 24 hours after doxycycline addition, odorants were diluted in OptiMEM and media was aspirated and replaced with 1 mL of the odorant-OptiMEM solution. 3 hours after odor stimulation, odor media was aspirated and 600 uL of buffer RLT (Qiagen) was added to each well. Cells were lysed with the Qiashredder Tissue and Cell Homogenizer (Qiagen) and RNA was purified using the RNEasy MiniPrep Kit (Qiagen) with the optional on-column DNAse step according to the manufacturer's protocol.
4. Pilot Scale Library Preparation and RNA-seq [0246] 5 ug of total RNA per sample was reverse transcribed with Superscript IV
(Thermo-Fisher) using a gene specific primer for the barcoded reporter gene (0L003). The reaction conditions are as follows: annealing: [65 C for 5 min, 0 C for 1 min]
extension:
[52 C for 60 min, 80 C for 10 min].10% of the cDNA library volumes were amplified for 5 cycles (OLOO4F and R) using HiFi Master Mix (Kapa Biosystems). The reaction and cycling conditions are optimized as follows: 95 C for 3 minutes, 5 cycles of 98 C for 20 seconds, 59 C for 15 seconds, and 72 C for 10 seconds, followed by an extension of 72 C
for 1 minute. The PCR products were purified using the DNA Clean & Concentrator kit (Zymo Research) into 10 ul and 1 ul of each sample was amplified (OLOO5F and R) using the SYBR

FAST qPCR Master mix (Kapa Biosystems) with a CFX Connect Thermocycler (Biorad) to determine the number of PCR cycles necessary for library amplification. The reaction and cycling conditions are optimized as follows: 95 C for 3 minutes, 40 cycles of 95 C for 3 seconds and 60 C for 20 seconds. After qPCR, 5 ul of the pre-amplified cDNA
libraries were amplified a second time at the same cycling conditions as the first amplification with the same primers used for qPCR for 4 cycles greater than the previously determined Cq. The PCR products were then gel isolated from a 1% agarose gel with the Zymoclean Gel DNA
Recovery Kit (Zymo Research). Library concentrations were quantified using a Tape Station 2200 (Agilent) and loaded equimolar onto a Hi-Seq 3000 with a 20% PhiX spike-in and sequenced with custom primers: Read 1 (0L003) and i7 Index (0L006).
5. OR Library Cloning [0247] The backbone plasmid (all genetic elements except the OR and barcode) was created using isothermal assembly with the Gibson Assembly Hifi Mastermix (SGI-DNA). A
short fragment was amplified with a primer containing 15 random nucleotides to create the barcode sequence (OLOO7F and R) using HiFi Master Mix. The reaction and cycling conditions are optimized as follows: 95 C for 3 minutes, 35 cycles of 98 C for 20 seconds, 60 C for 15 seconds, and 72 C for 20 seconds, followed by an extension of 72 C
for 1 minute. The amplicon and the backbone plasmid were digested with restriction enzymes MluI
and AgeI (New England Biolabs) and ligated together with T4 DNA ligase (New England .. Biolabs). DH5a E.coli competent cells (New England Biolabs) were transformed directly into liquid culture with antibiotic to maintain the diversity of the barcode library.
[0248] OR genes were amplified individually with primers (0L008) adding homology to the barcoded backbone plasmid using HiFi Master Mix. The reaction and cycling conditions are optimized as follows: 95 C for 3 minutes, 35 cycles of 98 C for 20 seconds, 61 C for 15 seconds, and 72 C for 30 seconds, followed by an extension of 72 C for 1 minute. The amplified ORs were purified with DNA Clean and Concentrator and pooled together. The barcoded backbone plasmid was digested with NdeI and SbfI and the OR amplicon pool was cloned into it using isothermal assembly with the Gibson Assembly Hifi Mastermix. DH5a E.coli competent cells were transformed with the assembly and antibiotic resistant clones were picked and grown up in 96-well plates overnight. The plasmid DNA was prepped with the Zyppy -96 Plasmid Miniprep Kit (Zymo Research). Plasmids were Sanger sequenced (01109-111) both to associate the barcode with the reporter gene and identify error-free ORs.

6. OR Library Genomic Integration [0249] HEK293T cells and HEK293T derived cells were seeded at a density of 350k cells/well in a 6-well plate in 2 ml DMEM. 24 hours after seeding, cells were transfected with plasmids encoding receptor/reporter transposon and the Super PiggyBac Transposase (Systems Bioscience) according to the manufacturer's instructions. 1 ug of transposon DNA
and 200 ng of transposase DNA were transfected per well with Lipofectamine 3000. 3 days after transfection cells were passaged 1:10 into a 6-well plate and one day after passaging 8 ug/ml blasticidin were added to the cells. Cells were grown with selection for 7-10 days. The OR library was transposed individually and pooled together at equal cell numbers.
7. Accessory Factor Cell Line Generation [0250] HEK293T derived cells were transposed with plasmids encoding the accessory factor genes RTP1S, RTP2, Ga olf (Gene ID: 2774), and Ric8b (Gene ID: 237422) inducibly driven by the Tet-On promoter pooled equimolar according to the transposition protocol in the OR Library Integration section. Cells were selected with 2 ug/ml puromycin (Thermo Fisher). After selection, cells were seeded in a 96-well plate at a density of 0.5 cells/well.
Wells were examined for single colonies after 3 days and expanded to 24-well plates after 7 days. Clones were screened for accessory factor expression by screening them for robust activation of 01fr62 and 0R7D4 with a transient luciferase assay ( FIG. 11).
The clone with the highest fold activation for both receptors and no salient growth defects was established for the multiplexed screen.
8. Transposon Copy Number Verification [0251] gDNA was purified from cells transposed with the OR reporter vector and from cells containing the single copy landing pad with the Quick-gDNA Miniprep kit.
50 ng of gDNA was amplified with primers annealing to the regions of the exogenous DNA
from each sample using the SYBR FAST qPCR Master Mix (Kapa Biosystems) on a CFX Connect Thermocycler using the manufacturer's protocol. The reaction and cycling conditions are optimized as follows: 95 C for 3 minutes, 40 cycles of 95 C for 3 seconds and 60 C for 20 seconds. Cq values for the transposed ORs were normalized to the single copy landing pad to determine copy number.
9. Lentiviral Transduction [0252] Lentiviral vector was produced by transient transfection of 293T
cells with lentiviral transfer plasmid, pCMVAR8.91 and pCAGGS-VSV-G using Mirus TransIT-293.

HEK293T cells were transduced to express the m2rtTA transcription factor (Tet-On) at 50%
confluency and seeded one day prior to transduction. Clones were isolated by seeding cells in a 96-well plate at a density of 0.5 cells/well. Wells were examined for single colonies after 7 days and expanded to 24 well plates. Clones were assessed for m2rtTA
expression by screening for robust activation of M0R42-3 (Gene ID: 257926) with a transient luciferase assay.
10. High-throughput Odorant Screening [0253] The OR library cell line was thawed from a liquid nitrogen frozen stock into a T-225 flask (Corning) three days before seeding into a 96-well plate for screening. The library was seeded at 6,666 cells per well in 100 ul of DMEM. 24 hours later a working concentration of 1 ug/ml of doxycycline in DMEM was added to the wells. 24 hours after induction, the media was removed from each plate and replaced with 25 ul of odorant diluted in OptiMEM. Each odor was added at three different concentrations (10 uM, 100 uM, 1 mM) in triplicate with the same amount of final DMSO (1%). Each plate contained two control .. odorants at a three concentration (10 uM, 100 uM, 1 mM) in triplicate and three wells containing 1% DMSO dissolved in media. The library was incubated with odorants for three hours in a cell culture incubator with the lids removed.
[0254] After odor incubation, media was pipetted out of the plates and cells were lysed by adding 25 uL of ice-cold Cells-to-cDNA II Lysis Buffer (Thermo Fisher) and pipetting up .. and down to homogenize and lyse cells. The lysate was then heated to 75 C
for 15 minutes and flash frozen with liquid nitrogen and kept at -80C until further processing. Then 0.5 uL
DNase I (New England Biolabs) was added to lysate, and incubated at 37 C for 15 minutes.
To anneal the RT primer, 5 ul of lysate from each well was combined with 2.5 ul of 10 mM
dNTPs (New England Biosciences), 1 ul of 2 uM gene specific RT primer (0L003), and 1.5 ul of H20. The reaction was heated to 65 C for 5 min and cooled back down to 0 C. After annealing, 1 ul of M-MuLV Reverse Transcriptase (Enzymatics), 1 ul of buffer, and 0.25 ul of RNase Inhibitor (Enzymatics) were added to each reaction. Reactions were incubated at 42 C for 60 min and the RT enzyme was heat inactivated at 85 C for 10 min.
[0255] For each batch, qPCR was performed on a few wells (OLOO5F and 0L013) with SYBR FAST qPCR Mastermix to determine the number of cycles necessary for PCR
based library preparation. The reaction and cycling conditions are optimized as follows: 95 C for 3 minutes, 40 cycles of 95 C for 3 seconds and 60 C for 20 seconds. After qPCR, 5 ul of each RT reaction was combined with 0.4 ul of 10 uM primers containing sequencing adaptors (OLOO5F and 0L013), 10 ul of NEB-Next Q5 Mastermix (New England Biosciences) and 4.2 ul H20, the PCR was carried out according to the manufacturer's protocol.
The forward primer contains the P7 adaptor sequence and an index identifying the well in the assay and the reverse primer contains the P5 adaptor sequence and an index identifying the plate in the assay. PCR products were pooled together by plate and purified with the DNA
Clean and Concentrator Kit. Library concentrations were quantified using a Tape Station 2200 and a Qubit (Thermo Fisher). The libraries were sequenced with two index reads and a single end 75-bp read on a NextSeq 500 in high-output mode (IIlumina).
11. Analysis of Next-Generation Sequencing Data [0256] Samples were identified via indexing by their PCR indexes adapters unique for each well (5' end) and unique for each plate (3' end). The well barcodes followed the 7bp indexing scheme in (IIlumina Sequencing Library Preparation for Highly Multiplexed Target Capture and Sequencing Matthias Meyer, Martin Kircher, Cold Spring Harb Protoc; 2010;
doi:10.1101/pdb.prot5448). The plate indexing scheme followed the Illumina indexing scheme. Sequencing data was demultiplexed and 15bp barcode sequences were counted with only exact matches by custom python and bash scripts.
12. Statistical Methods for Calling Hits [0257] Count data was then analyzed using the differential expression package EdgeR. To filter out ORs with low representation, we set a cutoff that an OR had to contain at least 0.5%
of the reads from more than 399 of the 1954 test samples. This filtered out 3 of 42 ORs which were underrepresented in the cell library (M0R172-1, M0R176-1 and MOR181-1).
Normalization factors were determined using the EdgeR package function calcNormFactors, and glmFit was used with the dispersion set to the tagwise dispersion since only 40 ORs were present in the library and trended dispersion values did fit the data well. By fitting a generalized linear model to the count data to determine if odorants stimulated specific ORs, we were able to determine both the mean activation for each OR-odorant interaction and the p-value. We then corrected this p-value for multiple hypothesis testing using the built in p.adjust function with the Benjamini & Hochberg correction yielding a False Discovery Rate .. (FDR). We set a conservative cutoff of 1% to determine interacting odorant-OR pairs. For each interaction between an odorant and an OR, we further required that an OR-odorant interaction was beyond the cutoff in two different concentrations of odorant or in just the 1000 uM concentration.
13. Molecular Autoencoder [0258] We used an autoencoder as described in Gomez-Bombarelli et al. to visualize OR-chemical interactions in the context of chemical space. Following the authors advice, we used a reimplementation of autoencoder as the original implementation requires a defunct Python package. This model comes pre-trained to a validation accuracy of 0.99 on the entire ChEMBL 23 database with the exception of molecules whose SMILES are longer than 120 characters. We used this pretrained model to generate the latent representations of both our 168 chemicals (for which we could find SMILES representations) and 250,000 randomly sampled chemicals from ChEMBL 23. We then used scikit-learn to perform principal component analysis to project the resulting matrix onto two dimensions.
Example 3¨ ADRB2 variant screen [0259] Overview of creation and functional assessment of the mutant library. We synthesize the mutant sequences on oligonucleotide microarrays, however the length limit for each oligo is ¨230 nt and ADRB2 is ¨1200 nt long. To cover the length of the protein we had to segment it into 8 parts, synthesize each mutant eighth and clone into a separate background vectors. When amplifying and cloning the variant segment, we attached a 15 nt random barcode to each sequence. Upon cloning, we mapped each barcode to each variant with next-gen sequencing. Afterwards, we cloned in the remainder of the protein and translocated the barcode to the 3' UTR of a cyclic AMP Response Element (CRE) reporter gene that expresses upon Gs signaling. From there, we integrated the library at a defined genomic locus in AADRB2 HEK293T cells at single copy per cell (essential to prevent crosstalk between mutants in the multiplexed assay) using serine recombinase technology. After integration, we .. stimulated the library cell line with various isoproterenol concentrations and performed RNA-seq on the barcode sequences. The relative abundance of each barcode can be inferred as the relative activity of each B2 variant after normalization for representation. This is shown in FIG. 21.
[0260] In FIG. 22, we show the the distributions activity relative to the median wild-type signal for both frameshifts (a common error mode of oligonucleotide microarray synthesis) and our single mutant library across two biological replicates. To build our variant distribution, we average the measurements of every barcode associated with a given variant.

To build the frameshift distribution, we average the measurements of every barcode associated with an indel at a particular codon (excluding the C-terminus). As expected, frameshifts have a more deleterious effect than the average missense mutation.
We also see that at high Isoproterenol concentrations, a higher proportion of our missense mutations approach wild-type levels of activity.
[0261] In FIG. 23 we show the variant activity landscape for (32 at 0.625 uM
Isoproterenol. The mutational landscape reveals general trends of (32 structure and function.
For example, we see that transmembrane domains are more sensitive to proline and charged residue substitutions than the termini or intracellular loop 3 (mutational tolerance is the average effect of all mutations). We also see that the effects of frameshifts are greatly diminished in the C-terminus. We see mutational data is correlated with EV
mutation Score and we can also see how rare variants affect function from GNOMAD data.
[0262] In FIG. 24 we show the comparison between missense variants assayed individually with a luciferase reporter compared to the multiplexed sequencing approach.
Mutant activity relative to WT is mostly recapitulated. The multiplexed assay can distinguish between completely dead mutants and partially deleterious mutants over the range of isoproterenol stimulation.
[0263] We looked at the mutational tolerance (avg. of all substitutions) of the ligand binding pocket of (32 as annotated from Ring et al.'s contact map of Hydroxybenzyl Isoproterenol with the receptor. In our assay, we stimulated solely with isoproterenol, and we see that mutations to the residues interacting with isoproterenol are significantly less tolerant to mutation relative to residues interacting with the hydroxybenzyl tail. This is shown in FIG. 25.
[0264] We also found that that simple algorithms such as k-means clustering could group our data into distinct classes that map onto the structure of (32 in a functionally relevant manner. In this specific example, we grouped the amino acid mutations together into functional classes and averaged their signal. Importantly, we did not provide any spatial information to the algorithm. We believe that future deep mutational scans could be a powerful method to investigate protein structure. This is shown in FIG. 26.
* * *
[0265] All of the methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. More specifically, it will be apparent that certain agents which are both chemically and physiologically related may be substituted for the agents described herein while the same or similar results would be achieved.
All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.

REFERENCES
The following references and the publications referred to throughout the specification, to the extent that they provide exemplary procedural or other details supplementary to those set forth herein, are specifically incorporated herein by reference.
1. Roth, B. L., Sheffler, D. J. & Kroeze, W. K. Magic shotguns versus magic bullets:
selectively non-selective drugs for mood disorders and schizophrenia. Nat.
Rev. Drug Discov. 3, 353-359 (2004).
2. Reddy, A. S. & Zhang, S. Polypharmacology: drug discovery for the future.
Expert Rev. Clin. Pharmacol. 6, 41-47 (2013).
3. Fang, J., Liu, C., Wang, Q., Lin, P. & Cheng, F. In silico polypharmacology of natural products. Brief. Bioinform. (2017). doi: 10.1093/bib/bbx045 4. Anighoro, A., Bajorath, J. & Rastelli, G. Polypharmacology: challenges and opportunities in drug discovery. J. Med. Chem. 57, 7874-7887 (2014).
5. Malnic, B., Hirono, J., Sato, T. & Buck, L. B. Combinatorial receptor codes for odors. Cell 96, 713-723 (1999).
6. Buck, L. & Axel, R. A novel multigene family may encode odorant receptors:
a molecular basis for odor recognition. Cell 65, 175-187 (1991).
7. Hauser, A. S., Attwood, M. M., Rask-Andersen, M., Schioth, H. B. & Gloriam, D.
E. Trends in GPCR drug discovery: new agents, targets and indications. Nat.
Rev. Drug Discov. 16, 829-842 (2017).
8. Niimura, Y., Matsui, A. & Touhara, K. Extreme expansion of the olfactory receptor gene repertoire in African elephants and evolutionary dynamics of orthologous gene groups in 13 placental mammals. Genome Res. 24, 1485-1496 (2014).
9. Peterlin, Z., Firestein, S. & Rogers, M. E. The state of the art of odorant receptor deorphanization: a report from the orphanage. J. Gen. Physiol. 143, 527-542 (2014).
10. Lu, M., Echeverri, F. & Moyer, B. D. Endoplasmic reticulum retention, degradation, and aggregation of olfactory G-protein coupled receptors. Traffic 4, 416-433 (2003).
11. Saito, H., Chi, Q., Zhuang, H., Matsunami, H. & Mainland, J. D. Odor coding by a Mammalian receptor repertoire. Sci. Signal. 2, ra9 (2009).
12. Mainland, J. D. et al. The missense of smell: functional variability in the human odorant receptor repertoire. Nat. Neurosci. 17, 114-120 (2014).

13. Botvinik, A. & Rossner, M. J. Linking cellular signalling to gene expression using EXT-encoded reporter libraries. Methods Mol. Biol. 786, 151-166 (2012).
14. Galinski, S., Wichert, S. P., Rossner, M. J. & Wehr, M. C. Multiplexed profiling of GPCR activities by combining split TEV assays and EXT-based barcoded readouts. Sci.
Rep. 8, 8137 (2018).
15. Zhuang, H. & Matsunami, H. Synergism of accessory factors in functional expression of mammalian odorant receptors. J. Biol. Chem. 282, 15284-15293 (2007).
16. Shepard, B. D., Natarajan, N., Protzko, R. J., Acres, 0. W. & Pluznick, J.
L. A
cleavable N-terminal signal peptide promotes widespread olfactory receptor surface expression in HEK293T cells. PLoS One 8, e68758 (2013).
17. Saito, H., Kubota, M., Roberts, R. W., Chi, Q. & Matsunami, H. RTP family members induce functional expression of mammalian odorant receptors. Cell 119, (2004).
18. Li, X. et al. piggyBac transposase tools for genome engineering. Proc.
Natl. Acad.
Sci. U. S. A. 110, E2279-87 (2013).
19. McCarthy, D. J., Chen, Y. & Smyth, G. K. Differential expression analysis of multifactor RNA-Seq experiments with respect to biological variation. Nucleic Acids Res.
40, 4288-4297 (2012).
20. Zhuang, H. & Matsunami, H. Evaluating cell-surface expression and measuring .. activation of mammalian odorant receptors in heterologous cells. Nat.
Protoc. 3, 1402-1413 (2008).
21. Gomez-Bombarelli, R. et al. Automatic Chemical Design Using a Data-Driven Continuous Representation of Molecules. ACS Cent Sci 4, 268-276 (2018).
22. Antebi, Y. E. et al. Combinatorial Signal Perception in the BMP Pathway.
Cell 170, 1184-1196.e24 (2017).

Claims

WHAT IS CLAIMED IS:

1. A nucleic acid comprising:
i.) a heterologous receptor gene;
ii.) an inducible reporter comprising a receptor-responsive element; wherein the expression of the reporter is dependent on the activation of the activity of the receptor encoded by the receptor gene, and wherein the reporter comprises a barcode comprising an index region that is unique to the heterologous receptor gene.

2. A vector comprising the nucleic acid of claim 1.

3. A vector comprising a heterologous receptor gene.

4. The vector of claim 3, wherein the vector further comprises an inducible reporter;
wherein expression of the reporter is dependent on the activation of the activity of the receptor encoded by the receptor gene, and wherein the reporter comprises a barcode comprising an index region that is unique to the heterologous receptor gene.

5. A vector comprising an inducible reporter, wherein the reporter comprises a barcode.

6. The vector of any one of claims 2-4, wherein the receptor gene encodes for a G-protein coupled receptor (GPCR).

7. The vector of any one of claims 2-6, wherein the receptor gene further comprises one or more additional polynucleotides encoding for an auxiliary polypeptide.

8. The vector of claim 7, wherein the auxiliary polypeptide comprises a selectable or screenable protein.

9. The vector of claim 7 or 8, wherein the auxiliary polypeptide comprises a protein tag.

10. The vector of any one of claims 7-8, wherein the auxiliary polypeptide comprises a transcription factor.

11. The vector of claim 10, wherein the receptor gene encodes for a fusion protein comprising the receptor gene and the auxiliary polypeptide.

12. The vector of claim 11, wherein the fusion protein comprises a protease site between the receptor gene and the auxiliary polypeptide.

13. The vector of any one of claims 2-12, wherein the auxiliary polypeptide comprises one or more trafficking tags.

14. The vector of claim 13, wherein the auxiliary polypeptide comprises two trafficking tags.

15. The vector of claim 13 or 14, wherein the trafficking tags comprise a Lucy and/or Rho tag.

16. The vector of any one of claims 2-15, wherein the reporter is induced by signal transduction upon activation of the GPCR.

17. The vector of any one of claims 2-16, wherein the receptor-responsive element comprises one or more of a cAMP response element (CRE), a nuclear factor of activated T-cells response element (NFAT-RE), serum response element (SRE), and serum response factor response element (SRF-RE).

18. The vector of claim 17, wherein the receptor-responsive element comprises CRE.

19. The vertor of claim 18, wherein the CRE comprises at least 5 repeats of SEQ ID
NO:1.

20. The vector of any one of claims 10-19, wherein the receptor-responsive element comprises a DNA element that is bound by the auxiliary polypeptide transcription factor.

21. The vector of claim 20, wherein the auxiliary polypeptide transcription factor comprises reverse tetracycline-controlled transactivator (rtTA), and the receptor-responsive element comprises a tetracycline responsive element (TRE).

22. The vector of any one of claims 6-21, wherein the GPCR is an olfactory receptor (OR).

23. The vector of any one of claims 2-22, wherein the receptor comprises an adrenoceptor.

24. The vector of claim 23, wherein the adrenoceptor comprises a beta-2 adrenergic receptor.

25. The vector of any one of claims 2-22, wherein the receptor gene comprises a nuclear hormone receptor gene.

26. The vector of any one of claim 2-22, wherein the receptor gene comprises a receptor tyrosine kinase gene.

27. The vector of any one of claims 2-26, wherein the receptor is a transmembrane receptor.

28. The vector of any one of claims 2-26, wherein the receptor is an intracellular receptor.

29. The vector of any one of claims 2-28, wherein the vector comprises a viral vector.

30. The vector of claim 29, wherein the vector comprises a lentiviral vector.

31. The vector of any one of claims 2-29, wherein the receptor gene comprises a constitutive promoter.

32. The vector of any one of claims 2-29, wherein the receptor gene comprises a conditional promoter.
32.1 The vector of any one of claims 2-32, wherein the heterologous receptor gene is operatively coupled to a conditional promoter.
32.2 The vector of claim 32.1, wherein the conditional promoter is a tetracycline response element.

33. The vector of any one of claims 2-32, wherein the barcode is at least 10 nucleic acids.

34. The vector of any one of claims 2-32, wherein the reporter comprises or further comprises an open reading frame (ORF); wherein the gene comprises a 3' untranslated region (UTR).

35. The vector of claim 34, wherein the barcode is located in the 3'UTR of the gene for the fluorescent protein.

36. The vecotor of claim 34 or 35, wherein the ORF encodes a selectable or screenable protein.

37. The vector of claim 36, wherein the ORF encodes a luciferase protein.

38. The vector of any one of claims 2-37, wherein the receptor gene is flanked at the 5' and/or 3' end by insulator sequences.

39. The vector of any one of claims 2-37, wherein the reporter is flanked at the 5' and/or 3' end by insulator sequences.

40. The vector of claim 38 or 39, wherein the insulator comprises a cHS4 insulator.

41. The vector of any one of claims 2-40, wherein the vector comprises a second, third, or fourth barcode.

42. The vector of claim 41, wherein at least one of the second, third, or fourth barcode comprises an index region that is unique to one or more of: an assay condition or a position on a microplate.

43. A viral particle comprising the vector of any one of claims 2-40.

44. A cell comprising the vector of any one of claims 3-39 or the viral particle of claim 43.
44.1 A cell comprising a plurality of copies of the vector of any one of claims 2-42.
44.2 The cell of claim 44.1, wherein the cell comprises at least three copies of the vector.

45. A population of cells, wherein each cell comprises:
i.) a heterologous receptor gene; and ii.) an inducible reporter comprising a receptor-responsive element; wherein expression of the reporter is dependent on the activation of the activity of the receptor encoded by the receptor gene, and wherein the reporter comprises a barcode comprising an index region that is unique to the heterologous receptor gene;
and wherein the cells express different heterologous receptors and wherein each single cell has one or more copies of one specific heterologous receptor and one or more copies of one specific reporter.

46. A cell comprising:
i.) a heterologous receptor gene; and ii.) an inducible reporter comprising a receptor-responsive element; wherein expression of the reporter is dependent on the activation of the activity of the receptor encoded by the receptor gene, and wherein the reporter comprises a barcode comprising an index region that is unique to the heterologous receptor gene.

47. The cell or cells of any one claims 44.2-46, wherein the receptor gene encodes for a GPCR.

48. The cell or cells of claim 47, wherein the reporter is induced by signal transduction upon activation of the GPCR.

49. The cell or cells of anyone of claims 44.2-48, wherein the receptor gene further comprises one or more additional polynucleotides encoding for an auxiliary polypeptide.

50. The cell or cells of claim 49, wherein the auxiliary polypeptide comprises a selectable or screenable protein.

51. The cell or cells of claim 49 or 50, wherein the auxiliary polypeptide comprises a protein tag.

52. The cell or cells of any one of claims 49-51, wherein the auxiliary polypeptide comprises a transcription factor.

53. The cell or cells of any one of claims 49-52, wherein the receptor gene encodes for a fusion protein comprising the receptor gene and the auxiliary polypeptide.

54. The cell or cells of claim 53, wherein the fusion protein comprises a protease site between the receptor gene and the auxiliary polypeptide.

55. The cell or cells of any one of claims 47-54, wherein the inducible reporter comprises one or more of a cAMP response element (CRE), a nuclear factor of activated T-cells response element (NFAT-RE), serum response element (SRE), and serum response factor response element (SRF-RE)

56. The cell or cells of any one of claims 47-55, wherein the GPCR is an olfactory receptor (OR).

57. The cell or cells of any one of claims 44-56, wherein the cell further comprises one or more genes encoding for one or more accessory proteins.

58. The cell or cells of claim 57, wherein the one or more accessory proteins comprises one or more of a G .alpha.-subunit, Ric-8B, RTP1L, RTP2, RTP3, RTP4, CHMR3, and RTP1S.
58.1 The cell of any one of claims 44.2-58, wherein the cell comprises stable integration of one or more exogenous nucleotides encoding one or more accessory factor genes, wherein the accessory factor genes comprise RTP1S, RTP2, G.alpha.-subunit, and Ric-8b.

59. The cell or cells of claim 57, wherein the one or more accessory proteins comprises an arrestin protein.

60. The cell of claim 59, wherein the arrestin protein is fused to a protease.

61. The cell or cells of any one of claims 44.2-60, wherein the receptor gene comprises a nuclear hormone receptor gene.

62. The cell or cells of any one of claims 44.2-61 wherein the receptor gene comprises a receptor tyrosine kinase gene.

63. The cell or cells of any one of claims 44.2-62, wherein the receptor is a transmembrane receptor.

64. The cell or cells of any one of claims 57-63, wherein the one or more accessory proteins comprises one or more of a chaperone protein, a G protein, and a guanine nucleotide exchange factor.

65. The cell or cells of any one of claim 44.2-64, wherein the cell further comprises a receptor protein expressed from the heterologous receptor gene.

66. The cell or cells or cells of claim 65, wherein the receptor protein is localized intracellularly.

67. The cell or cells of any one of claims 44.2-66, wherein the cell lacks an endogenous gene that encodes for a protein that is at least 80% identical to the heterologous receptor gene.

68. The cell or cells of any one of claims 44.2-67, wherein the receptor gene is integrated into the cell's genome.

69. The cell or cells of any one of claims 44.2-68, wherein the inducible reporter is integrated into the cell's genome.

70. The cell or cells of claim 68 or 69, wherein the receptor gene and inducible reporter are genetically linked.

71. The cell or cells of claim 68 or 69, wherein the receptor gene and inducible reporter are genetically unlinked.

72. The cell or cells of any one of claims 68-71, wherein the integrated receptor gene and/or inducible reporter are integrated by targeted integration.

73. The cel or cells of claim 72, wherein the integration is into the H11 safe harbor locus.

74. The cell or cells of any one of claims 68-71, wherein the integrated receptor gene and/or inducible reporter are randomly integrated into the genome.

75. The cell or cells of claim 74, wherein the random integration comprises transposition of the receptor gene and/or inducible reporter.

76. The cell or cells of any one of claims 44.2-75, wherein the cell comprises at least 2 copies of the receptor gene and/or inducible reporter.

77. The cell or cells of any one of claims 44.2-76, wherein the receptor gene comprises a constitutive promoter.

78. The cell or cells of any one of claims 65-77, wherein the expression of the receptor is constitutive.

79. The cell or cells of any one of claims 44.2-76, wherein the receptor gene comprises a conditional promoter.

80. The cell or cells of any one of claims 65-76 or 79, wherein the expression of the receptor is conditional.

81. The cell or cells of any one of claims 44.2-80, wherein the barcode and/or index region is at least 10 nucleic acids.

82. The cell of any one of claims 44.2-81, wherein the reporter comprises or further comprises a gene for a fluorescent protein; wherein the gene comprises a 3' untranslated region (UTR).

83. The cell or cells of claim 82, wherein the barcode is located in the 3'UTR of the gene for the fluorescent protein.

84. The cell or cells of claim 82 or 83, wherein the gene encodes a luciferase protein.

85. The cell or cells of any one of claims 68-84, wherein the receptor gene is flanked at the 5' and 3' end by insulator sequences.

86. The cell or cells of any one of claims 68-85, wherein the reporter is flanked at the 5' and 3' end by insulator sequences.

87. The cell or cells of any one of claims 44.2-86, wherein the expression level of the heterologous receptor is at a physiologically relevant expression level.

88. The cell or cells of any one of claims 44.2-87, wherein the cell or cells are frozen.

89. The cell or cells of any one of claims 44.2-88, wherein the cell is a mammalian cell.

90. The cell or cells of claim 90, wherein the cell is a human embryonic kidney 293T
(HEK293T) cells.

91. An assay system comprising the cells of any one of claims 44-90.

92. A method for screening for ligand and receptor binding comprising:
contacting the cell or cells of any one of claims 44-90 with a ligand;
detecting one or more reporters; and determining the identity of the one or more reporters; wherein the identity of the reporter indicates the identity of the bound receptor.

93. The method of claim 92, wherein determining the identity of the reporter comprises isolating nucleic acids from the cell.

94. The method of claim 93, wherein the nucleic acids comprise RNA.

95. The method of claim 94, wherein the method further comprises performing a reverse transcriptase reaction on the isolated RNA to make a cDNA.

96. The method of claim 95, wherein the RT is preformed in the lysate.

97. The method of any one of claims 93-96, wherein the method further comprises amplifying the isolated nucleic acids.

98. The method of any one of claims 93-97, wherein the method further comprises sequencing the isolated nucleic acids.

99. The method of any one of claims 92-98, wherein detecting one or more reporters comprises detecting the level of fluorescence from the cell or cells.

100. The method of any one of claims 92-99, wherein at least 2 different heterologous receptors are expressed in the cells.

101. The method of any one of claims 92-100, wherein the population of cells are co-mixed in one composition.

102. The method of any one of claims 92-101, wherein the population of cells are adhered to a substrate.

103. The method of any one of claims 92-102, wherein the population of cells are contained within one well of a substrate or within one cell culture dish.

104. The method of any one of claims 92-103, wherein the method further comprises plating the cells.

105. The method of claim 104, wherein the cells are plated onto a 96-well cell culture plate.

106. The method of any one of claims 92-105, wherein the cells or cells are frozen and the method further comprises thawing frozen cells.

107. A method for screening for ligand and receptor binding comprising:
contacting a population of cells with a ligand; wherein each cell of the population of cells comprises:

i.) a heterologous receptor gene; and ii.) an inducible reporter comprising a receptor-responsive element; wherein expression of the reporter is dependent on the activation of the activity of the receptor encoded by the receptor gene, and wherein the reporter comprises a barcode comprising an index region that is unique to the heterologous receptor gene;
and wherein the population of cells express at least 300 different receptors from the heterologous receptor genes and wherein each single cell has one or more copies of one specific heterologous receptor and one or more copies of one specific reporter;
detecting one or more reporters; and determining the identity of the one or more reporters; wherein the identity of the reporter indicates the identity of the bound receptor.

108. A vector library comprising at least two different vectors, wherein the vectors comprise different heterologous receptor genes and different inducible reporters.

109. A cell library comprising the population of cells of any one of claims 45-90.

110. A viral library comprising at least two viral particles according to claim 43, wherein the viral particles comprise different heterologous receptor genes and different inducible reporters.

111. A method for making a library of cells comprising receptor proteins, the method comprising:
i.) expressing the nucleic acid of claim 1 or the vector of any one of claims 2-39 in cells; or ii.) infecting cells with the virus of claim 43;
wherein the cells express different heterologous receptors and wherein each single cell expresses one or more copies of one specific heterologous receptor and one or more copies of one specific reporter.

112. A kit comprising the library of any one of claims 108-110.

113. A nucleic acid comprising:
i.) a heterologous receptor gene operatively coupled to an inducible promoter;
and ii.) a reporter comprising a receptor-responsive element; wherein the expression of the reporter is dependent on the activation of the activity of the receptor encoded by the heterologous receptor gene, and wherein the reporter comprises a barcode comprising an index region that is unique to the heterologous receptor gene.

114. A cell comprising at least 2 copies to at least 6 copies of the nucleic acid of claim 113 .