CA2523449C - Recombinant antibodies and fragments which recognize n glycolil gm3 ganglioside and its use in diagnosis and treatment of tumours - Google Patents
Recombinant antibodies and fragments which recognize n glycolil gm3 ganglioside and its use in diagnosis and treatment of tumours Download PDFInfo
- Publication number
- CA2523449C CA2523449C CA2523449A CA2523449A CA2523449C CA 2523449 C CA2523449 C CA 2523449C CA 2523449 A CA2523449 A CA 2523449A CA 2523449 A CA2523449 A CA 2523449A CA 2523449 C CA2523449 C CA 2523449C
- Authority
- CA
- Canada
- Prior art keywords
- replace
- melanomas
- cdr
- monoclonal antibody
- breast tumors
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Lifetime
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3076—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
- C07K16/3084—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties against tumour-associated gangliosides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/10—Cells modified by introduction of foreign genetic material
- C12N5/12—Fused cells, e.g. hybridomas
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Wood Science & Technology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Cell Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Biophysics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Animal Behavior & Ethology (AREA)
- Microbiology (AREA)
- Oncology (AREA)
- General Engineering & Computer Science (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The invention essentially relates to the production of less immunogenic immunoglobulins by means of genetic engineering and, more specifically, to a monoclonal antibody recognising antigens which contain ganglioside N-glycolyl-GM3 but not other N-glycolyl- or N-acetyl-type gangliosides nor sulphated glycolipids. In particular, the invention relates to peptide sequences encoding a recombinant monoclonal antibody against ganglioside N-glycolyl-GM3 or derivative fragments of same. The invention further relates to pharmaceutical compositions containing the aforementioned antibody or fragments thereof and to the diagnostic or therapeutic use of same for breast cancer and melanoma.
Description
Recombinant antibodies and fragments which recognize N glycolil GM3 ganglioside and its use in diagnosis and treatment of tumors.
Technical Field.
The present invention relates to the field of immunology and in particular with the obtaining less immunogenic immunoglobulins using genetic engineering technologic to use in the cancer treatment. The present invention is related specifically with the peptide sequences which codified a monoclonal antibody or fragments derived which recognize antigens containing the N-glycolil GM3 ganglioside and no other related gangliosides as N-glycolil or N-acetyl, and nor sulphates glycolipids Background of the invention.
The gangliosides are glycosphingolipids which contain sialic acid and they are present in plasmatic membranes of vertebrates (Stults CLM et. al, Methods Enzymology 179:167-214, 1989). Some of these molecules has been reported in the literature as tumour associated antigens or tumoral markers (Hakamori SH: Curr Opin Immunol 3:646-653, 1991), then It has been described the use of anti gangliosides antibodies in the diagnosis and therapeutic of cancer. (Hougton AN et. al, NAS USA 82:1242-1246, 1985;
Zhang S
et al. Int J Cancer 73:42-49, 1997). The more commonly sialic acids in mammalian cells are N-acetyl (NAc) and the N-glycolil (NGc) (Corfield AP et. al, Cell Biol Monogr 10:5-50, 1982). Generally the NGc is not expressed in human and chicken normal tissues but it is widely distributed in other vertebrates (Leeden RW et. al, Biological Role of Sialic Acid.
Rosemberg A and Shengtrund CL (Eds). Plenum Press, New York, 1-48, 1976, Kawai T
et. al, Cancer Research 51:1242-1246, 2001). However reports from the literature show that the anti-NGc antibodies recognize some human tumors and tumoral cell lines (Higashi H et. al, Jpn J. Cancer Res. 79:952-956, 1988, Fukui Y et. al, Biochem Biophys Res Commun 160:1149-1154, 1989). An increase in the GM3 (NGc) ganglioside level has been found in human breast cancer (Marquina G et. al, Cancer Research 56:5165-5171, 1996), which makes very attractive the use of this molecule as target for cancer therapy.
The filed patent EP 0972782 Al describes the murine monoclonal antibody produced by the hybridoma deposited according to the Budapest treaty under the access number ECACC 98101901. This monoclonal antibody has an IgGl isotype and was generated by the immunization of Balb/c mice with the NGcGM3 ganglioside hydrophobically conjugated with low density lipoproteins (VLDL) and in presence of Freund adjuvant, said antibody binds preferentially to the NGcGM3 ganglioside and recognizes an antigen expressed in human breast and melanoma tumors. (Carr A et. al, Hybridoma 19:3:241-247, 2000). This antibody showed a strong cytolitic activity on cells bearing said sequence a property that could make it a therapeutic tool.
Moreover it is known that the neovascularization induced by the tumors constitute one of the main parameters in the control of tumoral growth. This has direct research towards the search for new therapeutic weapons related with the inhibition of the antigenic process.
There are experimental evidences of the effect of the 14F7 antibody concerning this process. Said evidences have been found in matrix gel assay (Angiogenesis.
Vol. 4, Pags.
113-121, 2001; Anti-Cancer Res. Vol.18, Pags.783-790, 1998). Matrix gel is a mixture of proteins of the basal membrane and the extra cellular matrix that surrounds the endothelial cells. Its usefulness in the neovascularization process lies in the physiological importance of the endothelium-matrix interactions during the development of the new blood vessels.
Likewise components of this gel such as laminine are considered important markers of this process.
This model type has also been used in the study of the mechanisms related with tumor induced angiogenesis allowing to evaluate the pharmaceuticals capable of modulating the events directly related with the tumor thus influencing its growth and metastasis.
The use on non-human monoclonal antibodies such as the murine 14F7 has certain disadvantages for human treatment particularly in repetitive therapeutic schemes. For example the murine monoclonal antibodies have a relatively short blood half life.
Additionally they lose important immunological properties such as the effector functions when used in humans.
And what could be of greater importance, the murine monoclonal antibodies contain considerable amino acid sequences that are immunogenic when injected in humans.
Numerous studies have shown that after the administration of a foreign antibody the immune response produced in the patient can be considerably strong and substantially eliminate the therapeutic effect of the antibody after an initial treatment.
Moreover, even after administering treatment to a patient with a murine monoclonal antibody later treatments with non related murine antibodies could be ineffective and even dangerous due to the cross reactivity known as HAMA response (Khazaeli, M.B., et. al, Journal of Immunotherapy 15: 42-52, 1994).
Mateo et. al (US Patent No. US 5 712 120) describe a procedure for the reduction of immunogenicity of the murine antibodies. The antibody modified by the method described by Mateo et.al (Mateo C et. al, Hybridoma 19:6:463-471, 2000), retains the recognition and binding capacity to the antigen of the original antibody and results less immunogenic, which increases its therapeutic usefulness. Be this procedure one obtains, with a small number of mutations, modified antibodies that show a reduction of the immunogenicity when compared with the chimeric antibody.
From the above it is inferred the of obtaining versions of the therapeutic antibodies that are less immunogenic, obtained in a simple economic way and that result adequate for the manufacturing of therapeutic formulations for human use.
It is also known that the use of antibody fragments has been very useful in the immunodiagnosis of diseases. Ira Pastan among others (European patent filed EP
0796334 Al) describes the construction of Fv type single chain fragments using the variable regions of antibodies that speficifically recognize the carbohydrate related with the Lewis Y antigen. Based on said fragments the author develops a method for detecting cells bearing said antigen and also provides evidences of the inhibiting effect that these fragments have on the cells bearing the antigen.
The knowledge of the binding site of the 14F7 monoclonal antibody results interesting form the practical and theoretical point of view due to the potential of this antigen in the immunotherapy of diverse diseases. Souriau, C et. al in Expert Opin. Biol.
Ther. 1, 845-855, 2001 and Chester, K. A., et. al in Dis. Markers. 16, 53-62, 2000, show that the use of antibody fragments of the scFv type could result of great therapeutic use taking advantage of its pharmacological properties such as a better penetration in the tumoral tissue.
The construction of mini-libraries of antibody fragments exposed on philamentous phages from hybridomas allows the selection of molecules with the capacity of specific recognition of the antigen within this repertoire. The objective is obtaining rapidly antibody fragments that combine the recognition of the original antibody with a smaller molecular size and the capacity of being produced by bacteria host. This technique allows to outstand the multiple variants of antibody fragments that are non functional or impossible to be produced in bacterias that are obtained during the isolation and manipulation of the genes of the variable regions of a hybridoma by conventional clonation techniques (Roovers, R.
C. et. al, Br. J. Cancer. 78, 1407-1416, 1998).
The technology of antibody fragment presentation in filamentous phages offers a unique opportunity to access the biding site of the antibody as well as for introducing modifications in the antibody with the objective of improving its affinity (Chames, P. et. al, J. Immunol. 161, 5421-5429, 1998, Lamminmaki, U et. al, J. Mol. Biol. 291, 589-602, 1999, Parhami-Seren et. al, J. Immunol. Methods. 259, 43-53, 2002) or to modulate its specificity (Iba, Y. et. al, Prot. Engn., 11, 361-370,1998, Miyazaki, C. et.
al, Prot. Engn. 12, 407-415,1999, Darveau, R. P. et. al, J. Clin. Immunoassay. 15, 25-29, 1992).
The expression of antibody fragments in filamentous phages allows the exchange of chains (Lantto, J. et. al, Methods Mol. Biol. 178, 303-316, 2002), that is the combination of different VLs, with the original antibody VH or vice versa thus allowing to study the role that each one of the chains plays in the recognition of the antigen and its influence in the affinity of the antibody (Kabat, E. A., Wu, T. T., J. Immunol. 147, 1709-1719, 1991, Barbas III, C. F., Lerner, R. A. Methods: A companion to Methods in Enzymology 2, 119-124,1991). The exchange of chains allows modifying the properties of the binding site and also combining immunoglobulin sequences from different species and selecting those variants that conserve the recognition specificity (Klimka, A. et. al, Br. J.
Cancer. 83, 252-260, 2000, Steinberger, P. et. al, J. Biol. Chem. 275,36073-36078, 2000, Rader, C.
et. al, Proc. Natl. Acad. Sci. USA. 95,8910-8915, 1998, Beiboer, S. W. H. et.
al, J. Mol.
Biol. 296,833-849, 2000).
The present invention refers to a modified antibody derived from the murine monoclonal antibody which recognizes the original antigen with the same affinity and results less immunogenic when administered to patients. Another finding of the present invention has been obtaining fragments derived from said antibody that comprises variable regions of light chains different from the original but retaining its properties in relation to specificity, affinity and recognition and can be expressed by a bacteria host as soluble molecules as well as presented on the surface of filamentous phages.
The fragments derived from the 14F7 antibody are useful as therapeutic weapons.
Additionally the expression of scFv type fragments of the 14F7 antibody on the surface of a M13 filamentous phage allows manipulating the binding site and obtaining variants with higher affinity with therapeutic purposes.
One of the objectives of the present invention is the characterization of the antibody fragments that only conserve partially the sequence of the 14F7 but retain its specificity, affinity and recognition properties.
Both the modified antibody and the fragments obtained recognize specifically the tumor cells that express the NGcGM3 antigen thus allowing them to be used in the diagnosis or therapy of said tumors and have the advantage of resulting less immunogenic than the murine antibody from which they were originated.
New therapeutic compositions that comprise the modified 14F7 antibody or its Fv single chain fragments where said antibody or fragments may be bound to a radioactive isotope useful in localizing or treating tumors expressing the antigen are objects of the present invention.
It is also object of the present invention a method for the radioimmunodiagnosis or radio immunotherapy of tumors expressing the NGcGM3 ganglioside using the pharmaceutical compositions that comprise the modified 14F7 antibody or its fragments bound to a radioactive isotope.
Detailed description of the invention.
In the present invention is described the chimeric antibody derived- from the murine 14F7 monoclonal antibody produced by the hybridoma with deposit number ECACC
98101901, 5 characterized by the following sequences of the hyper variables regions (CDRs) of the heavy and light chains:
HEAVY CHAIN
CDR1: SYWIH
CDR2: YIDPATAYTESNQKFKD
CDR3: ESPRLRRGIYYYAMDY
LIGHT CHAIN
CDR1: RASQSISNNLH
CDR2: YASQSIS
CDR3: QQSNRWPLT
Preferentially said chimeric antibody is characterized by the following sequences of the framework regions (FRs) of the heavy and light chains:
HEAVY CHAIN
FR1: QVQLQQSGNELAKPGASMKMSCRASGYSFT
FR2: WLKQRPDQGLEWIG
FR3: KAILTADRSSNTAFMYLNSLTSEDSAVYYCAR
FR4: WGQGTTVTVSS
LIGHT CHAIN
FR1: DLVLTQSPATLSVTPGDSVSFSC
FR2: WYQQRTHESPRLLIK
FR3: GI PSRFSGSGSGTDFTLSIISVETEDFGMYFC
FR4: FGAGTKLELKRA
Moreover chimeric antibody is characterized by containing the constatn region of the IgG1 human heavy chain and the constant region of the Ck human light chain.
In a preferable presentation, the present invention referes to a modified antibody derived from the murine 14F7 monoclonal antibody produced by the hybridoma with deposit number ECACC 98101901, characterized because the frame regions of the heavy and light chains contain any of the following mutations:
HEAVY CHAIN:
Position 5: Q by V
Technical Field.
The present invention relates to the field of immunology and in particular with the obtaining less immunogenic immunoglobulins using genetic engineering technologic to use in the cancer treatment. The present invention is related specifically with the peptide sequences which codified a monoclonal antibody or fragments derived which recognize antigens containing the N-glycolil GM3 ganglioside and no other related gangliosides as N-glycolil or N-acetyl, and nor sulphates glycolipids Background of the invention.
The gangliosides are glycosphingolipids which contain sialic acid and they are present in plasmatic membranes of vertebrates (Stults CLM et. al, Methods Enzymology 179:167-214, 1989). Some of these molecules has been reported in the literature as tumour associated antigens or tumoral markers (Hakamori SH: Curr Opin Immunol 3:646-653, 1991), then It has been described the use of anti gangliosides antibodies in the diagnosis and therapeutic of cancer. (Hougton AN et. al, NAS USA 82:1242-1246, 1985;
Zhang S
et al. Int J Cancer 73:42-49, 1997). The more commonly sialic acids in mammalian cells are N-acetyl (NAc) and the N-glycolil (NGc) (Corfield AP et. al, Cell Biol Monogr 10:5-50, 1982). Generally the NGc is not expressed in human and chicken normal tissues but it is widely distributed in other vertebrates (Leeden RW et. al, Biological Role of Sialic Acid.
Rosemberg A and Shengtrund CL (Eds). Plenum Press, New York, 1-48, 1976, Kawai T
et. al, Cancer Research 51:1242-1246, 2001). However reports from the literature show that the anti-NGc antibodies recognize some human tumors and tumoral cell lines (Higashi H et. al, Jpn J. Cancer Res. 79:952-956, 1988, Fukui Y et. al, Biochem Biophys Res Commun 160:1149-1154, 1989). An increase in the GM3 (NGc) ganglioside level has been found in human breast cancer (Marquina G et. al, Cancer Research 56:5165-5171, 1996), which makes very attractive the use of this molecule as target for cancer therapy.
The filed patent EP 0972782 Al describes the murine monoclonal antibody produced by the hybridoma deposited according to the Budapest treaty under the access number ECACC 98101901. This monoclonal antibody has an IgGl isotype and was generated by the immunization of Balb/c mice with the NGcGM3 ganglioside hydrophobically conjugated with low density lipoproteins (VLDL) and in presence of Freund adjuvant, said antibody binds preferentially to the NGcGM3 ganglioside and recognizes an antigen expressed in human breast and melanoma tumors. (Carr A et. al, Hybridoma 19:3:241-247, 2000). This antibody showed a strong cytolitic activity on cells bearing said sequence a property that could make it a therapeutic tool.
Moreover it is known that the neovascularization induced by the tumors constitute one of the main parameters in the control of tumoral growth. This has direct research towards the search for new therapeutic weapons related with the inhibition of the antigenic process.
There are experimental evidences of the effect of the 14F7 antibody concerning this process. Said evidences have been found in matrix gel assay (Angiogenesis.
Vol. 4, Pags.
113-121, 2001; Anti-Cancer Res. Vol.18, Pags.783-790, 1998). Matrix gel is a mixture of proteins of the basal membrane and the extra cellular matrix that surrounds the endothelial cells. Its usefulness in the neovascularization process lies in the physiological importance of the endothelium-matrix interactions during the development of the new blood vessels.
Likewise components of this gel such as laminine are considered important markers of this process.
This model type has also been used in the study of the mechanisms related with tumor induced angiogenesis allowing to evaluate the pharmaceuticals capable of modulating the events directly related with the tumor thus influencing its growth and metastasis.
The use on non-human monoclonal antibodies such as the murine 14F7 has certain disadvantages for human treatment particularly in repetitive therapeutic schemes. For example the murine monoclonal antibodies have a relatively short blood half life.
Additionally they lose important immunological properties such as the effector functions when used in humans.
And what could be of greater importance, the murine monoclonal antibodies contain considerable amino acid sequences that are immunogenic when injected in humans.
Numerous studies have shown that after the administration of a foreign antibody the immune response produced in the patient can be considerably strong and substantially eliminate the therapeutic effect of the antibody after an initial treatment.
Moreover, even after administering treatment to a patient with a murine monoclonal antibody later treatments with non related murine antibodies could be ineffective and even dangerous due to the cross reactivity known as HAMA response (Khazaeli, M.B., et. al, Journal of Immunotherapy 15: 42-52, 1994).
Mateo et. al (US Patent No. US 5 712 120) describe a procedure for the reduction of immunogenicity of the murine antibodies. The antibody modified by the method described by Mateo et.al (Mateo C et. al, Hybridoma 19:6:463-471, 2000), retains the recognition and binding capacity to the antigen of the original antibody and results less immunogenic, which increases its therapeutic usefulness. Be this procedure one obtains, with a small number of mutations, modified antibodies that show a reduction of the immunogenicity when compared with the chimeric antibody.
From the above it is inferred the of obtaining versions of the therapeutic antibodies that are less immunogenic, obtained in a simple economic way and that result adequate for the manufacturing of therapeutic formulations for human use.
It is also known that the use of antibody fragments has been very useful in the immunodiagnosis of diseases. Ira Pastan among others (European patent filed EP
0796334 Al) describes the construction of Fv type single chain fragments using the variable regions of antibodies that speficifically recognize the carbohydrate related with the Lewis Y antigen. Based on said fragments the author develops a method for detecting cells bearing said antigen and also provides evidences of the inhibiting effect that these fragments have on the cells bearing the antigen.
The knowledge of the binding site of the 14F7 monoclonal antibody results interesting form the practical and theoretical point of view due to the potential of this antigen in the immunotherapy of diverse diseases. Souriau, C et. al in Expert Opin. Biol.
Ther. 1, 845-855, 2001 and Chester, K. A., et. al in Dis. Markers. 16, 53-62, 2000, show that the use of antibody fragments of the scFv type could result of great therapeutic use taking advantage of its pharmacological properties such as a better penetration in the tumoral tissue.
The construction of mini-libraries of antibody fragments exposed on philamentous phages from hybridomas allows the selection of molecules with the capacity of specific recognition of the antigen within this repertoire. The objective is obtaining rapidly antibody fragments that combine the recognition of the original antibody with a smaller molecular size and the capacity of being produced by bacteria host. This technique allows to outstand the multiple variants of antibody fragments that are non functional or impossible to be produced in bacterias that are obtained during the isolation and manipulation of the genes of the variable regions of a hybridoma by conventional clonation techniques (Roovers, R.
C. et. al, Br. J. Cancer. 78, 1407-1416, 1998).
The technology of antibody fragment presentation in filamentous phages offers a unique opportunity to access the biding site of the antibody as well as for introducing modifications in the antibody with the objective of improving its affinity (Chames, P. et. al, J. Immunol. 161, 5421-5429, 1998, Lamminmaki, U et. al, J. Mol. Biol. 291, 589-602, 1999, Parhami-Seren et. al, J. Immunol. Methods. 259, 43-53, 2002) or to modulate its specificity (Iba, Y. et. al, Prot. Engn., 11, 361-370,1998, Miyazaki, C. et.
al, Prot. Engn. 12, 407-415,1999, Darveau, R. P. et. al, J. Clin. Immunoassay. 15, 25-29, 1992).
The expression of antibody fragments in filamentous phages allows the exchange of chains (Lantto, J. et. al, Methods Mol. Biol. 178, 303-316, 2002), that is the combination of different VLs, with the original antibody VH or vice versa thus allowing to study the role that each one of the chains plays in the recognition of the antigen and its influence in the affinity of the antibody (Kabat, E. A., Wu, T. T., J. Immunol. 147, 1709-1719, 1991, Barbas III, C. F., Lerner, R. A. Methods: A companion to Methods in Enzymology 2, 119-124,1991). The exchange of chains allows modifying the properties of the binding site and also combining immunoglobulin sequences from different species and selecting those variants that conserve the recognition specificity (Klimka, A. et. al, Br. J.
Cancer. 83, 252-260, 2000, Steinberger, P. et. al, J. Biol. Chem. 275,36073-36078, 2000, Rader, C.
et. al, Proc. Natl. Acad. Sci. USA. 95,8910-8915, 1998, Beiboer, S. W. H. et.
al, J. Mol.
Biol. 296,833-849, 2000).
The present invention refers to a modified antibody derived from the murine monoclonal antibody which recognizes the original antigen with the same affinity and results less immunogenic when administered to patients. Another finding of the present invention has been obtaining fragments derived from said antibody that comprises variable regions of light chains different from the original but retaining its properties in relation to specificity, affinity and recognition and can be expressed by a bacteria host as soluble molecules as well as presented on the surface of filamentous phages.
The fragments derived from the 14F7 antibody are useful as therapeutic weapons.
Additionally the expression of scFv type fragments of the 14F7 antibody on the surface of a M13 filamentous phage allows manipulating the binding site and obtaining variants with higher affinity with therapeutic purposes.
One of the objectives of the present invention is the characterization of the antibody fragments that only conserve partially the sequence of the 14F7 but retain its specificity, affinity and recognition properties.
Both the modified antibody and the fragments obtained recognize specifically the tumor cells that express the NGcGM3 antigen thus allowing them to be used in the diagnosis or therapy of said tumors and have the advantage of resulting less immunogenic than the murine antibody from which they were originated.
New therapeutic compositions that comprise the modified 14F7 antibody or its Fv single chain fragments where said antibody or fragments may be bound to a radioactive isotope useful in localizing or treating tumors expressing the antigen are objects of the present invention.
It is also object of the present invention a method for the radioimmunodiagnosis or radio immunotherapy of tumors expressing the NGcGM3 ganglioside using the pharmaceutical compositions that comprise the modified 14F7 antibody or its fragments bound to a radioactive isotope.
Detailed description of the invention.
In the present invention is described the chimeric antibody derived- from the murine 14F7 monoclonal antibody produced by the hybridoma with deposit number ECACC
98101901, 5 characterized by the following sequences of the hyper variables regions (CDRs) of the heavy and light chains:
HEAVY CHAIN
CDR1: SYWIH
CDR2: YIDPATAYTESNQKFKD
CDR3: ESPRLRRGIYYYAMDY
LIGHT CHAIN
CDR1: RASQSISNNLH
CDR2: YASQSIS
CDR3: QQSNRWPLT
Preferentially said chimeric antibody is characterized by the following sequences of the framework regions (FRs) of the heavy and light chains:
HEAVY CHAIN
FR1: QVQLQQSGNELAKPGASMKMSCRASGYSFT
FR2: WLKQRPDQGLEWIG
FR3: KAILTADRSSNTAFMYLNSLTSEDSAVYYCAR
FR4: WGQGTTVTVSS
LIGHT CHAIN
FR1: DLVLTQSPATLSVTPGDSVSFSC
FR2: WYQQRTHESPRLLIK
FR3: GI PSRFSGSGSGTDFTLSIISVETEDFGMYFC
FR4: FGAGTKLELKRA
Moreover chimeric antibody is characterized by containing the constatn region of the IgG1 human heavy chain and the constant region of the Ck human light chain.
In a preferable presentation, the present invention referes to a modified antibody derived from the murine 14F7 monoclonal antibody produced by the hybridoma with deposit number ECACC 98101901, characterized because the frame regions of the heavy and light chains contain any of the following mutations:
HEAVY CHAIN:
Position 5: Q by V
Position 9: N by V
Position 11: L by V
Position 12: A by V
Position 18: M by V
Position 19: K by R
Position 20: M by V
Position 38: K by R
Position 40: R by A
Position 42: D by G
Position 48: I by V
LIGHT CHAIN:
Position 39: R by K
Position 40: T by P
Position 41: H by G
Position 42: E by Q
Position 58: I by V
Preferably, said modified antibody is characterized by containing the constant region of the IgG1 human heavy chain and the constant region of the Ck human light chain.
Another aspect of the present invention refers to the Fv single chain type fragments derived from the 14F7 antibody that comprise the sequence of the variable region of the heavy chain obtained from the hybridoma (deposit ECACC 98101901) and that conserves the recognition specificity of the 14F7 Preferably said Fv fragments include light chain variable regions derived from non immunized mice or human, different from the light chain variable region produced by the referred hybridoma that allow its production by a bacteria host as antibody fragments presented on filamentous phages or soluble molecules.
The present invention is also related with the cell lines that express the chimeric and humanized antibodies and the bacteria clones that produce the fragments derived from the 14F7.
Moreover the present invention is related with the pharmaceutical compositions for the treatment and/or localization and identification of the malignant breast and melanoma tumors their metastases and recurrences characterized by containing one of the recombinant monoclonal antibodies or its fragments of the present invention as well as an exipient appropriate for its application. Said antibody or fragment could be bound to a radioactive isotope useful in the localization and/or therapy of the malignant tumors.
Position 11: L by V
Position 12: A by V
Position 18: M by V
Position 19: K by R
Position 20: M by V
Position 38: K by R
Position 40: R by A
Position 42: D by G
Position 48: I by V
LIGHT CHAIN:
Position 39: R by K
Position 40: T by P
Position 41: H by G
Position 42: E by Q
Position 58: I by V
Preferably, said modified antibody is characterized by containing the constant region of the IgG1 human heavy chain and the constant region of the Ck human light chain.
Another aspect of the present invention refers to the Fv single chain type fragments derived from the 14F7 antibody that comprise the sequence of the variable region of the heavy chain obtained from the hybridoma (deposit ECACC 98101901) and that conserves the recognition specificity of the 14F7 Preferably said Fv fragments include light chain variable regions derived from non immunized mice or human, different from the light chain variable region produced by the referred hybridoma that allow its production by a bacteria host as antibody fragments presented on filamentous phages or soluble molecules.
The present invention is also related with the cell lines that express the chimeric and humanized antibodies and the bacteria clones that produce the fragments derived from the 14F7.
Moreover the present invention is related with the pharmaceutical compositions for the treatment and/or localization and identification of the malignant breast and melanoma tumors their metastases and recurrences characterized by containing one of the recombinant monoclonal antibodies or its fragments of the present invention as well as an exipient appropriate for its application. Said antibody or fragment could be bound to a radioactive isotope useful in the localization and/or therapy of the malignant tumors.
Finally the present invention is related with the use of the described recombinant antibodies for their in manufacturing a pharmaceutical composition useful in the treatment and/or localization and identification of malignant tumors.
The detailed description of how to execute and use the present invention is referred below:
1. ADNc synthesis and amplification by PCR (Polymerase Chain Reaction) of the variable regions of the 14F7 murine antibody.
The murine 14F7 antibody was obtained by immunizing Balb/c mice with the GM3 (NeuGc) ganglioside hydrophobically conjugated with low density lipoproteins and in presence of Freund adjuvant (EP 0972782 Al, Carr A et. al, Hybridoma 19:3:241-247, 2000). The RNA is obtained from 106 cells of the hybridoma producing the 14F7 monoclonal antibody (murine IgG1 Mab) that recognizes the NGcGM3 ganglioside using TM
the TRIZOL extraction method (GIBCO BRL, NY), according to the manufacturer's instructions.
The synthesis of the complementary DNA (DNAc) and the amplification of the VH
and VL
variable regions were performed using the set of reagents: Access RT-PCR
(Promega, USA) according to the manufacturer's recommendations. Briefly, the reaction is performed from 5 pg of RNA in presence of 25 pmoles of the dT olygonucleotide designed for hybridizing in the poly A tail the RNA and the corresponding olygonucleotides the extremes of each variable region: VH and VL. Incubate 10 minutes at 60 C and later add the mixture containing 0.2 mM of each deoxinucleotide (dNTPs), 1 mM MgSO4i 5 p of AMV-Reverse Transcriptase and 5 p of DNA Polymerase in reaction buffer for a total volume of 50 pL. The samples are incubated for 45 minutes at 48 C, 2 minutes at 94 C
and later submitted to 40 cycles of PCR with temperatures of 94 C (30 seconds), 60 C (1 minute), 68 C (2 minutes), and with a final incubation of 7 minutes at 68 C.
2. Contruction of chimeric genes and sequencing of the amplified DNAc.
The products of the PCR of the VH and VK are digested with the restriction enzymes Eco RV- Nhe I, for VH, and Eco RV-Sa/ I for VK, and cloned in the respective expression vectors (Coloma MJ et. al, J Immunol Methods 152:89-104, 1992). The VH region is cloned in the PAH4604 vector that has included a IgG1 human constant region and as selection marker the gen resistant to L-histidinol. The VK region is cloned in the vector PAG4622, which bears a gene of resistance to micophenolic acid and a constant human kappa region. The resulting genetic constructions were named 14F7VH-PAH4604 and 14F7VK-PAG4622, respectively.
The detailed description of how to execute and use the present invention is referred below:
1. ADNc synthesis and amplification by PCR (Polymerase Chain Reaction) of the variable regions of the 14F7 murine antibody.
The murine 14F7 antibody was obtained by immunizing Balb/c mice with the GM3 (NeuGc) ganglioside hydrophobically conjugated with low density lipoproteins and in presence of Freund adjuvant (EP 0972782 Al, Carr A et. al, Hybridoma 19:3:241-247, 2000). The RNA is obtained from 106 cells of the hybridoma producing the 14F7 monoclonal antibody (murine IgG1 Mab) that recognizes the NGcGM3 ganglioside using TM
the TRIZOL extraction method (GIBCO BRL, NY), according to the manufacturer's instructions.
The synthesis of the complementary DNA (DNAc) and the amplification of the VH
and VL
variable regions were performed using the set of reagents: Access RT-PCR
(Promega, USA) according to the manufacturer's recommendations. Briefly, the reaction is performed from 5 pg of RNA in presence of 25 pmoles of the dT olygonucleotide designed for hybridizing in the poly A tail the RNA and the corresponding olygonucleotides the extremes of each variable region: VH and VL. Incubate 10 minutes at 60 C and later add the mixture containing 0.2 mM of each deoxinucleotide (dNTPs), 1 mM MgSO4i 5 p of AMV-Reverse Transcriptase and 5 p of DNA Polymerase in reaction buffer for a total volume of 50 pL. The samples are incubated for 45 minutes at 48 C, 2 minutes at 94 C
and later submitted to 40 cycles of PCR with temperatures of 94 C (30 seconds), 60 C (1 minute), 68 C (2 minutes), and with a final incubation of 7 minutes at 68 C.
2. Contruction of chimeric genes and sequencing of the amplified DNAc.
The products of the PCR of the VH and VK are digested with the restriction enzymes Eco RV- Nhe I, for VH, and Eco RV-Sa/ I for VK, and cloned in the respective expression vectors (Coloma MJ et. al, J Immunol Methods 152:89-104, 1992). The VH region is cloned in the PAH4604 vector that has included a IgG1 human constant region and as selection marker the gen resistant to L-histidinol. The VK region is cloned in the vector PAG4622, which bears a gene of resistance to micophenolic acid and a constant human kappa region. The resulting genetic constructions were named 14F7VH-PAH4604 and 14F7VK-PAG4622, respectively.
Both constructions are sequenced by the dideoxinucleotide method (Sanger F et.
al, PNAS USA 74:5463-5470, 1979) using the sequence reagent kit T7 DNA Polymerase (Amershan-Pharmacia) according to the protocol described by the manufacturer.
3. Expression of the chimeric antibody.
NSO cells are electroporated with 10 pg of 14F7VH-PAH4604 and 10 pg of 14F7VK-PAG4622 linealized with the enzyme Pvu I. The DNAs are precipitated with ethanol, mixed and dissolved in 50 pL of PBS (Phospate buffer saline solution).
Approximately 107 cells are grown to semi confluence and are collected by centrifugation. The cells are later resuspended in 0.5 mL of PBS together with the DNA in an electroporation tray.
After 10 minutes in ice the cells are submitted to a pulse of 200 V and 960 F, and are kept in ice for 10 minutes. The cells are cultured in 96 wells plates in Modified Dulbecco (DMEM-F12) selective culture media, with 10% fetal calf serum (FCS) and 10 mM of L-hystidinol.
The transfected clones are made visible past 10 days of adding the selection media.
The production of chimeric immunoglobulin is determined by ELISA from the clones supernatant. For this the polystyrene plates (High binding, Costar) are coated with goat anti human IgG serum in carbonate bicarbonate buffer 100 mM, pH 9.8, all night at 4 C.
TM
The plates are then washed with PBS-Tween (Phosphate buffer saline solution, 0.5%
Tween-20, pH 7.5), and the culture supernatant samples diluted in PBS-Tween-FCS are added and incubated during one hour at 37 C. The plates are washed again in PBS-Tween and are then incubated in goat anti human kappa chain serum conjugated with peroxidase (Jackson), for one hour at 37 C. Later the plates are washed in the same manner and incubated with a citrate-phosphate buffer solution pH 4.2 that contains the substrate: o-fenilendiamine. After 15 minutes the absortion is measured at 492 nm.
The capacity of the chimeric antibody recognizing the antigen is verified by a competitive ELISA using the NGcGM3 and NacGM3 gangliosides. Briefly, the polyestirene plates (Polysorp, Nunc) are coated with 50 L of a solution at 4 g/mL of NGcGM3 or NAcGM3 in methanol and are incubated for one hour at 37 C. The plates are then blocked with 200 L of bovine seroalbumin solution (BSA) 1% in Tris-HCI buffer, pH 7.8-8.0 during one hour at 37 C. After 3 washes with PBS, the samples diluted in Tris-HCI-BSA 1 % are added in a concentration range between 2 g/ml- - 0.01 .ig/mL in presence of the the biotinilated murine 14F7 antibody 1 mg/mL, at 37 C during 2h. After the plates are washed with PBS
and the reaction is developed with a streptavidine-peroxidase conjugate (Jackson), at 37 C, 1 h. The absorbance is measured at 492 nm.
4. Construction of the humanized Ab 14F7hT by humanization of T epitopes.
Prediction of T epitopes.
al, PNAS USA 74:5463-5470, 1979) using the sequence reagent kit T7 DNA Polymerase (Amershan-Pharmacia) according to the protocol described by the manufacturer.
3. Expression of the chimeric antibody.
NSO cells are electroporated with 10 pg of 14F7VH-PAH4604 and 10 pg of 14F7VK-PAG4622 linealized with the enzyme Pvu I. The DNAs are precipitated with ethanol, mixed and dissolved in 50 pL of PBS (Phospate buffer saline solution).
Approximately 107 cells are grown to semi confluence and are collected by centrifugation. The cells are later resuspended in 0.5 mL of PBS together with the DNA in an electroporation tray.
After 10 minutes in ice the cells are submitted to a pulse of 200 V and 960 F, and are kept in ice for 10 minutes. The cells are cultured in 96 wells plates in Modified Dulbecco (DMEM-F12) selective culture media, with 10% fetal calf serum (FCS) and 10 mM of L-hystidinol.
The transfected clones are made visible past 10 days of adding the selection media.
The production of chimeric immunoglobulin is determined by ELISA from the clones supernatant. For this the polystyrene plates (High binding, Costar) are coated with goat anti human IgG serum in carbonate bicarbonate buffer 100 mM, pH 9.8, all night at 4 C.
TM
The plates are then washed with PBS-Tween (Phosphate buffer saline solution, 0.5%
Tween-20, pH 7.5), and the culture supernatant samples diluted in PBS-Tween-FCS are added and incubated during one hour at 37 C. The plates are washed again in PBS-Tween and are then incubated in goat anti human kappa chain serum conjugated with peroxidase (Jackson), for one hour at 37 C. Later the plates are washed in the same manner and incubated with a citrate-phosphate buffer solution pH 4.2 that contains the substrate: o-fenilendiamine. After 15 minutes the absortion is measured at 492 nm.
The capacity of the chimeric antibody recognizing the antigen is verified by a competitive ELISA using the NGcGM3 and NacGM3 gangliosides. Briefly, the polyestirene plates (Polysorp, Nunc) are coated with 50 L of a solution at 4 g/mL of NGcGM3 or NAcGM3 in methanol and are incubated for one hour at 37 C. The plates are then blocked with 200 L of bovine seroalbumin solution (BSA) 1% in Tris-HCI buffer, pH 7.8-8.0 during one hour at 37 C. After 3 washes with PBS, the samples diluted in Tris-HCI-BSA 1 % are added in a concentration range between 2 g/ml- - 0.01 .ig/mL in presence of the the biotinilated murine 14F7 antibody 1 mg/mL, at 37 C during 2h. After the plates are washed with PBS
and the reaction is developed with a streptavidine-peroxidase conjugate (Jackson), at 37 C, 1 h. The absorbance is measured at 492 nm.
4. Construction of the humanized Ab 14F7hT by humanization of T epitopes.
Prediction of T epitopes.
The sequences of the variable domains of the 14F7 are analyzed with the AMPHI
Program (Margalit H et. at, J Immunol 138: 2213-2229, 1987), which allows the identification of the segments of 7 or 11 amino acids with an anphypatic helix structure, which has been related with the T cell immunogenicity. These algorithms predict in this case the fragments related with the presentation of T epitopes in the variable regions of the heavy and light chains of the murine 14F7 monoclonal antibody.
- Analysis of homology with human immunoglobulins.
The amino acid sequences of the variable domains of the 14F7 are compared with the sequences of variable regions of reported human immunoglobulins to identify the human immunoglobulin that has the highest homology with the murine molecule being analyzed.
For this one can use the SWISSPROT data base available in Internet, through the BLAST
program (Altschul S F et. al, Nucleic Acids Res 25:3389-3402, 1997).
- Analysis for the reduction of immunogenicity.
The essence of the method lies in achieving the reduction of the immunogenicity by the rupture or humanization of the possible T epitopes, with a minimum of mutations in the FRs, specifically in those segments that have a amphipatic helix structure excluding those positions involved in the three-dimensional structure of the antigen recognition site.
According to the method the sequences of the variable regions VH and VL of the murine immunoglobulin are compared with the human one of highest homology and the residues that differ between the murine and the human sequence are identified only in the amphipatic regions that are within the region of the FRs (Kabat E, Sequences of proteins of immunological interest, Fifth Edition, National Institute of Health, 1991).
These "murine"
residues will be the ones susceptible of being muted by those that are found in the same position of the human sequence.
The residues present in the FRs positions responsible of the canonic structure, those present in the Vernier zone or the ones participating in the interaction of the VH-VL
interphase can not be mutated because it could affect the three-dimensional structure of the variable domain of the antibody and thus affect the binding to the antigen. Additional information about the influence of the substitutions proposed on the tertiary structure can be obtained by molecular modeling of the variable regions.
Since in the analysis of the mutations elements such as the presence of proline residues in the amphipatic helix or the fact that a certain murine residue does not appear in the same position in the most homologous human sequence but is frequent in other human immunoglobulins can be considered it is possible to obtain a version that contains a maximum of mutations, that is, where all the murine residues that differ from the human sequence are mutated but other versions can be obtained with different combinations of mutations.
After identifying on the murine sequence of the 14F7 the possible T epitopes and identifying within these segments the residues different from the human ones, the 5 substitutions are made by the conventional techniques of directed mutagenesis.
- Cloning and expression of the humanized 14F7hT antibody in the NSO cells.
Once the genetic constructions corresponding to the VH and VL regions of the 14F7hT
antibody are obtained by the method described before, they are cloned in the respective expression vectors similarly as describe above in the case of the chimeric antibody 10 construction, obtaining the following genetic constructions: 14F7hTVK-PAG4622 and 14F7hTVH-PAH4604. The transfections of these genes to the NSO cells is exactly under the same conditions described for the chimeric antibody. The clones producing the humanized antibody are also detected by ELISA.
The capacity of specific recognition of the antigen by the humanized antibody is verified by a competitive ELISA using the NGcGM3 and NAcGM3 gangliosides. The procedure is identical to the one described for the chimeric antibody 5. Construction of antibody fragments libraries on filamentous phages from the 14F7 hybridoma.
The messenger RNA is isolated from the cells of the 14F7 hybridoma, the complementary DNA is synthesized and the sequences corresponding to the variable regions of the heavy and light chains are separately amplified using two sets of oligonucleotides designed to hybridize with a wide spectrum of murine variable regions. The variable regions of each amplified heavy chain is purified, digested with the appropriate enzymes and linked to the phagemide pHG-1 m vector (designed for the presentation of single chain antibodies on the surface of filamentous phages), previously digested with the same enzyme.
The products of the binding reaction are purified and introduced by electroporation in bacterias of the TG1 E. coli strain. The transformed bacterias constitute a semi-library of heavy chain variable regions of limited diversity (all to them derived from the 14F7 hybridoma).
The DNA corresponding to this semi-library is purified and separately linked to collections of variable regions of the light chain (previously purified and digested with the appropriate enzymes). Finally they genetic constructions are introduced in bacterias of the TG1 strain by electroporation, to conform different types of independent libraries. One of them is a mini-library of limited diversity constructed with the variable regions of the light chain, also obtained from the cells of the 14F7 hybridoma. Libraries of chain exchange are also obtained in which the variable regions of the heavy chains from the hybridoma are combined with diverse collections of variable regions of light chains obtained from murine and human lymphocytes.
6. Isolation and characterization of the clones producing antibody fragments against N-glycolil GM3.
Colonies of each library are taken at random to produce phages from them using the auxilliar phage M13 K07. The recognition of N-glycolil GM3 for the phages bearing the antibody fragments is analyzed directly by an solid phase immunoenzymatic test (ELISA).
Thus the clones producing the functional fragments are localized. Phages bearing antibody fragments from the total mixture of transformed bacteria that forms each library are produced to obtain a preparation rich in functional antibody fragments and explore the diversity of the libraries. The phage mixture obtained is place in contact with the antigen N-glicolil GM3 bound to a solid surface, the phages bearing the antibody fragments with binding capacity are retained and the rest is eliminated by exhaustive washings. The bound phages are eluted by a pH change and are multiplied to obtain a new phage mixture that serves as starting material for a new selection cycle on the antigen. After various selection cycles the recognition of the antibody fragments presented on phages from colonies is analyzed. Thus the additional clones producing functional fragments diluted in the initial library are identified.
The characterization of the antibody fragments produced by the clones includes the analysis of the specificity by ELISA against a panel of related gangliosides, the study of the tumor recognition by immunohistochemistry, the evaluation of its capacity to be produced as soluble functional antibody fragments outside the context of their presentation in phages and the complete sequencing of their variable regions.
Examples:
In the following examples all the restriction enzymes or modification used as well as the reagents and materials were obtained from commercial source unless otherwise specified.
Example 1. Obtaining the 14F7 Chimeric Monoclonal Antibody.
The synthesis of the DNAc and the amplification by PCR of the VH and VK murine variable regions was performed with the Vent Polymerase enzyme using specific oligonucleotides with restriction sites Eco RV-Nhe I for VH, and Eco RV-Sa/ I
for VK. The switch oligonucleotides were the following:
For VH:
Oligonucleotide 1 (hybrid in the signal peptide):
5' ggg gatatc cacc atg gaa agg cac tgg atc ttt ctc ttc ctg 3' Olygonucleotide 2 (hybrid in JH1):
5' ggg gctagc tga gga gac ggt gac cgt ggt 3' For VK:
Olygonucleotide 1 (hybrid in the signal peptide):
5' ggg gatatc cacc atg gt(at) t(tc)c (ta)ca cct cag (at)t(ac) ctt gga ctt 3' Olygonucleotide 2 (hybrid in VLJ5):
5' agc gtcgac tta cgt ttc agc tcc agc ttg gtc cc 3' The products of the PCRs of VH and VK were digested with teh restriction enzymes Eco RV-Nhe I, for VH, and Eco RV-Sa/ I for VK, and cloned in their respective expression vectors, PAH4604 and PAG4622, for VH and VK respectively. These vectors are used for the expression of immunoglobulins in mammalian cells and were donated by Sherie Morrison (UCLA, California, USA). The vector PAH4604 has the human IgG1 constant region included and the PAG4622, a human constant kappa region (Coloma J et.
al, J
Immunol Methods 152:89-104, 1992). Once the VH and VK regions of the 14F7 have been cloned in the previous vectors, the constructions 14F7VH-PAH4604 and PAG4622 are formed.
Twelve independent clones were sequenced by the dideoxinucleotide method (Sanger F
et al, DNA sequencing with chain-terminating inhibitors. PNAS USA 1979;74:5463-5470) using the T7 DNA Polymerase sequencing kit (Amershan-Pharmacia) according to the protocol described by the manufacturer. The VH and VK sequences have a high relation with the IIB and V subgroups, respectively, (Figures 1 A and B) according to the Kabat classification (Kabat E, Sequences of proteins of inmunological interest, Fifth Edition, National Institute of Health, 1991).
NSO cells were electroporated with 10 pg of 14F7VH-PAH4604 and 10 pg of 14F7VK-PAG4622 linealized with the enzyme Pvu I. The DNAs were precipitated with ethanol, mixed and dissolved in 50 pL of PBS. Approximately 107 cells grown until semi confluence were collected by centrifugation and resuspended in 0.5 mL of PBS together with the DNA
in the electroporation tray. After 10 minutes in ice the cells were submitted to a pulse of 200 V and 960 F and incubated in ice for 10 minutes. The cells were cultured in 96 wells plates in Dulbecco Modified (DMEM-F12) selected media with 10% FCS and 10 mM
of L-hystidinol. The transfected clones are visualized 10 days after adding the selection media.
The production of chimeric immunoglobulin is determined by ELISA using the clones supernatants. For this the polyestirene plates (High binding, Costar) are coated with goat anti human IgG serum (Sigma) in carbonate bicarbonate buffer 100 mM, pH 9.8, all night at 4 C. The plates are then washed with PBS-Tween (Phosphate buffer saline solution, 0.5% Tween-20, pH 7.5), and the culture supernatant samples diluted in PBS-Tween-FCS
are added and incubated during one hour at 37 C. The plates are washed again in PBS-Tween and are then incubated in goat anti human kappa chain serum conjugated with peroxidase (Jackson), for one hour at 37 C. Later the plates are washed in the same manner and incubated with a citrate-phosphate buffer solution pH 4.2 that contains the substrate: o-fenilendiamine. After 15 minutes the absorption is measured at 492 nm.
Example 2. Reactivity of the 14F7Q antibody against the NGcGM3 and NAcGM3 antibodies.
The reactivity of the 14F7 chimeric antibody (Ab) was determined by a competitive ELISA.
Figure 2 shows the specificity of the chimeric 14F7 compared with the murine 14F7 in the recognition of polyesterine plates Polysorp, Nunc) coated with the GM3 N-glycolilated ganglioside. Both Abs show at similar concentration a 50 % inhibition of the recognition of the antigen by the murine biotinilated 14F7 Ab. While no immunoreactivity was observed when coating the plates with the N-acetylated variant of the GM3 for either of the antibodies. The murine C5 Mab was used as the irrelevant Ab.
Example 3. Obtaining different versions of the humanized antibody.
The 14F7 VH and VK sequences were compared with the human sequences data base obtaining the most homologous human sequence of the 14F7 antibody for the VH
and VK
regions (Fig 1A and B). Additionally in both sequences the amphipatic regions or potential T epitopes were determined. Later the mutations needed to convert the murine VH and VK sequences into human sequences were determined following the this method of humanization of T epitopes. We refer below the maximum possible mutations that can be performed.
In the case of the VH region mutations in the positions 5, 9, 11, 12, 18, 19, 20, 38, 40, 42 and 48 were introduced, where the amino acids Q, N, L, A, M, K, M, K, R, D and I were substituted for V, A, V, V, V, R, V, R, A, G and V, respectively. These mutations were performed by overlapping the PCR products (Kamman M et. al, Nucleic Acids Research 17:5404-5410, 1989), using the oligonucleotides 1 and 2, and the 3 and 4, in the first PCRs, and the results were overlapped in another PCR using oly the olygonucleotides 2 and 4. The sequences of the olygonucleotides used are shown below:
Olygonucleotides for the mutations 5, 9, 11 and 12, of the heavy chain:
Olygonucleotide 1: 5' gtc cag ctt gtg cag tct ggg get gaa gtg gta aaa cct ggg 3' Olygonucleotide 2: 5' ggg gctagc tga gga gac ggt gac cgt ggt 3' Olygonucleotide 3: 5' ccc agg ttt tac cac ttc agc ccc aga ctg cac aag ctg gac 3' Olygonucleotide 4: 5' ggg gatatc cacc atg gaa agg cac tgg atc ttt ctc ttc ctg 3' Once the previous mutations are sequenced and verified, mutations in the 18, 19 and 20 positions were introduced in the DNAs that carried them, substituting the amino acids M, K, M for V, R, V, respectively.
Program (Margalit H et. at, J Immunol 138: 2213-2229, 1987), which allows the identification of the segments of 7 or 11 amino acids with an anphypatic helix structure, which has been related with the T cell immunogenicity. These algorithms predict in this case the fragments related with the presentation of T epitopes in the variable regions of the heavy and light chains of the murine 14F7 monoclonal antibody.
- Analysis of homology with human immunoglobulins.
The amino acid sequences of the variable domains of the 14F7 are compared with the sequences of variable regions of reported human immunoglobulins to identify the human immunoglobulin that has the highest homology with the murine molecule being analyzed.
For this one can use the SWISSPROT data base available in Internet, through the BLAST
program (Altschul S F et. al, Nucleic Acids Res 25:3389-3402, 1997).
- Analysis for the reduction of immunogenicity.
The essence of the method lies in achieving the reduction of the immunogenicity by the rupture or humanization of the possible T epitopes, with a minimum of mutations in the FRs, specifically in those segments that have a amphipatic helix structure excluding those positions involved in the three-dimensional structure of the antigen recognition site.
According to the method the sequences of the variable regions VH and VL of the murine immunoglobulin are compared with the human one of highest homology and the residues that differ between the murine and the human sequence are identified only in the amphipatic regions that are within the region of the FRs (Kabat E, Sequences of proteins of immunological interest, Fifth Edition, National Institute of Health, 1991).
These "murine"
residues will be the ones susceptible of being muted by those that are found in the same position of the human sequence.
The residues present in the FRs positions responsible of the canonic structure, those present in the Vernier zone or the ones participating in the interaction of the VH-VL
interphase can not be mutated because it could affect the three-dimensional structure of the variable domain of the antibody and thus affect the binding to the antigen. Additional information about the influence of the substitutions proposed on the tertiary structure can be obtained by molecular modeling of the variable regions.
Since in the analysis of the mutations elements such as the presence of proline residues in the amphipatic helix or the fact that a certain murine residue does not appear in the same position in the most homologous human sequence but is frequent in other human immunoglobulins can be considered it is possible to obtain a version that contains a maximum of mutations, that is, where all the murine residues that differ from the human sequence are mutated but other versions can be obtained with different combinations of mutations.
After identifying on the murine sequence of the 14F7 the possible T epitopes and identifying within these segments the residues different from the human ones, the 5 substitutions are made by the conventional techniques of directed mutagenesis.
- Cloning and expression of the humanized 14F7hT antibody in the NSO cells.
Once the genetic constructions corresponding to the VH and VL regions of the 14F7hT
antibody are obtained by the method described before, they are cloned in the respective expression vectors similarly as describe above in the case of the chimeric antibody 10 construction, obtaining the following genetic constructions: 14F7hTVK-PAG4622 and 14F7hTVH-PAH4604. The transfections of these genes to the NSO cells is exactly under the same conditions described for the chimeric antibody. The clones producing the humanized antibody are also detected by ELISA.
The capacity of specific recognition of the antigen by the humanized antibody is verified by a competitive ELISA using the NGcGM3 and NAcGM3 gangliosides. The procedure is identical to the one described for the chimeric antibody 5. Construction of antibody fragments libraries on filamentous phages from the 14F7 hybridoma.
The messenger RNA is isolated from the cells of the 14F7 hybridoma, the complementary DNA is synthesized and the sequences corresponding to the variable regions of the heavy and light chains are separately amplified using two sets of oligonucleotides designed to hybridize with a wide spectrum of murine variable regions. The variable regions of each amplified heavy chain is purified, digested with the appropriate enzymes and linked to the phagemide pHG-1 m vector (designed for the presentation of single chain antibodies on the surface of filamentous phages), previously digested with the same enzyme.
The products of the binding reaction are purified and introduced by electroporation in bacterias of the TG1 E. coli strain. The transformed bacterias constitute a semi-library of heavy chain variable regions of limited diversity (all to them derived from the 14F7 hybridoma).
The DNA corresponding to this semi-library is purified and separately linked to collections of variable regions of the light chain (previously purified and digested with the appropriate enzymes). Finally they genetic constructions are introduced in bacterias of the TG1 strain by electroporation, to conform different types of independent libraries. One of them is a mini-library of limited diversity constructed with the variable regions of the light chain, also obtained from the cells of the 14F7 hybridoma. Libraries of chain exchange are also obtained in which the variable regions of the heavy chains from the hybridoma are combined with diverse collections of variable regions of light chains obtained from murine and human lymphocytes.
6. Isolation and characterization of the clones producing antibody fragments against N-glycolil GM3.
Colonies of each library are taken at random to produce phages from them using the auxilliar phage M13 K07. The recognition of N-glycolil GM3 for the phages bearing the antibody fragments is analyzed directly by an solid phase immunoenzymatic test (ELISA).
Thus the clones producing the functional fragments are localized. Phages bearing antibody fragments from the total mixture of transformed bacteria that forms each library are produced to obtain a preparation rich in functional antibody fragments and explore the diversity of the libraries. The phage mixture obtained is place in contact with the antigen N-glicolil GM3 bound to a solid surface, the phages bearing the antibody fragments with binding capacity are retained and the rest is eliminated by exhaustive washings. The bound phages are eluted by a pH change and are multiplied to obtain a new phage mixture that serves as starting material for a new selection cycle on the antigen. After various selection cycles the recognition of the antibody fragments presented on phages from colonies is analyzed. Thus the additional clones producing functional fragments diluted in the initial library are identified.
The characterization of the antibody fragments produced by the clones includes the analysis of the specificity by ELISA against a panel of related gangliosides, the study of the tumor recognition by immunohistochemistry, the evaluation of its capacity to be produced as soluble functional antibody fragments outside the context of their presentation in phages and the complete sequencing of their variable regions.
Examples:
In the following examples all the restriction enzymes or modification used as well as the reagents and materials were obtained from commercial source unless otherwise specified.
Example 1. Obtaining the 14F7 Chimeric Monoclonal Antibody.
The synthesis of the DNAc and the amplification by PCR of the VH and VK murine variable regions was performed with the Vent Polymerase enzyme using specific oligonucleotides with restriction sites Eco RV-Nhe I for VH, and Eco RV-Sa/ I
for VK. The switch oligonucleotides were the following:
For VH:
Oligonucleotide 1 (hybrid in the signal peptide):
5' ggg gatatc cacc atg gaa agg cac tgg atc ttt ctc ttc ctg 3' Olygonucleotide 2 (hybrid in JH1):
5' ggg gctagc tga gga gac ggt gac cgt ggt 3' For VK:
Olygonucleotide 1 (hybrid in the signal peptide):
5' ggg gatatc cacc atg gt(at) t(tc)c (ta)ca cct cag (at)t(ac) ctt gga ctt 3' Olygonucleotide 2 (hybrid in VLJ5):
5' agc gtcgac tta cgt ttc agc tcc agc ttg gtc cc 3' The products of the PCRs of VH and VK were digested with teh restriction enzymes Eco RV-Nhe I, for VH, and Eco RV-Sa/ I for VK, and cloned in their respective expression vectors, PAH4604 and PAG4622, for VH and VK respectively. These vectors are used for the expression of immunoglobulins in mammalian cells and were donated by Sherie Morrison (UCLA, California, USA). The vector PAH4604 has the human IgG1 constant region included and the PAG4622, a human constant kappa region (Coloma J et.
al, J
Immunol Methods 152:89-104, 1992). Once the VH and VK regions of the 14F7 have been cloned in the previous vectors, the constructions 14F7VH-PAH4604 and PAG4622 are formed.
Twelve independent clones were sequenced by the dideoxinucleotide method (Sanger F
et al, DNA sequencing with chain-terminating inhibitors. PNAS USA 1979;74:5463-5470) using the T7 DNA Polymerase sequencing kit (Amershan-Pharmacia) according to the protocol described by the manufacturer. The VH and VK sequences have a high relation with the IIB and V subgroups, respectively, (Figures 1 A and B) according to the Kabat classification (Kabat E, Sequences of proteins of inmunological interest, Fifth Edition, National Institute of Health, 1991).
NSO cells were electroporated with 10 pg of 14F7VH-PAH4604 and 10 pg of 14F7VK-PAG4622 linealized with the enzyme Pvu I. The DNAs were precipitated with ethanol, mixed and dissolved in 50 pL of PBS. Approximately 107 cells grown until semi confluence were collected by centrifugation and resuspended in 0.5 mL of PBS together with the DNA
in the electroporation tray. After 10 minutes in ice the cells were submitted to a pulse of 200 V and 960 F and incubated in ice for 10 minutes. The cells were cultured in 96 wells plates in Dulbecco Modified (DMEM-F12) selected media with 10% FCS and 10 mM
of L-hystidinol. The transfected clones are visualized 10 days after adding the selection media.
The production of chimeric immunoglobulin is determined by ELISA using the clones supernatants. For this the polyestirene plates (High binding, Costar) are coated with goat anti human IgG serum (Sigma) in carbonate bicarbonate buffer 100 mM, pH 9.8, all night at 4 C. The plates are then washed with PBS-Tween (Phosphate buffer saline solution, 0.5% Tween-20, pH 7.5), and the culture supernatant samples diluted in PBS-Tween-FCS
are added and incubated during one hour at 37 C. The plates are washed again in PBS-Tween and are then incubated in goat anti human kappa chain serum conjugated with peroxidase (Jackson), for one hour at 37 C. Later the plates are washed in the same manner and incubated with a citrate-phosphate buffer solution pH 4.2 that contains the substrate: o-fenilendiamine. After 15 minutes the absorption is measured at 492 nm.
Example 2. Reactivity of the 14F7Q antibody against the NGcGM3 and NAcGM3 antibodies.
The reactivity of the 14F7 chimeric antibody (Ab) was determined by a competitive ELISA.
Figure 2 shows the specificity of the chimeric 14F7 compared with the murine 14F7 in the recognition of polyesterine plates Polysorp, Nunc) coated with the GM3 N-glycolilated ganglioside. Both Abs show at similar concentration a 50 % inhibition of the recognition of the antigen by the murine biotinilated 14F7 Ab. While no immunoreactivity was observed when coating the plates with the N-acetylated variant of the GM3 for either of the antibodies. The murine C5 Mab was used as the irrelevant Ab.
Example 3. Obtaining different versions of the humanized antibody.
The 14F7 VH and VK sequences were compared with the human sequences data base obtaining the most homologous human sequence of the 14F7 antibody for the VH
and VK
regions (Fig 1A and B). Additionally in both sequences the amphipatic regions or potential T epitopes were determined. Later the mutations needed to convert the murine VH and VK sequences into human sequences were determined following the this method of humanization of T epitopes. We refer below the maximum possible mutations that can be performed.
In the case of the VH region mutations in the positions 5, 9, 11, 12, 18, 19, 20, 38, 40, 42 and 48 were introduced, where the amino acids Q, N, L, A, M, K, M, K, R, D and I were substituted for V, A, V, V, V, R, V, R, A, G and V, respectively. These mutations were performed by overlapping the PCR products (Kamman M et. al, Nucleic Acids Research 17:5404-5410, 1989), using the oligonucleotides 1 and 2, and the 3 and 4, in the first PCRs, and the results were overlapped in another PCR using oly the olygonucleotides 2 and 4. The sequences of the olygonucleotides used are shown below:
Olygonucleotides for the mutations 5, 9, 11 and 12, of the heavy chain:
Olygonucleotide 1: 5' gtc cag ctt gtg cag tct ggg get gaa gtg gta aaa cct ggg 3' Olygonucleotide 2: 5' ggg gctagc tga gga gac ggt gac cgt ggt 3' Olygonucleotide 3: 5' ccc agg ttt tac cac ttc agc ccc aga ctg cac aag ctg gac 3' Olygonucleotide 4: 5' ggg gatatc cacc atg gaa agg cac tgg atc ttt ctc ttc ctg 3' Once the previous mutations are sequenced and verified, mutations in the 18, 19 and 20 positions were introduced in the DNAs that carried them, substituting the amino acids M, K, M for V, R, V, respectively.
Below are shown the olygonucleotides 1 and 2, and los 3 and 4, described for said mutations. The overlapping of the PCRs products was performed as described before.
Olygonucleotide for the mutations 18, 19 and 20 of the heavy chain:
Olygonucleotide 1: 5' ggg gcc tca gtg agg gtg tcc tgc agg 3' Olygonucleotide 2: 5' ggg gctagc tga gga gac ggt gac cgt ggt 3' Olygonucleotide 3: 5' cct gca gga cac cct cac tga ggc ccc 3' Olygonucleotide 4: 5' ggg gatatc cacc atg gaa agg cac tgg atc ttt ctc ttc ctg 3' Likewise once the previous mutations are sequenced and verified, mutations R, A, G were introduced in the positions 38, 40 and 42 in the DNAs that carried them, substituting the amino acids K, R, D, respectively.
Below are shown the olygonucleotides 1 and 2, and 3 and 4, described for these mutations. The overlapping of the PCRs products was performed as described before.
Olygonucleotides for the mutations 38, 40 and 42 of the heavy chain:
Olygonucleotide 1: 5' cac tgg tta aga cag gca cct ggc cag ggt ctg 3' Olygonucleotide 2: 5' ggg gctagc tga gga gac ggt gac cgt ggt 3' Olygonucleotide 3: 5' cag acc ctg gcc agg tgc ctg tct taa cca gtg 3' Olygonucleotide 4: 5' ggg gatatc cacc atg gaa agg cac tgg atc ttt ctc ttc ctg 3' Finally after verifying by sequence the prior mutations, a mutation in position 48 was introduced in the DNAs bearing them substituting the amino acid I for V. Below are shown the olygonucleotides 1 and 2, and 3 and 4, used in this mutation. The overlapping of the PCRs products was performed as described before.
Olygonucleotides for the mutation 48 of the heavy chain:
Olygonucleotide 1: 5' ctg gaa tgg gtt gga tac aft 3' Olygonucleotide 2: 5' ggg gctagc tga gga gac ggt gac cgt ggt 3' Olygonucleotide 3: 5' aat gta tcc aac cca ftc cag 3' Olygonucleotide 4: 5' ggg gatatc cacc atg gaa agg cac tgg atc ttt ctc ttc ctg 3' All these mutations were verified by sequence. The genetic construction obtained was denominated 14F7hTVH.
In the case of the heavy chain there are different amino acids between the VH14F7 and the most similar human one that were not performed because these substitutions involved amino acids of the Vernier zone or are key positions in the antigen recognition.
For the light chain mutations in positions 39, 40, 41, 42 and 58 were performed, substituting R, T, H, E, I, for K, P, G, Q, and V respectively. The mutations were introduced in the same way as in the heavy chain. Below the olygonucleotide sequences used are described.
Olygonucleotides for the mutations 39, 40, 41, and 42 of the light chain.
Olygonucleotide 1: 5' tat caa caa aaa cca ggt cag tct cca agg 3' Olygonucleotide 2: 5' agc gtcgac tta cgt ttc agc tcc agc ttg gtc cc 3' Olygonucleotide 3: 5' cct tgg aga ctg acc tgg ttt ttg ttg ata 3' Olygonucleotide 4: 5' ggg gatatc cacc atg gt(at) t(tc)c (ta)ca cct cag (at)t(ac) ctt gga ctt 5 3' After verifying by sequence the previous mutations a mutation in position 58 was introduced in the DNAs bearing them substituting the amino acid I for V. Below are shown the olygonucleotides 1 and 2, and 3 and 4, used in this mutation. The overlapping of the PCRs products was performed as described before.
10 Olygonucleotides for mutation 58 of the light chain:
Olygonucleotide 1: 5' all tct ggg gtc ccc tcc agg 3' Olygonucleotide 2: 5' agc gtcgac tta cgt ttc agc tcc agc ttg gtc cc 3' Olygonucleotide 3: 5' cct gga ggg gac ccc aga aat 3' Olygonucleotide 4: 5' ggg gatatc cacc atg gt(at) t(tc)c (ta)ca cct cag (at)t(ac) ctt gga ctt 3' 15 Once the mutation was performed it was verified by sequence.
The resulting genetic construction was denominated 14F7hTVK.
The VK and VH humanized regions were cloned in the vectors PAG4622 and PAH4604, forming the constructions 14F7hTVH-PAH4604 and 14F7hTVK-PAG4622, respectively.
NSO cells were electroporated with 10 pg of each vector that carried the humanized variable regions 14F7hTVH-PAH4604 and 14F7hTVK-PAG4622, previously linealized by digestion with Pvu I. The electroporation process and detection of the clones that express the 14F7hT humanized antibody was identical to the one described for the chimeric antibody.
Example 4: Effect of the 14F7 Ab on the tumor growth decrease in the in vivo angiogenesis model The melanoma B16 tumor cell line mixed with matrix gel as angiogenesis inductor was used as model for in vivo angiogenesis With the subcutaneous implantation of the tumor line (B16) with matrix gel in the middle ventral line of C57/BL6 male mice, the induction of the tumoral angiogenesis processes was measured. For this the melanoma B16 cell were mixed with 0.5 mL of matrix gel and 64 units/mL of heparin, alone, in the control group, or in combination with other antibodies, to be administered by subcutaneous injection in the abdominal region of the animals.
Fifteen days after inoculation the animals were sacrificed and gel pearls were extracted along with the residues of dermis and epidermis and the size of the tumor is examined macroscopically. Figure 3 shows how the size of the tumor mass of the tumors of the mice treated with 14F7 decreased drastically.
Olygonucleotide for the mutations 18, 19 and 20 of the heavy chain:
Olygonucleotide 1: 5' ggg gcc tca gtg agg gtg tcc tgc agg 3' Olygonucleotide 2: 5' ggg gctagc tga gga gac ggt gac cgt ggt 3' Olygonucleotide 3: 5' cct gca gga cac cct cac tga ggc ccc 3' Olygonucleotide 4: 5' ggg gatatc cacc atg gaa agg cac tgg atc ttt ctc ttc ctg 3' Likewise once the previous mutations are sequenced and verified, mutations R, A, G were introduced in the positions 38, 40 and 42 in the DNAs that carried them, substituting the amino acids K, R, D, respectively.
Below are shown the olygonucleotides 1 and 2, and 3 and 4, described for these mutations. The overlapping of the PCRs products was performed as described before.
Olygonucleotides for the mutations 38, 40 and 42 of the heavy chain:
Olygonucleotide 1: 5' cac tgg tta aga cag gca cct ggc cag ggt ctg 3' Olygonucleotide 2: 5' ggg gctagc tga gga gac ggt gac cgt ggt 3' Olygonucleotide 3: 5' cag acc ctg gcc agg tgc ctg tct taa cca gtg 3' Olygonucleotide 4: 5' ggg gatatc cacc atg gaa agg cac tgg atc ttt ctc ttc ctg 3' Finally after verifying by sequence the prior mutations, a mutation in position 48 was introduced in the DNAs bearing them substituting the amino acid I for V. Below are shown the olygonucleotides 1 and 2, and 3 and 4, used in this mutation. The overlapping of the PCRs products was performed as described before.
Olygonucleotides for the mutation 48 of the heavy chain:
Olygonucleotide 1: 5' ctg gaa tgg gtt gga tac aft 3' Olygonucleotide 2: 5' ggg gctagc tga gga gac ggt gac cgt ggt 3' Olygonucleotide 3: 5' aat gta tcc aac cca ftc cag 3' Olygonucleotide 4: 5' ggg gatatc cacc atg gaa agg cac tgg atc ttt ctc ttc ctg 3' All these mutations were verified by sequence. The genetic construction obtained was denominated 14F7hTVH.
In the case of the heavy chain there are different amino acids between the VH14F7 and the most similar human one that were not performed because these substitutions involved amino acids of the Vernier zone or are key positions in the antigen recognition.
For the light chain mutations in positions 39, 40, 41, 42 and 58 were performed, substituting R, T, H, E, I, for K, P, G, Q, and V respectively. The mutations were introduced in the same way as in the heavy chain. Below the olygonucleotide sequences used are described.
Olygonucleotides for the mutations 39, 40, 41, and 42 of the light chain.
Olygonucleotide 1: 5' tat caa caa aaa cca ggt cag tct cca agg 3' Olygonucleotide 2: 5' agc gtcgac tta cgt ttc agc tcc agc ttg gtc cc 3' Olygonucleotide 3: 5' cct tgg aga ctg acc tgg ttt ttg ttg ata 3' Olygonucleotide 4: 5' ggg gatatc cacc atg gt(at) t(tc)c (ta)ca cct cag (at)t(ac) ctt gga ctt 5 3' After verifying by sequence the previous mutations a mutation in position 58 was introduced in the DNAs bearing them substituting the amino acid I for V. Below are shown the olygonucleotides 1 and 2, and 3 and 4, used in this mutation. The overlapping of the PCRs products was performed as described before.
10 Olygonucleotides for mutation 58 of the light chain:
Olygonucleotide 1: 5' all tct ggg gtc ccc tcc agg 3' Olygonucleotide 2: 5' agc gtcgac tta cgt ttc agc tcc agc ttg gtc cc 3' Olygonucleotide 3: 5' cct gga ggg gac ccc aga aat 3' Olygonucleotide 4: 5' ggg gatatc cacc atg gt(at) t(tc)c (ta)ca cct cag (at)t(ac) ctt gga ctt 3' 15 Once the mutation was performed it was verified by sequence.
The resulting genetic construction was denominated 14F7hTVK.
The VK and VH humanized regions were cloned in the vectors PAG4622 and PAH4604, forming the constructions 14F7hTVH-PAH4604 and 14F7hTVK-PAG4622, respectively.
NSO cells were electroporated with 10 pg of each vector that carried the humanized variable regions 14F7hTVH-PAH4604 and 14F7hTVK-PAG4622, previously linealized by digestion with Pvu I. The electroporation process and detection of the clones that express the 14F7hT humanized antibody was identical to the one described for the chimeric antibody.
Example 4: Effect of the 14F7 Ab on the tumor growth decrease in the in vivo angiogenesis model The melanoma B16 tumor cell line mixed with matrix gel as angiogenesis inductor was used as model for in vivo angiogenesis With the subcutaneous implantation of the tumor line (B16) with matrix gel in the middle ventral line of C57/BL6 male mice, the induction of the tumoral angiogenesis processes was measured. For this the melanoma B16 cell were mixed with 0.5 mL of matrix gel and 64 units/mL of heparin, alone, in the control group, or in combination with other antibodies, to be administered by subcutaneous injection in the abdominal region of the animals.
Fifteen days after inoculation the animals were sacrificed and gel pearls were extracted along with the residues of dermis and epidermis and the size of the tumor is examined macroscopically. Figure 3 shows how the size of the tumor mass of the tumors of the mice treated with 14F7 decreased drastically.
To distinguish the neovessels a histopathological analysis is performed of the gels stained with hetamtoxilin/eosin and with immunostaining with an anti PECAM Mab (endothelial marker). Figure 4, A and B, a decrease in the number of blood vessels is observed in the tissue sections of the animals treated with 14F7, when compared to the tumor sections of untreated animals.
Example 5: Construction of antibody fragment libraries on filamentous phages from 14F7 hybridoma.
TM
The messenger RNA was isolated with TriPure Isolation Reagent (Boehringer Mannheim, Germany) from 5.0 x 106 14F7 hybridoma cells and the complementary DNA was synthesized with Pro-STAR First Strand RT-PCR reagent kit (Stratagene, USA).
The variable regions of the heavy and light chains derived from the hybridoma were amplified by 26 cycles of polymerase chain reaction in the following conditions: 50 seconds at 940 C, 1 minute at 55 C, 1 minute at 72 C. For this all the possible combinations of a kit of degenerated olygonucleotides were used (designed for hybridizing with a wide variaty of mice variable regions), which are shown in the following table:
Olygonucleotides used to amplify VH and VL. The degenerated positions appear in brackets in the sequence of the olygonucleotides. The sequences of the restriction sites are underlined.
5' VH Apa LI
5'... ttc tat tct cac agt aca cag (gc)ag gt(gt) cag ct(gt) ac(ag) cag tc(at) gga 3' 5'... ftc tat tct cac a t ca cag gc(ag) gt(ct) ca(ag) ctg cag cag ct(ct) ggg gc 3' 5'... ftc tat tct cac a -qt ca cag ga(ag) gtg aag ct(gt) (gc)t(gc) gag tct gg(ag) gga 3' 3' VH Sfi I
5'... ga acc agt act cca aac ctc1aaa age cgc aga gac agt gac cag agt ccc 3' 5'... ga acc agt act cca age ctgagogac cga gga gac ggt gac tga ggt tcc 3' 5'... ga acc agt act cca qqc ctg app qqc cga gga gac (gt)gt ga(gc) (ca) gt gga (gc)cc...3' 5'VL Sal I
5'...gta etc cap tcg acg aca ttg tg(ca) tg(at) t(ac)c agt etc c... 3' 5'... gta etc ca tg cg acg ata tcc aga tga c(ac)c a(ga)a ct(ac) c... 3' 5'... gta etc ca tg cq ac(cg) aaa ttg t(tg)c tca ccc agt etc c... 3' 3' VL Not I
5'...aag gaa aaa age qqc cqc ttt (tc)a(tg) (tc)tc cag ctt ggt... 3' 5'...aag gaa aaa age qqc cqc ttt (tg)a(tg) etc caa ctt gt(gt)... 3' The variable regions of the amplified heavy chains were purified and sequentially digested with the restriction enzymes Sfi I and ApaLl. The digestion products were purified and linked with the DNA of the phagomidium vector pHG-1m (Heber Biotec S.A., Cuba) (Figure 5). With the resulting genetic constructions bacterias of the TG1 of E.coli strain were transformed by electroporation. The group of transformed bacteria conformed a semi-library of heavy chains variable regions derived from the 14F7 hybridoma with a moderate size of 2.3 x 104 members. The plasmid DNA of the semi-library was purified and was sequentially digested with Not I and Sal I enzymes. This DNA was linked separetly with four collections of light chain variable regions previously digested with the same enzymes. Bacterias of the TG1 strain were transformed with these new genetic constructions and four independent libraries were obtained. One of them was a mini-library of limited diversity containing the varialbe regions both of the heavy and light chains derived from the 14F7 hybridoma with a size of 1.6 x 106 individuals.
The other three were chain exchange libraries that incorporated diverse collections of variable regions of light chains obtained previously from mice (kappa isotype) and humans (kappa and lambda isotypes) and their size were of 1.0 x 107, 1.4 x 106, and 1.2 x 106 members respectively.
Example 6: Isolation of clones producing antibody fragments against the N-glycolil GM3.
Phages carrying the antibody fragments from 92 clones taken at random of each library were produced, in microtitulation plate wells according to procedures described before (Marks, J. D. et. al, J. Mol. Biol. 222,581-597. 1991). Its specificity was evaluated in an ELISA on polyvinyl chloride plates (Costar, USA) coated with N-glycolil GM3 and N-acetyl GM3 at 1pg/ml. The bound phages were detected with an anti-M13 monoclonal antibody conjugated with peroxidase (Amersham, Sweden). In addition to the characterization of individual clones picked at random, the selection of the phages with capacity of binding to the N-glycolil GM3 from a mixture of phages produced by a group of bacterias that conform each library was performed. For this, phages were produced using the auxiliary phage M13 K07, they were purified by precipitation with polyethylenglicol according to the procedure referred and they were put in contact with the N-glycolil GM3 bound to a plastic surface (Inmuno tubes, Nunc, Denmark). The tubes were washed extensively and the phages eluted in presence of triethylamine 100 mmol/I. The elutate was neutralized and used to infect bacterias of the TG1 of E.coli strain. From the group of infected bacterias phages carrying the antibody were produced and purified again that were used as starting material for a new selection round in identical conditions to those described.
After four selection cycles 92 colonies of bacteria infected with the phages resulting from each library were taken at random and the recognition of the N-glycolil GM3 was performed in a similar form as described for the evaluation of the clones taken at random from the libraries.
Example 5: Construction of antibody fragment libraries on filamentous phages from 14F7 hybridoma.
TM
The messenger RNA was isolated with TriPure Isolation Reagent (Boehringer Mannheim, Germany) from 5.0 x 106 14F7 hybridoma cells and the complementary DNA was synthesized with Pro-STAR First Strand RT-PCR reagent kit (Stratagene, USA).
The variable regions of the heavy and light chains derived from the hybridoma were amplified by 26 cycles of polymerase chain reaction in the following conditions: 50 seconds at 940 C, 1 minute at 55 C, 1 minute at 72 C. For this all the possible combinations of a kit of degenerated olygonucleotides were used (designed for hybridizing with a wide variaty of mice variable regions), which are shown in the following table:
Olygonucleotides used to amplify VH and VL. The degenerated positions appear in brackets in the sequence of the olygonucleotides. The sequences of the restriction sites are underlined.
5' VH Apa LI
5'... ttc tat tct cac agt aca cag (gc)ag gt(gt) cag ct(gt) ac(ag) cag tc(at) gga 3' 5'... ftc tat tct cac a t ca cag gc(ag) gt(ct) ca(ag) ctg cag cag ct(ct) ggg gc 3' 5'... ftc tat tct cac a -qt ca cag ga(ag) gtg aag ct(gt) (gc)t(gc) gag tct gg(ag) gga 3' 3' VH Sfi I
5'... ga acc agt act cca aac ctc1aaa age cgc aga gac agt gac cag agt ccc 3' 5'... ga acc agt act cca age ctgagogac cga gga gac ggt gac tga ggt tcc 3' 5'... ga acc agt act cca qqc ctg app qqc cga gga gac (gt)gt ga(gc) (ca) gt gga (gc)cc...3' 5'VL Sal I
5'...gta etc cap tcg acg aca ttg tg(ca) tg(at) t(ac)c agt etc c... 3' 5'... gta etc ca tg cg acg ata tcc aga tga c(ac)c a(ga)a ct(ac) c... 3' 5'... gta etc ca tg cq ac(cg) aaa ttg t(tg)c tca ccc agt etc c... 3' 3' VL Not I
5'...aag gaa aaa age qqc cqc ttt (tc)a(tg) (tc)tc cag ctt ggt... 3' 5'...aag gaa aaa age qqc cqc ttt (tg)a(tg) etc caa ctt gt(gt)... 3' The variable regions of the amplified heavy chains were purified and sequentially digested with the restriction enzymes Sfi I and ApaLl. The digestion products were purified and linked with the DNA of the phagomidium vector pHG-1m (Heber Biotec S.A., Cuba) (Figure 5). With the resulting genetic constructions bacterias of the TG1 of E.coli strain were transformed by electroporation. The group of transformed bacteria conformed a semi-library of heavy chains variable regions derived from the 14F7 hybridoma with a moderate size of 2.3 x 104 members. The plasmid DNA of the semi-library was purified and was sequentially digested with Not I and Sal I enzymes. This DNA was linked separetly with four collections of light chain variable regions previously digested with the same enzymes. Bacterias of the TG1 strain were transformed with these new genetic constructions and four independent libraries were obtained. One of them was a mini-library of limited diversity containing the varialbe regions both of the heavy and light chains derived from the 14F7 hybridoma with a size of 1.6 x 106 individuals.
The other three were chain exchange libraries that incorporated diverse collections of variable regions of light chains obtained previously from mice (kappa isotype) and humans (kappa and lambda isotypes) and their size were of 1.0 x 107, 1.4 x 106, and 1.2 x 106 members respectively.
Example 6: Isolation of clones producing antibody fragments against the N-glycolil GM3.
Phages carrying the antibody fragments from 92 clones taken at random of each library were produced, in microtitulation plate wells according to procedures described before (Marks, J. D. et. al, J. Mol. Biol. 222,581-597. 1991). Its specificity was evaluated in an ELISA on polyvinyl chloride plates (Costar, USA) coated with N-glycolil GM3 and N-acetyl GM3 at 1pg/ml. The bound phages were detected with an anti-M13 monoclonal antibody conjugated with peroxidase (Amersham, Sweden). In addition to the characterization of individual clones picked at random, the selection of the phages with capacity of binding to the N-glycolil GM3 from a mixture of phages produced by a group of bacterias that conform each library was performed. For this, phages were produced using the auxiliary phage M13 K07, they were purified by precipitation with polyethylenglicol according to the procedure referred and they were put in contact with the N-glycolil GM3 bound to a plastic surface (Inmuno tubes, Nunc, Denmark). The tubes were washed extensively and the phages eluted in presence of triethylamine 100 mmol/I. The elutate was neutralized and used to infect bacterias of the TG1 of E.coli strain. From the group of infected bacterias phages carrying the antibody were produced and purified again that were used as starting material for a new selection round in identical conditions to those described.
After four selection cycles 92 colonies of bacteria infected with the phages resulting from each library were taken at random and the recognition of the N-glycolil GM3 was performed in a similar form as described for the evaluation of the clones taken at random from the libraries.
From the direct analysis of the clones of the libraries producing clones were isolated from phages carrying the antibody fragments that recognize the N-glycolil GM3, that were found in a variable frequency in the three chain exchange libraries. No positive clone was found in the mini-library formed exclusively by variable regions derived from the 14F7 hybridoma. After the selection cycles additional clones were isolated from the chain exchange libraries and none were found in the mini-library of the original sequences. The following table shows the quantity of clones producing antibody fragments that recognize the N-glycolil GM3 and the frequency that it represents of the total number of clones analyzed from each library. Only one clone produced phages that presented cross reactivity with the N-acetyl GM3.
Library Frequency of positive clones Frequency of positive clones (four (direct screening) selection cycles) ......
-__....._-.... - .............-......
Mini-library hybridoma 14F7 0/92 0/92 Exchange of light kappa 31/92 (33.70%) " 52/92 (56.52%) murine chains Exchange of light kappa 2/92 (2.17%) 8/92 (17.39%) human chains Exchange of light lambda 4/92 (4.35%) 12/92 (13.04%) human chains One clone with cross reactivity with the N-acetyl GM3.
Example 7. Characterization of the antibody fragments derived from the 14F7 that recognize the N-glycolil GM3 The variable regions of 11 antibody fragments were completely sequenced with an automatic sequencer ALF Express II (Pharmacia, Sweden), using olygonucleotides that hybridize in the regions of the pHG-1 m vector that flank the extremes 5' and 3' of the sequences that codify for the inserted antibody fragments. It was confirmed that the sequence of the variable region of all the heavy chains corresponds to the one reported for the 14F7, changes were only presented in the framework 1 and framework 4 regions, presumable introduced by the use of degenerated olygonucleotides in the PCR.
The reset of the sequences included the three CDRs had no variations. On the contrary, the sequences of the variable regions of the light chains of the 11 clones were all different from the one of the 14F7 and were grouped in 5 groups of different sequences, two of murine origin and one of human origin (kappa isotype) and two other of human origin but of lambda isotype. One clone representative of each sequence group was taken for its latter characterization.
The following table shows the differences between the variable regions of the light chains of the selected clones with respect to their original identity, their origin and isotype and the the classification in subgroups according to the Kabat classification.
VL Origin Isotype Identity with VL 14F7 Subgroup AcM 14F7 Murine kappa - V
ScFv 2Am Murine kappa 59.46% III
ScFv 3Fm Murine kappa 59.81% V
ScFv 7Bhk Human kappa 60.74%
ScFv 7Ahl Human lambda 35.45%
ScFv 8Bhl Human lambda 37.04% III
The differences between the variable regions of the light chains of the clones and the ones reported originally for the 14F7 antibody are localized along all the sequence including the three complementary determinant regions and are shown below (Figure 6).
Fri 14F7 Mab D L V L T Q S P A T L S V T P G D S V S F S C
2Am scFv . I . M F . . . . S . A . S L . QRATI
3Fm scFv . I Q M . . T . S S . . ASL . R. T I..
7Bhk scFv . I Q M. . T S S.. A S V.. R T I T
7AhI scFv QSVV . P. S A. G G. . Q. L T I.
8B hi scFv S S E L.. D.. V.. A L. Q T . R I I.
R A S Q S I S N N L H
S V S S. S Y S Y M.
D . . . Y . N
S F . N
T G T S S D V G G Y. H V S
Q G D S L R. Y Y A S
Fr 2 W Y Q Q R T H E S P R L L I K
K P G Q P. K. ...
K P D G T V K. . . V
KPGKA K. .. Y
HPGKA K. M. Y
KPGQA V. V. Y
Y A S Q S I S
. . N L E .
T . R L H .
A . . N L Q .
D V . KRP
G K N N R P.
5 Fr 3 G I P S R F S G S G S G T D F T L S I I A V E T E D F G M Y F C
V . A . . . . . . . . . . . . . N . H P . . E . . A A T . Y .
V . . . . . . . . . . . . Y S . T . S N L . Q . . I A T . . .
V . . . . . . R . . . . . . . . T . S S L Q P . . . A A . Y .
VH . .... KNTASTVSGLQA EAVY
D . .... S . . NTAS T . TGAQA . EAD V.
Q Q S N R W P L T F
H . R D V .
G . T L . P . .
G Y T T .
S S Y A G S N N . V.
NSRDSSGNHVV
Fr 4 G A G T K L E L K
Q . . . . . . .
G. . . V T V L
G . . . . T V L
The specificity of the binding confirmed by ELISA according to the method described by using as coating in addition to the N-glycolil GM3 and the N-acetyl GM3, a panel of related gangliosides that included various N-acetylated gangliosides and one N-glycolilated ganglioside. Figure 7 shows the recognition of the different antigens by the 5 clones producing characterized antibody fragments. Only the binding to the target antigen N-glycolil GM3 was detected.
The production of the soluble antibody fragments (outside the context of the phages) by the clones was induced in presence of isopropil-thiogalactopiranoside at 1 mmol/I. The supernatant were collected and the periplasmatic fractions were obtained according to the established procedures (de Haard, H. J.Biol. Chem. 274, 18218-18230, 1999).
Recognition activity of the N-glycolil GM3 was detected both in the culture supernatants as in the periplasmatic fractions through an ELISA on plates coated with said antigen similar to the one described but with the following modification. The bound antibody fragments were detected using the 1E10 monoclonal antibody (directed against the c-myc peptide fused in the genetic construction to the antibody fragments) at 10 pg/ml and an anti mice immunoglobulins conjugate (Sigma, USA). The antibody fragments were purified from the periplasmatic fractions in a single affinity chromatography to metallic ions using the matrix HIS-Select HC Nickel Affinity Gel (Sigma, USA) according to the manufacturer's instructions. Figure 8 shows the activity determined by ELISA
of the purified soluble fragments.
Brief description of the Figures.
Figure 1: Shows the amino acidic sequence of the variable regions VH (a) and VK (b) of the 14F7 Mab, and the respective most homologous human sequence. The CDRs are underlined and the amphypatic regions and potential T epitopes are shadowed.
The sequence resulting of the humanization of the variable regions with the mutations performed is also shown.
Figure 2: Recognition of the 14F7Q antibody measured by competitive ELISA.
Axis X: Expresses the antibodies concentrations.
Axis Y: Absorbance measured at 492 nm The for C5 monoclonal antibody was used as negative control.
Figure 3: Effect of the 14F7 monoclonal antibody on the growth of murine tumors (melanoma B16 tumor cell line).
Figure 4: A) Immunohistochemical study of the effect of the 14F7 monoclonal antibody on the formation of blood vessels. The arrows indicate the immunostained vessels.
B) Inhibition of angiogenesis induced by the 14F7 monoclonal antibody.
Figure 5: Diagram of the pHG-1 m vector.
Figure 6: Protein sequence of the VL regions of the 14F7 monoclonal antibody and the selected Fv single chain fragments. The points indicate homology with the sequence of the VL of the 14F7.
Figure 7: Recognition specificity by the phages carrying the antibody fragments. The inhibition of the binding of the 14F7 Ab to the ganglioside by the exposed fragments in the phages is observed. The plates are coated with N-glycolil GM3 and the phages were incubated with viral particles and varias concentrations of 14F7.
Figure B. Recognition of the N-glycolil GM3 by the soluble purified fragments.
SEQUENCE LISTING
<110> CENTRO DE INMUNOLOGIA MOLECULAR
CENTRO DE INMUNOLOGIA MOLECULAR
<120> Recombinant Antibodies and Fragments Recognizing Ganglioside N-Glycosyl-GM3 and Use Thereof in the Treatment of Tumours.
<130> CU 92/2003 <140> CU 92/2003 <141> 2003-04-23 <160> 58 <170> Patentln version 3.2 <210> 1 <211> 5 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1).. (5) <400> 1 Ser Tyr Trp Ile His <210> 2 <211> 17 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(17) <400> 2 Tyr Ile Asp Pro Ala Thr Ala Tyr Thr Glu Ser Asn Gln Lys Phe Lys Asp <210> 3 <211> 16 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1) .. (16) <400> 3 Glu Ser Pro Arg Leu Arg Arg Gly Ile Tyr Tyr Tyr Ala Met Asp Tyr <210> 4 <211> 11 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1) .. (11) <400> 4 Arg Ala Ser Gln Ser Ile Ser Asn Asn Leu His <210> 5 <211> 7 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(7) <400> 5 Tyr Ala Ser Gln Ser Ile Ser <210> 6 <211> 9 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(9) <400> 6 Gln Gln Ser Asn Arg Trp Pro Leu Thr <210> 7 <211> 30 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1) .. (30) <400> 7 Gln Val Gln Leu Gln Gln Ser Gly Asn Glu Leu Ala Lys Pro Gly Ala Ser Met Lys Met Ser Cys Arg Ala Ser Gly Tyr Ser Phe Thr <210> 8 <211> 14 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(14) <400> 8 Trp Leu Lys Gln Arg Pro Asp Gln Gly Leu Glu Trp Ile Gly <210> 9 <211> 32 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(32) <400> 9 Lys Ala Ile Leu Thr Ala Asp Arg Ser Ser Asn Thr Ala Phe Met Tyr Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys Ala Arg <210> 10 <211> 11 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(11) <400> 10 Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser <210> 11 <211> 23 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(23) <400> 11 Asp Leu Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Val Thr Pro Gly Asp Ser Val Ser Phe Ser Cys <210> 12 <211> 15 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(15) <400> 12 Trp Tyr Gln Gln Arg Thr His Glu Ser Pro Arg Leu Leu Ile Lys <210> 13 <211> 32 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(32) <400> 13 Gly Ile Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Ser Ile Ile Ser Val Glu Thr Glu Asp Phe Gly Met Tyr Phe Cys <210> 14 <211> 12 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1) (12) <400> 14 Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys Arg Ala <210> 15 <211> 43 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) .. (43) <400> 15 ggggatatcc accatggaaa ggcactggat ctttctcttc ctg 43 <210> 16 <211> 30 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(30) <400> 16 ggggctagct gaggagacgg tgaccgtggt 30 <210> 17 <211> 48 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(48) <220>
<221> prim - transcript <222> (1) . (43) <400> 17 ggggatatcc accatggtat ttcctacacc tcagattacc ttggactt 48 <210> 18 <211> 35 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1). (35) <400> 18 agcgtcgact tacgtttcag ctccagcttg gtccc 35 <210> 19 <211> 42 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(42) <400> 19 gtccagcttg tgcagtctgg ggctgaagtg gtaaaacctg gg 42 <210> 20 <211> 30 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) .. (30) <400> 20 ggggctagct gaggagacgg tgaccgtggt 30 <210> 21 <211> 42 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(42) <400> 21 cccaggtttt accacttcag ccccagactg cacaagctgg ac 42 <210> 22 <211> 43 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(43) <400> 22 ggggatatcc accatggaaa ggcactggat ctttctcttc ctg 43 <210> 23 <211> 27 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(27) <400> 23 ggggcctcag tgagggtgtc ctgcagg 27 <210> 24 <211> 30 <212> DNA
<213> Mus musculus .<220>
<221> prim - transcript <222> (1) .. (30) <400> 24 ggggctagct gaggagacgg tgaccgtggt 30 <210> 25 <211> 27 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(27) <400> 25 cctgcaggac accctcactg aggcccc 27 <210> 26 <211> 43 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(43) <400> 26 ggggatatcc accatggaaa ggcactggat ctttctcttc ctg 43 <210> 27 <211> 33 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(33) <400> 27 cactggttaa gacaggcacc tggccagggt ctg 33 <210> 28 <211> 30 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) .. (30) <400> 28 ggggctagct gaggagacgg tgaccgtggt 30 <210> 29 <211> 33 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(33) <400> 29 cagaccctgg ccaggtgcct gtcttaacca gtg 33 <210> 30 <211> 43 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(43) <400> 30 ggggatatcc accatggaaa ggcactggat ctttctcttc ctg 43 <210> 31 <211> 21 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(21) <400> 31 ctggaatggg ttggatacat t 21 <210> 32 <211> 30 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(30) <400> 32 ggggctagct gaggagacgg tgaccgtggt 30 <210> 33 <211> 21 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) .. (21) <400> 33 aatgtatcca acccattcca g 21 <210> 34 <211> 43 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) . (43) <400> 34 ggggatatcc accatggaaa ggcactggat ctttctcttc ctg 43 <210> 35 <211> 30 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1). (30) <400> 35 tatcaacaaa aaccaggtca gtctccaagg 30 <210> 36 <211> 35 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) .. (35) <400> 36 agcgtcgact tacgtttcag ctccagcttg gtccc 35 <210> 37 <211> 30 <212> DNA
<213> Mus musculus <220>
<221> prim transcript <222> (1) . (30) <400> 37 ccttggagac tgacctggtt tttgttgata 30 <210> 38 <211> 48 <212> DNA
<213> Mus musculus <220>
<221> lprim_transcript <222> (1) .. (48) <400> 38 ggggatatcc accatggtat ttcctacacc tcagattacc ttggactt 48 <210> 39 <211> 21 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1). (21) <400> 39 atttctgggg tcccctccag g 21 <210> 40 <211> 35 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1). (35) <400> 40 agcgtcgact tacgtttcag ctccagcttg gtccc 35 <210> 41 <211> 21 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(21) <400> 41 cctggagggg accccagaaa t 21 <210> 42 <211> 48 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) (48) <400> 42 ggggatatcc accatggtat ttcctacacc tcagattacc ttggactt 48 <210> 43 <211> 50 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(50) <400> 43 ttctattctc acagtgcaca ggcaggtgtc agctgtacag cagtcatgga 50 <210> 44 <211> 51 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) .. (51) <400> 44 ttctattctc acagtgcaca ggcaggtctc aagctgcagc agctctgggg c 51 <210> 45 <211> 53 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) . (53) <400> 45 ttctattctc acagtgcaca ggaaggtgaa gctgtgctgc gagtctggag gga 53 <210> 46 <211> 50 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) .. (50) <400> 46 gaaccagtac tccaggcctg aggggccgca gagacagtga ccagagtccc 50 <210> 47 <211> 50 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(50) <400> 47 gaaccagtac tccaggcctg aggggccgag gagacggtga ctgaggttcc 50 <210> 48 <211> 54 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) . (54) <400> 48 gaaccagtac tccaggcctg aggggccgag gagacgtgtg agccagtgga gccc 54 <210> 49 <211> 40 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) (40) <400> 49 gtactccagt cgacgacatt gtgcatgatt accagtctcc 40 <210> 50 <211> 40 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(40) <400> 50 gtactccagt cgacgatatc cagatgacac cagaactacc 40 <210> 51 <211> 39 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(39) <400> 51 gtactccagt cgaccgaaat tgttgctcac ccagtctcc 39 <210> 52 <211> 39 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(39) <400> 52 aaggaaaaaa gcggccgctt ttcatgtctc cagcttggt 39 <210> 53 <211> 39 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(39) <400> 53 aaggaaaaaa gcggccgctt ttgatgctcc aacttgtgt 39 <210> 54 <211> 111 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(111) <400> 54 Asp Ile Val Met Phe Gln Ser Pro Ala Ser Leu Ala Val Ser Leu Gly Gln Arg Ala Thr Ile Ser Cys Arg Ala Ser Gln Ser Val Ser Ser Ser Ser Tyr Ser Tyr Met His Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Ile Lys Tyr Ala Ser Asn Leu Glu Ser Gly Val Pro Ala Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Asn Ile His Pro Val Glu Glu Glu Asp Ala Ala Thr Tyr Tyr Cys Gln His Ser Arg Asp Val Pro Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu Ile Lys <210> 55 <211> 107 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(107) <400> 55 Asp Ile Gln Met Thr Gln Thr Pro Ser Ser Leu Ser Ala Ser Leu Gly Asp Arg Val Thr Ile Ser Cys Arg Ala Ser Gln Asp Ile Ser Asn Tyr Leu Asn Trp Tyr Gln Gln Lys Pro Asp Gly Thr Val Lys Leu Leu Ile Val Tyr Thr Ser Arg Leu His Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Tyr Ser Leu Thr Ile Ser Asn Leu Glu Gln Glu Asp Ile Ala Thr Tyr Phe Cys Gln Gln Gly Asn Thr Leu Pro Pro Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys <210> 56 <211> 107 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(107) <400> 56 Asp Ile Gln Met Thr Gln Thr Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Phe Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ala Ala Ser Asn Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly Arg Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Ala Tyr Tyr Cys Gln Gln Gly Tyr Thr Thr Pro Leu Thr Phe Gly Gln Gly Thr Lys Leu Glu Leu Lys <210> 57 <211> 111 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(111) <400> 57 Gln Ser Val Val Thr Gln Pro Pro Ser Thr Ala Ser Gly Gly Pro Gly Gln Ser Leu Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Gly Tyr Asn His Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu Met Ile Tyr Asp Val Ser Lys Arg Pro Ser Gly Val Pro His Arg Phe Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Val Ser Gly Leu Gln Ala Glu Asp Glu Ala Val Tyr Tyr Cys Ser Ser Tyr Ala Gly Ser Asn Asn Leu Val Phe Gly Gly Gly Thr Lys Val Thr Val Leu <210> 58 <211> 109 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(109) <400> 58 Ser Ser Glu Leu Thr Gln Asp Pro Ala Thr Val Ser Val Ala Leu Gly Gln Thr Val Arg Ile Thr Cys Gln Gly Asp Ser Leu Arg Ser Tyr Tyr Ala Ser Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Val Leu Val Ile Tyr Gly Lys Asn Asn Arg Pro Ser Gly Ile Pro Asp Arg Phe Ser Gly Ser Ser Ser Gly Asn Thr Ala Ser Leu Thr Ile Thr Gly Ala Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Asn Ser Arg Asp Ser Ser Gly Asn His Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu
Library Frequency of positive clones Frequency of positive clones (four (direct screening) selection cycles) ......
-__....._-.... - .............-......
Mini-library hybridoma 14F7 0/92 0/92 Exchange of light kappa 31/92 (33.70%) " 52/92 (56.52%) murine chains Exchange of light kappa 2/92 (2.17%) 8/92 (17.39%) human chains Exchange of light lambda 4/92 (4.35%) 12/92 (13.04%) human chains One clone with cross reactivity with the N-acetyl GM3.
Example 7. Characterization of the antibody fragments derived from the 14F7 that recognize the N-glycolil GM3 The variable regions of 11 antibody fragments were completely sequenced with an automatic sequencer ALF Express II (Pharmacia, Sweden), using olygonucleotides that hybridize in the regions of the pHG-1 m vector that flank the extremes 5' and 3' of the sequences that codify for the inserted antibody fragments. It was confirmed that the sequence of the variable region of all the heavy chains corresponds to the one reported for the 14F7, changes were only presented in the framework 1 and framework 4 regions, presumable introduced by the use of degenerated olygonucleotides in the PCR.
The reset of the sequences included the three CDRs had no variations. On the contrary, the sequences of the variable regions of the light chains of the 11 clones were all different from the one of the 14F7 and were grouped in 5 groups of different sequences, two of murine origin and one of human origin (kappa isotype) and two other of human origin but of lambda isotype. One clone representative of each sequence group was taken for its latter characterization.
The following table shows the differences between the variable regions of the light chains of the selected clones with respect to their original identity, their origin and isotype and the the classification in subgroups according to the Kabat classification.
VL Origin Isotype Identity with VL 14F7 Subgroup AcM 14F7 Murine kappa - V
ScFv 2Am Murine kappa 59.46% III
ScFv 3Fm Murine kappa 59.81% V
ScFv 7Bhk Human kappa 60.74%
ScFv 7Ahl Human lambda 35.45%
ScFv 8Bhl Human lambda 37.04% III
The differences between the variable regions of the light chains of the clones and the ones reported originally for the 14F7 antibody are localized along all the sequence including the three complementary determinant regions and are shown below (Figure 6).
Fri 14F7 Mab D L V L T Q S P A T L S V T P G D S V S F S C
2Am scFv . I . M F . . . . S . A . S L . QRATI
3Fm scFv . I Q M . . T . S S . . ASL . R. T I..
7Bhk scFv . I Q M. . T S S.. A S V.. R T I T
7AhI scFv QSVV . P. S A. G G. . Q. L T I.
8B hi scFv S S E L.. D.. V.. A L. Q T . R I I.
R A S Q S I S N N L H
S V S S. S Y S Y M.
D . . . Y . N
S F . N
T G T S S D V G G Y. H V S
Q G D S L R. Y Y A S
Fr 2 W Y Q Q R T H E S P R L L I K
K P G Q P. K. ...
K P D G T V K. . . V
KPGKA K. .. Y
HPGKA K. M. Y
KPGQA V. V. Y
Y A S Q S I S
. . N L E .
T . R L H .
A . . N L Q .
D V . KRP
G K N N R P.
5 Fr 3 G I P S R F S G S G S G T D F T L S I I A V E T E D F G M Y F C
V . A . . . . . . . . . . . . . N . H P . . E . . A A T . Y .
V . . . . . . . . . . . . Y S . T . S N L . Q . . I A T . . .
V . . . . . . R . . . . . . . . T . S S L Q P . . . A A . Y .
VH . .... KNTASTVSGLQA EAVY
D . .... S . . NTAS T . TGAQA . EAD V.
Q Q S N R W P L T F
H . R D V .
G . T L . P . .
G Y T T .
S S Y A G S N N . V.
NSRDSSGNHVV
Fr 4 G A G T K L E L K
Q . . . . . . .
G. . . V T V L
G . . . . T V L
The specificity of the binding confirmed by ELISA according to the method described by using as coating in addition to the N-glycolil GM3 and the N-acetyl GM3, a panel of related gangliosides that included various N-acetylated gangliosides and one N-glycolilated ganglioside. Figure 7 shows the recognition of the different antigens by the 5 clones producing characterized antibody fragments. Only the binding to the target antigen N-glycolil GM3 was detected.
The production of the soluble antibody fragments (outside the context of the phages) by the clones was induced in presence of isopropil-thiogalactopiranoside at 1 mmol/I. The supernatant were collected and the periplasmatic fractions were obtained according to the established procedures (de Haard, H. J.Biol. Chem. 274, 18218-18230, 1999).
Recognition activity of the N-glycolil GM3 was detected both in the culture supernatants as in the periplasmatic fractions through an ELISA on plates coated with said antigen similar to the one described but with the following modification. The bound antibody fragments were detected using the 1E10 monoclonal antibody (directed against the c-myc peptide fused in the genetic construction to the antibody fragments) at 10 pg/ml and an anti mice immunoglobulins conjugate (Sigma, USA). The antibody fragments were purified from the periplasmatic fractions in a single affinity chromatography to metallic ions using the matrix HIS-Select HC Nickel Affinity Gel (Sigma, USA) according to the manufacturer's instructions. Figure 8 shows the activity determined by ELISA
of the purified soluble fragments.
Brief description of the Figures.
Figure 1: Shows the amino acidic sequence of the variable regions VH (a) and VK (b) of the 14F7 Mab, and the respective most homologous human sequence. The CDRs are underlined and the amphypatic regions and potential T epitopes are shadowed.
The sequence resulting of the humanization of the variable regions with the mutations performed is also shown.
Figure 2: Recognition of the 14F7Q antibody measured by competitive ELISA.
Axis X: Expresses the antibodies concentrations.
Axis Y: Absorbance measured at 492 nm The for C5 monoclonal antibody was used as negative control.
Figure 3: Effect of the 14F7 monoclonal antibody on the growth of murine tumors (melanoma B16 tumor cell line).
Figure 4: A) Immunohistochemical study of the effect of the 14F7 monoclonal antibody on the formation of blood vessels. The arrows indicate the immunostained vessels.
B) Inhibition of angiogenesis induced by the 14F7 monoclonal antibody.
Figure 5: Diagram of the pHG-1 m vector.
Figure 6: Protein sequence of the VL regions of the 14F7 monoclonal antibody and the selected Fv single chain fragments. The points indicate homology with the sequence of the VL of the 14F7.
Figure 7: Recognition specificity by the phages carrying the antibody fragments. The inhibition of the binding of the 14F7 Ab to the ganglioside by the exposed fragments in the phages is observed. The plates are coated with N-glycolil GM3 and the phages were incubated with viral particles and varias concentrations of 14F7.
Figure B. Recognition of the N-glycolil GM3 by the soluble purified fragments.
SEQUENCE LISTING
<110> CENTRO DE INMUNOLOGIA MOLECULAR
CENTRO DE INMUNOLOGIA MOLECULAR
<120> Recombinant Antibodies and Fragments Recognizing Ganglioside N-Glycosyl-GM3 and Use Thereof in the Treatment of Tumours.
<130> CU 92/2003 <140> CU 92/2003 <141> 2003-04-23 <160> 58 <170> Patentln version 3.2 <210> 1 <211> 5 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1).. (5) <400> 1 Ser Tyr Trp Ile His <210> 2 <211> 17 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(17) <400> 2 Tyr Ile Asp Pro Ala Thr Ala Tyr Thr Glu Ser Asn Gln Lys Phe Lys Asp <210> 3 <211> 16 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1) .. (16) <400> 3 Glu Ser Pro Arg Leu Arg Arg Gly Ile Tyr Tyr Tyr Ala Met Asp Tyr <210> 4 <211> 11 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1) .. (11) <400> 4 Arg Ala Ser Gln Ser Ile Ser Asn Asn Leu His <210> 5 <211> 7 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(7) <400> 5 Tyr Ala Ser Gln Ser Ile Ser <210> 6 <211> 9 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(9) <400> 6 Gln Gln Ser Asn Arg Trp Pro Leu Thr <210> 7 <211> 30 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1) .. (30) <400> 7 Gln Val Gln Leu Gln Gln Ser Gly Asn Glu Leu Ala Lys Pro Gly Ala Ser Met Lys Met Ser Cys Arg Ala Ser Gly Tyr Ser Phe Thr <210> 8 <211> 14 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(14) <400> 8 Trp Leu Lys Gln Arg Pro Asp Gln Gly Leu Glu Trp Ile Gly <210> 9 <211> 32 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(32) <400> 9 Lys Ala Ile Leu Thr Ala Asp Arg Ser Ser Asn Thr Ala Phe Met Tyr Leu Asn Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys Ala Arg <210> 10 <211> 11 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(11) <400> 10 Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser <210> 11 <211> 23 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(23) <400> 11 Asp Leu Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Val Thr Pro Gly Asp Ser Val Ser Phe Ser Cys <210> 12 <211> 15 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(15) <400> 12 Trp Tyr Gln Gln Arg Thr His Glu Ser Pro Arg Leu Leu Ile Lys <210> 13 <211> 32 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(32) <400> 13 Gly Ile Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Ser Ile Ile Ser Val Glu Thr Glu Asp Phe Gly Met Tyr Phe Cys <210> 14 <211> 12 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1) (12) <400> 14 Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys Arg Ala <210> 15 <211> 43 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) .. (43) <400> 15 ggggatatcc accatggaaa ggcactggat ctttctcttc ctg 43 <210> 16 <211> 30 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(30) <400> 16 ggggctagct gaggagacgg tgaccgtggt 30 <210> 17 <211> 48 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(48) <220>
<221> prim - transcript <222> (1) . (43) <400> 17 ggggatatcc accatggtat ttcctacacc tcagattacc ttggactt 48 <210> 18 <211> 35 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1). (35) <400> 18 agcgtcgact tacgtttcag ctccagcttg gtccc 35 <210> 19 <211> 42 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(42) <400> 19 gtccagcttg tgcagtctgg ggctgaagtg gtaaaacctg gg 42 <210> 20 <211> 30 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) .. (30) <400> 20 ggggctagct gaggagacgg tgaccgtggt 30 <210> 21 <211> 42 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(42) <400> 21 cccaggtttt accacttcag ccccagactg cacaagctgg ac 42 <210> 22 <211> 43 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(43) <400> 22 ggggatatcc accatggaaa ggcactggat ctttctcttc ctg 43 <210> 23 <211> 27 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(27) <400> 23 ggggcctcag tgagggtgtc ctgcagg 27 <210> 24 <211> 30 <212> DNA
<213> Mus musculus .<220>
<221> prim - transcript <222> (1) .. (30) <400> 24 ggggctagct gaggagacgg tgaccgtggt 30 <210> 25 <211> 27 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(27) <400> 25 cctgcaggac accctcactg aggcccc 27 <210> 26 <211> 43 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(43) <400> 26 ggggatatcc accatggaaa ggcactggat ctttctcttc ctg 43 <210> 27 <211> 33 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(33) <400> 27 cactggttaa gacaggcacc tggccagggt ctg 33 <210> 28 <211> 30 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) .. (30) <400> 28 ggggctagct gaggagacgg tgaccgtggt 30 <210> 29 <211> 33 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(33) <400> 29 cagaccctgg ccaggtgcct gtcttaacca gtg 33 <210> 30 <211> 43 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(43) <400> 30 ggggatatcc accatggaaa ggcactggat ctttctcttc ctg 43 <210> 31 <211> 21 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(21) <400> 31 ctggaatggg ttggatacat t 21 <210> 32 <211> 30 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(30) <400> 32 ggggctagct gaggagacgg tgaccgtggt 30 <210> 33 <211> 21 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) .. (21) <400> 33 aatgtatcca acccattcca g 21 <210> 34 <211> 43 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) . (43) <400> 34 ggggatatcc accatggaaa ggcactggat ctttctcttc ctg 43 <210> 35 <211> 30 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1). (30) <400> 35 tatcaacaaa aaccaggtca gtctccaagg 30 <210> 36 <211> 35 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) .. (35) <400> 36 agcgtcgact tacgtttcag ctccagcttg gtccc 35 <210> 37 <211> 30 <212> DNA
<213> Mus musculus <220>
<221> prim transcript <222> (1) . (30) <400> 37 ccttggagac tgacctggtt tttgttgata 30 <210> 38 <211> 48 <212> DNA
<213> Mus musculus <220>
<221> lprim_transcript <222> (1) .. (48) <400> 38 ggggatatcc accatggtat ttcctacacc tcagattacc ttggactt 48 <210> 39 <211> 21 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1). (21) <400> 39 atttctgggg tcccctccag g 21 <210> 40 <211> 35 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1). (35) <400> 40 agcgtcgact tacgtttcag ctccagcttg gtccc 35 <210> 41 <211> 21 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(21) <400> 41 cctggagggg accccagaaa t 21 <210> 42 <211> 48 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) (48) <400> 42 ggggatatcc accatggtat ttcctacacc tcagattacc ttggactt 48 <210> 43 <211> 50 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(50) <400> 43 ttctattctc acagtgcaca ggcaggtgtc agctgtacag cagtcatgga 50 <210> 44 <211> 51 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) .. (51) <400> 44 ttctattctc acagtgcaca ggcaggtctc aagctgcagc agctctgggg c 51 <210> 45 <211> 53 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) . (53) <400> 45 ttctattctc acagtgcaca ggaaggtgaa gctgtgctgc gagtctggag gga 53 <210> 46 <211> 50 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) .. (50) <400> 46 gaaccagtac tccaggcctg aggggccgca gagacagtga ccagagtccc 50 <210> 47 <211> 50 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(50) <400> 47 gaaccagtac tccaggcctg aggggccgag gagacggtga ctgaggttcc 50 <210> 48 <211> 54 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) . (54) <400> 48 gaaccagtac tccaggcctg aggggccgag gagacgtgtg agccagtgga gccc 54 <210> 49 <211> 40 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1) (40) <400> 49 gtactccagt cgacgacatt gtgcatgatt accagtctcc 40 <210> 50 <211> 40 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(40) <400> 50 gtactccagt cgacgatatc cagatgacac cagaactacc 40 <210> 51 <211> 39 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(39) <400> 51 gtactccagt cgaccgaaat tgttgctcac ccagtctcc 39 <210> 52 <211> 39 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(39) <400> 52 aaggaaaaaa gcggccgctt ttcatgtctc cagcttggt 39 <210> 53 <211> 39 <212> DNA
<213> Mus musculus <220>
<221> prim - transcript <222> (1)..(39) <400> 53 aaggaaaaaa gcggccgctt ttgatgctcc aacttgtgt 39 <210> 54 <211> 111 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(111) <400> 54 Asp Ile Val Met Phe Gln Ser Pro Ala Ser Leu Ala Val Ser Leu Gly Gln Arg Ala Thr Ile Ser Cys Arg Ala Ser Gln Ser Val Ser Ser Ser Ser Tyr Ser Tyr Met His Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro Lys Leu Leu Ile Lys Tyr Ala Ser Asn Leu Glu Ser Gly Val Pro Ala Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Asn Ile His Pro Val Glu Glu Glu Asp Ala Ala Thr Tyr Tyr Cys Gln His Ser Arg Asp Val Pro Leu Thr Phe Gly Ala Gly Thr Lys Leu Glu Ile Lys <210> 55 <211> 107 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(107) <400> 55 Asp Ile Gln Met Thr Gln Thr Pro Ser Ser Leu Ser Ala Ser Leu Gly Asp Arg Val Thr Ile Ser Cys Arg Ala Ser Gln Asp Ile Ser Asn Tyr Leu Asn Trp Tyr Gln Gln Lys Pro Asp Gly Thr Val Lys Leu Leu Ile Val Tyr Thr Ser Arg Leu His Ser Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Tyr Ser Leu Thr Ile Ser Asn Leu Glu Gln Glu Asp Ile Ala Thr Tyr Phe Cys Gln Gln Gly Asn Thr Leu Pro Pro Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys <210> 56 <211> 107 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(107) <400> 56 Asp Ile Gln Met Thr Gln Thr Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Ser Ile Ser Ser Phe Leu Asn Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile Tyr Ala Ala Ser Asn Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly Arg Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Ala Tyr Tyr Cys Gln Gln Gly Tyr Thr Thr Pro Leu Thr Phe Gly Gln Gly Thr Lys Leu Glu Leu Lys <210> 57 <211> 111 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(111) <400> 57 Gln Ser Val Val Thr Gln Pro Pro Ser Thr Ala Ser Gly Gly Pro Gly Gln Ser Leu Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Gly Tyr Asn His Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu Met Ile Tyr Asp Val Ser Lys Arg Pro Ser Gly Val Pro His Arg Phe Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Val Ser Gly Leu Gln Ala Glu Asp Glu Ala Val Tyr Tyr Cys Ser Ser Tyr Ala Gly Ser Asn Asn Leu Val Phe Gly Gly Gly Thr Lys Val Thr Val Leu <210> 58 <211> 109 <212> PRT
<213> Mus musculus <220>
<221> DOMAIN
<222> (1)..(109) <400> 58 Ser Ser Glu Leu Thr Gln Asp Pro Ala Thr Val Ser Val Ala Leu Gly Gln Thr Val Arg Ile Thr Cys Gln Gly Asp Ser Leu Arg Ser Tyr Tyr Ala Ser Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Val Leu Val Ile Tyr Gly Lys Asn Asn Arg Pro Ser Gly Ile Pro Asp Arg Phe Ser Gly Ser Ser Ser Gly Asn Thr Ala Ser Leu Thr Ile Thr Gly Ala Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Asn Ser Arg Asp Ser Ser Gly Asn His Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu
Claims (15)
1. A chimeric antibody derived from the murine 14F7 monoclonal antibody produced by the hybridoma with the deposit ECACC 98101901, characterized by comprising (a) the constant region of the IgG1 human heavy chain, (b) the constant region of the Ck human light region, and (c) the sequences of the hyper variable regions (CDRs) and the sequences of the framework regions (FRs) of the heavy and light chains shown below:
HEAVY CHAIN:
CDR1: SYWIH
CDR2: YIDPATAYTESNQKFKD
CDR3: ESPRLRRGIYYYAMDY
FR1: QVQLQQSGNELAKPGASMKMSCRASGYSFT
FR2: WLKQRPDQGLEWIG
FR3: KAILTADRSSNTAFMYLNSLTSEDSAVYYCAR
FR4: WGQGTTVTVSS
LIGHT CHAIN:
CDR1: RASQSISNNLH
CDR2: YASQSIS
CDR3: QQSNRWPLT
FR1: DLVLTQSPATLSVTPGDSVSFSC
FR2: WYQQRTHESPRLLIK
FR3: GIPSRFSGSGSGTDFTLSIISVETEDFGMYFC
FR4: FGAGTKLELKRA
wherein the framework regions of the heavy and light chains comprise one or more of the following mutations:
HEAVY CHAIN:
Position 5: replace Q by V
Position 9: replace N by A
Position 11: replace L by V
Position 12: replace A by V
Position 18: replace M by V
Position 19: replace K by R
Position 20: replace M by V
Position 38: replace K by R
Position 40: replace R by A
Position 42: replace D by G
Position 48: replace I by V
LIGHT CHAIN:
Position 39: replace R by K
Position 40: replace T by P
Position 41: replace H by G
Position 42: replace E by Q
Position 58: replace I by V.
HEAVY CHAIN:
CDR1: SYWIH
CDR2: YIDPATAYTESNQKFKD
CDR3: ESPRLRRGIYYYAMDY
FR1: QVQLQQSGNELAKPGASMKMSCRASGYSFT
FR2: WLKQRPDQGLEWIG
FR3: KAILTADRSSNTAFMYLNSLTSEDSAVYYCAR
FR4: WGQGTTVTVSS
LIGHT CHAIN:
CDR1: RASQSISNNLH
CDR2: YASQSIS
CDR3: QQSNRWPLT
FR1: DLVLTQSPATLSVTPGDSVSFSC
FR2: WYQQRTHESPRLLIK
FR3: GIPSRFSGSGSGTDFTLSIISVETEDFGMYFC
FR4: FGAGTKLELKRA
wherein the framework regions of the heavy and light chains comprise one or more of the following mutations:
HEAVY CHAIN:
Position 5: replace Q by V
Position 9: replace N by A
Position 11: replace L by V
Position 12: replace A by V
Position 18: replace M by V
Position 19: replace K by R
Position 20: replace M by V
Position 38: replace K by R
Position 40: replace R by A
Position 42: replace D by G
Position 48: replace I by V
LIGHT CHAIN:
Position 39: replace R by K
Position 40: replace T by P
Position 41: replace H by G
Position 42: replace E by Q
Position 58: replace I by V.
2. A single chain Fv fragment derived from the murine 14 F7 monoclonal antibody produced by the hybridoma with the deposit ECACC 98101901, characterized by the sequences of the hyper variable regions (CDRs) and the sequences of the framework regions (FRs) of the heavy and light chains shown below:
HEAVY CHAIN:
CDR1: SYWIH
CDR2: YIDPATAYTESNQKFKD
CDR3: ESPRLRRGIYYYAMDY
FR1: QVQLQQSGNELAKPGASMKMSCRASGYSFT
FR2: WLKQRPDQGLEWIG
FR3: KAILTADRSSNTAFMYLNSLTSEDSAVYYCAR
FR4: WGQGTTVTVSS
LIGHT CHAIN:
CDR1: RASQSISNNLH
CDR2: YASQSIS
CDR3: QQSNRWPLT
FR1: DLVLTQSPATLSVTPGDSVSFSC
FR2: WYQQRTHESPRLLIK
FR3: GIPSRFSGSGSGTDFTLSIISVETEDFGMYFC
FR4: FGAGTKLELKRA
wherein the framework regions of the heavy and light chains comprise one or more of the following mutations:
HEAVY CHAIN:
Position 5: replace Q by V
Position 9: replace N by A
Position 11: replace L by V
Position 12: replace A by V
Position 18: replace M by V
Position 19: replace K by R
Position 20: replace M by V
Position 38: replace K by R
Position 40: replace R by A
Position 42: replace D by G
Position 48: replace I by V
LIGHT CHAIN:
Position 39: replace R by K
Position 40: replace T by P
Position 41: replace H by G
Position 42: replace E by Q
Position 58: replace I by V.
HEAVY CHAIN:
CDR1: SYWIH
CDR2: YIDPATAYTESNQKFKD
CDR3: ESPRLRRGIYYYAMDY
FR1: QVQLQQSGNELAKPGASMKMSCRASGYSFT
FR2: WLKQRPDQGLEWIG
FR3: KAILTADRSSNTAFMYLNSLTSEDSAVYYCAR
FR4: WGQGTTVTVSS
LIGHT CHAIN:
CDR1: RASQSISNNLH
CDR2: YASQSIS
CDR3: QQSNRWPLT
FR1: DLVLTQSPATLSVTPGDSVSFSC
FR2: WYQQRTHESPRLLIK
FR3: GIPSRFSGSGSGTDFTLSIISVETEDFGMYFC
FR4: FGAGTKLELKRA
wherein the framework regions of the heavy and light chains comprise one or more of the following mutations:
HEAVY CHAIN:
Position 5: replace Q by V
Position 9: replace N by A
Position 11: replace L by V
Position 12: replace A by V
Position 18: replace M by V
Position 19: replace K by R
Position 20: replace M by V
Position 38: replace K by R
Position 40: replace R by A
Position 42: replace D by G
Position 48: replace I by V
LIGHT CHAIN:
Position 39: replace R by K
Position 40: replace T by P
Position 41: replace H by G
Position 42: replace E by Q
Position 58: replace I by V.
3. The single chain Fv fragment derived from the murine 14F7 monoclonal antibody produced by the hybridoma with deposit number ECACC 98101901 according to claim 2, characterized by containing the sequence of the variable region of the heavy chain of the 14F7 monoclonal antibody and a light chain variable region which comprises the following sequences:
Fr1: DIVMFQSPASLAVSLGQRATISC
CDR 1: RASQSVSSSSYSYMH
Fr 2: WYQQKPGQPPKLLIK
CDR 2: YASNLES
Fr 3: GVPARFSGSGSGTDFTLNIHPVEEEDAATYYC
CDR 3: QHSRDVPLTF
Fr 4: GAGTKLELK
Fr1: DIVMFQSPASLAVSLGQRATISC
CDR 1: RASQSVSSSSYSYMH
Fr 2: WYQQKPGQPPKLLIK
CDR 2: YASNLES
Fr 3: GVPARFSGSGSGTDFTLNIHPVEEEDAATYYC
CDR 3: QHSRDVPLTF
Fr 4: GAGTKLELK
4. The single chain Fv fragment derived from the murine 14F7 monoclonal antibody produced by the hybridoma with deposit number ECACC 98101901 according to claim 2, characterized by containing the sequence of the variable region of the heavy chain of the 14F7 monoclonal antibody and a light chain variable region which comprises the following sequences:
Fr1: DIQMTQTPSSLSASLGDRVTISC
CDR 1: RASQDISNYLN
Fr 2: WYQQKPDGTVKLLIV
CDR 2: YTSRLHS
Fr 3: GVPSRFSGSGSGTDYSLTISNLEQEDIATYFC
CDR 3: QQGNTLPPTF
Fr 4: GAGTKLELK
Fr1: DIQMTQTPSSLSASLGDRVTISC
CDR 1: RASQDISNYLN
Fr 2: WYQQKPDGTVKLLIV
CDR 2: YTSRLHS
Fr 3: GVPSRFSGSGSGTDYSLTISNLEQEDIATYFC
CDR 3: QQGNTLPPTF
Fr 4: GAGTKLELK
5. The single chain Fv fragment derived from the murine 14F7 monoclonal antibody produced by the hybridoma with deposit number ECACC 98101901 according to claim 2, characterized by containing the sequence of the variable region of the heavy chain of the 14F7 monoclonal antibody and a light chain variable region which comprises the following sequences:
Fr1: DIQMTQTPSSLSASVGDRVTITC
CDR 1: RASQSISSFLN
Fr 2: WYQQKPGKAPKLLIY
CDR 2: AASNLQS
Fr 3: GVPSRFSGRGSGTDFTLTISSLQPEDFAAYYC
CDR 3: QQGYTTPLTF
Fr 4: GQGTKLELK
Fr1: DIQMTQTPSSLSASVGDRVTITC
CDR 1: RASQSISSFLN
Fr 2: WYQQKPGKAPKLLIY
CDR 2: AASNLQS
Fr 3: GVPSRFSGRGSGTDFTLTISSLQPEDFAAYYC
CDR 3: QQGYTTPLTF
Fr 4: GQGTKLELK
6. The single chain Fv fragment derived from the murine 14F7 monoclonal antibody produced by the hybridoma with deposit number ECACC 98101901 according to claim 2, characterized by containing the sequence of the variable region of the heavy chain of the 14F7 monoclonal antibody and a light chain variable region which comprises the following sequences:
Fr1: QSVVTQPPSASGGPGQSLTISC
CDR1:TGTSSDVGGYNHVS
Fr 2: WYQQHPGKAPKLMIY
CDR 2: DVSKRPS
Fr 3: GVPHRFSGSKSGNTASLTVSGLQAEDEAVYYC
CDR 3: SSYAGSNNLVF
Fr 4: GGGTKVTVL
Fr1: QSVVTQPPSASGGPGQSLTISC
CDR1:TGTSSDVGGYNHVS
Fr 2: WYQQHPGKAPKLMIY
CDR 2: DVSKRPS
Fr 3: GVPHRFSGSKSGNTASLTVSGLQAEDEAVYYC
CDR 3: SSYAGSNNLVF
Fr 4: GGGTKVTVL
7. The, single chain Fv fragment derived from the murine 14F7 monoclonal antibody produced by the hybridoma with deposit number ECACC 98101901 according to claim 2, characterized by containing the sequence of the variable region of the heavy chain of the 14F7 monoclonal antibody and a light chain variable region which comprises the following sequences:
Fr1: SSELTQDPAVSVALGQTVRITC
CDR 1: QGDSLRSYYAS
Fr 2: WYQQKPGQAPVLVIY
CDR 2: GKNNRPS
Fr 3: GIPDRFSGSSSGNTASLTITGAQAEDEADYYC
CDR 3: NSRDSSGNHWF
Fr 4: GGGTKLTVL
Fr1: SSELTQDPAVSVALGQTVRITC
CDR 1: QGDSLRSYYAS
Fr 2: WYQQKPGQAPVLVIY
CDR 2: GKNNRPS
Fr 3: GIPDRFSGSSSGNTASLTITGAQAEDEADYYC
CDR 3: NSRDSSGNHWF
Fr 4: GGGTKLTVL
8. A cell line which expresses any of the recombinant antibodies of claim 1.
9. A cell line which expresses the single chain Fv fragment of any one of claims 2 to 7.
10. A pharmaceutical composition for the treatment of breast tumors or melanomas which comprises any of the recombinant antibodies of claim 1, and an appropriate excipient.
11. A pharmaceutical composition for the treatment of breast tumors or melanomas which comprises the single chain Fv fragment of any one claims 2 to 7, and an appropriate excipient.
12. Use of the pharmaceutical composition of claim 10 for the treatment of malignant breast tumors, melanomas, metastases of malignant breast tumors, metastases of melanomas, recurrences of malignant breast tumors or recurrences of melanomas.
13. Use of the pharmaceutical composition of claim 11 for the treatment of malignant breast tumors, melanomas, metastases of malignant breast tumors, metastases of melanomas, recurrences of malignant breast tumors or recurrences of melanomas.
14. A reagent for use in the "in vivo" localization and identification of malignant breast tumors, melanomas, mestastases of malignant breast tumors, metastases of melanomas, recurrences of malignant breast tumors or recurrences of melanomas which comprises any of the recombinant antibodies of claim 1 and an appropriate marker.
15. A reagent for use in the "in vivo" localization and identification of malignant breast tumors, melanomas, metastases of malignant breast tumors, metastases of melanomas, recurrences of malignant breast tumors or recurrences of melanomas which comprises the single chain Fv fragment of any one of claims 2 to 7 and an appropriate marker.
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CU20030092A CU23403A1 (en) | 2003-04-23 | 2003-04-23 | RECOMBINANT ANTIBODIES AND FRAGMENTS RECOGNIZING GANGLIOSIDE N-GLICOLIL GM3 AND ITS USE FOR DIAGNOSIS AND TUMOR TREATMENT |
| CU2003-0092 | 2003-04-23 | ||
| PCT/CU2004/000006 WO2004094477A1 (en) | 2003-04-23 | 2004-04-22 | Recombinant antibodies and fragments recognising ganglioside n-glycolyl-gm3 and use thereof in the diagnosis and treatment of tumours |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CA2523449A1 CA2523449A1 (en) | 2004-11-04 |
| CA2523449C true CA2523449C (en) | 2012-09-18 |
Family
ID=40261249
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CA2523449A Expired - Lifetime CA2523449C (en) | 2003-04-23 | 2004-04-22 | Recombinant antibodies and fragments which recognize n glycolil gm3 ganglioside and its use in diagnosis and treatment of tumours |
Country Status (31)
| Country | Link |
|---|---|
| EP (1) | EP1623997B1 (en) |
| JP (1) | JP2006524194A (en) |
| KR (1) | KR20060006937A (en) |
| CN (2) | CN1809592A (en) |
| AR (1) | AR044076A1 (en) |
| AU (1) | AU2004232391B2 (en) |
| BR (1) | BRPI0409664A (en) |
| CA (1) | CA2523449C (en) |
| CL (1) | CL2004000843A1 (en) |
| CR (1) | CR8105A (en) |
| CU (1) | CU23403A1 (en) |
| EA (1) | EA008353B1 (en) |
| ES (1) | ES2535813T3 (en) |
| GE (1) | GEP20084476B (en) |
| HR (1) | HRP20050922A2 (en) |
| HU (1) | HUE025266T2 (en) |
| IL (1) | IL171541A (en) |
| LT (1) | LT5353B (en) |
| LV (1) | LV13427B (en) |
| MX (1) | MXPA05011368A (en) |
| MY (1) | MY144620A (en) |
| NZ (1) | NZ543345A (en) |
| PE (1) | PE20050422A1 (en) |
| PL (1) | PL1623997T3 (en) |
| RS (2) | RS20110319A3 (en) |
| SI (1) | SI1623997T1 (en) |
| TN (1) | TNSN05274A1 (en) |
| TW (1) | TWI343923B (en) |
| UY (1) | UY28289A1 (en) |
| WO (1) | WO2004094477A1 (en) |
| ZA (1) | ZA200509457B (en) |
Families Citing this family (39)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE69942782D1 (en) | 1998-11-27 | 2010-10-28 | Ucb Sa | Compositions and methods for increasing bone mineralization |
| EP1636270B1 (en) | 2003-06-16 | 2016-07-20 | UCB Pharma S.A. | Antibodies specific for sclerostin and methods for increasing bone mineralization |
| US7592429B2 (en) | 2005-05-03 | 2009-09-22 | Ucb Sa | Sclerostin-binding antibody |
| US8003108B2 (en) | 2005-05-03 | 2011-08-23 | Amgen Inc. | Sclerostin epitopes |
| CL2008002775A1 (en) | 2007-09-17 | 2008-11-07 | Amgen Inc | Use of a sclerostin binding agent to inhibit bone resorption. |
| SMT202000095T1 (en) | 2010-05-14 | 2020-03-13 | Amgen Inc | High concentration anti-sclerostin antibody formulations |
| US9133272B2 (en) | 2011-03-01 | 2015-09-15 | Amgen Inc. | Bispecific binding agents |
| JP2014511842A (en) | 2011-03-25 | 2014-05-19 | アムジエン・インコーポレーテツド | Anti-sclerostin antibody crystals and preparations thereof |
| DK2739311T3 (en) | 2011-08-04 | 2018-04-23 | Amgen Inc | Method of treating bone slit defects |
| CU24070B1 (en) * | 2011-12-27 | 2015-01-29 | Ct De Inmunología Molecular | PHARMACEUTICAL COMPOSITIONS FOR THE TREATMENT OF TUMORS EXPRESSING REGF AND GM3 N-GLYCOLLATED GANGLIOSIDS (NEUGCGM3) |
| EA036740B1 (en) | 2011-12-28 | 2020-12-15 | Эмджен Инк. | Method of increasing alveolar bone height through the use of anti-sclerostin antibodies |
| CU24120B1 (en) * | 2012-03-01 | 2015-08-27 | Ct De Inmunología Molecular | RECOMBINANT ANTIBODIES WITH DUAL SPECIFICITY BY N-ACETIL GM3 AND N-GLICOLIL GM3 GANGLIOSIDS |
| WO2014006100A1 (en) | 2012-07-05 | 2014-01-09 | Ucb Pharma S.A. | Treatment for bone diseases |
| UY35148A (en) | 2012-11-21 | 2014-05-30 | Amgen Inc | HETERODIMERIC IMMUNOGLOBULINS |
| JP2017513818A (en) | 2014-03-15 | 2017-06-01 | ノバルティス アーゲー | Treatment of cancer using chimeric antigen receptors |
| MA41142A (en) | 2014-12-12 | 2017-10-17 | Amgen Inc | ANTI-SCLEROSTINE ANTIBODIES AND THE USE OF THEM TO TREAT BONE CONDITIONS AS PART OF THE TREATMENT PROTOCOL |
| CN104651314B (en) * | 2015-02-14 | 2018-06-19 | 百泰生物药业有限公司 | Obtain the method for high and stable yields expression cell clone and thus obtained antibody molecule |
| EP3286211A1 (en) | 2015-04-23 | 2018-02-28 | Novartis AG | Treatment of cancer using chimeric antigen receptor and protein kinase a blocker |
| US11667691B2 (en) | 2015-08-07 | 2023-06-06 | Novartis Ag | Treatment of cancer using chimeric CD3 receptor proteins |
| CN108603200B (en) | 2015-11-23 | 2022-08-19 | 诺华股份有限公司 | Optimized lentiviral transfer vectors and uses thereof |
| CN109072195A (en) | 2015-12-30 | 2018-12-21 | 诺华股份有限公司 | Immune effector cell therapy with enhanced efficacy |
| GB201604124D0 (en) | 2016-03-10 | 2016-04-27 | Ucb Biopharma Sprl | Pharmaceutical formulation |
| WO2018102795A2 (en) | 2016-12-02 | 2018-06-07 | University Of Southern California | Synthetic immune receptors and methods of use thereof |
| EP3574005B1 (en) | 2017-01-26 | 2021-12-15 | Novartis AG | Cd28 compositions and methods for chimeric antigen receptor therapy |
| EP3577134A1 (en) | 2017-01-31 | 2019-12-11 | Novartis AG | Treatment of cancer using chimeric t cell receptor proteins having multiple specificities |
| WO2019081983A1 (en) | 2017-10-25 | 2019-05-02 | Novartis Ag | Antibodies targeting cd32b and methods of use thereof |
| RU2020116579A (en) | 2017-10-25 | 2021-11-25 | Новартис Аг | METHODS FOR OBTAINING CELLS EXPRESSING A CHIMERIC ANTIGENIC RECEPTOR |
| CU20170173A7 (en) * | 2017-12-27 | 2019-11-04 | Ct Inmunologia Molecular | NANO-PARTICLES CONTAINING GM3 GANGLIOSIDE AS IMMUNOMODULATORS |
| CN119241705A (en) | 2018-03-30 | 2025-01-03 | 安姆根有限公司 | C-terminal antibody variants |
| WO2019210153A1 (en) | 2018-04-27 | 2019-10-31 | Novartis Ag | Car t cell therapies with enhanced efficacy |
| EP3801769A1 (en) | 2018-05-25 | 2021-04-14 | Novartis AG | Combination therapy with chimeric antigen receptor (car) therapies |
| WO2019237035A1 (en) | 2018-06-08 | 2019-12-12 | Intellia Therapeutics, Inc. | Compositions and methods for immunooncology |
| KR102344948B1 (en) * | 2018-09-03 | 2021-12-28 | 세종대학교산학협력단 | Monoclonal antibody N1-A4 specific to human naive pluripotent stem cells |
| MX2021007392A (en) | 2018-12-20 | 2021-08-24 | Novartis Ag | Dosing regimen and pharmaceutical combination comprising 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives. |
| BR112021015783A2 (en) | 2019-02-15 | 2021-10-05 | Novartis Ag | DERIVATIVES OF 3-(1-OXO-5-(PIPERIDIN-4-IL)ISOINDOLIN-2-IL)PIPERIDINE-2,6-DIONE AND USES THEREOF |
| CN110208409A (en) * | 2019-06-05 | 2019-09-06 | 中国海洋大学 | A kind of biomarker of breast cancer and its application |
| TW202135859A (en) | 2019-12-20 | 2021-10-01 | 瑞士商諾華公司 | Combination therapies |
| WO2021123908A1 (en) | 2019-12-20 | 2021-06-24 | Ludwig Institute For Cancer Research Ltd | Car-t cell therapy targeting ngcgm3 |
| WO2024089639A1 (en) | 2022-10-26 | 2024-05-02 | Novartis Ag | Lentiviral formulations |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2078539C (en) * | 1991-09-18 | 2005-08-02 | Kenya Shitara | Process for producing humanized chimera antibody |
| AU703152B2 (en) * | 1994-01-25 | 1999-03-18 | Biogen Ma Inc. | Humanized antibodies against leukocyte adhesion molecule VLA-4 |
| CU22615A1 (en) | 1994-06-30 | 2000-02-10 | Centro Inmunologia Molecular | PROCEDURE FOR OBTAINING LESS IMMUNOGENIC MONOCLONAL ANTIBODIES. MONOCLONAL ANTIBODIES OBTAINED |
| CA2203236A1 (en) | 1994-10-28 | 1996-05-09 | Ira Pastan | Tumor-specific antibody fragments, fusion proteins, and uses thereof |
| JP3925663B2 (en) * | 1995-06-30 | 2007-06-06 | 持田製薬株式会社 | Anti-Fas ligand antibody and measurement method using the antibody |
| US5834597A (en) * | 1996-05-20 | 1998-11-10 | Protein Design Labs, Inc. | Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same |
| CU22731A1 (en) * | 1998-02-05 | 2002-02-28 | Centro Inmunologia Molecular | MONOCLONAL ANTIBODY THAT RECOGNIZES THE SYNLICAL OLIGOSACÁRIDO SYNALIC N´GLICOLILADO-GALACTOSA-GLUCOSA (NGCNEU-GAL-GLU) IN MALIGN TUMORS AND PHARMACEUTICAL COMPOSITIONS CONTAINING THEM |
-
2003
- 2003-04-23 CU CU20030092A patent/CU23403A1/en unknown
-
2004
- 2004-04-21 CL CL200400843A patent/CL2004000843A1/en unknown
- 2004-04-21 PE PE2004000397A patent/PE20050422A1/en not_active Application Discontinuation
- 2004-04-22 AU AU2004232391A patent/AU2004232391B2/en not_active Ceased
- 2004-04-22 WO PCT/CU2004/000006 patent/WO2004094477A1/en not_active Ceased
- 2004-04-22 MX MXPA05011368A patent/MXPA05011368A/en active IP Right Grant
- 2004-04-22 CA CA2523449A patent/CA2523449C/en not_active Expired - Lifetime
- 2004-04-22 KR KR1020057020182A patent/KR20060006937A/en not_active Ceased
- 2004-04-22 HU HUE04728755A patent/HUE025266T2/en unknown
- 2004-04-22 CN CNA2004800174578A patent/CN1809592A/en active Pending
- 2004-04-22 MY MYPI20041468A patent/MY144620A/en unknown
- 2004-04-22 EA EA200501653A patent/EA008353B1/en not_active IP Right Cessation
- 2004-04-22 JP JP2006504218A patent/JP2006524194A/en active Pending
- 2004-04-22 NZ NZ543345A patent/NZ543345A/en not_active IP Right Cessation
- 2004-04-22 BR BRPI0409664-9A patent/BRPI0409664A/en not_active Application Discontinuation
- 2004-04-22 GE GEAP20049062A patent/GEP20084476B/en unknown
- 2004-04-22 EP EP04728755.2A patent/EP1623997B1/en not_active Expired - Lifetime
- 2004-04-22 RS RS20110319A patent/RS20110319A3/en unknown
- 2004-04-22 CN CN201210517262.6A patent/CN103012586B/en not_active Expired - Fee Related
- 2004-04-22 HR HR20050922A patent/HRP20050922A2/en not_active Application Discontinuation
- 2004-04-22 SI SI200432242T patent/SI1623997T1/en unknown
- 2004-04-22 ES ES04728755.2T patent/ES2535813T3/en not_active Expired - Lifetime
- 2004-04-22 RS YU20050795A patent/RS51853B/en unknown
- 2004-04-22 TW TW093111267A patent/TWI343923B/en not_active IP Right Cessation
- 2004-04-22 PL PL04728755T patent/PL1623997T3/en unknown
- 2004-04-23 UY UY28289A patent/UY28289A1/en not_active Application Discontinuation
- 2004-04-23 AR ARP040101389A patent/AR044076A1/en active IP Right Grant
-
2005
- 2005-10-21 TN TNP2005000274A patent/TNSN05274A1/en unknown
- 2005-10-23 IL IL171541A patent/IL171541A/en active IP Right Grant
- 2005-11-21 LT LT2005101A patent/LT5353B/en not_active IP Right Cessation
- 2005-11-22 ZA ZA200509457A patent/ZA200509457B/en unknown
- 2005-11-22 LV LVP-05-152A patent/LV13427B/en unknown
- 2005-11-25 CR CR8105A patent/CR8105A/en not_active Application Discontinuation
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CA2523449C (en) | Recombinant antibodies and fragments which recognize n glycolil gm3 ganglioside and its use in diagnosis and treatment of tumours | |
| CN109963591B (en) | B7H3 antibody-drug conjugate and medical application thereof | |
| JP2022514693A (en) | MUC18-specific antibody | |
| EP3741777A1 (en) | Pd-l1 antibody, antigen-binding fragment thereof, and pharmaceutical use thereof | |
| TW202132351A (en) | Anti-cd47 / anti-pd-l1 antibodies and applications thereof | |
| JP2022523710A (en) | CD44-specific antibody | |
| EP4458853A1 (en) | Development of novel upar single-domain antibody | |
| CZ304424B6 (en) | Recombinant antibodies associated with gangliosides and their use in diagnosis and treatment of tumors | |
| ES2296952T3 (en) | METHOD TO TREAT MULTIPLE MYELOMA. | |
| CN112500485A (en) | anti-B7-H3 antibody and application thereof | |
| JP2024514855A (en) | Binding molecules for DLL3 and their uses | |
| JP2022514786A (en) | MUC18-specific antibody | |
| CN112513088A (en) | anti-OX 40 antibodies, antigen-binding fragments thereof, and medical uses thereof | |
| CN109776677A (en) | A kind of humanization anti-il-13 antibody and its preparation method and application | |
| JP2022539344A (en) | Anti-CEA antibody and its application | |
| KR20250173509A (en) | Antibody specifically binding to claudin 18.2, method for producing the same, and application thereof | |
| CN115947855B (en) | Preparation of anti-CD 24 antibodies and uses thereof | |
| US20250043016A1 (en) | Tnfr2 binding molecule and use thereof | |
| HK1198654A1 (en) | Recombinant antibodies having dual specificity for gangliosides and use thereof | |
| CN115746133B (en) | Anti-human CD47 monoclonal antibody and application thereof | |
| CN115772221B (en) | Monoclonal antibody capable of inducing macrophages to phagocytose cancer cells, and preparation method and application thereof | |
| CN110563847A (en) | Immune checkpoint inhibitors for therapeutic use | |
| CN120988130A (en) | Preparation and antitumor effects of Siglec-15 specific monoclonal antibodies | |
| HK1183492B (en) | Recombinant antibodies ana fragments recognising ganglioside n-glycolyl-gm3 and use thereof in the diagnosis and treatment of tumours | |
| WO2025201517A1 (en) | Anti-cd93 antibody, and antigen-binding fragment thereof and use thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| EEER | Examination request | ||
| MKEX | Expiry |
Effective date: 20240422 |