CA2420092A1 - New dengue and west nile viruses proteins and genes coding the foregoing, and their use in vaccinal, therapeutic and diagnostic applications - Google Patents
New dengue and west nile viruses proteins and genes coding the foregoing, and their use in vaccinal, therapeutic and diagnostic applications Download PDFInfo
- Publication number
- CA2420092A1 CA2420092A1 CA002420092A CA2420092A CA2420092A1 CA 2420092 A1 CA2420092 A1 CA 2420092A1 CA 002420092 A CA002420092 A CA 002420092A CA 2420092 A CA2420092 A CA 2420092A CA 2420092 A1 CA2420092 A1 CA 2420092A1
- Authority
- CA
- Canada
- Prior art keywords
- virus
- recombinant
- polypeptide according
- west
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 241000710886 West Nile virus Species 0.000 title claims description 32
- 206010012310 Dengue fever Diseases 0.000 title claims description 8
- 208000025729 dengue disease Diseases 0.000 title claims description 8
- 208000001490 Dengue Diseases 0.000 title claims description 6
- 108090000623 proteins and genes Proteins 0.000 title description 16
- 102000004169 proteins and genes Human genes 0.000 title description 6
- 241000710829 Dengue virus group Species 0.000 title 1
- 230000001225 therapeutic effect Effects 0.000 title 1
- 241000700605 Viruses Species 0.000 claims description 43
- 241000712079 Measles morbillivirus Species 0.000 claims description 26
- 229960005486 vaccine Drugs 0.000 claims description 18
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 17
- 241000725619 Dengue virus Species 0.000 claims description 10
- 239000000427 antigen Substances 0.000 claims description 10
- 108091007433 antigens Proteins 0.000 claims description 10
- 102000036639 antigens Human genes 0.000 claims description 10
- 108090000288 Glycoproteins Proteins 0.000 claims description 9
- 102000003886 Glycoproteins Human genes 0.000 claims description 9
- 239000012634 fragment Substances 0.000 claims description 7
- 239000013603 viral vector Substances 0.000 claims description 7
- 239000000833 heterodimer Substances 0.000 claims description 6
- 238000000034 method Methods 0.000 claims description 6
- 101710121417 Envelope glycoprotein Proteins 0.000 claims description 5
- 101710128560 Initiator protein NS1 Proteins 0.000 claims description 5
- 101710144127 Non-structural protein 1 Proteins 0.000 claims description 5
- 102100021696 Syncytin-1 Human genes 0.000 claims description 5
- 230000002238 attenuated effect Effects 0.000 claims description 5
- 241000124008 Mammalia Species 0.000 claims description 3
- 230000001681 protective effect Effects 0.000 claims description 3
- 241000700721 Hepatitis B virus Species 0.000 claims description 2
- 241000701806 Human papillomavirus Species 0.000 claims description 2
- 230000002163 immunogen Effects 0.000 claims description 2
- 229920001184 polypeptide Polymers 0.000 claims 15
- 102000004196 processed proteins & peptides Human genes 0.000 claims 15
- 102000040430 polynucleotide Human genes 0.000 claims 7
- 108091033319 polynucleotide Proteins 0.000 claims 7
- 239000002157 polynucleotide Substances 0.000 claims 7
- 239000008194 pharmaceutical composition Substances 0.000 claims 4
- 239000013604 expression vector Substances 0.000 claims 3
- 239000003795 chemical substances by application Substances 0.000 claims 2
- 230000002950 deficient Effects 0.000 claims 2
- 229940023605 dengue virus vaccine Drugs 0.000 claims 2
- 230000001939 inductive effect Effects 0.000 claims 2
- 241000713666 Lentivirus Species 0.000 claims 1
- 241000709664 Picornaviridae Species 0.000 claims 1
- 239000012472 biological sample Substances 0.000 claims 1
- 230000028993 immune response Effects 0.000 claims 1
- 230000036039 immunity Effects 0.000 claims 1
- 230000010076 replication Effects 0.000 claims 1
- 210000004027 cell Anatomy 0.000 description 13
- 206010057293 West Nile viral infection Diseases 0.000 description 8
- 206010014599 encephalitis Diseases 0.000 description 7
- 239000013612 plasmid Substances 0.000 description 7
- 239000013598 vector Substances 0.000 description 6
- 230000003612 virological effect Effects 0.000 description 6
- 201000006449 West Nile encephalitis Diseases 0.000 description 5
- 239000002299 complementary DNA Substances 0.000 description 5
- 208000015181 infectious disease Diseases 0.000 description 5
- 241000699670 Mus sp. Species 0.000 description 4
- 230000005540 biological transmission Effects 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 210000001072 colon Anatomy 0.000 description 4
- 235000018102 proteins Nutrition 0.000 description 4
- 241000271566 Aves Species 0.000 description 3
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 3
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 3
- 241000255925 Diptera Species 0.000 description 3
- 108010076039 Polyproteins Proteins 0.000 description 3
- 235000001014 amino acid Nutrition 0.000 description 3
- 150000001413 amino acids Chemical class 0.000 description 3
- 230000002458 infectious effect Effects 0.000 description 3
- 239000002773 nucleotide Substances 0.000 description 3
- 125000003729 nucleotide group Chemical group 0.000 description 3
- 206010048282 zoonosis Diseases 0.000 description 3
- 101710117545 C protein Proteins 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- 241000710831 Flavivirus Species 0.000 description 2
- 241000282553 Macaca Species 0.000 description 2
- 201000005505 Measles Diseases 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- 206010037660 Pyrexia Diseases 0.000 description 2
- 108020000999 Viral RNA Proteins 0.000 description 2
- 125000003275 alpha amino acid group Chemical group 0.000 description 2
- 150000001768 cations Chemical class 0.000 description 2
- 210000003837 chick embryo Anatomy 0.000 description 2
- 230000001747 exhibiting effect Effects 0.000 description 2
- 210000002950 fibroblast Anatomy 0.000 description 2
- 210000002443 helper t lymphocyte Anatomy 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- 101150034533 ATIC gene Proteins 0.000 description 1
- 208000004998 Abdominal Pain Diseases 0.000 description 1
- 241000238876 Acari Species 0.000 description 1
- 208000006740 Aseptic Meningitis Diseases 0.000 description 1
- 241000193738 Bacillus anthracis Species 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 241000283153 Cetacea Species 0.000 description 1
- 241000867607 Chlorocebus sabaeus Species 0.000 description 1
- 241000557626 Corvus corax Species 0.000 description 1
- 241000256054 Culex <genus> Species 0.000 description 1
- 241000256113 Culicidae Species 0.000 description 1
- 206010014596 Encephalitis Japanese B Diseases 0.000 description 1
- 206010014612 Encephalitis viral Diseases 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- 101710204837 Envelope small membrane protein Proteins 0.000 description 1
- 206010019233 Headaches Diseases 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 201000005807 Japanese encephalitis Diseases 0.000 description 1
- 241000710842 Japanese encephalitis virus Species 0.000 description 1
- 101710145006 Lysis protein Proteins 0.000 description 1
- 101710085938 Matrix protein Proteins 0.000 description 1
- 101710127721 Membrane protein Proteins 0.000 description 1
- 241000710185 Mengo virus Species 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 208000010428 Muscle Weakness Diseases 0.000 description 1
- 206010028372 Muscular weakness Diseases 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- 208000025966 Neurological disease Diseases 0.000 description 1
- 101710101547 Non-structural protein NS-S Proteins 0.000 description 1
- 101710141454 Nucleoprotein Proteins 0.000 description 1
- 102100034574 P protein Human genes 0.000 description 1
- 101710181008 P protein Proteins 0.000 description 1
- 206010033645 Pancreatitis Diseases 0.000 description 1
- 206010033799 Paralysis Diseases 0.000 description 1
- 101710177166 Phosphoprotein Proteins 0.000 description 1
- 208000000474 Poliomyelitis Diseases 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- IWUCXVSUMQZMFG-AFCXAGJDSA-N Ribavirin Chemical compound N1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 IWUCXVSUMQZMFG-AFCXAGJDSA-N 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- 108010008038 Synthetic Vaccines Proteins 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 101710137500 T7 RNA polymerase Proteins 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 208000003152 Yellow Fever Diseases 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 238000007792 addition Methods 0.000 description 1
- 210000001691 amnion Anatomy 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 239000010836 blood and blood product Substances 0.000 description 1
- 229940125691 blood product Drugs 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 230000002498 deadly effect Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 108700004025 env Genes Proteins 0.000 description 1
- 101150030339 env gene Proteins 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 239000012737 fresh medium Substances 0.000 description 1
- 231100000869 headache Toxicity 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 230000004727 humoral immunity Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 229940124590 live attenuated vaccine Drugs 0.000 description 1
- 229940023012 live-attenuated vaccine Drugs 0.000 description 1
- 210000001161 mammalian embryo Anatomy 0.000 description 1
- 238000012768 mass vaccination Methods 0.000 description 1
- 229940041323 measles vaccine Drugs 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 230000001617 migratory effect Effects 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- LWGJTAZLEJHCPA-UHFFFAOYSA-N n-(2-chloroethyl)-n-nitrosomorpholine-4-carboxamide Chemical compound ClCCN(N=O)C(=O)N1CCOCC1 LWGJTAZLEJHCPA-UHFFFAOYSA-N 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000000601 reactogenic effect Effects 0.000 description 1
- 229940124551 recombinant vaccine Drugs 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 229960000329 ribavirin Drugs 0.000 description 1
- HZCAHMRRMINHDJ-DBRKOABJSA-N ribavirin Natural products O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1N=CN=C1 HZCAHMRRMINHDJ-DBRKOABJSA-N 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 238000011282 treatment Methods 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 238000002255 vaccination Methods 0.000 description 1
- 229940125575 vaccine candidate Drugs 0.000 description 1
- 201000002498 viral encephalitis Diseases 0.000 description 1
- 230000029812 viral genome replication Effects 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 210000002845 virion Anatomy 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/70—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving virus or bacteriophage
- C12Q1/701—Specific hybridization probes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5256—Virus expressing foreign proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/18011—Paramyxoviridae
- C12N2760/18411—Morbillivirus, e.g. Measles virus, canine distemper
- C12N2760/18441—Use of virus, viral particle or viral elements as a vector
- C12N2760/18443—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/24011—Flaviviridae
- C12N2770/24111—Flavivirus, e.g. yellow fever virus, dengue, JEV
- C12N2770/24122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Virology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Immunology (AREA)
- Biomedical Technology (AREA)
- Analytical Chemistry (AREA)
- Plant Pathology (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicinal Chemistry (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Description
NEW DENGUE AND WEST NILE VIRUSES PROTEINS ANp GENES C(~DINC~
ThIE IIrORE~DINta, ANG ThiEIR L.15E IN YACCINAL, 1'HERAPEIITIG
AND DIAfiNOSTIC APPLICATIONS
introduction The aim of this work is to develop viral vectors expressing different immunogens from the West Nite Encephalitis Virus (UVNV) or the Dengue virus able to induce protective humors! and cellular immune responses against LNNV or Dengue virus Infections. We describe 3 antigens from WNV (the secreted envelope glycoprotein (E}, the heterodimer glycoproteins {pre-Ivl-Ej and tile NS1 protein) and from Dengue virus (the secreted envelope glycoprotein (E), the heterodimer glycoproteins (pre~M-E) and the NS1 protein). These antigens have been derived from West Niie Virus 98-ST1 strain and from Dengue virus.
Any fragment of a r3ucleotidic or aminoacid sequence of the present invention comprising at least 30 nucleotides or 10 aminoacids are part of the present invention.
Any nucleotidic or aminoacid sequence having at least 80°~0 of identity of the sequences of the present invention are part of said inventian provided that the sequences have the capacity to hydridize under strir7gent conditions with the nucleatidic sequence as disclosed or the polynucieotidic sequences capable to be recognized by antibodies raised against any aminmacids sequences as disclosed in the present invention.
Various viral vectors are known and well documented. Ids exarrtpfes, we refer to the use of Hepatitis B virus (French Patent hI° 2636532), or Human Papilloma Virus, ar Polio virus (International patent application n°WO 89 D1516}, o~r Mengo virus (International patent application n°WG 94 2972), or Measles virus (European Patent Application N3 0229~5~1.6 flee on June 20, 2U~2} for the expression of foreign nucleotidic sequences as use#u1 immunogens in therapE:utical, vaccines, or diagnostic fields.
lr~troductic~n WNV
Ftaviviridae are arboviruses (arfhrvpc7d-borne virus} mainly transporketl by mosquitoes and blood-sucking ticks. They are small encapsid~ated viruses and their ~enomES consist of infectious singe-stranded anr! iine~r RNA of positive pt~larity. in y Y
Man, flaviviruses cause deadly Yremarrhagic fever or meningc~-encephalitis.
Yellow fever, dengue fever and Japanese encephalitis are the main, tropical flaviviroses.
ether' important human f9aviviroses are Saint houis encephalitis, tickrbarn European encephalitis and West Nile fever.
West Nile fever is a zoonosis associated with a flavivirus which was first isolated in Uganda in 1937. Its transmission cycle calls for birds as the main resevoir and for blood sucking mosquitoes of the Cut~x genus as vectors. Migratory virsmic birds transport the virus to far-away regions where they transmit ii: anew to ornithophile mosquitoes of the Culex genus. IVtany species of mammals ;are permissive for the West Niie virus. Horses are particularly sensitive t~ the disease but dcy riot participate irt the cycle of transmission. West Nile fever is endemic in Affica, Asia, Europe 'and Australia. Phylogenic studies have revealed the existence of fiwo strains of viruses viral line 1 has a worldwide distribution, and viral line ~ is essentially African. ~6iral line 1 was responsible far enzooties in Romania ~19g~), Russia (1999), Israel {1998-2000) and mare recently in Forth America where the virus had never been detected before 1999. The viral strains isolated during the recent epidemics in Israel and the United-States are more than 99,7 °/o identical. In the Diddle-East and Norkh America, where the virus has taken root, an important bird rrlortality rate has been observed among infected birds, notably in Caafviclae. In Nortlh America, over x#000 subjects were infected with the West Nile virus, ~5Q of which died between the months of August and December X002. At the present time, zoonosis is observed in all regions of the United States. At the moment, there exists no human vaccine or specific therapy against West Nile fever.
In temperate and subytropical regions, human infections may occur during the fall season. When a subject is bitten by an infected mosquitos, the incubation period larsts approximately one week but Iess than 20 °/a of people infected with the West Nile virus ever go on to clinical manifestations. In its benignant form, the viral infection manifests itself by an undifferentiated febrile state associated with muscular weakness, headaches and abdominal pain. In less than 1°!~, c~f infected subjects, encephalitis or acute aseptic meningitis may occur, Spl~enora~egaly, hepatitis, pancreatitis and myccarditis are also observed. Flask paralyses similar to a poliomyelitis syndrome have recently been reported, but fatal cases of viral encephalitis (b°l° of patients having severe neurological disorders) mainly concern fragile subjects and the aged. Inter-human transmission of tl~e virus has else recently been observed in the United-States in subjects having undergone organ transplants of having been perfused With canfaminated blood products. intro-uterine transmission of the virus has been reported in the United-States. The dev~elopmet~t.nf a hu.rn_a_n vaccine against the West Nile fever is a priority in view of the fact thi~t the zoonoSis has taken root in North America and is expected to propagate in the coming months to Central America, South America and the Caribbean where dengue fever and yelkaw fever are already rampanf.
The present invention will be more readily understood by referring tovthe i_Im...:~... _..._ -.1._.. T4.~~a ~.-...-te.. ..,. :11...-.t....a:.... t ih.... ~ ~ri.. ."-..s~f nr.nlin.ahifiW r of the present inventir~n and are not intended to limit its scope:
Itnodtttcattans ana variations ran be made theCein without deparking from the spirit and scope of the invention. Although any methods and materials similar or equivalent t4 those described herein can be used in the practice for testing of the present invention; the preferred methods and materials are described.
Example 1 : Construc~on of measles viruses (MV) expressing "WNV astd Den'I antigens In order to test their capacity as vaccine candidates against WNV infeotian;
we constructed recombinant Schwarz measles viruses (h~IV~ expressing these WNV:and DEN-1 antigens. The different genes were introduced in an additions( transcription unit in the Schwarz MV cDNA that we previously cloned ~pTl~~-MVSchw) (European Patent Application N° 022918a1.fi filed on June 20, 20U2). After rescue of the different recombin2~nt Slchwarz measles viruses expressing the WNV and DEN-1 genes, (heir capacity to protect mice from a lethal WNV intraperitoneal challenge,. and monkeys from Dengue virus infection will be tested.
MV vector Mass vaccination with live attenuated vaccines floe reducced the incidence of measles and its complications dramatically since it was intrc>'duced in the St)'s. By now, the vaccine has been given to billions of people and is safe and efFieaCious. It induces a very efficient, fife-long CI~~> CD8 and humoral immunity after a single injection of '! 04 T~ID~4. Moreover, it is easy to produce, cheap, and the means to deliver It worldwide already exist. TYte safety of this uaccine is clue to several factors:
!) The stability of the MV genome which explains that reversion to pathoget~icity has never been observed, ii)The impossibility for the MV genome to integrate in host chromosomes since viral replication is exclusively cytoplasmic. iii) The production of the vaccine on safe primary chick embryo fibrobtastic cefls_ Thus, live attenuated ;MV
could provide a safe and efficient pediatric vaccination vector.
MV belongs to the genus l~icrt;bidddvirr~s in the family f~aramyxoviridae. The ~dmonston MV was isolated in 1954 (1), serially passaged on primary human kidney and amnion cells, then adapted to chick embrys~ fibroblasts (CEF) to produce Edmonston A and B seeds (see (?, S) for review). Edmonston E was licensed in as the first MV vaccine. Further passages of ~dmonston ,~ and B on CEF
produced the more attenuated Schwarz and Moraten viruses (4) whose sequences trove recently been shown to be identical (5, 6). Being "reactogenic,'°
Edrnorrston S vaccine was abandoned in 1975 and replaced by the Schwar~IMoraten vaccine. This is now the most commonly used measles vaccine (2, 3).
In a previous work, we constructed an infectious cDNA frorrr a batch of commercial Schwarc vaccine, a widely used MV vaccine (European latent Application N° ~~29'1551_6 filed on June 20, ~~2). The extremit;es of the cDNA
were engineered in order to maximize virus yield during rescue. A previously described helper cell-based rescue system was adapted by co-cultivating tr'ansfected cells on primary chick embryo fibroblasts, the cells used to produce the Schwarz vaccine. After two passages the sequence of the rescued virus was identical to that Of the cDNA and of the published Schwarz sequence. Two additional transcription units {ATU) were introdurxd in She cDNA for cloning foreign genetic material.
The immunogenicity of rescued virus was studied in mice transg~;nic for the C1~4~6 MV
receptor and in macaques. Antibody titers in animals inoculated with low doses of the rescued virus were identical to those obtained with commercial Schwarz MV
vaccine.
In contrast, the immunogenicity of a previously described Edmonston strain-derived MV clone was much lower, This new molecular clone allows producing MV vaccine without having to rely on seed stocks. The ATtJs, allow producing recombinant vaccines based on an approved, efficient and worldwide used vaccine strain.
F~cample 2: Construction of ~chwarz M~'-VI~NV recombinant plasmids.
~) Secreted glyccrprateln E frr~r» YIdIVV
The WNV env gene encoding the secreted form of the protein was generated by RT-PCR amplification of viral RNA pucsfied from viral particles ('WNV IS-strain), The specific sequence was amplified wing Pfr~Turbo DNA polymerase ~Stratagerte} and specific primers that contain unique sites for suiasectuent cloning in pTM-~ItVSehw vector : HIV-VIINEnv~~ 5'-TATCGTACGATGAGAGTTCaTGTTTGTGGTGCTA--3' (BsiWt site underlined) and fUIV-WNEnv3 5'-ATAGCGCGCTTAGACAGCCTTGCCAACTGAr3' (BssNIJ site urtderiir~ed). A start and a stop colon were adtfed at both ends of the gene.
The Hrhole settuence generated is '138() nucleotides long, including the start and the stt~p colons and respects the rule of six", stipulating that the nuct~:otides number of MV
genome must be divisible by 6 (7, 8}. The Ertv protein thus generated contains its signal pcptido en N-term (18 aa) end no transmemE~r~np rp~inn Thm, If rPpr~:~Prsts. _.. _.._.. ... ..
amino acids 27~-T32 in WNV polyprotein and has the following sequence SEQIbN°1 ~
atgagagttgtgtttgtcgtgctattgcttttggtggccccagcttacagcttcaactgc;cttggaatgagcaacaga g acttattggaaggagtgtctggagcaacatgggtggatttggttctcgaaggcgacagctgcgtgactatcatgtct aaggacaagcctaccatcgatgtgaagatgwtgaatutg~aggdggtcaacctf~gcagaggxccgcar~ttg ctatttggctaccgtcagcgatctctcoaccaaagctgcgtgcccgaccatgggagaagctcacaatgacaaac gtgctgacccagcttttgtgtgcagacaaggagtggtggacaggggctggggcaacggctgaggattatttggca aaggaagcattgacacatgcgccaaatttgcctgctcta~aaggcaataggaa~gaaccatcttgaaagagaa JJ~J~c"actcaggcag9g~9~>~~'a~'g'c~"d~~~'~~t~~a~'c~'a'~Z~~~a~'~itC~d'g~d-"~''~~t~~ -agaggtgacagtggactgtgaaccacggtcagggattgacaccaatgcatactacgtgatgactgttggaacaa agacgttcttggtccatcgtgagtggttcatgg acctcaa cctcccttgg agcagtg ctg g aagtactgtgtg g egg aacagagagacgttaatggagtttgaggaaccacacgccacgaagcagtctgtgatagcattgggotcat;aag agggagctctgcatcaagctttggctggagccattcctgtggaattttcaagcaacactgtcaagttgacgtcgggt ~tttgaagtgtagagtgaagatggaaaaattgcagttgaagggaacaacctatc~gcgtctgttcaaaggctttGa agtttcttgggactcccgcagacac2tggtc~rcggcactgtggtgttggaattgcagtacactggcacggatggac cttgcaaagttcctatctcgtcagtggcttcattgaacgacctaacgccagtgggc<~gattggtcactgtcaaccctt t tgtttcagtggceacggcr~acgctaaggtcctgattgaattggaaccaccctttggagactcatacatagtggtgg gcagaggagaacaacagatcaatcacca#ggcacaagtctggaagcagcattggcaaagcctttacaacca ccctcaaaggagcgcagagactagccgctctaggagacacagct~ggacfttggatcagttggaggggtgitc acctcagttgggaaggctgtctaa SEt~ iD N° 5 i MRVVFVVLLLLVAPAYSFNCLGMSNF~DFLIGVSGATIWDLVI_EGt~SCVTIMSKD
KPTfDVKMMNMEAVhILAEVRSYCYI-ATVSDLSTKAACPTiIatGEAHNDKRADPAF
VGRQGWDRGWGNGCGLFGKGSIATCAKFACSTKAIGRTILKENlKYEVAIFVHG
PTT~/~SHGNYSTQVGATQAGRFS ITPAAPSYTLKL.GEYGEVI-VDC EPRSG I DTN
AYYVMTVGTKTFLVHREWFttrIDLNLPVVSSAGSTVWRNRETLMEFEEPHATKC~S
VIALGSQEGALHQALAGAIPVEFSSNTVKLTSGHLKCRVKMEKLC~LKGTTYGVC
SKAFKFLGTPApTGHGTWLELQYTGTaGPCK4lPISSVASLNDLTPVGRLV-fVl~
PFVSVATANAKVLIELEPPFGDSYIWGRGEQQINHHWHKSGSSIGKAFT'rTLKG
Af,~I~LAALGpTAWDFGSVGC~VFTSVGKAV'~
Z) preM plus E glycoprofeins from tNNV
The WNV gene encoding the preM plus E glycoprcteins was generated by PCR
ampl~cation of plasmid pVL prM-E.55.1 (clone CNCM I-273 depose le 15 Octobre ADO'!, Philippe Despres). This expression plasmid encodes the pre~M and E
proteins of WNV (6S-98-ST1 strain). The sequence was amplified using PfuTurbo DNA
polymerase (Stratagene} and specific primers that contain unique sites for subseguent cloning in pTM-MVSchw vector v MV-WNpreMES 5'-TATCGTACGATGGAAAAGAAAAGAGGAGGAAAG--3' (BsiWl site underlined) and MV-WNpreME3 5'.-ATAGCGGGGTTAAGCGTGCACGTTGACCaG AG-3' ~BssNll site underlined). A start and a step codan were added at both ends of the gene. The whole sequence generated is 2076 nuclet~tides long, ir~c9uding the start and the stop codons and respects the MV "rule of six". in this canstrcrct, the ~-terminus part of the C protein serves as a prM translocation signal. Bath preM ann E viral glycoproteins are transrnembrane giycoproteins type i. It is presumed ti~at WNV env preME
expressing MV will produce and release muitimeric forms of preM-E heterodimers exhibiting high immunagenic potential. The construct represents arrtino acids 3~D~-~$9 in WNV polyprotein and has the fDllowing sequence SEQ ID N° 2 ~ atgcaaaageaaagaggaggaaagaccggaattgcagtcatgattggcctga~tcgccagcgtaggagcagtt accctctctaacttccaagggaaggtgatgatgacggtaaatgctackgacgtcacagatgtcatcacgattccaa cagctgc~gaaagaacctatgcattgtcagagcaatggatgtgggatacatgtgcgatgatactatcaGttatga atgcccagtgctgtcggCtggtaatgatccagaagacatcgactgttggtgcaca~aagtcagcagtctacgtcag gtatggaagatgcaccaagacacgccactcaagacgcagtcgg aggtcactgacagtgc;agacacacggag aaagcactctagcgaacaagaagggggcttggatggacagcaccaaggccacaaggtatttggtaaaaaca gaatcatggatcttgaggaaccctggatatgccctggtggcagccgtcattggttggatgcttgggagcaacacc _.e:y,__"~_o_~u~,yLU.~ya.~,.ry..s~yy~Jlie.~~a~~ ~~~
=~i6......=...i.4...~.....,~..rr.niiw...r...&r.-mvnnnnra gagacttcttggaaggagtgtc~,qgagcaacatgggtggatttggttctcgaaggcgacagctgcgtgactatcat gtctaaggacaagcctaccatcgatgtgaagatgatgaatatggaggcggtcaa.cctggcagaggtccgcagtt attgctattfggctaccgtcagcgatctctccaccaaagctgcgtgcccgaccatgc~gagaagctcacaatgaca aacgtgctgacccagcttttgtgtgcagacaaggagtggtggacaggggctgg9gcaacggctgcggattatttg gcaaaggaagcattgacacatg Ggccaaatttgcctgctctaccaaggcaatag ga agaaccatcttgaaaga gaatatcaagtacgaagtggccatt~ttgtccatggaccaaCtactgtggagtcgc~acggaaactactccacaca ggttggagccactcaggcagggagattcagcatcactcctgcggcgccttcatacacactaaagctkggagaat atggagaggtg acagtggactgtgaaccacggtcagggattgacaccaatgcatactacgtgatg actgttg g a acaaagacgttcttggtccatcgtgagtggttcatggacctcaacctcccttggagcagtgctggaagtactgtgtg gaggaacagagagacgttaatggagtttgaggaaccacacgccacgaagcagtctgtgatagcattgggctca caagagggagctctgcatcaagcittggctggagccattcctgtggaattttcaagcaacactgtcaagttgacgtc gggtcatttgaagtgtagagtgaagatggaaaaattgCagttgaagggaacaac:ctatggcgtctgttcaaaggc tttcaagtttcttgggactcccgcagacacaggtcacggc~ctg~gtgttgg~attYr-.ant,~~:artnacacggata ._ _ . _ . . _..
gaccttgcaaagttcctatctcgtcagtggcttcattgaacgacctaacgccagtgc~gcagattggtcactgtcaac cctfttgtttcagtggccacggcc2~acgctaaggtcctgattgaattggaaccacccattggagactcatacatagtg gtgggcagaggagaacaacagatcaatcaccattggcacaagtctggaagcagcattggcaaagcctttaca accaccctcaaaggagcgcagagactagccgctctaggagacacagcttgggactttggatcagttggagggg tgttcacCtcagttgggaaggct9tccatcaagtgttcggaggagca~.ccgctcaa:.tgttcaggcatgtcctc~a ..
ataacgcaaggattgctgggggctctcctgttgtggatgggcatcaatgctcgtgataggtccatagctctcacgttt ctcgcagttggaggagttctgctcttcctCtocgtgaacgtgcacgcttaa SEQ !D N° 6 a M~KtCRGGKTGIAVMIGLIASVGAVTI-SNFQGKVMMTVNATDVTDV1TIPTAAGKN
ewr. r.nr."rwrwr~r.er.~o~~r~~rercwn~J'v.d4lL~Vr~~~l'~TllTl9lJ
SRRSRRSL'i'1iQ'1'HGESTL.AIVKKGAWMDSTKATRYLVKTESWILf~I~t-~c~YAwl~~t VIGWM~GSNTMQRVtIFVVLLLtVAPAYSFNCLGMSNRDFLEGV~GATWVDLVL
EGDSCVTlMSKDKPTIDVKMMNMI=AtINLA~VRSYCYLAT~JSDLSTKAACPTMGE
AHNDKRADPAFVCf~c~GVVDRG1NGNGCGLFGKGSIDTCAKFAC~TKAIGRTILI~
FNI~CYEVAIFVHC~P~ESF-~GNYSTQVGATC2~1GRFSlTPAAF'SYTLKLfaEYGEVT
vaCEPRSGIDTNAYYVMIV~TKTFLVHI~EwF~nDLNLPws,sAGS-rVWRNRETL
MEFEEPHATKQSVlALG~QEGALF~iQALAGA(PVEFSSNTVKLTSGHLKCRVKMI=
KLaLKGTTYGVCSKAFKFLGT'f'A~TGHGTVVLELQYTGTL?GPCKVPISGVA SLN
DLTPVGRLVTVNPFVGVATAi~AKVLI~LEPPFGDSYiVVGR.~EQQINHH1NHKSG
SS1G~<AFTTTLKGAQRLAALGDTAWDFGSVGGVFTSVGKAVHQV'FGGAFRSLF
GGMSWiTQGLL~ALLLVIINi~ftJARDRSfALTFL~VGGVLLFf_SVNVHA*
3~ N5? pmteirt from WNV
The WNV NS? gene was generated by RT~PCR amplification of viral RNA , purified from viral particles (WNV° 15-98~5T1 strain). The specific sequence was amplified using PfuTurbo DNA polymerase (~tratagene) and ;specific primers :
MV-WNNS15 5'- TATCGTACGATGAC3GTDGATAGCTGTCAt'>G-3° (BsiWI site underlined} and MV-WNh1S13 ATAGCGCGCTCATTAGGTCTTTTCATCATGTCT(:-3' (~sst~lJ site underlined}. A
start codan was added at the ~' end and two stop codons at the 3' end of the sequence. The whole sequence is 1110 nuCiet~tides long, including the start and the two step colons; thus respecting the "rule of six". The N~1 protein generated contains its signs! peptide sequence in N~terrn (~3 as}. It represents amino acids 769-1136 in WNV polyprotein and has the following sequence r~~~ ~~ N
atgaggtccatagGtctcacgtttctcgcagttggaggagttctgctcttcctctccgtgaacgtgcacgctgacactg ggtgtgccatagacatcagccggcaagagctgagatgtggaagtggagtgttcatacacaatgatgtggaggct tggatggaccggtacaagtattaccctgaaacgccacaaggcctagccaagatc;attcagaaagctcataagg aaggagtgtgcggtctacgatcagtttccagac#ggagcatcaaatgtgggaa9c;agtgaaggacgagctgaa eactcttttgaaggagaatggtgtggaccttagtgtcgtggttgagaaacaggagggaatgtacaagtcagcacc taaacgcctcaccgccaccacggaaaaattggaaattggctggaaggoctggg~gaaagagtattttatttgcac cagaactcgccaacaacacctt#gtggttgatggtccggagaccaac~gaatgtcc:gactcagaatcgcgcttgg aatagcttagaagtggaggattttggattkggtctcaccagcactcggatgttcctgaaggtcagagagagcaaca caactgaatgtgactcgaagatcattggaacggotgtcaagaacaacttggcgat:ccacagtgacctgtcctattg gattgaaagcaggctcaatgatacgtggaagcttgaaagggcagttctgggtgaagtcaa~ttcatgtacgtggc ctgagacgcataccttgtggggcgatggaa#ccttgagagtgacttgataataccagtcacactggcgggaccac gaagcaatcacaatcggagacctgggtacaagacacaaaaccagg9cccatc~ggacgaag9ccgggtag agatlgacttcgattactgcccaggaactacggtcaccctgagtgagagctgcggacaccgtggacctgccactc gcaccaccacagagagcggaaagttgataacagattggtgctgcaggagctgt:accttaccaccactgcgcta ccaaactgacagcggctgttggtatggtatggagatcagacoacagagacatg~~tgaaaagacctaatga SEA Ia P~° T
s MRSIALTFLAVGGVLLFLSVNVHADTGCAIDISRGtELRCtaL~GIfFIHNDVFAWNlDR
YKYYPETPQGLAK11QKAHKEGVG~3LRSVSRLEHQMWF~'uKDf=L.NTLLKENGVD
~.SWVEKQEGMYKSAPKRLTATTEKL.EICzWKAWGKSILF.~.PELANNTFVVDCaPE
TKEGPTQNRAWNSLEVEDFGFGLTSTRMF'LKVRESNTTECf~SKIIGTA~JKNNLAI
HSDLSYWIESRLNDTWKLERAVLGEVKSCTWPETp-ITLWGaDGILESDLIIPVTLAG
PRSNHNRRPGYKTQNQGPWI~FGR~tEIDFDYCP~TI'VTLSESC~~HRGPATRTT
TESGKLITDWCCRSCTLPPLRYC~TDSCaCVVYGMEIRPQRI-If~EKT""
4~ preM-E protein from Dengue type 9 virus The Dengue virus gene encoding the preM plus E glycoproteins was generated by PCR amplification of plasrt~id pVL pINaI~prM+E) (clone 2) I;CC)URAC3EC)T, M.-I~., FRENKIEL, M.-P., DUARTE DDS SANTC)S, C.N., DEUSEL., V. & DFSPRES P.
2000, A-glucosidase inhibitors reduce dengue virus production by affecting the initial steps of virion morphagenesis in the endoplasmic reticuium. ,;lournal of Virology ?'.4:
5~~-57~}. Tills plasmid encodes the pre-M and E glyccproteins of DEN-1 virus (strain FGAl89}. The sequence was amplified using PfuTur6o ~NA polymerase (Stratagene) arid specific primers that contain unique sites fr~r subsequent cloning in pTM-MVSchw vector : MV-pFN1 preMES 5'-TATC~TACGATGAACAGGAGGAAAAGATCCCTG-3' (BsiW! site underlined) and MV-DENIpreME3 5'-ATAGCGCGCTTAAAGCATGACTCCTACaGT ACAG-3' (Bss~'l!
site underlined}. A start and a stop colon were added at both ends of the gene. The whale sequence generated is X040 nucleotides long, including the start and the stop 4:ULlUffrl C&flCi-3t'.:rflt,.'-'G v=~~iv- 6r~;f='::a49-i,if=.3C:a:-'ii~-:~>~.-t:,'J.'.~'.Oe3'~',.t:SG~f=~.'~f-t.--~ ~~'..i~5#-?~.ix?-!'sF:r"~.--'~3~-~'".~~.
- __ C protein serves as a preM transDc~cation signal. Bath preM and ~ virral glycoproteins are transmemfJrane glycoproteiris type 1. It is presumed that f)EN-'! env expressing MV will produce and realease multirrteric farms of preM-E h~sterodirners exhibiting po~ypratem and nas the to~~owmg sequence 5~Q ID N° ~
atgaacaggaggaaaagatccgfigaccatgctcctcatgctgckgcccacagtcctggctttccatttgaccacac gagggggagagccacacatgatagttagtaagcaggaaagaggaaagtcactcttgttr"aagacctctgcagg tgtcaatatgtgcactctcattgcgatggatttgggagagttatgtgaggacacaat~gacktacaaatgcccccgga tcactgaggcggaaccagatgacgttgactgctggtgcaatgccacagacacai:gggtgacctatgggacgtgt tctcaaaccggtgaacaccgacgagacaaacgttccgtggcactggccccaca~cgtgggacttggtctagaaa caagaaccgaaacatggatgtcctctgaaggcgcctggaaacaaatacaaaaagtggagaCttgggctttgag acacccaggattcacggtgatagctcttttfttagcacatgccataggaacatccal:cactcagaaagggatcatttt catkctgctgatgctggtaacaccatcaatggccatgcgatgcgtgggaataggc~aacagagacttcgttgaagg actgtcaggagcaacgtgggtggacgtggtattggagcatggaagctgcgtcac:caccatggcaaaaaataaa ccaacatkggacattgaactcttgaagacggaggtcacgaaccctgccgtcttgcgcaaatkgtgcattgaagcta aaatatcaaacaccaccaccgattcaagatgtccaacacaaggagaggctacactggtggaagaacaagac gcgaactttgtgtgtcgacgaacggttgtggacagaggctggggcaatggctgcggactatttggaaaaggaag cctactgacgtgtgctaagttcaagtgtgtgacaaaactggaaggaaagatagttcaatatc~aaaaGttaaaatat tcagtgatagtcactgtccacacaggggaccagcaccaggtgggaaacgagactacagaacatggaacaatt gcaaccataacacctcaagctcctacgtcggaaatacagktgacagact2~cggaacccttacaotggactgctc acccagaacagggctg gactttaatgaggtggtgotattg acaatgaaagaaaaatcatgg cttgtccacaaac aatggtttctagactta~ccactgccttggacttcgggggcttcaacatcccaagagacttggaacagacaagatttg ctggtcacattcaagacagctcatgcaaagaagcaggaagtagtcgtactgggatcacaggaaggagcaatg cacactgcgttgaccggggcgacagaaatccagacgtcaggaacgacaacaatctttgcaggacacctgaaa tgcagattaaaaatggataaactgactttaaaagggatgtcatatgtgatgtgcacaggctcatttaagctagaga aggaagtggctgagacccagcatggaactgtcctagtgcaggttaaatacgaaggaacagatgcgccatgca agatccccttttcgacccaagatgagaaaggagtgacccagaatgggagattgataacagccaatcccatagtt actgacaaagaaaaaccaatcaacattgagacagaaccaccttttggtgagagctacatt:atagtaggggcag gtgaaaaagctttgaaactaagctggttcaagaaaggaagcagcatagggaaaatgttcgaagcaatcgccc 9a99a9cacgaaggatggctatcctgg9a9acaccgcatgggacttcggctctatagga~ggagtgtttacgtct gtgggaaaattggtacaccaggtttttggaaccgcatacggggtcctgttcagcgc,,~cgtttcttggaccatgaaaa t aggaatagggafcttgctgacatggttgggattaaatfcaaggagcgcgtcgcttt~cc~atgacgtgcatfgcagfit g gcatggttacactgtacctaggagtcatggtttaa "~ ') SEA ID 1~i 8 TLIAMDLGELCEDTMTYKCPRiTEAEP~DVDCWVCNATDTbWTYGTCSQTGEHR
RDKRSVALAPHVGLGLETRTETWMSSEGAWKt~IQKVETL'VALRHPGFTVIALFLA
HAIGTSITG~KGIIFILLIVILVTPSMAMRGVGIGNRDFVEGLSC9ATWVDVVLEHGSGV
TfMAKNKPTLI~IELLKTEVTNPAVI_RKLGIEAKiSNTTTDSR;~PTC~G~ATLVEEQD
ANFVCRRTVVDRGWGrJGCGLFrjKGSLLTGAKFKCVT'KLE:GK1V(~YENL.KYSVIV
TVHTGDC~HQVCaNETTEI-#GTIATITPC,ZAPTSEIQLTDYGTLI'LDCSI~RTGLDFNEV
VLLTMKEKSWLVHKc~WFLDLPLPWTSGASTSQETWNRQDLLVTFKTAHAKKQE
VVVLGSC~EGAMHTALTGATEIC~TSG I-TT9FAGHLKCRLKMDKLTLKGMSYVMCT
GSFKLEKEVAETc~.HGTVLVQVKYEGTDAPCKiPFSTC~DEKGVTQNGRLITANPIV
TDKEKPINIETEPPFGESYIIVGAGEKALKLSWFKKGSSIG~;~IIFEAIARGARRMAIL
GDTAWDFGSIGGVFTSVGKL\iHQVFGTAYtaVLFSGVBW TMKiG#GILLTWLGLN
SRSAS LSMTCIAVGMVTLYLGVMV*
The same immunogens can be pr~:pared by the same way from C1EN-2, DEN-~ .arid DE1~-~ serotypes.
5j Insertion into M1~ Schwarz vecfc~r The different WNV and ~EN-1 nuclec~tir~ic sequences were cloned ire pGR2.1-Tf~PO p9asmid {lnvitrogen~ and sequenced to cheok that no mutations were introduced. After BsillVlIBssHll digestion of the pCR2_1-TOPC7 plasmids, the fragments were cloned in the pTM-MVSchw ve~aor irr ATU position 2 giving plasrnids pTM-MVSchw-Env",,NV, pTM-MVSchw-preMEWn~, pTM-MVSchw-NSIwNV and pTM-MVSchW-preMEpEN-~ accordEng to Figure 1.
~,--.-..., ", a np ""~ 156D Gp y 2916 Cp CBJ-1 p"d!~
i.-..~T----- n 2asc by er~m _ &sN
r/ ~
~n;~'~ ~~ r--~.A =,i ~
1Da bA
~
j 7 hh (iE'I'U
pps 35 pTM-M'I~SChw- WNV
Figure 1. Schert~atic map of the pTM-MVSchw recambinant plasmids described ~xarn~le 3 . Recovery of recnr~binarrt ~lVSchvr-Ec~Vw,~v, MYSahw-~reMEw,"~ ~la~d MVSchw-NS9wNy viruses.
T~ reCOVef f~Ca,arTT~felalti .at;flYSiaTZ--~'3iu~rif vile ~~i~Si11id3;..~~-.UJy - ~~~-.. _I-- __....-._ helper~cell-based rescue system d2scribcd -by--Radec~ et-a'---{9;-~r~-r-:aodiffed b; ' -i Parks et al. {10}. Human helper cells stabiy expressing T7 RNA polymerase and measles N and P proteins (293-3-46 cells, a kind gift from IVIA Billeter) were ' transfected using the calcium phosphate procedure with pTM-tvlVSchw-!~nvurNV, pTM-M'1/''v-ChW-prBMEwnv or pTM-MVSchw-NSIu"~~ plasmids (5 pg~ a.nd a plasmid I
expressing the MV polymerase ~ gene {pEMC-La, ~0 ng, a kind gift from MA
Eilleter).
After overnight incubation at 37° C, the transfectian medium was replaced by fresh medium and a heat shock was applied (43° C for two hours) 1;10). Af~.er two days of Sr,.-~ ~~. .,+~.. .~+ QZ.° _ f fr f r~~,..g ) a rA tY C fr: f'I i ~ ~
C~?Ilfi. IFIVP..C ~11d i InGU~c7~eC~c9t JG Cr flC-uf~,s~! ~ cl~c~~~iy ~'uer~.rsti~wWi~illcW .I~o~a~~~'-~~wmsr msw.~.yw~u _ originally selected on CEF cells and is currently grown ,an these cells for safety considerations. Infectious ~rirus was easily recovered between 3 and ~ days following cocultivatiori. Syncytia appeared c~GCasianally in REF= but not systematically. The recombinant viruses were also resaaed by the same technique after cocultivation of transfected 293-3-~6 hetper cells at 3?° C with primate Vere~ cells {africart green monkey kidney. In this case, syncytia appeared systematic~~lly in call transfectiQns after 2 days of Goculture. In order to increase the yield crf rescue and because these recombinant viruses will be used in mice experiments, we usi::d Vert~ cells as target cells in place of the usual Ghick embryo fibrablasts (CE.F) (European Patent Application NG 022915~1.fi fifes on June 20, 2802). Recombinant virl~ses were i passaged two times on Vera cells. Mlle have previooasly shown that two passages ofi I
the Schwarz virus ors Vera cells did not change its immunogenic capacities in macaques (European Patent Application N° 022915b1.6 files on June ~0, 2002).
The recombinant viruses were prepared as described abcwe send the expression of the transgene in infected Gells was checked by immunofluc~rescence. To detect t WNV Envelope giycoproteins expression, we used irnrr~une sera from mice resistant to WNV infection (3nternatic~nal Patent Application Wc~ 0210817'4'1 ).'To detect NSs protein expression, we used anti-NS1 Monoclonal antiobadies {International Patent Application N° WO ~01756fi5).
>Biibhography WNV
Anderson, J.F., and Rahal, J.J. (2002). Efficacy of interferon alpha-?.b and ribavirin against West Nile virus infection.
Anonymous 0042)_ Intrauterine West Nile virus infection-New Ynric, 2002. MMINR
Morb Marta~ fNkly Rep. 51 :1135-11336.
Brintan, M.A. (2U02). The molecular biology of West tile virus: a nevv invader of the Western Hemisphere. Anna. Rev. NNcrabiat. 58: 371-x.42 Campbell, G., Marfin, A.A., Lanciotti, R.B., Cubler, 1~.J. {2002}. West Nile virus. Tfre Lancef 2: 519-529 I
Crupi RS, Asnis DS, Lee CC, Santucci T, Marino P~J, Flanz 5,.1. (2003).
Meet9ng the challenge of bioterrorism: Lessons learned from blest Nile virus and anthrax.
~4rn J
Emerg Med. 21:77-9.
Glass, J.D., Samuels, tJ,, Rich, M.M. (2002). Poliorr~yelitis due to Vllest Nile virus. N.
Engl. ,l. Med. Sep. 23 Lanciotti, R.S,, Ebei., G.D., Deubel, V., and al. {2002). Complete genome sequence analysis of West Nile virus strains isolated from the l.lnited States, ~:urope, anti the i Middie East. Virology 298 : 9B-105 Petsrsen, L.R., Raehrig, J.T., Hughes, J.M. {2p02). We5t NEIe vBCUS
encephalitis. dU_ I
Engl. J. Med. 347: 1225-1226 I
G~uirk, M. (2002). First treatment trio! for West Nils infection faegins.
f'lre f.anCet 2 : j 589 i i Tesh RB, Arroyo ,t, Travassas Da Rosa A~, Guzman H, Xiao SY, Monath TP.
(2002). , Efficacy of kiiled vircs vaccine, live attenuated chimeria virus vaaeine, and passive i immunization far prevention of West Nile virus encephalitis in hEamster rnadel. ~ri~erg lrtf~ct Dis. $:1392-1397.
~n~th TP, Arroyo J, Miller C, Guirakhoo F. {2001). West Mile virus vaccine.
burr ag Targets Infect ~isord. 1 :37-50.
~Iingraphy ~tIV
I=nders, .~. F. & Peebles, T. ~. (1954) Proc. hoc. Exp. Bic~d. fed. 86, 277-286.
griffin, D. (2c701} in Field's V!t'o~ogy, 4th ~difaon, eds. Knipe, fib. &
Howiey, P.
(i-ippincott - Raven Publishers, Philadelphia)" Voi. 2, pp. 14Q1-1 X4'1.
Hiifeman, M. (2002} V~ccirre 20, &51-665.
Schwarz, A. {1962) Arn. .i. Des. ~h~ld. 103, 216-2'99.
Parks, G. L., Lerch, R. A., V'dalpita, P., Wang, I~i. P., Sidhu, . S. 8 Udern, S_ (2061 ) J Vrrol 75, 910-20.
Parks, C. L., Lercn, F~. A., V~dalpita, P., Wang, t-!. P., Sid~hu, M. S. &
Udem, S.
(26Q1} J VfreJTS, 921-33.
Caiain, P. ~ Raux, L. (1993) J ldirc~! 67, 482-30.
Sehnei~let', H., Kaeiin, K. ~ Billeter, iVl. A. {1997) 'Jirology~ X27, 3.14-22.
Radecke, fF., Spielhof~r, P., Schneider, H., Kaelin, K., fiut~er, M., Dotsch, C., Christiansen, G. & Biileter, M. A. {1995) Emb~ J 14, 577;3-84.
Perks, C. ~., Lerch, R. A.. llltaipita, P., Sidhc~, M. ~. & Udem, S. A. (1999) J
of 73, 3560-C.
ThIE IIrORE~DINta, ANG ThiEIR L.15E IN YACCINAL, 1'HERAPEIITIG
AND DIAfiNOSTIC APPLICATIONS
introduction The aim of this work is to develop viral vectors expressing different immunogens from the West Nite Encephalitis Virus (UVNV) or the Dengue virus able to induce protective humors! and cellular immune responses against LNNV or Dengue virus Infections. We describe 3 antigens from WNV (the secreted envelope glycoprotein (E}, the heterodimer glycoproteins {pre-Ivl-Ej and tile NS1 protein) and from Dengue virus (the secreted envelope glycoprotein (E), the heterodimer glycoproteins (pre~M-E) and the NS1 protein). These antigens have been derived from West Niie Virus 98-ST1 strain and from Dengue virus.
Any fragment of a r3ucleotidic or aminoacid sequence of the present invention comprising at least 30 nucleotides or 10 aminoacids are part of the present invention.
Any nucleotidic or aminoacid sequence having at least 80°~0 of identity of the sequences of the present invention are part of said inventian provided that the sequences have the capacity to hydridize under strir7gent conditions with the nucleatidic sequence as disclosed or the polynucieotidic sequences capable to be recognized by antibodies raised against any aminmacids sequences as disclosed in the present invention.
Various viral vectors are known and well documented. Ids exarrtpfes, we refer to the use of Hepatitis B virus (French Patent hI° 2636532), or Human Papilloma Virus, ar Polio virus (International patent application n°WO 89 D1516}, o~r Mengo virus (International patent application n°WG 94 2972), or Measles virus (European Patent Application N3 0229~5~1.6 flee on June 20, 2U~2} for the expression of foreign nucleotidic sequences as use#u1 immunogens in therapE:utical, vaccines, or diagnostic fields.
lr~troductic~n WNV
Ftaviviridae are arboviruses (arfhrvpc7d-borne virus} mainly transporketl by mosquitoes and blood-sucking ticks. They are small encapsid~ated viruses and their ~enomES consist of infectious singe-stranded anr! iine~r RNA of positive pt~larity. in y Y
Man, flaviviruses cause deadly Yremarrhagic fever or meningc~-encephalitis.
Yellow fever, dengue fever and Japanese encephalitis are the main, tropical flaviviroses.
ether' important human f9aviviroses are Saint houis encephalitis, tickrbarn European encephalitis and West Nile fever.
West Nile fever is a zoonosis associated with a flavivirus which was first isolated in Uganda in 1937. Its transmission cycle calls for birds as the main resevoir and for blood sucking mosquitoes of the Cut~x genus as vectors. Migratory virsmic birds transport the virus to far-away regions where they transmit ii: anew to ornithophile mosquitoes of the Culex genus. IVtany species of mammals ;are permissive for the West Niie virus. Horses are particularly sensitive t~ the disease but dcy riot participate irt the cycle of transmission. West Nile fever is endemic in Affica, Asia, Europe 'and Australia. Phylogenic studies have revealed the existence of fiwo strains of viruses viral line 1 has a worldwide distribution, and viral line ~ is essentially African. ~6iral line 1 was responsible far enzooties in Romania ~19g~), Russia (1999), Israel {1998-2000) and mare recently in Forth America where the virus had never been detected before 1999. The viral strains isolated during the recent epidemics in Israel and the United-States are more than 99,7 °/o identical. In the Diddle-East and Norkh America, where the virus has taken root, an important bird rrlortality rate has been observed among infected birds, notably in Caafviclae. In Nortlh America, over x#000 subjects were infected with the West Nile virus, ~5Q of which died between the months of August and December X002. At the present time, zoonosis is observed in all regions of the United States. At the moment, there exists no human vaccine or specific therapy against West Nile fever.
In temperate and subytropical regions, human infections may occur during the fall season. When a subject is bitten by an infected mosquitos, the incubation period larsts approximately one week but Iess than 20 °/a of people infected with the West Nile virus ever go on to clinical manifestations. In its benignant form, the viral infection manifests itself by an undifferentiated febrile state associated with muscular weakness, headaches and abdominal pain. In less than 1°!~, c~f infected subjects, encephalitis or acute aseptic meningitis may occur, Spl~enora~egaly, hepatitis, pancreatitis and myccarditis are also observed. Flask paralyses similar to a poliomyelitis syndrome have recently been reported, but fatal cases of viral encephalitis (b°l° of patients having severe neurological disorders) mainly concern fragile subjects and the aged. Inter-human transmission of tl~e virus has else recently been observed in the United-States in subjects having undergone organ transplants of having been perfused With canfaminated blood products. intro-uterine transmission of the virus has been reported in the United-States. The dev~elopmet~t.nf a hu.rn_a_n vaccine against the West Nile fever is a priority in view of the fact thi~t the zoonoSis has taken root in North America and is expected to propagate in the coming months to Central America, South America and the Caribbean where dengue fever and yelkaw fever are already rampanf.
The present invention will be more readily understood by referring tovthe i_Im...:~... _..._ -.1._.. T4.~~a ~.-...-te.. ..,. :11...-.t....a:.... t ih.... ~ ~ri.. ."-..s~f nr.nlin.ahifiW r of the present inventir~n and are not intended to limit its scope:
Itnodtttcattans ana variations ran be made theCein without deparking from the spirit and scope of the invention. Although any methods and materials similar or equivalent t4 those described herein can be used in the practice for testing of the present invention; the preferred methods and materials are described.
Example 1 : Construc~on of measles viruses (MV) expressing "WNV astd Den'I antigens In order to test their capacity as vaccine candidates against WNV infeotian;
we constructed recombinant Schwarz measles viruses (h~IV~ expressing these WNV:and DEN-1 antigens. The different genes were introduced in an additions( transcription unit in the Schwarz MV cDNA that we previously cloned ~pTl~~-MVSchw) (European Patent Application N° 022918a1.fi filed on June 20, 20U2). After rescue of the different recombin2~nt Slchwarz measles viruses expressing the WNV and DEN-1 genes, (heir capacity to protect mice from a lethal WNV intraperitoneal challenge,. and monkeys from Dengue virus infection will be tested.
MV vector Mass vaccination with live attenuated vaccines floe reducced the incidence of measles and its complications dramatically since it was intrc>'duced in the St)'s. By now, the vaccine has been given to billions of people and is safe and efFieaCious. It induces a very efficient, fife-long CI~~> CD8 and humoral immunity after a single injection of '! 04 T~ID~4. Moreover, it is easy to produce, cheap, and the means to deliver It worldwide already exist. TYte safety of this uaccine is clue to several factors:
!) The stability of the MV genome which explains that reversion to pathoget~icity has never been observed, ii)The impossibility for the MV genome to integrate in host chromosomes since viral replication is exclusively cytoplasmic. iii) The production of the vaccine on safe primary chick embryo fibrobtastic cefls_ Thus, live attenuated ;MV
could provide a safe and efficient pediatric vaccination vector.
MV belongs to the genus l~icrt;bidddvirr~s in the family f~aramyxoviridae. The ~dmonston MV was isolated in 1954 (1), serially passaged on primary human kidney and amnion cells, then adapted to chick embrys~ fibroblasts (CEF) to produce Edmonston A and B seeds (see (?, S) for review). Edmonston E was licensed in as the first MV vaccine. Further passages of ~dmonston ,~ and B on CEF
produced the more attenuated Schwarz and Moraten viruses (4) whose sequences trove recently been shown to be identical (5, 6). Being "reactogenic,'°
Edrnorrston S vaccine was abandoned in 1975 and replaced by the Schwar~IMoraten vaccine. This is now the most commonly used measles vaccine (2, 3).
In a previous work, we constructed an infectious cDNA frorrr a batch of commercial Schwarc vaccine, a widely used MV vaccine (European latent Application N° ~~29'1551_6 filed on June 20, ~~2). The extremit;es of the cDNA
were engineered in order to maximize virus yield during rescue. A previously described helper cell-based rescue system was adapted by co-cultivating tr'ansfected cells on primary chick embryo fibroblasts, the cells used to produce the Schwarz vaccine. After two passages the sequence of the rescued virus was identical to that Of the cDNA and of the published Schwarz sequence. Two additional transcription units {ATU) were introdurxd in She cDNA for cloning foreign genetic material.
The immunogenicity of rescued virus was studied in mice transg~;nic for the C1~4~6 MV
receptor and in macaques. Antibody titers in animals inoculated with low doses of the rescued virus were identical to those obtained with commercial Schwarz MV
vaccine.
In contrast, the immunogenicity of a previously described Edmonston strain-derived MV clone was much lower, This new molecular clone allows producing MV vaccine without having to rely on seed stocks. The ATtJs, allow producing recombinant vaccines based on an approved, efficient and worldwide used vaccine strain.
F~cample 2: Construction of ~chwarz M~'-VI~NV recombinant plasmids.
~) Secreted glyccrprateln E frr~r» YIdIVV
The WNV env gene encoding the secreted form of the protein was generated by RT-PCR amplification of viral RNA pucsfied from viral particles ('WNV IS-strain), The specific sequence was amplified wing Pfr~Turbo DNA polymerase ~Stratagerte} and specific primers that contain unique sites for suiasectuent cloning in pTM-~ItVSehw vector : HIV-VIINEnv~~ 5'-TATCGTACGATGAGAGTTCaTGTTTGTGGTGCTA--3' (BsiWt site underlined) and fUIV-WNEnv3 5'-ATAGCGCGCTTAGACAGCCTTGCCAACTGAr3' (BssNIJ site urtderiir~ed). A start and a stop colon were adtfed at both ends of the gene.
The Hrhole settuence generated is '138() nucleotides long, including the start and the stt~p colons and respects the rule of six", stipulating that the nuct~:otides number of MV
genome must be divisible by 6 (7, 8}. The Ertv protein thus generated contains its signal pcptido en N-term (18 aa) end no transmemE~r~np rp~inn Thm, If rPpr~:~Prsts. _.. _.._.. ... ..
amino acids 27~-T32 in WNV polyprotein and has the following sequence SEQIbN°1 ~
atgagagttgtgtttgtcgtgctattgcttttggtggccccagcttacagcttcaactgc;cttggaatgagcaacaga g acttattggaaggagtgtctggagcaacatgggtggatttggttctcgaaggcgacagctgcgtgactatcatgtct aaggacaagcctaccatcgatgtgaagatgwtgaatutg~aggdggtcaacctf~gcagaggxccgcar~ttg ctatttggctaccgtcagcgatctctcoaccaaagctgcgtgcccgaccatgggagaagctcacaatgacaaac gtgctgacccagcttttgtgtgcagacaaggagtggtggacaggggctggggcaacggctgaggattatttggca aaggaagcattgacacatgcgccaaatttgcctgctcta~aaggcaataggaa~gaaccatcttgaaagagaa JJ~J~c"actcaggcag9g~9~>~~'a~'g'c~"d~~~'~~t~~a~'c~'a'~Z~~~a~'~itC~d'g~d-"~''~~t~~ -agaggtgacagtggactgtgaaccacggtcagggattgacaccaatgcatactacgtgatgactgttggaacaa agacgttcttggtccatcgtgagtggttcatgg acctcaa cctcccttgg agcagtg ctg g aagtactgtgtg g egg aacagagagacgttaatggagtttgaggaaccacacgccacgaagcagtctgtgatagcattgggotcat;aag agggagctctgcatcaagctttggctggagccattcctgtggaattttcaagcaacactgtcaagttgacgtcgggt ~tttgaagtgtagagtgaagatggaaaaattgcagttgaagggaacaacctatc~gcgtctgttcaaaggctttGa agtttcttgggactcccgcagacac2tggtc~rcggcactgtggtgttggaattgcagtacactggcacggatggac cttgcaaagttcctatctcgtcagtggcttcattgaacgacctaacgccagtgggc<~gattggtcactgtcaaccctt t tgtttcagtggceacggcr~acgctaaggtcctgattgaattggaaccaccctttggagactcatacatagtggtgg gcagaggagaacaacagatcaatcacca#ggcacaagtctggaagcagcattggcaaagcctttacaacca ccctcaaaggagcgcagagactagccgctctaggagacacagct~ggacfttggatcagttggaggggtgitc acctcagttgggaaggctgtctaa SEt~ iD N° 5 i MRVVFVVLLLLVAPAYSFNCLGMSNF~DFLIGVSGATIWDLVI_EGt~SCVTIMSKD
KPTfDVKMMNMEAVhILAEVRSYCYI-ATVSDLSTKAACPTiIatGEAHNDKRADPAF
VGRQGWDRGWGNGCGLFGKGSIATCAKFACSTKAIGRTILKENlKYEVAIFVHG
PTT~/~SHGNYSTQVGATQAGRFS ITPAAPSYTLKL.GEYGEVI-VDC EPRSG I DTN
AYYVMTVGTKTFLVHREWFttrIDLNLPVVSSAGSTVWRNRETLMEFEEPHATKC~S
VIALGSQEGALHQALAGAIPVEFSSNTVKLTSGHLKCRVKMEKLC~LKGTTYGVC
SKAFKFLGTPApTGHGTWLELQYTGTaGPCK4lPISSVASLNDLTPVGRLV-fVl~
PFVSVATANAKVLIELEPPFGDSYIWGRGEQQINHHWHKSGSSIGKAFT'rTLKG
Af,~I~LAALGpTAWDFGSVGC~VFTSVGKAV'~
Z) preM plus E glycoprofeins from tNNV
The WNV gene encoding the preM plus E glycoprcteins was generated by PCR
ampl~cation of plasmid pVL prM-E.55.1 (clone CNCM I-273 depose le 15 Octobre ADO'!, Philippe Despres). This expression plasmid encodes the pre~M and E
proteins of WNV (6S-98-ST1 strain). The sequence was amplified using PfuTurbo DNA
polymerase (Stratagene} and specific primers that contain unique sites for subseguent cloning in pTM-MVSchw vector v MV-WNpreMES 5'-TATCGTACGATGGAAAAGAAAAGAGGAGGAAAG--3' (BsiWl site underlined) and MV-WNpreME3 5'.-ATAGCGGGGTTAAGCGTGCACGTTGACCaG AG-3' ~BssNll site underlined). A start and a step codan were added at both ends of the gene. The whole sequence generated is 2076 nuclet~tides long, ir~c9uding the start and the stop codons and respects the MV "rule of six". in this canstrcrct, the ~-terminus part of the C protein serves as a prM translocation signal. Bath preM ann E viral glycoproteins are transrnembrane giycoproteins type i. It is presumed ti~at WNV env preME
expressing MV will produce and release muitimeric forms of preM-E heterodimers exhibiting high immunagenic potential. The construct represents arrtino acids 3~D~-~$9 in WNV polyprotein and has the fDllowing sequence SEQ ID N° 2 ~ atgcaaaageaaagaggaggaaagaccggaattgcagtcatgattggcctga~tcgccagcgtaggagcagtt accctctctaacttccaagggaaggtgatgatgacggtaaatgctackgacgtcacagatgtcatcacgattccaa cagctgc~gaaagaacctatgcattgtcagagcaatggatgtgggatacatgtgcgatgatactatcaGttatga atgcccagtgctgtcggCtggtaatgatccagaagacatcgactgttggtgcaca~aagtcagcagtctacgtcag gtatggaagatgcaccaagacacgccactcaagacgcagtcgg aggtcactgacagtgc;agacacacggag aaagcactctagcgaacaagaagggggcttggatggacagcaccaaggccacaaggtatttggtaaaaaca gaatcatggatcttgaggaaccctggatatgccctggtggcagccgtcattggttggatgcttgggagcaacacc _.e:y,__"~_o_~u~,yLU.~ya.~,.ry..s~yy~Jlie.~~a~~ ~~~
=~i6......=...i.4...~.....,~..rr.niiw...r...&r.-mvnnnnra gagacttcttggaaggagtgtc~,qgagcaacatgggtggatttggttctcgaaggcgacagctgcgtgactatcat gtctaaggacaagcctaccatcgatgtgaagatgatgaatatggaggcggtcaa.cctggcagaggtccgcagtt attgctattfggctaccgtcagcgatctctccaccaaagctgcgtgcccgaccatgc~gagaagctcacaatgaca aacgtgctgacccagcttttgtgtgcagacaaggagtggtggacaggggctgg9gcaacggctgcggattatttg gcaaaggaagcattgacacatg Ggccaaatttgcctgctctaccaaggcaatag ga agaaccatcttgaaaga gaatatcaagtacgaagtggccatt~ttgtccatggaccaaCtactgtggagtcgc~acggaaactactccacaca ggttggagccactcaggcagggagattcagcatcactcctgcggcgccttcatacacactaaagctkggagaat atggagaggtg acagtggactgtgaaccacggtcagggattgacaccaatgcatactacgtgatg actgttg g a acaaagacgttcttggtccatcgtgagtggttcatggacctcaacctcccttggagcagtgctggaagtactgtgtg gaggaacagagagacgttaatggagtttgaggaaccacacgccacgaagcagtctgtgatagcattgggctca caagagggagctctgcatcaagcittggctggagccattcctgtggaattttcaagcaacactgtcaagttgacgtc gggtcatttgaagtgtagagtgaagatggaaaaattgCagttgaagggaacaac:ctatggcgtctgttcaaaggc tttcaagtttcttgggactcccgcagacacaggtcacggc~ctg~gtgttgg~attYr-.ant,~~:artnacacggata ._ _ . _ . . _..
gaccttgcaaagttcctatctcgtcagtggcttcattgaacgacctaacgccagtgc~gcagattggtcactgtcaac cctfttgtttcagtggccacggcc2~acgctaaggtcctgattgaattggaaccacccattggagactcatacatagtg gtgggcagaggagaacaacagatcaatcaccattggcacaagtctggaagcagcattggcaaagcctttaca accaccctcaaaggagcgcagagactagccgctctaggagacacagcttgggactttggatcagttggagggg tgttcacCtcagttgggaaggct9tccatcaagtgttcggaggagca~.ccgctcaa:.tgttcaggcatgtcctc~a ..
ataacgcaaggattgctgggggctctcctgttgtggatgggcatcaatgctcgtgataggtccatagctctcacgttt ctcgcagttggaggagttctgctcttcctCtocgtgaacgtgcacgcttaa SEQ !D N° 6 a M~KtCRGGKTGIAVMIGLIASVGAVTI-SNFQGKVMMTVNATDVTDV1TIPTAAGKN
ewr. r.nr."rwrwr~r.er.~o~~r~~rercwn~J'v.d4lL~Vr~~~l'~TllTl9lJ
SRRSRRSL'i'1iQ'1'HGESTL.AIVKKGAWMDSTKATRYLVKTESWILf~I~t-~c~YAwl~~t VIGWM~GSNTMQRVtIFVVLLLtVAPAYSFNCLGMSNRDFLEGV~GATWVDLVL
EGDSCVTlMSKDKPTIDVKMMNMI=AtINLA~VRSYCYLAT~JSDLSTKAACPTMGE
AHNDKRADPAFVCf~c~GVVDRG1NGNGCGLFGKGSIDTCAKFAC~TKAIGRTILI~
FNI~CYEVAIFVHC~P~ESF-~GNYSTQVGATC2~1GRFSlTPAAF'SYTLKLfaEYGEVT
vaCEPRSGIDTNAYYVMIV~TKTFLVHI~EwF~nDLNLPws,sAGS-rVWRNRETL
MEFEEPHATKQSVlALG~QEGALF~iQALAGA(PVEFSSNTVKLTSGHLKCRVKMI=
KLaLKGTTYGVCSKAFKFLGT'f'A~TGHGTVVLELQYTGTL?GPCKVPISGVA SLN
DLTPVGRLVTVNPFVGVATAi~AKVLI~LEPPFGDSYiVVGR.~EQQINHH1NHKSG
SS1G~<AFTTTLKGAQRLAALGDTAWDFGSVGGVFTSVGKAVHQV'FGGAFRSLF
GGMSWiTQGLL~ALLLVIINi~ftJARDRSfALTFL~VGGVLLFf_SVNVHA*
3~ N5? pmteirt from WNV
The WNV NS? gene was generated by RT~PCR amplification of viral RNA , purified from viral particles (WNV° 15-98~5T1 strain). The specific sequence was amplified using PfuTurbo DNA polymerase (~tratagene) and ;specific primers :
MV-WNNS15 5'- TATCGTACGATGAC3GTDGATAGCTGTCAt'>G-3° (BsiWI site underlined} and MV-WNh1S13 ATAGCGCGCTCATTAGGTCTTTTCATCATGTCT(:-3' (~sst~lJ site underlined}. A
start codan was added at the ~' end and two stop codons at the 3' end of the sequence. The whole sequence is 1110 nuCiet~tides long, including the start and the two step colons; thus respecting the "rule of six". The N~1 protein generated contains its signs! peptide sequence in N~terrn (~3 as}. It represents amino acids 769-1136 in WNV polyprotein and has the following sequence r~~~ ~~ N
atgaggtccatagGtctcacgtttctcgcagttggaggagttctgctcttcctctccgtgaacgtgcacgctgacactg ggtgtgccatagacatcagccggcaagagctgagatgtggaagtggagtgttcatacacaatgatgtggaggct tggatggaccggtacaagtattaccctgaaacgccacaaggcctagccaagatc;attcagaaagctcataagg aaggagtgtgcggtctacgatcagtttccagac#ggagcatcaaatgtgggaa9c;agtgaaggacgagctgaa eactcttttgaaggagaatggtgtggaccttagtgtcgtggttgagaaacaggagggaatgtacaagtcagcacc taaacgcctcaccgccaccacggaaaaattggaaattggctggaaggoctggg~gaaagagtattttatttgcac cagaactcgccaacaacacctt#gtggttgatggtccggagaccaac~gaatgtcc:gactcagaatcgcgcttgg aatagcttagaagtggaggattttggattkggtctcaccagcactcggatgttcctgaaggtcagagagagcaaca caactgaatgtgactcgaagatcattggaacggotgtcaagaacaacttggcgat:ccacagtgacctgtcctattg gattgaaagcaggctcaatgatacgtggaagcttgaaagggcagttctgggtgaagtcaa~ttcatgtacgtggc ctgagacgcataccttgtggggcgatggaa#ccttgagagtgacttgataataccagtcacactggcgggaccac gaagcaatcacaatcggagacctgggtacaagacacaaaaccagg9cccatc~ggacgaag9ccgggtag agatlgacttcgattactgcccaggaactacggtcaccctgagtgagagctgcggacaccgtggacctgccactc gcaccaccacagagagcggaaagttgataacagattggtgctgcaggagctgt:accttaccaccactgcgcta ccaaactgacagcggctgttggtatggtatggagatcagacoacagagacatg~~tgaaaagacctaatga SEA Ia P~° T
s MRSIALTFLAVGGVLLFLSVNVHADTGCAIDISRGtELRCtaL~GIfFIHNDVFAWNlDR
YKYYPETPQGLAK11QKAHKEGVG~3LRSVSRLEHQMWF~'uKDf=L.NTLLKENGVD
~.SWVEKQEGMYKSAPKRLTATTEKL.EICzWKAWGKSILF.~.PELANNTFVVDCaPE
TKEGPTQNRAWNSLEVEDFGFGLTSTRMF'LKVRESNTTECf~SKIIGTA~JKNNLAI
HSDLSYWIESRLNDTWKLERAVLGEVKSCTWPETp-ITLWGaDGILESDLIIPVTLAG
PRSNHNRRPGYKTQNQGPWI~FGR~tEIDFDYCP~TI'VTLSESC~~HRGPATRTT
TESGKLITDWCCRSCTLPPLRYC~TDSCaCVVYGMEIRPQRI-If~EKT""
4~ preM-E protein from Dengue type 9 virus The Dengue virus gene encoding the preM plus E glycoproteins was generated by PCR amplification of plasrt~id pVL pINaI~prM+E) (clone 2) I;CC)URAC3EC)T, M.-I~., FRENKIEL, M.-P., DUARTE DDS SANTC)S, C.N., DEUSEL., V. & DFSPRES P.
2000, A-glucosidase inhibitors reduce dengue virus production by affecting the initial steps of virion morphagenesis in the endoplasmic reticuium. ,;lournal of Virology ?'.4:
5~~-57~}. Tills plasmid encodes the pre-M and E glyccproteins of DEN-1 virus (strain FGAl89}. The sequence was amplified using PfuTur6o ~NA polymerase (Stratagene) arid specific primers that contain unique sites fr~r subsequent cloning in pTM-MVSchw vector : MV-pFN1 preMES 5'-TATC~TACGATGAACAGGAGGAAAAGATCCCTG-3' (BsiW! site underlined) and MV-DENIpreME3 5'-ATAGCGCGCTTAAAGCATGACTCCTACaGT ACAG-3' (Bss~'l!
site underlined}. A start and a stop colon were added at both ends of the gene. The whale sequence generated is X040 nucleotides long, including the start and the stop 4:ULlUffrl C&flCi-3t'.:rflt,.'-'G v=~~iv- 6r~;f='::a49-i,if=.3C:a:-'ii~-:~>~.-t:,'J.'.~'.Oe3'~',.t:SG~f=~.'~f-t.--~ ~~'..i~5#-?~.ix?-!'sF:r"~.--'~3~-~'".~~.
- __ C protein serves as a preM transDc~cation signal. Bath preM and ~ virral glycoproteins are transmemfJrane glycoproteiris type 1. It is presumed that f)EN-'! env expressing MV will produce and realease multirrteric farms of preM-E h~sterodirners exhibiting po~ypratem and nas the to~~owmg sequence 5~Q ID N° ~
atgaacaggaggaaaagatccgfigaccatgctcctcatgctgckgcccacagtcctggctttccatttgaccacac gagggggagagccacacatgatagttagtaagcaggaaagaggaaagtcactcttgttr"aagacctctgcagg tgtcaatatgtgcactctcattgcgatggatttgggagagttatgtgaggacacaat~gacktacaaatgcccccgga tcactgaggcggaaccagatgacgttgactgctggtgcaatgccacagacacai:gggtgacctatgggacgtgt tctcaaaccggtgaacaccgacgagacaaacgttccgtggcactggccccaca~cgtgggacttggtctagaaa caagaaccgaaacatggatgtcctctgaaggcgcctggaaacaaatacaaaaagtggagaCttgggctttgag acacccaggattcacggtgatagctcttttfttagcacatgccataggaacatccal:cactcagaaagggatcatttt catkctgctgatgctggtaacaccatcaatggccatgcgatgcgtgggaataggc~aacagagacttcgttgaagg actgtcaggagcaacgtgggtggacgtggtattggagcatggaagctgcgtcac:caccatggcaaaaaataaa ccaacatkggacattgaactcttgaagacggaggtcacgaaccctgccgtcttgcgcaaatkgtgcattgaagcta aaatatcaaacaccaccaccgattcaagatgtccaacacaaggagaggctacactggtggaagaacaagac gcgaactttgtgtgtcgacgaacggttgtggacagaggctggggcaatggctgcggactatttggaaaaggaag cctactgacgtgtgctaagttcaagtgtgtgacaaaactggaaggaaagatagttcaatatc~aaaaGttaaaatat tcagtgatagtcactgtccacacaggggaccagcaccaggtgggaaacgagactacagaacatggaacaatt gcaaccataacacctcaagctcctacgtcggaaatacagktgacagact2~cggaacccttacaotggactgctc acccagaacagggctg gactttaatgaggtggtgotattg acaatgaaagaaaaatcatgg cttgtccacaaac aatggtttctagactta~ccactgccttggacttcgggggcttcaacatcccaagagacttggaacagacaagatttg ctggtcacattcaagacagctcatgcaaagaagcaggaagtagtcgtactgggatcacaggaaggagcaatg cacactgcgttgaccggggcgacagaaatccagacgtcaggaacgacaacaatctttgcaggacacctgaaa tgcagattaaaaatggataaactgactttaaaagggatgtcatatgtgatgtgcacaggctcatttaagctagaga aggaagtggctgagacccagcatggaactgtcctagtgcaggttaaatacgaaggaacagatgcgccatgca agatccccttttcgacccaagatgagaaaggagtgacccagaatgggagattgataacagccaatcccatagtt actgacaaagaaaaaccaatcaacattgagacagaaccaccttttggtgagagctacatt:atagtaggggcag gtgaaaaagctttgaaactaagctggttcaagaaaggaagcagcatagggaaaatgttcgaagcaatcgccc 9a99a9cacgaaggatggctatcctgg9a9acaccgcatgggacttcggctctatagga~ggagtgtttacgtct gtgggaaaattggtacaccaggtttttggaaccgcatacggggtcctgttcagcgc,,~cgtttcttggaccatgaaaa t aggaatagggafcttgctgacatggttgggattaaatfcaaggagcgcgtcgcttt~cc~atgacgtgcatfgcagfit g gcatggttacactgtacctaggagtcatggtttaa "~ ') SEA ID 1~i 8 TLIAMDLGELCEDTMTYKCPRiTEAEP~DVDCWVCNATDTbWTYGTCSQTGEHR
RDKRSVALAPHVGLGLETRTETWMSSEGAWKt~IQKVETL'VALRHPGFTVIALFLA
HAIGTSITG~KGIIFILLIVILVTPSMAMRGVGIGNRDFVEGLSC9ATWVDVVLEHGSGV
TfMAKNKPTLI~IELLKTEVTNPAVI_RKLGIEAKiSNTTTDSR;~PTC~G~ATLVEEQD
ANFVCRRTVVDRGWGrJGCGLFrjKGSLLTGAKFKCVT'KLE:GK1V(~YENL.KYSVIV
TVHTGDC~HQVCaNETTEI-#GTIATITPC,ZAPTSEIQLTDYGTLI'LDCSI~RTGLDFNEV
VLLTMKEKSWLVHKc~WFLDLPLPWTSGASTSQETWNRQDLLVTFKTAHAKKQE
VVVLGSC~EGAMHTALTGATEIC~TSG I-TT9FAGHLKCRLKMDKLTLKGMSYVMCT
GSFKLEKEVAETc~.HGTVLVQVKYEGTDAPCKiPFSTC~DEKGVTQNGRLITANPIV
TDKEKPINIETEPPFGESYIIVGAGEKALKLSWFKKGSSIG~;~IIFEAIARGARRMAIL
GDTAWDFGSIGGVFTSVGKL\iHQVFGTAYtaVLFSGVBW TMKiG#GILLTWLGLN
SRSAS LSMTCIAVGMVTLYLGVMV*
The same immunogens can be pr~:pared by the same way from C1EN-2, DEN-~ .arid DE1~-~ serotypes.
5j Insertion into M1~ Schwarz vecfc~r The different WNV and ~EN-1 nuclec~tir~ic sequences were cloned ire pGR2.1-Tf~PO p9asmid {lnvitrogen~ and sequenced to cheok that no mutations were introduced. After BsillVlIBssHll digestion of the pCR2_1-TOPC7 plasmids, the fragments were cloned in the pTM-MVSchw ve~aor irr ATU position 2 giving plasrnids pTM-MVSchw-Env",,NV, pTM-MVSchw-preMEWn~, pTM-MVSchw-NSIwNV and pTM-MVSchW-preMEpEN-~ accordEng to Figure 1.
~,--.-..., ", a np ""~ 156D Gp y 2916 Cp CBJ-1 p"d!~
i.-..~T----- n 2asc by er~m _ &sN
r/ ~
~n;~'~ ~~ r--~.A =,i ~
1Da bA
~
j 7 hh (iE'I'U
pps 35 pTM-M'I~SChw- WNV
Figure 1. Schert~atic map of the pTM-MVSchw recambinant plasmids described ~xarn~le 3 . Recovery of recnr~binarrt ~lVSchvr-Ec~Vw,~v, MYSahw-~reMEw,"~ ~la~d MVSchw-NS9wNy viruses.
T~ reCOVef f~Ca,arTT~felalti .at;flYSiaTZ--~'3iu~rif vile ~~i~Si11id3;..~~-.UJy - ~~~-.. _I-- __....-._ helper~cell-based rescue system d2scribcd -by--Radec~ et-a'---{9;-~r~-r-:aodiffed b; ' -i Parks et al. {10}. Human helper cells stabiy expressing T7 RNA polymerase and measles N and P proteins (293-3-46 cells, a kind gift from IVIA Billeter) were ' transfected using the calcium phosphate procedure with pTM-tvlVSchw-!~nvurNV, pTM-M'1/''v-ChW-prBMEwnv or pTM-MVSchw-NSIu"~~ plasmids (5 pg~ a.nd a plasmid I
expressing the MV polymerase ~ gene {pEMC-La, ~0 ng, a kind gift from MA
Eilleter).
After overnight incubation at 37° C, the transfectian medium was replaced by fresh medium and a heat shock was applied (43° C for two hours) 1;10). Af~.er two days of Sr,.-~ ~~. .,+~.. .~+ QZ.° _ f fr f r~~,..g ) a rA tY C fr: f'I i ~ ~
C~?Ilfi. IFIVP..C ~11d i InGU~c7~eC~c9t JG Cr flC-uf~,s~! ~ cl~c~~~iy ~'uer~.rsti~wWi~illcW .I~o~a~~~'-~~wmsr msw.~.yw~u _ originally selected on CEF cells and is currently grown ,an these cells for safety considerations. Infectious ~rirus was easily recovered between 3 and ~ days following cocultivatiori. Syncytia appeared c~GCasianally in REF= but not systematically. The recombinant viruses were also resaaed by the same technique after cocultivation of transfected 293-3-~6 hetper cells at 3?° C with primate Vere~ cells {africart green monkey kidney. In this case, syncytia appeared systematic~~lly in call transfectiQns after 2 days of Goculture. In order to increase the yield crf rescue and because these recombinant viruses will be used in mice experiments, we usi::d Vert~ cells as target cells in place of the usual Ghick embryo fibrablasts (CE.F) (European Patent Application NG 022915~1.fi fifes on June 20, 2802). Recombinant virl~ses were i passaged two times on Vera cells. Mlle have previooasly shown that two passages ofi I
the Schwarz virus ors Vera cells did not change its immunogenic capacities in macaques (European Patent Application N° 022915b1.6 files on June ~0, 2002).
The recombinant viruses were prepared as described abcwe send the expression of the transgene in infected Gells was checked by immunofluc~rescence. To detect t WNV Envelope giycoproteins expression, we used irnrr~une sera from mice resistant to WNV infection (3nternatic~nal Patent Application Wc~ 0210817'4'1 ).'To detect NSs protein expression, we used anti-NS1 Monoclonal antiobadies {International Patent Application N° WO ~01756fi5).
>Biibhography WNV
Anderson, J.F., and Rahal, J.J. (2002). Efficacy of interferon alpha-?.b and ribavirin against West Nile virus infection.
Anonymous 0042)_ Intrauterine West Nile virus infection-New Ynric, 2002. MMINR
Morb Marta~ fNkly Rep. 51 :1135-11336.
Brintan, M.A. (2U02). The molecular biology of West tile virus: a nevv invader of the Western Hemisphere. Anna. Rev. NNcrabiat. 58: 371-x.42 Campbell, G., Marfin, A.A., Lanciotti, R.B., Cubler, 1~.J. {2002}. West Nile virus. Tfre Lancef 2: 519-529 I
Crupi RS, Asnis DS, Lee CC, Santucci T, Marino P~J, Flanz 5,.1. (2003).
Meet9ng the challenge of bioterrorism: Lessons learned from blest Nile virus and anthrax.
~4rn J
Emerg Med. 21:77-9.
Glass, J.D., Samuels, tJ,, Rich, M.M. (2002). Poliorr~yelitis due to Vllest Nile virus. N.
Engl. ,l. Med. Sep. 23 Lanciotti, R.S,, Ebei., G.D., Deubel, V., and al. {2002). Complete genome sequence analysis of West Nile virus strains isolated from the l.lnited States, ~:urope, anti the i Middie East. Virology 298 : 9B-105 Petsrsen, L.R., Raehrig, J.T., Hughes, J.M. {2p02). We5t NEIe vBCUS
encephalitis. dU_ I
Engl. J. Med. 347: 1225-1226 I
G~uirk, M. (2002). First treatment trio! for West Nils infection faegins.
f'lre f.anCet 2 : j 589 i i Tesh RB, Arroyo ,t, Travassas Da Rosa A~, Guzman H, Xiao SY, Monath TP.
(2002). , Efficacy of kiiled vircs vaccine, live attenuated chimeria virus vaaeine, and passive i immunization far prevention of West Nile virus encephalitis in hEamster rnadel. ~ri~erg lrtf~ct Dis. $:1392-1397.
~n~th TP, Arroyo J, Miller C, Guirakhoo F. {2001). West Mile virus vaccine.
burr ag Targets Infect ~isord. 1 :37-50.
~Iingraphy ~tIV
I=nders, .~. F. & Peebles, T. ~. (1954) Proc. hoc. Exp. Bic~d. fed. 86, 277-286.
griffin, D. (2c701} in Field's V!t'o~ogy, 4th ~difaon, eds. Knipe, fib. &
Howiey, P.
(i-ippincott - Raven Publishers, Philadelphia)" Voi. 2, pp. 14Q1-1 X4'1.
Hiifeman, M. (2002} V~ccirre 20, &51-665.
Schwarz, A. {1962) Arn. .i. Des. ~h~ld. 103, 216-2'99.
Parks, G. L., Lerch, R. A., V'dalpita, P., Wang, I~i. P., Sidhu, . S. 8 Udern, S_ (2061 ) J Vrrol 75, 910-20.
Parks, C. L., Lercn, F~. A., V~dalpita, P., Wang, t-!. P., Sid~hu, M. S. &
Udem, S.
(26Q1} J VfreJTS, 921-33.
Caiain, P. ~ Raux, L. (1993) J ldirc~! 67, 482-30.
Sehnei~let', H., Kaeiin, K. ~ Billeter, iVl. A. {1997) 'Jirology~ X27, 3.14-22.
Radecke, fF., Spielhof~r, P., Schneider, H., Kaelin, K., fiut~er, M., Dotsch, C., Christiansen, G. & Biileter, M. A. {1995) Emb~ J 14, 577;3-84.
Perks, C. ~., Lerch, R. A.. llltaipita, P., Sidhc~, M. ~. & Udem, S. A. (1999) J
of 73, 3560-C.
Claims (26)
1. A purified polypeptide wherein it derives from a West-Nile virus antigen or a Dengue virus antigen.
2. The polypeptide according to claim 1, wherein it is capable of inducing a protective immune response against a West-Nile virus or a Dengue virus in a mammal.
3. The polypeptide according to claim 1 or 2, wherein the West-Nile virus antigen is selected from the group consisting of secreted envelope glycoprotein (E), heterodimer glycoproteins (PreM-E) and NS1 protein.
4. The polypeptide according to claim 3, wherein the secreted envelope glycoprotein (E) comprises the sequence of SEQ ID NO: 5 or a fragment
5. The polypeptide according to claim 3, wherein the heterodimer glycoproteins (PreM-E) comprises the sequence of SEQ ID NO: 6 or a fragment thereof.
6. The polypeptide according to claim 3, wherein the NS1 protein comprises the sequence of SEQ ID NO: 7 or a fragment thereof.
7. The polypeptide according to claim 1 or 2, wherein the Dengue virus antigen is selected from the group consisting of secreted envelope glycoprotein (E), heterodimer glycoproteins (PreM-E) and NS1 protein.
8. The polypeptide according to claim 7, wherein the heterodimer glycoproteins (PreM-E) comprises the sequence of SEQ ID NO: 8 or functional derivatives thereof.
9. The polypeptide according to any one of claims 1 to 8, which is an immunogenic peptide.
10. A purified polyclonal or monoclonal antibody capable of specifically binding to a polypeptide according to any one of claims 1 to 9, or to a fragment thereof.
11. An expression vector comprising a polynucleotide sequence coding for a polypeptide according to any one of claims 1 to 9.
12. A purified polynucleotide sequence coding for a polypeptide according to any one of claims 1 to 9.
13. The purified polynucleotide sequence of claim 12 comprising a sequence selected from the group consisting of SEQ ID Nos: 1 to 4.
14. Use of a polynucleotide sequence as defined in claim 12 or 13 for detecting the presence or absence of a West-Nile virus antigen or a Dengue virus antigen in a biological sample.
15. A recombinant viral vector which is a recombinant virus comprising a polynucleotide sequence as defined in claim 12 or 13.
16. The recombinant viral vector of claim 15, wherein the recombinant virus is a live attenuated virus or a defective virus.
17. The recombinant viral vector of claim 15 or 16, wherein the recombinant virus is selected from the group consisting of measles virus, hepatitis B virus, human papillomavirus, picornaviridae and lentivirus.
18. A recombinant measles virus capable of expressing a polypeptide according to any one of claim 1 to 9.
19. A recombinant measles virus comprising, in its genome, a polynucleotide according to claim 12 or 13.
20. The recombinant measles virus of claim 18 or 19, which is a live attenuated virus or a defective virus.
21. A pharmaceutical composition comprising:
a) at least one component selected from the group consisting of:
a polypeptide according to any one of claims 1 to 9 or a fragment thereof;
- an antibody according to claim 10;
- an expression vector according to claim 11;
- a polynucleotide according to claim 12 or 13, - a recombinant viral vector according to any cane of claims 15 to 17;
and - a recombinant measles virus according to any one of claims 18 to 20;
and b) a pharmaceutically acceptable vehicle or carrier.
a) at least one component selected from the group consisting of:
a polypeptide according to any one of claims 1 to 9 or a fragment thereof;
- an antibody according to claim 10;
- an expression vector according to claim 11;
- a polynucleotide according to claim 12 or 13, - a recombinant viral vector according to any cane of claims 15 to 17;
and - a recombinant measles virus according to any one of claims 18 to 20;
and b) a pharmaceutically acceptable vehicle or carrier.
22. The pharmaceutical composition of claim 21, capable of inducing a protective immunity against a West-Nile virus or a Dengue virus in a mammal or in a bird.
23. Use of a pharmaceutical composition according to claim 21, as an anti-West-Nile virus agent, or for the preparation of an anti-West-Nile virus vaccine.
24. Use of a pharmaceutical composition according to claim 21, as an anti-Dengue virus agent, or for the preparation of an anti-Dengue virus vaccine.
25. A host cell incorporating an expression vector as defined in claim 11 or a recombinant viral vector as defined in any one of claims 15 to 17.
26. Method of producing a recombinant virus for the preparation of an anti-West-Nile virus vaccine or an anti-Dengue virus vaccine, the method comprising the steps of:
a) providing a host cell as defined in claim 25;
b) placing the host cell from step a) in conditions permitting the replication of a recombinant virus capable of expressing a polypeptide according to any one of claims 1 to 9; and c) isolating the recombinant virus produced in step b).
a) providing a host cell as defined in claim 25;
b) placing the host cell from step a) in conditions permitting the replication of a recombinant virus capable of expressing a polypeptide according to any one of claims 1 to 9; and c) isolating the recombinant virus produced in step b).
Priority Applications (13)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CA002420092A CA2420092A1 (en) | 2003-02-26 | 2003-02-26 | New dengue and west nile viruses proteins and genes coding the foregoing, and their use in vaccinal, therapeutic and diagnostic applications |
CA002432738A CA2432738A1 (en) | 2003-02-26 | 2003-06-20 | New dengue and west nile viruses proteins and genes coding the foregoing, and their use in vaccinal, therapeutic and diagnostic applications |
CA2517258A CA2517258C (en) | 2003-02-26 | 2004-02-26 | Recombinant measles virus comprising dengue or west nile virus polynucleotides, and their use in vaccinal and therapeutic applications |
BRPI0407840A BRPI0407840B8 (en) | 2003-02-26 | 2004-02-26 | recombinant measles virus, pharmaceutical composition, use of a pharmaceutical composition, bacterial cell, method for producing a recombinant virus and use |
ES04714865T ES2394307T3 (en) | 2003-02-26 | 2004-02-26 | Proteins and genes of the West Nile virus and dengue and its therapeutic application |
EP04714865.5A EP1599495B9 (en) | 2003-02-26 | 2004-02-26 | Dengue and west nile virus proteins and genes and their therapeutic application |
CA002456873A CA2456873A1 (en) | 2003-02-26 | 2004-02-26 | West nile virus proteins and genes coding the foregoing and their use in vaccinal, therapeutic and diagnostic applications |
PCT/IB2004/001027 WO2004076619A2 (en) | 2003-02-26 | 2004-02-26 | New dengue and west nile viruses proteins and genes coding the foregoing, and their use in vaccinal, therapeutic and diagnostic applications |
DK04714865.5T DK1599495T3 (en) | 2003-02-26 | 2004-02-26 | PROTEINS AND GENES OF DENGUE AND WEST NILE VIRUS AND THERAPEUTIC APPLICATION THEREOF |
IL170418A IL170418A (en) | 2003-02-26 | 2005-08-22 | Recombinant virus which is a live attenuated or a defective measles virus, pharmaceutical composition comprising same, its use and method of preparation |
US11/210,960 US7556812B2 (en) | 2003-02-26 | 2005-08-25 | Dengue and West Nile viruses proteins and genes coding the foregoing, and their use in vaccinal, therapeutic and diagnostic applications |
HK06105979.8A HK1086278A1 (en) | 2003-02-26 | 2006-05-24 | Dengue and west nile virus proteins and genes and their therapeutic application |
US12/476,304 US8859240B2 (en) | 2003-02-26 | 2009-06-02 | Dengue and West Nile viruses proteins and genes coding the foregoing, and their use in vaccinal, therapeutic and diagnostic applications |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CA002420092A CA2420092A1 (en) | 2003-02-26 | 2003-02-26 | New dengue and west nile viruses proteins and genes coding the foregoing, and their use in vaccinal, therapeutic and diagnostic applications |
Publications (1)
Publication Number | Publication Date |
---|---|
CA2420092A1 true CA2420092A1 (en) | 2004-08-26 |
Family
ID=32873364
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA002420092A Abandoned CA2420092A1 (en) | 2003-02-26 | 2003-02-26 | New dengue and west nile viruses proteins and genes coding the foregoing, and their use in vaccinal, therapeutic and diagnostic applications |
Country Status (1)
Country | Link |
---|---|
CA (1) | CA2420092A1 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8475808B2 (en) | 2003-05-23 | 2013-07-02 | Novartis Vaccines And Diagnostics, Inc. | Immunogenic reagents from west nile virus |
-
2003
- 2003-02-26 CA CA002420092A patent/CA2420092A1/en not_active Abandoned
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8475808B2 (en) | 2003-05-23 | 2013-07-02 | Novartis Vaccines And Diagnostics, Inc. | Immunogenic reagents from west nile virus |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US8088391B2 (en) | West nile virus vaccine | |
JP5538729B2 (en) | Mock infectious flaviviruses and their use | |
US11400150B2 (en) | Construction of West Nile virus and dengue virus chimeras for use in a live virus vaccine to prevent disease caused by West Nile virus | |
KR102626270B1 (en) | Compositions and methods for dengue virus chimeric constructs in vaccines | |
KR20180137514A (en) | Vaccination compositions and methods against dengue virus in children and young adults | |
US8716013B2 (en) | Recombinant lentiviral vector for expression of a flaviviridae protein and applications thereof as a vaccine | |
EP2303320B1 (en) | Attenuated pestivirus | |
JP2003523189A (en) | Non-toxic immunogenic flavivirus chimeras | |
Tangy et al. | Live attenuated measles vaccine as a potential multivalent pediatric vaccination vector | |
CA2432738A1 (en) | New dengue and west nile viruses proteins and genes coding the foregoing, and their use in vaccinal, therapeutic and diagnostic applications | |
US20150231226A1 (en) | Novel attenuated dengue virus strains for vaccine application | |
US20210338794A1 (en) | Dna plasmid-launched live-attanuated vaccines for plus-sense singel stranded rna | |
CA2420092A1 (en) | New dengue and west nile viruses proteins and genes coding the foregoing, and their use in vaccinal, therapeutic and diagnostic applications | |
US12070494B2 (en) | Chimeric flavivirus lyssavirus vaccines | |
JP2024503482A (en) | Replication-competent adenovirus type 4 SARS-COV-2 vaccines and their use | |
JP2022141602A (en) | recombinant measles virus | |
WO2007103565A2 (en) | Wnv dna vaccine incorporating a cmv/r backbone and expressing wnv prm and e proteins | |
TW201002343A (en) | Flavivirus NS1 subunit vaccine |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
FZDE | Discontinued |